2C9NY

Structure of the epstein-barr virus zebra protein at approximately 3. 5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*AP*CP*TP*GP*AP*CP*TP*CP*AP *T)-3'
publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 23
structure length 59
sequence length 59
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9nY00
2IPPA 4JYCA 1JNMA 4KHXA 5AW8B 5AVZB 1GU4A 4XE5B 1GTWA 3B8EB 3M06A 3V4QA 3NTNA 1OXZA 4C7NB 5APTA 2E42A 3VYIA 2R5DA 2XV5A 3V5BA 3KDPB 2YO3A 5AW3B 5AW0B 1MUUA 5APQA 3M9BA 5AVXB 4EOTA 2XZRA 4GT1A 2JJLA 3L35A 1MV8A 2WPSA 2Z5IA 2Q7CA 3V4WA 1FAVA 1YYCA 3TNUB 1MFZA 5AVQB 2R5BA 4AQRD 3VMZA 2BASA 2Z5HA 1H8AA 5AVYB 4AUWA 2R32A 1OWAA 2VRSA 2Q5UA 2W27A 3A5TA 2WT7B 4LC1A 4DZOA 5AW4B 3L36A 1HJBA 1DH3A 3TK1A 2WT7A 2H7HA 3LIDA 2QM7A 3P8MC 1A02F 2WPQA 3M91A 3MD0A 3TYYA 4C7NA 4M3LA 5AW1B 1H88A 3T97A 1KQLA 3A7OA 1GK6A 1GU5A 3M0AA 5AW2B 3VTPC 1GZLA 1T2KC 3O8ZA 2P67A 2N9BA 1FOSF 5AW6B 3A3YB 2WWWA 5APVA 2W6AA 4C46A 5APUA 5AW7B 1CI6B 2E43A 3NMDA 3TNUA 3A2AA 1NAFA 1CI6A 1H89A 4GKGA 1NWQA 3IR9A 2KP8A 2C9LY 3MGNA 2XU6A 5APXA 3M9HA 3HE5B 1SP4A 3VMYA 3VN0A 2P2UA 2QM8A 2ZXEB 1SLQA 4I2LC 3SWFA 1HWTC 1IO4A 5APYA 3HTKA 1GK4A 1FOSE 1GD2E 2YNYA 4AYCA 4RESB 1S9KE 1HBWA 3P7KA 5AVRB 3OAKA 1JUNA 1CZQA 3L37A 2WPRA 2YO2A 2C9NY 1X8YA 3P32A 4JYBA 3I5CA 4B86A 5AW5B 4HYTB 4I6MC 3NXSA 5AVSB 2R3CA 2P7JA 3UIAA 5AVVB 3HE4B 1S9KD 5CMZA 1HUCA 5APSA 1T2KD 1G2CB 2ZFCA 3HE5A 5AVWB 5AW9B 3HE4A 3NFQA 1J2JB 2Q3IA 5AVTB 5AVUB 2WTYA 1A02J 5APWA 1CSBA 3M0DA 3KQGA 3VMXA 3LIEA
chains in the Genus database with same CATH superfamily
4KHXA 3CL3D 1L4AC 3IF4A 4LGDE 1KFMA 4H13D 2E42A 3H1KG 3BCCD 5B5EE 1PFIA 1L4AA 3RK2C 2QSIA 3H1KJ 2BASA 2B9BA 4PJ0E 2PGDA 2PAJA 2W27A 4WY4C 1IK9A 3SWKA 1L0LG 4LC1A 4Z1MH 1Y9BA 1NTKD 1OIPA 2WPVB 4M3LA 3CX5H 3T97A 4EI2A 5AW2B 4WY4A 4L76A 1L0LJ 2Y9ZA 2PP6A 3WMM0 2BCCG 4GKGA 5GTIH 1NWQA 1SQQD 1LTGC 1QVFO 1QX8A 1RE3C 2WSEH 1DD4A 2BCCJ 4N6JA 2G3AA 2RMZA 1HBWA 3GLMA 2W6BA 3M9QA 1NTMK 1S5LH 3H1JD 1QGKB 4I6MC 1PPJG 2M5AA 2J58A 3FXEA 3AE7C 1KFNA 5CCHD 3OJAB 5APWA 1Q2NA 1PL5A 2NPSA 3L70E 4QMAA 2KSEA 3B8EB 3GF7A 2O01N 2R5DA 3KDPB 1HGZA 1ZXGA 5KKZB 3GW6A 1YI2P 1N2DC 1URQD 2NZ2A 2ZAEB 2XNXA 3B5NB 1L0LD 1NTMJ 3MUDC 2IBZI 3EFGA 5C39A 2H7HA 2YMKA 1KN7A 3L4FA 1PGOA 2WPQA 3ZDMA 5KJ7C 3AE8C 5KLIC 2K9YA 1NOHA 3MUDA 1JMBA 4N3YB 2LKMA 2KYVA 1KQSO 3L73E 3NMDA 3QWOC 3A2AA 5KJ7A 3L72E 3RK3E 4PV1D 1WRGA 3HE5B 3USSA 1QLED 3CWBE 2ZVNB 3FWNA 1ZRTD 4I2LC 3PLNA 1XTCC 1X0TA 4B86A 2IBZD 1PPJD 5AVSB 3RGUA 3UIAA 1FZEA 2B87B 1IFMA 1EZVI 4XA4A 1FZGA 4H0LB 4XFJA 4RKUJ 2JWAA 4L75A 3D6YA 4H44B 2POHA 3AE9C 5AVZB 1VQ6P 1MFTA 2AEFA 3BASA 1NTMD 1YJNP 1X9VA 1KB9D 3TSIA 2N1TD 2HYNA 1KV4A 2LXCB 1MFZA 2YKOA 3VMAA 2GM4A 4OGQD 2OYIB 1GL2A 4GDOA 5KKZC 3R4YA 4GIFA 1SQPD 1VDFA 4DZOA 3VOPA 3JCUH 4EDFA 1EZVD 3W67A 3VP8A 1YBKA 3B5NC 2L91A 3SWYA 4OWFA 1OW6A 2FFDB 3WU2E 1OZHA 4A7PA 2PFXA 4DCKA 2A45H 3B5NA 1KMIZ 1HJ0A 1S2EA 1VQOP 4R4MA 3H6PA 1PGPA 3H1IE 1KILA 5KAIH 3IFMA 2G8YA 3L37A 1JY3P 1M56D 4IL6E 3HE4B 2JDIH 3HE5A 2JP3A 5AVTB 3KQGA 3KHUA 1R8EA 1GTWA 4DT0A 1AJYA 4C7NB 1BDCA 3H1KE 1DIPA 3KZIH 2B87A 5BVZA 3CCSP 3H32A 2D2CB 1N7SB 3L70G 1NTZK 2WSCJ 1AQTA 3L36A 1FZFA 3L70J 1KQLA 3AE1C 1OMIA 2OYIC 1P84H 1FOSF 5B66H 4PD4H 1AVYA 1Q86Q 2OYIA 3H1HE 1SFCB 2BEZF 2BCCE 1KYOE 3RK2D 2FFDC 1IZNB 1NTZG 3GF3A 3CCJP 1LTBC 2ZYDA 1S9KE 3L73G 2K3RA 3L72G 2RH0A 3OAKA 1JUNA 4ASVA 1FC2C 3IN6A 1LP1A 2FFDA 1NTZJ 3CWBG 5AW5B 4HYTB 1VL2A 2K37A 3L73J 3L72J 1IFNA 3FX0A 1IFPA 1FDOA 2Q1KA 1NGMB 3CWBJ 1VQ9P 3TDKA 1T3UA 4XE5B 4ZNCA 3M06A 3V4QA 3NTNA 2KS1B 4JBZA 3Q5RA 1D7MA 2E75B 2JR8A 1FJKA 1FZAA 1IFDA 3PP5A 2A06G 4YXWH 3BVHA 4K3AA 3L70D 2OQQA 3S4RA 5AVYB 3II6A 3LW5H 2QJKB 1N7LA 2KK7A 1HJBA 3TK1A 3S1KA 2Y0CA 2D2CC 4WY4B 4C7NA 1N7SC 2GA1A 3Q3DA 3AEEC 3QH9A 2QG4A 2WWWA 3V2NA 2QJPB 4C46A 1LTTC 5DJTB 1BSHA 4W80A 3CCVP 3RL0D 1N7SA 2KP8A 4RO0A 3CCEP 2QRXA 1OX3A 3VN0A 3L73D 1GK4A 3L72D 3N4XA 3RK3D 2O1JA 5KTBA 2I1JA 2WSFH 2WPRA 3CWBD 5GTHE 3P32A 4JYBA 1VPCA 2KI7B 1WMKA 2M5AB 4W7YA 4WBAA 3H1IG 1LT9A 1PIXA 1A02J 1Q90D 2NPSB 3AEDC 2UWJE 3H1IJ 4I1LA 4HJGH 3A0HH 1GDTA 4NPEA 3H25A 1YHQP 3HD7D 1PZQA 1MUUA 4NPFX 1OVRA 2XKMA 3AE3C 4EOTA 2Q7CA 5CBNA 4JPZB 2IZ0A 1L0NG 1AV1A 4YPCA 1VQMP 1H8AA 3RBZA 3L74G 1IK7A 2YXQB 3CXHE 2A45G 2HPCA 2E75C 2OYOA 2KUBA 3KYQA 1DH3A 1VQ5P 3AE5C 4ZKUA 5KAFE 1UIIA 3MD0A 1BSNA 2AXCA 1JY2O 2ZYAA 2KS1A 2K9JA 2WQYC 1T3JA 1GZLA 1T2KC 2QJKC 3A3YB 2P1JA 3U1AA 2BEQD 5KLIB 4L73A 1SQXE 1NAFA 2FYNB 1H89A 2KOGA 1U57A 1H0TB 4JF7A 1N73B 2QJPC 2I1KA 1K9MQ 4RESB 1Y47A 5AVRB 2HODB 3H1HG 4JQ0D 2C9NY 1YQ3C 2WVRA 3H1ID 1MZ9A 2OTKE 2P7JA 2V7QH 5AVVB 3B5ND 2ZJSE 3H1HJ 1ZOYC 1EDKA 3EQ2A 4U3FE 1PGQA 1EXJA 1S72P 1USDA 5AW8B 2XV5A 4N78E 4BXLA 3AE4C 3WUUA 1W2EA 3WUTA 2NPSC 2XDJA 3CX5E 2NRGA 2IFMA 3FWLA 2JKVA 2J59M 1NU1E 2OTLP 2CPBA 1GL2B 4DJGA 1LWUA 2M0BA 3CCMP 4GOFA 1RHZB 3OA7A 1JTHA 1U7MA 3H1KD 5GTIE 3TGUE 5AW4B 3KXDA 2HFED 2CK3H 1A02F 3D6ZA 3CCUP 3V2QA 1PP9G 1FS0E 2OYHB 4OH8B 1UIXA 5APUA 3WUVA 2QEXP 2E43A 1JCCA 1VQNP 4H0LD 1S5LE 1PP9J 4H44D 2KSJA 1KILB 1ZW0A 1JMMA 1DEBA 1GD2E 2FYNC 1NTZE 3H1HD 3AEBC 1EXIA 2HG5D 1N73C 2BCCD 1KYOD 4DOJA 2ZT9D 5CCGA 1YQ4C 1S9KD 1KB9I 1H0TA 3VP9A 1N73A 2AXTH 1G2CA 3MTUE 1LJ2A 3HTKA 2IPPA 1JNMA 1QEXA 3CI9A 1OXZA 2HODA 2Q9IA 3PJSK 3LW5J 3M9BA 3H1LE 3H32B 2Z5IA 2ZXXA 3SSUA 1S4XA 1M7LA 2ZYGA 4LLHA 1NJIQ 2R3SA 2A06E 2H8PD 4AUWA 4D6TE 5KLVE 2Q5UA 1ZLLA 2FXPA 1VF5D 1Q82Q 4H13C 3Q5PA 1SQXK 3LIDA 1N86A 1GL2C 1T8ZA 1GK6A 1GU5A 3O8ZA 2W6AA 2P58A 5AW7B 5BU8B 2KB7P 1R5LA 1Q7YQ 1FU1A 3EWKA 2IFNA 2OYHC 2O01J 1SQBE 2J5UA 1BGYG 1SLQA 1M1JB 4PV1B 1ZV8A 1SQXG 1SS1A 4KJMA 2E74D 1LP1B 2HLOA 2OYHA 4UB8H 5H2FH 4U7JA 4RJTA 1KILC 1SVFA 1SQXJ 3IAOA 2WTYA 1BE3G 2WSSH 1CSBA 3V2RA 4UB6H 2Q3EA 3K5BA 3MIWA 3CD6P 3M0DA 3L75E 1VQKP 1NU1K 4W7ZA 2QA4P 1K73Q 3F89A 1QVGO 1KILE 2W6JH 1BE3J 3JCUE 3BATA 1FDMA 1JY3N 4U3FG 5AVQB 5CCHC 1SFCD 4IL6X 4YXDC 2N1TB 1L0NE 1K04A 3L74E 2FBWC 4U3FJ 4IFFA 3A0BH 2QM7A 3P8MC 5CCHA 2Y0EA 4OGQB 5TISH 2FXMA 3FGAD 3C1LA 1NU1G 3CXHD 3F5HA 2GUVA 1YTZI 5KAIE 1K8AQ 3TGUG 3PTZA 1NU1J 1AFOA 2QJYB 5E79H 2IYPA 1JY2P 5APXA 3M9HA 1WT6A 2FXOA 2P2UA 1URQA 3TGUJ 3CCRP 1J1EB 1SQXD 2OTJP 1E79H 4HB1A 2WSEJ 1L4AD 2KIKA 1K05A 1RQVA 1M1JC 4C7RA 1LT9B 4PV1C 2L5GB 3FXDA 1T2KD 1VQ8P 2WZ7A 3GMAA 3SFEC 3KZIE 2LR2A 3CMEP 2ITAA 1M1JA 2K88A 4WY4D 5M1BA 5CJ4A 2E76B 1IC2A 3D71A 1KTMA 1IFIA 5KLVK 5AVXB 2XZRA 4GT1A 4U3FD 2B89A 2O3JA 1YYCA 1P84E 2YKPA 3TNUB 1KB9H 1JB0J 2R5BA 5B66E 4PD4E 2HPCB 3G3ZA 1S1CX 2R32A 4N78D 3E7KA 5CBOA 2QE7H 4WB4A 3CX5D 1YJWP 3H1LG 1KZUB 2K9JB 1NU1D 1BCCE 1T6AA 3O6QB 3CC7P 3VTPC 1KC8Q 2N1TC 1AVOA 5AW6B 4D6TG 1SQBK 5KLVG 2OGUA 3C9IA 3TGUD 1PP9E 3H1LJ 1LGHB 1HTLC 4OGQC 2N1TA 4IOIH 4D6TJ 2NPSD 5KLVJ 1ZN5A 1M90Q 1FZCA 1J1DB 3SWFA 5APYA 2FY8A 1X22A 2JO1A 2QJYC 3P7KA 5DJUB 1DD3A 1USEA 1NO4A 2AEMA 3EFFK 1EDIA 1SQBG 1J1EC 5CMZA 1HUCA 3BCCG 4ASWA 1NTZD 3RBXA 5AVUB 1SQBJ 1W2BO 1LT9C 1GU4A 3CC2P 1HGVA 3V5BA 5KJ7D 1L0NK 1NTKG 5AW0B 3HUSB 4BWNA 2E5TA 1LWUB 4ZMDA 2E76C 1Q81Q 3L75G 1NVOA 3S9OA 1JTHB 1OWAA 3H1LD 1AA0A 1QL1A 1EC5A 3AE2C 2H88C 2FYZA 5B5EH 3L75J 1HH0A 2A06D 1W5CE 4D6TD 5KLVD 2Y9YA 4PJ0H 3TNUA 3L71E 2RN0A 1L0NJ 1HVVA 3RL0B 4KT0J 3L74J 1RE4C 1IO4A 1LTJB 1BGYE 1JOCA 3O6QA 1MKMA 1DX7A 1NYHA 1SQBD 2YO2A 1X8YA 1J1DC 1RE4A 3A0HE 3RK3B 1GL2D 1JCDA 3I56P 1M1KQ 1G2CB 1EDLA 3HTKB 3U1CA 2A45I 4WWIA 1BE3E 1VQ7P 4EYYQ 2MJZA 4O9BA 2YO3A 1JM0A 4IFMA 1IFJA 3HD7B 3L75D 2YIUB 2WSCH 2Z5HA 1KILD 3HUSC 1TU3F 2H89C 1LWUC 2WT7A 4I7ZB 3D70A 2FYUE 3M91A 1H88A 1RF0C 3M0AA 4H13B 2FKWB 1L0ND 3P8CE 5EFWB 3HUSA 3L74D 1KYOI 1RE3A 1NKNA 1G1JA 1CI6A 1RF0A 2QVAA 4OVNF 2QIWA 1BCCG 2Y0DA 2IBZG 2ZXEB 3PH0A 2C0WA 1VQPP 2YNYA 4AYCA 1G1IA 1L2PA 1QL2A 1SQPK 1BCCJ 1CW5A 2B88A 2E5YA 3JC22 3RL0C 3I5CA 1PV3A 1P84I 3E1IA 3NXSA 3C8VA 2W90A 2R3CA 4PD4I 1NTMG 1LTJC 3I55P 4MN4C 2ZFCA 1EDJA 5CCGC 1S5LX 3VMXA 3RK3C 1LTJA 2IDBA 1SQPG 3AEAC 1JO5A 5APQA 1HF9A 1MV8A 2YMYA 1FE6A 3KPEA 1SQVE 4K35A 1FAVA 1EZVG 3G6EP 1AQ5A 1SQPJ 3VMZA 2OARA 2N9YB 3CCQP 1FDIA 3HD7C 1P84D 1ZR4A 4NPDA 3TYYA 2YIUC 4PD4D 5AW1B 1GW4A 3A7OA 1VQLP 2N9BA 2YKQA 3V2PA 2JEEA 3HD7A 4I7ZC 3OW2O 3GHGB 1OFCX 1BCCD 1BDDA 1URQB 3ITKA 2CPSA 3VMYA 2QM8A 1PP9D 1RQUA 2AXTE 1LTIC 3L71G 3WU2H 2KLVA 2I8DA 1RF1B 1ZP0C 3L71J 1IJDB 2WSFJ 3CPWO 2KXPB 5AVWB 2ZT9B 1OW7A 3NFQA 1J2JB 4L74A 2HR3A 3BCCE 1ZR2A 3MP7B 1BGYJ 1GMJA 3E1RA 5APTA 4IL6H 2D2CD 3M0DC 1N7SD 3G71P 1GW3A 3L35A 2IX7C 2KZJA 2WPSA 3Q5SA 3CXHI 1NTKE 2IZ1A 3CC4P 2FYUK 1EQ7A 4Y28J 1NAYA 1N8RQ 2O1KA 4CPGA 3W68A 1KORA 1OVVA 1X79B 1VF5B 2K1AA 1SQQE 3SFDC 5APVA 1LTAC 3TF5A 3MHVA 3Q2YA 1NH4A 1NKZB 1Y8AA 4UB8E 2ZVOB 5H2FE 1FZBA 3BRTB 2KZIA 2C9LY 2FYUG 3MGNA 2XU6A 1FZCB 1JEKA 1RH5B 4HKZH 3AE6C 3H1JE 5K5GB 4HH2A 2E76D 3L71D 2M3EA 3GHGC 2FYUJ 2GUSA 5TJHA 4UB6E 1URQC 4H0LC 1KYOH 4Y99B 2E74B 3GHGA 4EIJA 1BGYD 5APSA 4H44C 2IYOA 5AW9B 1JY2N 3G9RA 3B71A 3V6IA 3Q1MA 2V7QJ 1SQVK 2E75D 1RF1C 3ABVC 1M57D 3CX5I 3VYIA 1YITP 2ZT9C 4ZKPA 5AW3B 1L0LE 3A0BE 2JJLA 5TISE 1RY3A 4BRYB 3AECC 1RF1A 1BE3D 1LT1A 2Z4EA 1M8OB 4AQRD 3CLQA 3AEGC 2VRSA 3A5TA 2Q6QA 5E79E 1SQVG 1ZMEC 4TLFA 2KNCB 1FJPA 5BU5A 1ZRTE 2XNDH 1SQVJ 2M8RA 2FYUD 3R2PA 3IR9A 1VF5C 5CHXA 1E5WA 3P8CD 1LTSC 5CJ0A 3G4SP 3RL0g 1OW8A 1YJ9P 1HWTC 2IBZE 1PPJE 3PHLA 4WVZA 1XTGB 4YTPC 3N7NA 1FZCC 1KD1Q 1LNQA 1KQGB 1L4AB 2KLUA 4GOEA 2JWDA 3HE4A 1NTME 3B4SA 2DW3A 1VQ4P 1KB9E 2WITA 2M3BA 2W83C 3LIEA 4Y99C 4JYCA 1NTKK 3RK2B 2E74C 2V4HA 5GTHH 3U59A 2R44A 1U7JA 3T97B 5L8RJ 1R5SA 3PRJA 1OVUA 4TT3H 1SQPE 2AEJA 2RKLA 3V4WA 3CCLP 2SPZA 2YXRB 1S3JA 4R4LA 1EZVE 1Z56A 1SQQK 3AEFC 2WT7B 3BCCJ 1SQVD 3MZWB 3GG2A 3HRNA 2WMMA 1KQFB 5CCGD 2MKVA 4IFDK 2P67A 3CMAP 1YIJP 1CI6B 3JSVC 4BRYA 1SFCC 2LXBA 3CXHH 2O01H 1NTKJ 1DEEG 5KAFH 1SP4A 4GODA 1SQQG 1JY3O 1SFCA 1FOSE 2W8ZA 2KNCA 1CZQA 1SQQJ 3BRVB 3H1JG 2C0XA 1YTZT 2H43A 2Q3IA 1FBMA 1NHLA 1L0LK 2P10A 3H1JJ 1PGJA 2PRRA
chains in the Genus database with same CATH topology
1LTJA 4KHXA 1T3UA 3CL3D 1L4AC 4XE5B 1NU1K 4LGDE 1KFMA 3M06A 3V4QA 3NTNA 4W7ZA 2E42A 1JO5A 5APQA 1FJKA 1FZAA 1IFDA 1MV8A 2YMYA 3KPEA 1PFIA 3BATA 3PP5A 1FAVA 1L4AA 1JY3N 3BVHA 3RK2C 1FDMA 5AVQB 5CCHC 1AQ5A 1SFCD 3VMZA 2BASA 2OARA 5AVYB 3II6A 2N1TB 3LW5H 2PAJA 2W27A 4WY4C 1IK9A 4LC1A 1N7LA 4IFFA 1HJBA 3HD7C 3TK1A 2QM7A 3P8MC 5CCHA 1ZR4A 2FXMA 3TYYA 4WY4B 4C7NA 4M3LA 5AW1B 1GW4A 1N7SC 3T97A 3A7OA 5AW2B 2N9BA 4WY4A 2GUVA 1YTZI 2WWWA 3V2NA 2YKQA 3V2PA 2PP6A 4C46A 1LTTC 2JEEA 3WMM0 3HD7A 4W80A 3RL0D 3GHGB 1N7SA 4GKGA 1NWQA 2KP8A 1AFOA 1JY2P 5APXA 1URQB 2CPSA 3M9HA 1WT6A 1LTGC 3VMYA 3VN0A 2P2UA 2QM8A 1RE3C 1URQA 2WSEH 1J1EB 1GK4A 3N4XA 4N6JA 1LTIC 3RK3D 1HBWA 2W6BA 2O1JA 5KTBA 1L4AD 2I1JA 3M9QA 1NTMK 2KLVA 2WSFH 2WPRA 3P32A 4JYBA 1VPCA 1M1JC 4I6MC 4W7YA 4C7RA 1LT9B 1RF1B 4WBAA 1IJDB 2L5GB 2J58A 1T2KD 1LT9A 2WZ7A 5AVWB 1KFNA 3NFQA 1J2JB 5CCHD 1A02J 3OJAB 5APWA 2NPSB 1M1JA 4WY4D 2NPSA 1ZR2A 5CJ4A 4I1LA 1IC2A 3B8EB 1GDTA 3HD7D 5APTA 2R5DA 1IFIA 3KDPB 1HGZA 5KLVK 3M0DC 1N7SD 1MUUA 5AVXB 2XKMA 2XZRA 4GT1A 4EOTA 1GW3A 3L35A 2IX7C 2WPSA 2Q7CA 1YYCA 2YKPA 3TNUB 2FYUK 1N2DC 1URQD 2R5BA 1EQ7A 2HPCB 1H8AA 3G3ZA 2XNXA 2R32A 4N78D 2O1KA 3B5NB 2A45G 2HPCA 4WB4A 3EFGA 3KYQA 1X79B 1KZUB 1DH3A 2H7HA 4ZKUA 3L4FA 2WPQA 3MD0A 5KJ7C 1JY2O 1NOHA 1T3JA 3VTPC 1GZLA 3MUDA 1T2KC 2N1TC 5AW6B 3A3YB 5APVA 2P1JA 1LTAC 1SQBK 3C9IA 3U1AA 1LGHB 4N3YB 2LKMA 2KYVA 1NH4A 1NKZB 1HTLC 3NMDA 3A2AA 5KJ7A 1NAFA 1H89A 1FZBA 2KOGA 3BRTB 2C9LY 3MGNA 2XU6A 4JF7A 1FZCB 2N1TA 1WRGA 1N73B 3HE5B 2NPSD 1ZN5A 1FZCA 1J1DB 2I1KA 4I2LC 3SWFA 5APYA 4HH2A 3GHGC 4RESB 2GUSA 3P7KA 5AVRB 1XTCC 1URQC 2HODB 1NO4A 2C9NY 4B86A 4Y99B 1J1EC 5AVSB 3GHGA 1MZ9A 2P7JA 4EIJA 3UIAA 1FZEA 5AVVB 1IFMA 5CMZA 1HUCA 5APSA 4XA4A 3B5ND 1FZGA 5AW9B 1JY2N 5AVUB 3EQ2A 1SQVK 2POHA 1LT9C 1RF1C 5AW8B 5AVZB 1GU4A 3VYIA 2XV5A 3BASA 1HGVA 3V5BA 4N78E 4ZKPA 5AW3B 5KJ7D 1L0NK 1X9VA 5AW0B 1W2EA 2JJLA 3HUSB 2NPSC 3TSIA 2XDJA 2N1TD 2HYNA 1LWUB 1RY3A 2IFMA 1RF1A 2J59M 1MFZA 2Z4EA 2CPBA 1GL2B 1LWUA 2YKOA 4AQRD 2GM4A 3CLQA 1JTHB 1OWAA 2VRSA 2OYIB 1GL2A 3A5TA 4GIFA 1VDFA 1JTHA 3OA7A 1QL1A 5AW4B 4DZOA 2HFED 2FYZA 3VOPA 1A02F 1HH0A 3V2QA 3VP8A 3B5NC 3SWYA 2OYHB 4OH8B 1FJPA 5BU5A 5APUA 2FFDB 2M8RA 2E43A 1JCCA 3TNUA 3R2PA 3IR9A 5CHXA 1E5WA 2A45H 3B5NA 3P8CD 1LTSC 5CJ0A 1HVVA 2KSJA 3RL0B 1KILB 1JMMA 1RE4C 1HWTC 1IO4A 3H6PA 1DEBA 1GD2E 1KILA 1XTGB 1LTJB 1JOCA 3IFMA 3N7NA 1FZCC 2HG5D 1N73C 1DX7A 4DOJA 3L37A 2YO2A 1X8YA 1J1DC 1RE4A 5CCGA 1JY3P 3RK3B 1GL2D 1JCDA 1L4AB 3HE4B 1S9KD 3VP9A 1G2CB 1N73A 3HE5A 3HE4A 5AVTB 3HTKB 1G2CA 3U1CA 2A45I 2WITA 3MTUE 2M3BA 3KQGA 3HTKA 3LIEA 4Y99C 2IPPA 1NTKK 4JYCA 3RK2B 1JNMA 3CI9A 3U59A 1GTWA 1OXZA 4C7NB 2HODA 2Q9IA 2MJZA 4O9BA 2YO3A 3M9BA 3H32B 2Z5IA 4IFMA 1IFJA 3V4WA 5BVZA 3HD7B 1M7LA 3H32A 4LLHA 1N7SB 2WSCH 2Z5HA 2H8PD 4AUWA 1Z56A 1SQQK 1KILD 2Q5UA 1ZLLA 2WT7B 3HUSC 1NTZK 1LWUC 3L36A 2WT7A 3HRNA 1SQXK 3LIDA 1FZFA 3M91A 1N86A 1GL2C 5CCGD 1H88A 1RF0C 1T8ZA 1KQLA 1GK6A 1GU5A 3M0AA 4IFDK 2FKWB 3O8ZA 2P67A 2OYIC 1FOSF 3P8CE 3HUSA 2W6AA 5AW7B 1CI6B 5BU8B 1SFCC 2KB7P 2O01H 1RE3A 1NKNA 1G1JA 1CI6A 1RF0A 1FU1A 2OYIA 1SFCB 2IFNA 1SP4A 2OYHC 2ZXEB 1JY3O 1SLQA 1SFCA 3RK2D 1M1JB 2FFDC 2C0WA 1FOSE 2YNYA 1LTBC 1G1IA 4AYCA 1QL2A 1S9KE 1SQPK 1ZV8A 1CW5A 3OAKA 2HLOA 2OYHA 1JUNA 1CZQA 3RL0C 1KILC 2FFDA 1SVFA 3I5CA 5AW5B 4HYTB 3BRVB 3E1IA 3NXSA 2R3CA 2C0XA 1LTJC 1YTZT 2H43A 2ZFCA 1IFNA 5CCGC 2Q3IA 1FBMA 1NHLA 1L0LK 2WTYA 1CSBA 3V2RA 3MIWA 3M0DA 3VMXA 3RK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP A;  4JYC A;  1JNM A;  4KHX A;  5AW8 B;  5AVZ B;  1GU4 A;  4XE5 B;  1GTW A;  3B8E B;  3M06 A;  3V4Q A;  3NTN A;  1OXZ A;  4C7N B;  5APT A;  2E42 A;  3VYI A;  2R5D A;  2XV5 A;  3V5B A;  3KDP B;  2YO3 A;  5AW3 B;  5AW0 B;  1MUU A;  5APQ A;  3M9B A;  5AVX B;  4EOT A;  2XZR A;  4GT1 A;  2JJL A;  3L35 A;  1MV8 A;  2WPS A;  2Z5I A;  2Q7C A;  3V4W A;  1FAV A;  1YYC A;  3TNU B;  1MFZ A;  5AVQ B;  2R5B A;  4AQR D;  3VMZ A;  2BAS A;  2Z5H A;  1H8A A;  5AVY B;  4AUW A;  2R32 A;  1OWA A;  2VRS A;  2Q5U A;  2W27 A;  3A5T A;  2WT7 B;  4LC1 A;  4DZO A;  5AW4 B;  3L36 A;  1HJB A;  1DH3 A;  3TK1 A;  2WT7 A;  2H7H A;  3LID A;  2QM7 A;  3P8M C;  1A02 F;  2WPQ A;  3M91 A;  3MD0 A;  3TYY A;  4C7N A;  4M3L A;  5AW1 B;  1H88 A;  3T97 A;  1KQL A;  3A7O A;  1GK6 A;  1GU5 A;  3M0A A;  5AW2 B;  3VTP C;  1GZL A;  1T2K C;  3O8Z A;  2P67 A;  2N9B A;  1FOS F;  5AW6 B;  3A3Y B;  2WWW A;  5APV A;  2W6A A;  4C46 A;  5APU A;  5AW7 B;  1CI6 B;  2E43 A;  3NMD A;  3TNU A;  3A2A A;  1NAF A;  1CI6 A;  1H89 A;  4GKG A;  1NWQ A;  3IR9 A;  2KP8 A;  2C9L Y;  3MGN A;  2XU6 A;  5APX A;  3M9H A;  3HE5 B;  1SP4 A;  3VMY A;  3VN0 A;  2P2U A;  2QM8 A;  2ZXE B;  1SLQ A;  4I2L C;  3SWF A;  1HWT C;  1IO4 A;  5APY A;  3HTK A;  1GK4 A;  1FOS E;  1GD2 E;  2YNY A;  4AYC A;  4RES B;  1S9K E;  1HBW A;  3P7K A;  5AVR B;  3OAK A;  1JUN A;  1CZQ A;  3L37 A;  2WPR A;  2YO2 A;  2C9N Y;  1X8Y A;  3P32 A;  4JYB A;  3I5C A;  4B86 A;  5AW5 B;  4HYT B;  4I6M C;  3NXS A;  5AVS B;  2R3C A;  2P7J A;  3UIA A;  5AVV B;  3HE4 B;  1S9K D;  5CMZ A;  1HUC A;  5APS A;  1T2K D;  1G2C B;  2ZFC A;  3HE5 A;  5AVW B;  5AW9 B;  3HE4 A;  3NFQ A;  1J2J B;  2Q3I A;  5AVT B;  5AVU B;  2WTY A;  1A02 J;  5APW A;  1CSB A;  3M0D A;  3KQG A;  3VMX A;  3LIE A; 
#chains in the Genus database with same CATH topology
 4KHX A;  3CL3 D;  1L4A C;  3IF4 A;  4LGD E;  1KFM A;  4H13 D;  2E42 A;  3H1K G;  3BCC D;  5B5E E;  1PFI A;  1L4A A;  3RK2 C;  2QSI A;  3H1K J;  2BAS A;  2B9B A;  4PJ0 E;  2PGD A;  2PAJ A;  2W27 A;  4WY4 C;  1IK9 A;  3SWK A;  1L0L G;  4LC1 A;  4Z1M H;  1Y9B A;  1NTK D;  1OIP A;  2WPV B;  4M3L A;  3CX5 H;  3T97 A;  4EI2 A;  5AW2 B;  4WY4 A;  4L76 A;  1L0L J;  2Y9Z A;  2PP6 A;  3WMM 0;  2BCC G;  4GKG A;  5GTI H;  1NWQ A;  1SQQ D;  1LTG C;  1QVF O;  1QX8 A;  1RE3 C;  2WSE H;  1DD4 A;  2BCC J;  4N6J A;  2G3A A;  2RMZ A;  1HBW A;  3GLM A;  2W6B A;  3M9Q A;  1NTM K;  1S5L H;  3H1J D;  1QGK B;  4I6M C;  1PPJ G;  2M5A A;  2J58 A;  3FXE A;  3AE7 C;  1KFN A;  5CCH D;  3OJA B;  5APW A;  1Q2N A;  1PL5 A;  2NPS A;  3L70 E;  4QMA A;  2KSE A;  3B8E B;  3GF7 A;  2O01 N;  2R5D A;  3KDP B;  1HGZ A;  1ZXG A;  5KKZ B;  3GW6 A;  1YI2 P;  1N2D C;  1URQ D;  2NZ2 A;  2ZAE B;  2XNX A;  3B5N B;  1L0L D;  1NTM J;  3MUD C;  2IBZ I;  3EFG A;  5C39 A;  2H7H A;  2YMK A;  1KN7 A;  3L4F A;  1PGO A;  2WPQ A;  3ZDM A;  5KJ7 C;  3AE8 C;  5KLI C;  2K9Y A;  1NOH A;  3MUD A;  1JMB A;  4N3Y B;  2LKM A;  2KYV A;  1KQS O;  3L73 E;  3NMD A;  3QWO C;  3A2A A;  5KJ7 A;  3L72 E;  3RK3 E;  4PV1 D;  1WRG A;  3HE5 B;  3USS A;  1QLE D;  3CWB E;  2ZVN B;  3FWN A;  1ZRT D;  4I2L C;  3PLN A;  1XTC C;  1X0T A;  4B86 A;  2IBZ D;  1PPJ D;  5AVS B;  3RGU A;  3UIA A;  1FZE A;  2B87 B;  1IFM A;  1EZV I;  4XA4 A;  1FZG A;  4H0L B;  4XFJ A;  4RKU J;  2JWA A;  4L75 A;  3D6Y A;  4H44 B;  2POH A;  3AE9 C;  5AVZ B;  1VQ6 P;  1MFT A;  2AEF A;  3BAS A;  1NTM D;  1YJN P;  1X9V A;  1KB9 D;  3TSI A;  2N1T D;  2HYN A;  1KV4 A;  2LXC B;  1MFZ A;  2YKO A;  3VMA A;  2GM4 A;  4OGQ D;  2OYI B;  1GL2 A;  4GDO A;  5KKZ C;  3R4Y A;  4GIF A;  1SQP D;  1VDF A;  4DZO A;  3VOP A;  3JCU H;  4EDF A;  1EZV D;  3W67 A;  3VP8 A;  1YBK A;  3B5N C;  2L91 A;  3SWY A;  4OWF A;  1OW6 A;  2FFD B;  3WU2 E;  1OZH A;  4A7P A;  2PFX A;  4DCK A;  2A45 H;  3B5N A;  1KMI Z;  1HJ0 A;  1S2E A;  1VQO P;  4R4M A;  3H6P A;  1PGP A;  3H1I E;  1KIL A;  5KAI H;  3IFM A;  2G8Y A;  3L37 A;  1JY3 P;  1M56 D;  4IL6 E;  3HE4 B;  2JDI H;  3HE5 A;  2JP3 A;  5AVT B;  3KQG A;  3KHU A;  1R8E A;  1GTW A;  4DT0 A;  1AJY A;  4C7N B;  1BDC A;  3H1K E;  1DIP A;  3KZI H;  2B87 A;  5BVZ A;  3CCS P;  3H32 A;  2D2C B;  1N7S B;  3L70 G;  1NTZ K;  2WSC J;  1AQT A;  3L36 A;  1FZF A;  3L70 J;  1KQL A;  3AE1 C;  1OMI A;  2OYI C;  1P84 H;  1FOS F;  5B66 H;  4PD4 H;  1AVY A;  1Q86 Q;  2OYI A;  3H1H E;  1SFC B;  2BEZ F;  2BCC E;  1KYO E;  3RK2 D;  2FFD C;  1IZN B;  1NTZ G;  3GF3 A;  3CCJ P;  1LTB C;  2ZYD A;  1S9K E;  3L73 G;  2K3R A;  3L72 G;  2RH0 A;  3OAK A;  1JUN A;  4ASV A;  1FC2 C;  3IN6 A;  1LP1 A;  2FFD A;  1NTZ J;  3CWB G;  5AW5 B;  4HYT B;  1VL2 A;  2K37 A;  3L73 J;  3L72 J;  1IFN A;  3FX0 A;  1IFP A;  1FDO A;  2Q1K A;  1NGM B;  3CWB J;  1VQ9 P;  3TDK A;  1T3U A;  4XE5 B;  4ZNC A;  3M06 A;  3V4Q A;  3NTN A;  2KS1 B;  4JBZ A;  3Q5R A;  1D7M A;  2E75 B;  2JR8 A;  1FJK A;  1FZA A;  1IFD A;  3PP5 A;  2A06 G;  4YXW H;  3BVH A;  4K3A A;  3L70 D;  2OQQ A;  3S4R A;  5AVY B;  3II6 A;  3LW5 H;  2QJK B;  1N7L A;  2KK7 A;  1HJB A;  3TK1 A;  3S1K A;  2Y0C A;  2D2C C;  4WY4 B;  4C7N A;  1N7S C;  2GA1 A;  3Q3D A;  3AEE C;  3QH9 A;  2QG4 A;  2WWW A;  3V2N A;  2QJP B;  4C46 A;  1LTT C;  5DJT B;  1BSH A;  4W80 A;  3CCV P;  3RL0 D;  1N7S A;  2KP8 A;  4RO0 A;  3CCE P;  2QRX A;  1OX3 A;  3VN0 A;  3L73 D;  1GK4 A;  3L72 D;  3N4X A;  3RK3 D;  2O1J A;  5KTB A;  2I1J A;  2WSF H;  2WPR A;  3CWB D;  5GTH E;  3P32 A;  4JYB A;  1VPC A;  2KI7 B;  1WMK A;  2M5A B;  4W7Y A;  4WBA A;  3H1I G;  1LT9 A;  1PIX A;  1A02 J;  1Q90 D;  2NPS B;  3AED C;  2UWJ E;  3H1I J;  4I1L A;  4HJG H;  3A0H H;  1GDT A;  4NPE A;  3H25 A;  1YHQ P;  3HD7 D;  1PZQ A;  1MUU A;  4NPF X;  1OVR A;  2XKM A;  3AE3 C;  4EOT A;  2Q7C A;  5CBN A;  4JPZ B;  2IZ0 A;  1L0N G;  1AV1 A;  4YPC A;  1VQM P;  1H8A A;  3RBZ A;  3L74 G;  1IK7 A;  2YXQ B;  3CXH E;  2A45 G;  2HPC A;  2E75 C;  2OYO A;  2KUB A;  3KYQ A;  1DH3 A;  1VQ5 P;  3AE5 C;  4ZKU A;  5KAF E;  1UII A;  3MD0 A;  1BSN A;  2AXC A;  1JY2 O;  2ZYA A;  2KS1 A;  2K9J A;  2WQY C;  1T3J A;  1GZL A;  1T2K C;  2QJK C;  3A3Y B;  2P1J A;  3U1A A;  2BEQ D;  5KLI B;  4L73 A;  1SQX E;  1NAF A;  2FYN B;  1H89 A;  2KOG A;  1U57 A;  1H0T B;  4JF7 A;  1N73 B;  2QJP C;  2I1K A;  1K9M Q;  4RES B;  1Y47 A;  5AVR B;  2HOD B;  3H1H G;  4JQ0 D;  2C9N Y;  1YQ3 C;  2WVR A;  3H1I D;  1MZ9 A;  2OTK E;  2P7J A;  2V7Q H;  5AVV B;  3B5N D;  2ZJS E;  3H1H J;  1ZOY C;  1EDK A;  3EQ2 A;  4U3F E;  1PGQ A;  1EXJ A;  1S72 P;  1USD A;  5AW8 B;  2XV5 A;  4N78 E;  4BXL A;  3AE4 C;  3WUU A;  1W2E A;  3WUT A;  2NPS C;  2XDJ A;  3CX5 E;  2NRG A;  2IFM A;  3FWL A;  2JKV A;  2J59 M;  1NU1 E;  2OTL P;  2CPB A;  1GL2 B;  4DJG A;  1LWU A;  2M0B A;  3CCM P;  4GOF A;  1RHZ B;  3OA7 A;  1JTH A;  1U7M A;  3H1K D;  5GTI E;  3TGU E;  5AW4 B;  3KXD A;  2HFE D;  2CK3 H;  1A02 F;  3D6Z A;  3CCU P;  3V2Q A;  1PP9 G;  1FS0 E;  2OYH B;  4OH8 B;  1UIX A;  5APU A;  3WUV A;  2QEX P;  2E43 A;  1JCC A;  1VQN P;  4H0L D;  1S5L E;  1PP9 J;  4H44 D;  2KSJ A;  1KIL B;  1ZW0 A;  1JMM A;  1DEB A;  1GD2 E;  2FYN C;  1NTZ E;  3H1H D;  3AEB C;  1EXI A;  2HG5 D;  1N73 C;  2BCC D;  1KYO D;  4DOJ A;  2ZT9 D;  5CCG A;  1YQ4 C;  1S9K D;  1KB9 I;  1H0T A;  3VP9 A;  1N73 A;  2AXT H;  1G2C A;  3MTU E;  1LJ2 A;  3HTK A;  2IPP A;  1JNM A;  1QEX A;  3CI9 A;  1OXZ A;  2HOD A;  2Q9I A;  3PJS K;  3LW5 J;  3M9B A;  3H1L E;  3H32 B;  2Z5I A;  2ZXX A;  3SSU A;  1S4X A;  1M7L A;  2ZYG A;  4LLH A;  1NJI Q;  2R3S A;  2A06 E;  2H8P D;  4AUW A;  4D6T E;  5KLV E;  2Q5U A;  1ZLL A;  2FXP A;  1VF5 D;  1Q82 Q;  4H13 C;  3Q5P A;  1SQX K;  3LID A;  1N86 A;  1GL2 C;  1T8Z A;  1GK6 A;  1GU5 A;  3O8Z A;  2W6A A;  2P58 A;  5AW7 B;  5BU8 B;  2KB7 P;  1R5L A;  1Q7Y Q;  1FU1 A;  3EWK A;  2IFN A;  2OYH C;  2O01 J;  1SQB E;  2J5U A;  1BGY G;  1SLQ A;  1M1J B;  4PV1 B;  1ZV8 A;  1SQX G;  1SS1 A;  4KJM A;  2E74 D;  1LP1 B;  2HLO A;  2OYH A;  4UB8 H;  5H2F H;  4U7J A;  4RJT A;  1KIL C;  1SVF A;  1SQX J;  3IAO A;  2WTY A;  1BE3 G;  2WSS H;  1CSB A;  3V2R A;  4UB6 H;  2Q3E A;  3K5B A;  3MIW A;  3CD6 P;  3M0D A;  3L75 E;  1VQK P;  1NU1 K;  4W7Z A;  2QA4 P;  1K73 Q;  3F89 A;  1QVG O;  1KIL E;  2W6J H;  1BE3 J;  3JCU E;  3BAT A;  1FDM A;  1JY3 N;  4U3F G;  5AVQ B;  5CCH C;  1SFC D;  4IL6 X;  4YXD C;  2N1T B;  1L0N E;  1K04 A;  3L74 E;  2FBW C;  4U3F J;  4IFF A;  3A0B H;  2QM7 A;  3P8M C;  5CCH A;  2Y0E A;  4OGQ B;  5TIS H;  2FXM A;  3FGA D;  3C1L A;  1NU1 G;  3CXH D;  3F5H A;  2GUV A;  1YTZ I;  5KAI E;  1K8A Q;  3TGU G;  3PTZ A;  1NU1 J;  1AFO A;  2QJY B;  5E79 H;  2IYP A;  1JY2 P;  5APX A;  3M9H A;  1WT6 A;  2FXO A;  2P2U A;  1URQ A;  3TGU J;  3CCR P;  1J1E B;  1SQX D;  2OTJ P;  1E79 H;  4HB1 A;  2WSE J;  1L4A D;  2KIK A;  1K05 A;  1RQV A;  1M1J C;  4C7R A;  1LT9 B;  4PV1 C;  2L5G B;  3FXD A;  1T2K D;  1VQ8 P;  2WZ7 A;  3GMA A;  3SFE C;  3KZI E;  2LR2 A;  3CME P;  2ITA A;  1M1J A;  2K88 A;  4WY4 D;  5M1B A;  5CJ4 A;  2E76 B;  1IC2 A;  3D71 A;  1KTM A;  1IFI A;  5KLV K;  5AVX B;  2XZR A;  4GT1 A;  4U3F D;  2B89 A;  2O3J A;  1YYC A;  1P84 E;  2YKP A;  3TNU B;  1KB9 H;  1JB0 J;  2R5B A;  5B66 E;  4PD4 E;  2HPC B;  3G3Z A;  1S1C X;  2R32 A;  4N78 D;  3E7K A;  5CBO A;  2QE7 H;  4WB4 A;  3CX5 D;  1YJW P;  3H1L G;  1KZU B;  2K9J B;  1NU1 D;  1BCC E;  1T6A A;  3O6Q B;  3CC7 P;  3VTP C;  1KC8 Q;  2N1T C;  1AVO A;  5AW6 B;  4D6T G;  1SQB K;  5KLV G;  2OGU A;  3C9I A;  3TGU D;  1PP9 E;  3H1L J;  1LGH B;  1HTL C;  4OGQ C;  2N1T A;  4IOI H;  4D6T J;  2NPS D;  5KLV J;  1ZN5 A;  1M90 Q;  1FZC A;  1J1D B;  3SWF A;  5APY A;  2FY8 A;  1X22 A;  2JO1 A;  2QJY C;  3P7K A;  5DJU B;  1DD3 A;  1USE A;  1NO4 A;  2AEM A;  3EFF K;  1EDI A;  1SQB G;  1J1E C;  5CMZ A;  1HUC A;  3BCC G;  4ASW A;  1NTZ D;  3RBX A;  5AVU B;  1SQB J;  1W2B O;  1LT9 C;  1GU4 A;  3CC2 P;  1HGV A;  3V5B A;  5KJ7 D;  1L0N K;  1NTK G;  5AW0 B;  3HUS B;  4BWN A;  2E5T A;  1LWU B;  4ZMD A;  2E76 C;  1Q81 Q;  3L75 G;  1NVO A;  3S9O A;  1JTH B;  1OWA A;  3H1L D;  1AA0 A;  1QL1 A;  1EC5 A;  3AE2 C;  2H88 C;  2FYZ A;  5B5E H;  3L75 J;  1HH0 A;  2A06 D;  1W5C E;  4D6T D;  5KLV D;  2Y9Y A;  4PJ0 H;  3TNU A;  3L71 E;  2RN0 A;  1L0N J;  1HVV A;  3RL0 B;  4KT0 J;  3L74 J;  1RE4 C;  1IO4 A;  1LTJ B;  1BGY E;  1JOC A;  3O6Q A;  1MKM A;  1DX7 A;  1NYH A;  1SQB D;  2YO2 A;  1X8Y A;  1J1D C;  1RE4 A;  3A0H E;  3RK3 B;  1GL2 D;  1JCD A;  3I56 P;  1M1K Q;  1G2C B;  1EDL A;  3HTK B;  3U1C A;  2A45 I;  4WWI A;  1BE3 E;  1VQ7 P;  4EYY Q;  2MJZ A;  4O9B A;  2YO3 A;  1JM0 A;  4IFM A;  1IFJ A;  3HD7 B;  3L75 D;  2YIU B;  2WSC H;  2Z5H A;  1KIL D;  3HUS C;  1TU3 F;  2H89 C;  1LWU C;  2WT7 A;  4I7Z B;  3D70 A;  2FYU E;  3M91 A;  1H88 A;  1RF0 C;  3M0A A;  4H13 B;  2FKW B;  1L0N D;  3P8C E;  5EFW B;  3HUS A;  3L74 D;  1KYO I;  1RE3 A;  1NKN A;  1G1J A;  1CI6 A;  1RF0 A;  2QVA A;  4OVN F;  2QIW A;  1BCC G;  2Y0D A;  2IBZ G;  2ZXE B;  3PH0 A;  2C0W A;  1VQP P;  2YNY A;  4AYC A;  1G1I A;  1L2P A;  1QL2 A;  1SQP K;  1BCC J;  1CW5 A;  2B88 A;  2E5Y A;  3JC2 2;  3RL0 C;  3I5C A;  1PV3 A;  1P84 I;  3E1I A;  3NXS A;  3C8V A;  2W90 A;  2R3C A;  4PD4 I;  1NTM G;  1LTJ C;  3I55 P;  4MN4 C;  2ZFC A;  1EDJ A;  5CCG C;  1S5L X;  3VMX A;  3RK3 C;  1LTJ A;  2IDB A;  1SQP G;  3AEA C;  1JO5 A;  5APQ A;  1HF9 A;  1MV8 A;  2YMY A;  1FE6 A;  3KPE A;  1SQV E;  4K35 A;  1FAV A;  1EZV G;  3G6E P;  1AQ5 A;  1SQP J;  3VMZ A;  2OAR A;  2N9Y B;  3CCQ P;  1FDI A;  3HD7 C;  1P84 D;  1ZR4 A;  4NPD A;  3TYY A;  2YIU C;  4PD4 D;  5AW1 B;  1GW4 A;  3A7O A;  1VQL P;  2N9B A;  2YKQ A;  3V2P A;  2JEE A;  3HD7 A;  4I7Z C;  3OW2 O;  3GHG B;  1OFC X;  1BCC D;  1BDD A;  1URQ B;  3ITK A;  2CPS A;  3VMY A;  2QM8 A;  1PP9 D;  1RQU A;  2AXT E;  1LTI C;  3L71 G;  3WU2 H;  2KLV A;  2I8D A;  1RF1 B;  1ZP0 C;  3L71 J;  1IJD B;  2WSF J;  3CPW O;  2KXP B;  5AVW B;  2ZT9 B;  1OW7 A;  3NFQ A;  1J2J B;  4L74 A;  2HR3 A;  3BCC E;  1ZR2 A;  3MP7 B;  1BGY J;  1GMJ A;  3E1R A;  5APT A;  4IL6 H;  2D2C D;  3M0D C;  1N7S D;  3G71 P;  1GW3 A;  3L35 A;  2IX7 C;  2KZJ A;  2WPS A;  3Q5S A;  3CXH I;  1NTK E;  2IZ1 A;  3CC4 P;  2FYU K;  1EQ7 A;  4Y28 J;  1NAY A;  1N8R Q;  2O1K A;  4CPG A;  3W68 A;  1KOR A;  1OVV A;  1X79 B;  1VF5 B;  2K1A A;  1SQQ E;  3SFD C;  5APV A;  1LTA C;  3TF5 A;  3MHV A;  3Q2Y A;  1NH4 A;  1NKZ B;  1Y8A A;  4UB8 E;  2ZVO B;  5H2F E;  1FZB A;  3BRT B;  2KZI A;  2C9L Y;  2FYU G;  3MGN A;  2XU6 A;  1FZC B;  1JEK A;  1RH5 B;  4HKZ H;  3AE6 C;  3H1J E;  5K5G B;  4HH2 A;  2E76 D;  3L71 D;  2M3E A;  3GHG C;  2FYU J;  2GUS A;  5TJH A;  4UB6 E;  1URQ C;  4H0L C;  1KYO H;  4Y99 B;  2E74 B;  3GHG A;  4EIJ A;  1BGY D;  5APS A;  4H44 C;  2IYO A;  5AW9 B;  1JY2 N;  3G9R A;  3B71 A;  3V6I A;  3Q1M A;  2V7Q J;  1SQV K;  2E75 D;  1RF1 C;  3ABV C;  1M57 D;  3CX5 I;  3VYI A;  1YIT P;  2ZT9 C;  4ZKP A;  5AW3 B;  1L0L E;  3A0B E;  2JJL A;  5TIS E;  1RY3 A;  4BRY B;  3AEC C;  1RF1 A;  1BE3 D;  1LT1 A;  2Z4E A;  1M8O B;  4AQR D;  3CLQ A;  3AEG C;  2VRS A;  3A5T A;  2Q6Q A;  5E79 E;  1SQV G;  1ZME C;  4TLF A;  2KNC B;  1FJP A;  5BU5 A;  1ZRT E;  2XND H;  1SQV J;  2M8R A;  2FYU D;  3R2P A;  3IR9 A;  1VF5 C;  5CHX A;  1E5W A;  3P8C D;  1LTS C;  5CJ0 A;  3G4S P;  3RL0 g;  1OW8 A;  1YJ9 P;  1HWT C;  2IBZ E;  1PPJ E;  3PHL A;  4WVZ A;  1XTG B;  4YTP C;  3N7N A;  1FZC C;  1KD1 Q;  1LNQ A;  1KQG B;  1L4A B;  2KLU A;  4GOE A;  2JWD A;  3HE4 A;  1NTM E;  3B4S A;  2DW3 A;  1VQ4 P;  1KB9 E;  2WIT A;  2M3B A;  2W83 C;  3LIE A;  4Y99 C;  4JYC A;  1NTK K;  3RK2 B;  2E74 C;  2V4H A;  5GTH H;  3U59 A;  2R44 A;  1U7J A;  3T97 B;  5L8R J;  1R5S A;  3PRJ A;  1OVU A;  4TT3 H;  1SQP E;  2AEJ A;  2RKL A;  3V4W A;  3CCL P;  2SPZ A;  2YXR B;  1S3J A;  4R4L A;  1EZV E;  1Z56 A;  1SQQ K;  3AEF C;  2WT7 B;  3BCC J;  1SQV D;  3MZW B;  3GG2 A;  3HRN A;  2WMM A;  1KQF B;  5CCG D;  2MKV A;  4IFD K;  2P67 A;  3CMA P;  1YIJ P;  1CI6 B;  3JSV C;  4BRY A;  1SFC C;  2LXB A;  3CXH H;  2O01 H;  1NTK J;  1DEE G;  5KAF H;  1SP4 A;  4GOD A;  1SQQ G;  1JY3 O;  1SFC A;  1FOS E;  2W8Z A;  2KNC A;  1CZQ A;  1SQQ J;  3BRV B;  3H1J G;  2C0X A;  1YTZ T;  2H43 A;  2Q3I A;  1FBM A;  1NHL A;  1L0L K;  2P10 A;  3H1J J;  1PGJ A;  2PRR A; 
#chains in the Genus database with same CATH homology
 1LTJ A;  4KHX A;  1T3U A;  3CL3 D;  1L4A C;  4XE5 B;  1NU1 K;  4LGD E;  1KFM A;  3M06 A;  3V4Q A;  3NTN A;  4W7Z A;  2E42 A;  1JO5 A;  5APQ A;  1FJK A;  1FZA A;  1IFD A;  1MV8 A;  2YMY A;  3KPE A;  1PFI A;  3BAT A;  3PP5 A;  1FAV A;  1L4A A;  1JY3 N;  3BVH A;  3RK2 C;  1FDM A;  5AVQ B;  5CCH C;  1AQ5 A;  1SFC D;  3VMZ A;  2BAS A;  2OAR A;  5AVY B;  3II6 A;  2N1T B;  3LW5 H;  2PAJ A;  2W27 A;  4WY4 C;  1IK9 A;  4LC1 A;  1N7L A;  4IFF A;  1HJB A;  3HD7 C;  3TK1 A;  2QM7 A;  3P8M C;  5CCH A;  1ZR4 A;  2FXM A;  3TYY A;  4WY4 B;  4C7N A;  4M3L A;  5AW1 B;  1GW4 A;  1N7S C;  3T97 A;  3A7O A;  5AW2 B;  2N9B A;  4WY4 A;  2GUV A;  1YTZ I;  2WWW A;  3V2N A;  2YKQ A;  3V2P A;  2PP6 A;  4C46 A;  1LTT C;  2JEE A;  3WMM 0;  3HD7 A;  4W80 A;  3RL0 D;  3GHG B;  1N7S A;  4GKG A;  1NWQ A;  2KP8 A;  1AFO A;  1JY2 P;  5APX A;  1URQ B;  2CPS A;  3M9H A;  1WT6 A;  1LTG C;  3VMY A;  3VN0 A;  2P2U A;  2QM8 A;  1RE3 C;  1URQ A;  2WSE H;  1J1E B;  1GK4 A;  3N4X A;  4N6J A;  1LTI C;  3RK3 D;  1HBW A;  2W6B A;  2O1J A;  5KTB A;  1L4A D;  2I1J A;  3M9Q A;  1NTM K;  2KLV A;  2WSF H;  2WPR A;  3P32 A;  4JYB A;  1VPC A;  1M1J C;  4I6M C;  4W7Y A;  4C7R A;  1LT9 B;  1RF1 B;  4WBA A;  1IJD B;  2L5G B;  2J58 A;  1T2K D;  1LT9 A;  2WZ7 A;  5AVW B;  1KFN A;  3NFQ A;  1J2J B;  5CCH D;  1A02 J;  3OJA B;  5APW A;  2NPS B;  1M1J A;  4WY4 D;  2NPS A;  1ZR2 A;  5CJ4 A;  4I1L A;  1IC2 A;  3B8E B;  1GDT A;  3HD7 D;  5APT A;  2R5D A;  1IFI A;  3KDP B;  1HGZ A;  5KLV K;  3M0D C;  1N7S D;  1MUU A;  5AVX B;  2XKM A;  2XZR A;  4GT1 A;  4EOT A;  1GW3 A;  3L35 A;  2IX7 C;  2WPS A;  2Q7C A;  1YYC A;  2YKP A;  3TNU B;  2FYU K;  1N2D C;  1URQ D;  2R5B A;  1EQ7 A;  2HPC B;  1H8A A;  3G3Z A;  2XNX A;  2R32 A;  4N78 D;  2O1K A;  3B5N B;  2A45 G;  2HPC A;  4WB4 A;  3EFG A;  3KYQ A;  1X79 B;  1KZU B;  1DH3 A;  2H7H A;  4ZKU A;  3L4F A;  2WPQ A;  3MD0 A;  5KJ7 C;  1JY2 O;  1NOH A;  1T3J A;  3VTP C;  1GZL A;  3MUD A;  1T2K C;  2N1T C;  5AW6 B;  3A3Y B;  5APV A;  2P1J A;  1LTA C;  1SQB K;  3C9I A;  3U1A A;  1LGH B;  4N3Y B;  2LKM A;  2KYV A;  1NH4 A;  1NKZ B;  1HTL C;  3NMD A;  3A2A A;  5KJ7 A;  1NAF A;  1H89 A;  1FZB A;  2KOG A;  3BRT B;  2C9L Y;  3MGN A;  2XU6 A;  4JF7 A;  1FZC B;  2N1T A;  1WRG A;  1N73 B;  3HE5 B;  2NPS D;  1ZN5 A;  1FZC A;  1J1D B;  2I1K A;  4I2L C;  3SWF A;  5APY A;  4HH2 A;  3GHG C;  4RES B;  2GUS A;  3P7K A;  5AVR B;  1XTC C;  1URQ C;  2HOD B;  1NO4 A;  2C9N Y;  4B86 A;  4Y99 B;  1J1E C;  5AVS B;  3GHG A;  1MZ9 A;  2P7J A;  4EIJ A;  3UIA A;  1FZE A;  5AVV B;  1IFM A;  5CMZ A;  1HUC A;  5APS A;  4XA4 A;  3B5N D;  1FZG A;  5AW9 B;  1JY2 N;  5AVU B;  3EQ2 A;  1SQV K;  2POH A;  1LT9 C;  1RF1 C;  5AW8 B;  5AVZ B;  1GU4 A;  3VYI A;  2XV5 A;  3BAS A;  1HGV A;  3V5B A;  4N78 E;  4ZKP A;  5AW3 B;  5KJ7 D;  1L0N K;  1X9V A;  5AW0 B;  1W2E A;  2JJL A;  3HUS B;  2NPS C;  3TSI A;  2XDJ A;  2N1T D;  2HYN A;  1LWU B;  1RY3 A;  2IFM A;  1RF1 A;  2J59 M;  1MFZ A;  2Z4E A;  2CPB A;  1GL2 B;  1LWU A;  2YKO A;  4AQR D;  2GM4 A;  3CLQ A;  1JTH B;  1OWA A;  2VRS A;  2OYI B;  1GL2 A;  3A5T A;  4GIF A;  1VDF A;  1JTH A;  3OA7 A;  1QL1 A;  5AW4 B;  4DZO A;  2HFE D;  2FYZ A;  3VOP A;  1A02 F;  1HH0 A;  3V2Q A;  3VP8 A;  3B5N C;  3SWY A;  2OYH B;  4OH8 B;  1FJP A;  5BU5 A;  5APU A;  2FFD B;  2M8R A;  2E43 A;  1JCC A;  3TNU A;  3R2P A;  3IR9 A;  5CHX A;  1E5W A;  2A45 H;  3B5N A;  3P8C D;  1LTS C;  5CJ0 A;  1HVV A;  2KSJ A;  3RL0 B;  1KIL B;  1JMM A;  1RE4 C;  1HWT C;  1IO4 A;  3H6P A;  1DEB A;  1GD2 E;  1KIL A;  1XTG B;  1LTJ B;  1JOC A;  3IFM A;  3N7N A;  1FZC C;  2HG5 D;  1N73 C;  1DX7 A;  4DOJ A;  3L37 A;  2YO2 A;  1X8Y A;  1J1D C;  1RE4 A;  5CCG A;  1JY3 P;  3RK3 B;  1GL2 D;  1JCD A;  1L4A B;  3HE4 B;  1S9K D;  3VP9 A;  1G2C B;  1N73 A;  3HE5 A;  3HE4 A;  5AVT B;  3HTK B;  1G2C A;  3U1C A;  2A45 I;  2WIT A;  3MTU E;  2M3B A;  3KQG A;  3HTK A;  3LIE A;  4Y99 C;  2IPP A;  1NTK K;  4JYC A;  3RK2 B;  1JNM A;  3CI9 A;  3U59 A;  1GTW A;  1OXZ A;  4C7N B;  2HOD A;  2Q9I A;  2MJZ A;  4O9B A;  2YO3 A;  3M9B A;  3H32 B;  2Z5I A;  4IFM A;  1IFJ A;  3V4W A;  5BVZ A;  3HD7 B;  1M7L A;  3H32 A;  4LLH A;  1N7S B;  2WSC H;  2Z5H A;  2H8P D;  4AUW A;  1Z56 A;  1SQQ K;  1KIL D;  2Q5U A;  1ZLL A;  2WT7 B;  3HUS C;  1NTZ K;  1LWU C;  3L36 A;  2WT7 A;  3HRN A;  1SQX K;  3LID A;  1FZF A;  3M91 A;  1N86 A;  1GL2 C;  5CCG D;  1H88 A;  1RF0 C;  1T8Z A;  1KQL A;  1GK6 A;  1GU5 A;  3M0A A;  4IFD K;  2FKW B;  3O8Z A;  2P67 A;  2OYI C;  1FOS F;  3P8C E;  3HUS A;  2W6A A;  5AW7 B;  1CI6 B;  5BU8 B;  1SFC C;  2KB7 P;  2O01 H;  1RE3 A;  1NKN A;  1G1J A;  1CI6 A;  1RF0 A;  1FU1 A;  2OYI A;  1SFC B;  2IFN A;  1SP4 A;  2OYH C;  2ZXE B;  1JY3 O;  1SLQ A;  1SFC A;  3RK2 D;  1M1J B;  2FFD C;  2C0W A;  1FOS E;  2YNY A;  1LTB C;  1G1I A;  4AYC A;  1QL2 A;  1S9K E;  1SQP K;  1ZV8 A;  1CW5 A;  3OAK A;  2HLO A;  2OYH A;  1JUN A;  1CZQ A;  3RL0 C;  1KIL C;  2FFD A;  1SVF A;  3I5C A;  5AW5 B;  4HYT B;  3BRV B;  3E1I A;  3NXS A;  2R3C A;  2C0X A;  1LTJ C;  1YTZ T;  2H43 A;  2ZFC A;  1IFN A;  5CCG C;  2Q3I A;  1FBM A;  1NHL A;  1L0L K;  2WTY A;  1CSB A;  3V2R A;  3MIW A;  3M0D A;  3VMX A;  3RK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...