2C9NY

Structure of the epstein-barr virus zebra protein at approximately 3. 5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
molecule keywords 5'-D(*CP*AP*CP*TP*GP*AP*CP*TP*CP*AP *T)-3'
total genus 23
structure length 59
sequence length 59
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9nY00
1HUCA 2VRSA 5AVYB 5AW8B 2WTYA 3HE4A 4JYCA 4B86A 3L36A 5AW6B 2C9NY 2BASA 3VMXA 3IR9A 1FAVA 3A3YB 1J2JB 3HE5B 4RESB 4XE5B 1SLQA 3A2AA 3NXSA 3O8ZA 2P67A 5AVSB 2WPSA 1A02J 2H7HA 3LIEA 3TNUB 3TK1A 1S9KD 1MV8A 4DZOA 1FOSF 1H88A 3B8EB 1JUNA 1GTWA 2QM8A 3HTKA 2YO3A 1H89A 1YYCA 2C9LY 2Q5UA 3I5CA 3SWFA 2IPPA 5AW5B 3M0AA 5AW2B 5AVRB 2ZXEB 2W6AA 2KP8A 2JJLA 2R5BA 4AUWA 1DH3A 2WT7B 3TNUA 3VTPC 4AQRD 3P7KA 2QM7A 3P8MC 5AW4B 1GD2E 5APVA 1X8YA 1T2KC 3M9HA 4I6MC 5APTA 3VYIA 3P32A 5AW3B 2WPRA 2WT7A 3OAKA 3KQGA 3TYYA 1HBWA 4JYBA 5AVUB 1GZLA 3HE5A 3V4QA 5AW9B 3V5BA 1NAFA 1MUUA 1OWAA 2WPQA 3KDPB 2XU6A 4HYTB 3M0DA 5APUA 3MD0A 5AVZB 3A5TA 2W27A 3NFQA 1HJBA 4EOTA 1GU4A 3M9BA 3M06A 3NMDA 5APYA 5AVTB 2XV5A 4AYCA 3V4WA 5AVQB 5AVWB 5APQA 1A02F 3LIDA 5AW7B 1T2KD 1GK4A 1FOSE 4GKGA 5AVVB 1H8AA 1HWTC 2P7JA 1MFZA 1OXZA 2R3CA 2R32A 2N9BA 2WWWA 2Z5IA 2P2UA 4GT1A 3VN0A 4C7NB 4I2LC 1IO4A 2Q7CA 2YNYA 5APWA 1CZQA 1KQLA 1SP4A 5AW0B 5AVXB 1JNMA 1GU5A 3UIAA 4C46A 1CI6B 3L37A 4M3LA 3NTNA 2Z5HA 3L35A 5AW1B 1S9KE 3A7OA 1CI6A 1G2CB 5APXA 3HE4B 1NWQA 3M91A 4KHXA 3VMYA 3MGNA 2YO2A 1GK6A 4C7NA 2XZRA 2E43A 5APSA 2Q3IA 5CMZA 3T97A 2ZFCA 1CSBA 3VMZA 4LC1A 2R5DA 2E42A
chains in the Genus database with same CATH superfamily
1HUCA 2VRSA 2KK7A 2YKOA 3O6QB 1DIPA 1Y8AA 2BCCE 1E5WA 3A0HH 1L0NJ 1URQB 2OARA 1NVOA 2W8ZA 1L4AA 3CX5D 3MIWA 4U3FJ 1NU1K 3TDKA 1X22A 1VQOP 3D6ZA 1QGKB 3H1ID 1IZNB 2C9NY 3IF4A 3N7NA 5CCHC 1LWUC 1YIJP 2WZ7A 2C0WA 1WRGA 1FAVA 2ZAEB 3CXHH 1KQSO 4K35A 4RESB 3MTUE 3BATA 3H1HG 2K3RA 3CXHD 1YHQP 3CXHE 2D2CD 3CWBE 2OTJP 2FFDB 2LR2A 3NXSA 2FYZA 3AE7C 1L2PA 3MUDA 3M0DC 3BASA 3O8ZA 1SQXK 4OGQD 1A02J 1JTHB 1G1JA 1NTMD 1YQ3C 1LTSC 3TNUB 1RE4A 5AW5B 3HUSA 4Y99B 2PGDA 3CWBJ 3CPWO 3CCLP 3B8EB 3S9OA 4DCKA 4RJTA 2IDBA 4L75A 1VQKP 3A0HE 2PFXA 3IAOA 2IBZD 3HTKA 2KYVA 4IFMA 4DJGA 4ZKUA 4U7JA 1GTWA 1SQXD 2QG4A 1OFCX 1VQ4P 1BSNA 1XTGB 1GL2A 4BRYB 1VF5D 4EIJA 5KLVJ 3AE6C 1PP9E 4R4MA 3L72D 2HLOA 1RF0A 2BCCJ 3GLMA 4LLHA 1S5LE 5CBNA 2FYNC 2QEXP 1FOSF 5GTIH 2R5BA 3TGUD 1KMIZ 2A45G 1SQVK 2NPSC 3L75J 1KILD 2A06D 3PHLA 3RL0D 3SWKA 1DH3A 4H13C 3WUUA 2WT7B 2ZXXA 4OGQC 2KLUA 3TNUA 3I56P 2E5TA 3HUSB 3U1CA 1DD3A 5B66H 3F89A 4I6MC 5APTA 2JDIH 4I7ZB 2I8DA 2Y0DA 4JQ0D 1PFIA 2E75C 3OA7A 1AV1A 1BGYJ 3OAKA 3D70A 3H1LG 2KIKA 4PV1B 4D6TJ 1EZVI 3QH9A 1OX3A 2N1TA 1N7LA 1LTGC 3H1LE 3W67A 4XFJA 4H44C 2Y9YA 1OWAA 2WPQA 3BCCG 3CXHI 3B4SA 3MD0A 4QMAA 1FZAA 5CCGA 1Q90D 1RE4C 2P58A 3M9BA 5B66E 4U3FG 1M1KQ 1FZCB 4O9BA 1LNQA 5CCHA 1L4AB 2KSEA 2XV5A 3E1IA 4AYCA 2QSIA 4GIFA 1USEA 2A45I 1SQQK 2JO1A 5AVQB 1JCCA 3G71P 1CW5A 1K05A 5APQA 1R5LA 1S5LH 1KILC 5AW7B 1T2KD 2H88C 3CC2P 1M1JC 1SFCB 1HH0A 3E1RA 5AVVB 1IFIA 3L71G 3Q1MA 1MFZA 1UIIA 2R3CA 1IFDA 2R32A 3AE8C 1HJ0A 1SQBG 2N9BA 1L0LD 2Z5IA 3L75D 3WUTA 1LT9B 2HG5D 2E76B 1KB9D 3B5NB 2Q7CA 4ASWA 1KYOI 5KAFH 3Q5RA 1VF5B 1LP1A 3HRNA 1U57A 2WITA 4Y99C 1SQBK 1EDIA 3BCCJ 3L73E 1VQ6P 2HODA 4C46A 4D6TE 1G2CA 1PPJD 2A45H 5TISH 1BGYE 3L37A 2QJKC 1NTMG 3CCEP 3FXDA 4D6TG 5AW1B 2AXTH 3JC22 3L35A 5KJ7A 1IFMA 3A7OA 1CI6A 1ZMEC 2ITAA 1MZ9A 2E76C 3B5NC 3M91A 1G1IA 3L75E 4NPFX 1L0NE 2H89C 4DT0A 2M3BA 1PGOA 2IX7C 2YO2A 2RH0A 1OIPA 3N4XA 2D2CC 3HD7B 1IFNA 1L0NG 3L75G 4GOEA 5BU5A 1PP9J 3C1LA 1GW4A 1USDA 2AEFA 5KLVE 3AE5C 3T97A 1CSBA 3R4YA 2GA1A 3KYQA 3SSUA 2R5DA 2E42A 1K73Q 1SQQJ 5AVYB 2FY8A 1IC2A 3H1JG 3CCRP 3CD6P 1DEEG 5AW8B 2WTYA 1BCCD 1AFOA 2YMYA 4JYCA 1KQGB 3H1JE 3AEEC 3CCQP 3CI9A 3L36A 2LXBA 4ZMDA 4AQRD 2BASA 3JSVC 4W7ZA 3H25A 1LJ2A 2JWDA 3CWBG 3R2PA 3USSA 2AEJA 1GL2B 3KHUA 1SQPG 3AE9C 1YITP 1S72P 3GHGA 1ZRTE 2UWJE 4RO0A 1J2JB 4ZNCA 3CCJP 3U1AA 2HYNA 1KYOE 1SLQA 1RY3A 2IYPA 3D6YA 3MUDC 3CX5E 4C7RA 3BRVB 3FGAD 3G3ZA 1SQPD 1WT6A 4H13D 3SFEC 2V7QH 4ASVA 2P67A 4YPCA 1KN7A 5AVSB 2WPSA 1D7MA 2OYHB 3KZIH 4EDFA 3L70J 3RK2D 1RHZB 3RBZA 3TK1A 1NHLA 2KXPB 1SQVJ 3L74G 2K9JA 5GTHE 2QA4P 2A06G 1S9KD 2M5AB 1FC2C 2PAJA 2XNDH 2KNCB 1VQ8P 1FZBA 4H0LD 2WVRA 1JUNA 2E75D 2QM8A 1NTZD 1GL2D 4WY4B 2M3EA 2NPSB 4PJ0H 4EI2A 4HJGH 2W6BA 1YYCA 5H2FH 1QLED 1IFPA 1N7SC 1YJWP 5CJ0A 1KFMA 3I5CA 2OYHC 1EZVE 2QJYB 4GODA 4BXLA 2IPPA 1BCCJ 3M0AA 3AEBC 1UIXA 5AVRB 1BE3E 3V2RA 2FFDC 2C0XA 4DOJA 1ZN5A 4CPGA 2NPSA 5KKZB 2KNCA 1FS0E 2IZ0A 3H1HE 5B5EE 2M5AA 1Q81Q 4WY4C 2M0BA 1M90Q 2K9JB 2R44A 1L0LJ 1VQNP 2FXOA 2NZ2A 3VTPC 1PP9D 2GUSA 1LWUA 1SQPJ 5APVA 1X8YA 1YQ4C 4I7ZC 1T2KC 3HD7D 4UB8H 5B5EH 1ZOYC 2OQQA 3L70D 3L71J 1SQXG 1ZW0A 1HBWA 2ZVNB 4JYBA 5AVUB 1SQXE 2OYIC 1HF9A 1AJYA 5AW9B 5BU8B 4GDOA 1SQBD 2O01N 3KDPB 1Q2NA 3CX5I 4OGQB 3L70G 3M0DA 3H1IJ 4UB6E 5APUA 1VQLP 3L72G 3L72J 3NFQA 4EOTA 4IL6H 2QJYC 3AE4C 3NMDA 1LTTC 1JB0J 2ZYDA 1JOCA 5CBOA 1EQ7A 1ZR4A 1FDIA 2HFED 5KLIC 1PPJG 3CC4P 2QRXA 2BEQD 2FXPA 5E79E 4XA4A 1KZUB 4I1LA 5CCGD 4PD4E 1NGMB 3LIDA 1A02F 1FZCC 1OVRA 1YTZT 1NTZJ 3B71A 4H0LB 2J5UA 4GKGA 1H8AA 3G4SP 1SQQD 1JTHA 1IK9A 4JF7A 3Q5SA 3AE2C 2QJKB 1OMIA 2N1TD 1L0LG 3CCVP 2WWWA 3L73G 3TGUE 1URQD 3ABVC 3C9IA 1U7MA 2XNXA 2Q9IA 4YXDC 1IO4A 1CZQA 2IFNA 1KQLA 4IL6X 2OGUA 3C8VA 3Q2YA 2O1KA 5AVXB 1JMBA 3UIAA 1CI6B 1NAYA 1S4XA 2V7QJ 2QJPC 1SQBJ 1BE3D 1KB9H 2MJZA 3H1KJ 1LGHB 2Z5HA 1OW7A 2O01H 4OWFA 2M8RA 2WSFH 1P84E 1G2CB 2PRRA 2G8YA 2YXQB 5KTBA 3QWOC 2OYIA 1RQVA 2B89A 4KHXA 1KTMA 1XTCC 3BCCD 1ZR2A 2JWAA 2B87B 3H6PA 1DEBA 2OTKE 3A0BH 2Q3IA 5APSA 2AEMA 1NTMJ 2Q1KA 1S1CX 2Z4EA 1RF1B 1NOHA 1OVVA 1NU1J 1FU1A 1KILB 1Y9BA 3CL3D 3V2QA 1GD2E 1M7LA 4IFFA 1URQC 3H32A 1S9KE 4IFDK 2K9YA 1JM0A 2RKLA 2IBZG 3GMAA 4BWNA 3AEAC 2OYIB 1OZHA 3EFGA 3S4RA 2KOGA 2IBZE 1EDKA 1U7JA 1LT9C 2W90A 3V2NA 1AQTA 3PP5A 5KAIH 1NH4A 3CMEP 5AW6B 1BGYG 2I1JA 1KV4A 3IR9A 4H13B 2O01J 1L0ND 1M8OB 2RN0A 1NTMK 4LGDE 4TLFA 5CJ4A 3HE5B 1QVFO 2IZ1A 4XE5B 1RQUA 1ZXGA 3L74D 3L74E 2GUVA 1YJNP 2BCCG 2Q6QA 2GM4A 1Q82Q 2N9YB 5C39A 2Q3EA 3BVHA 3RK3B 4D6TD 2H7HA 3LIEA 1NYHA 1VPCA 2CPSA 1L0NK 3V6IA 1AQ5A 2KS1B 1MV8A 3S1KA 3GHGC 2FBWC 2H8PD 3EWKA 4H0LC 4IOIH 3RL0B 2L5GB 3SWYA 1YJ9P 2P10A 4HB1A 1FZGA 3GF7A 5KJ7D 3VP9A 1N73A 2BEZF 2RMZA 2YKPA 4MN4C 2YO3A 1H0TB 3MHVA 1YBKA 2FYUJ 4TT3H 1H89A 2B88A 1GL2C 3TGUJ 3ZDMA 1K9MQ 2C9LY 1W5CE 2LXCB 4BRYA 3RK3C 2J59M 2Y0CA 1NTZE 1WMKA 2ZJSE 3GG2A 2WQYC 1EZVD 3A0BE 4GOFA 2ZXEB 1KYOD 5AW2B 4NPEA 3WMM0 1VDFA 2JR8A 1NKNA 2G3AA 2W6JH 1H0TA 2KP8A 3ITKA 3PTZA 4JBZA 1N73B 3H1HD 2J58A 1FBMA 5EFWB 4AUWA 3CLQA 3AEGC 1P84H 1TU3F 4OH8B 2W83C 1NU1E 2HPCB 1VQMP 3P7KA 5AW4B 1KB9E 1LWUB 1NTKK 3JCUH 5BVZA 4N78D 3VYIA 3P32A 1PZQA 2WPRA 4H44B 2FFDA 1HTLC 1LTJA 2D2CB 1E79H 1NTKE 1QX8A 2P1JA 2WSFJ 3HD7C 3KQGA 1IFJA 3LW5H 3WU2E 2E74D 1GZLA 1NTKG 3HE5A 2WSEH 4WBAA 3WU2H 3V5BA 3OJAB 1MUUA 2XKMA 1ZLLA 2Y9ZA 2YIUC 2QVAA 3H1KE 3D71A 1HJBA 1JO5A 2E74B 3WUVA 3CMAP 2ZT9B 5K5GB 1BSHA 1SFCD 2H43A 3W68A 3M9QA 3P8CD 1K8AQ 1M1JB 1SFCC 1KFNA 3E7KA 1BCCG 5AVWB 1BDDA 4PD4D 3TGUG 1JY3O 3EFFK 1BCCE 1GK4A 1JY2P 1L4AD 1KILA 2KI7B 3L71D 1BGYD 2IYOA 1HWTC 1P84I 1OXZA 2OYHA 1JY2O 5CHXA 4IL6E 1KQFB 1W2BO 3L73D 2E74C 3VN0A 2P2UA 1MFTA 4GT1A 2E5YA 4WWIA 1J1EC 3AECC 3G6EP 2YNYA 1VL2A 1N2DC 1NKZB 4R4LA 1N8RQ 1JY2N 1PGQA 1SP4A 3L74J 2V4HA 3GHGB 2WSEJ 1JNMA 1GU5A 4PV1D 1M1JA 2IFMA 5KLVG 3RGUA 1OVUA 3H1IG 1NTKJ 4N6JA 2WSCH 4PV1C 1RE3C 3FWLA 3L72E 4YTPC 4EYYQ 5KJ7C 2JKVA 5M1BA 1FZCA 1HGZA 3FWNA 3NTNA 1EXJA 1KORA 3HE4B 3G9RA 1SQXJ 2IBZI 2ZYGA 1PPJE 2PP6A 3PLNA 3KPEA 3RK3D 1VQ9P 1GK6A 1X79B 1EDLA 5DJTB 4C7NA 1L4AC 2ZVOB 3L4FA 1FDMA 3T97B 1LTJB 1FZFA 1JMMA 1SQPE 1KC8Q 2FKWB 1Y47A 3PRJA 1L0LE 1LTIC 2FYUK 2O3JA 5KAIE 5H2FE 3VMZA 3CCSP 1NTME 3H1HJ 1FJKA 2BCCD 4L76A 3RL0g 3Q5PA 1L0LK 1IJDB 1FZEA 1PV3A 1RF0C 2FYUE 3GF3A 1FDOA 3GW6A 3HE4A 1GMJA 5KKZC 1NO4A 3AEFC 2FYUG 4Y28J 4B86A 2LKMA 1EDJA 4NPDA 3FX0A 4OVNF 5GTHH 3PH0A 1QL1A 2WSCJ 2CPBA 3VMXA 2L91A 1AVYA 2QJPB 1QL2A 2K88A 2QE7H 2POHA 2FYUD 3A3YB 2HR3A 4ZKPA 4W80A 3LW5J 1NTKD 1KYOH 1J1DC 1LT1A 1M57D 1ZV8A 1W2EA 2N1TC 3B5NA 3A2AA 3HTKB 3IN6A 4N78E 3RL0C 4Z1MH 2ZT9D 4HKZH 2OTLP 1EZVG 2FXMA 1NU1D 1PGJA 1BE3G 4WY4D 4A7PA 1K04A 5CCGC 1NTZK 2E75B 3RK3E 1N73C 3II6A 1PL5A 3L73J 4KT0J 4DZOA 2XDJA 1H88A 3HUSC 4WVZA 1HVVA 2B9BA 3H1JD 4PD4I 1ZP0C 2MKVA 1LTAC 1NTZG 1GDTA 3H1LD 1N7SA 1N7SD 1R5SA 1FJPA 2YXRB 1GW3A 2Q5UA 2I1KA 2OYOA 3AE1C 3EQ2A 4JPZB 3CCMP 3SWFA 3FXEA 1S2EA 1JY3N 5KLVD 3H1JJ 1VQ5P 1NU1G 2W6AA 2YIUB 1FE6A 1N7SB 2AXCA 3KXDA 4PD4H 1J1DB 2N1TB 4WY4A 1YI2P 1KILE 2A06E 2FYNB 2JEEA 2JJLA 2KB7P 5E79H 1HGVA 3CC7P 2Y0EA 2ZT9C 1MKMA 2NRGA 2KLVA 1PP9G 2K1AA 3L71E 2AXTE 1JY3P 1EC5A 2E76D 2CK3H 2QM7A 1S5LX 3B5ND 2KZJA 3P8MC 3M9HA 3CWBD 2QIWA 3SFDC 1SQBE 4KJMA 5AW3B 5TISE 3VP8A 1AA0A 5KLVK 5DJUB 4UB6H 4RKUJ 2WT7A 2HPCA 3H1KG 3TYYA 1X9VA 1KD1Q 2B87A 1N86A 5L8RJ 3V4QA 1R8EA 5KAFE 1T3UA 4W7YA 1NAFA 1BDCA 2XU6A 1PGPA 1X0TA 4HYTB 4H44D 5AVZB 3VOPA 2YMKA 1BE3J 3H1KD 2W27A 1T6AA 4UB8E 3A5TA 1GU4A 1EXIA 1RF1C 3IFMA 4YXWH 2K37A 3M06A 3AEDC 5APYA 5AVTB 3BCCE 5TJHA 1KB9I 3V4WA 1RH5B 2O1JA 2SPZA 2KUBA 4U3FD 3RK2C 3PJSK 2YKQA 4L74A 4WB4A 2R3SA 2KS1A 1DD4A 3BRTB 4HH2A 5KLIB 1OW8A 1FOSE 3P8CE 1JCDA 1SQVE 2P7JA 2WPVB 2KZIA 3L70E 1YTZI 2ZYAA 3U59A 1SQVG 4C7NB 3I55P 4K3AA 3JCUE 3H1IE 4I2LC 1SS1A 2JP3A 4PJ0E 3V2PA 3TF5A 1LTJC 2KSJA 3HD7A 5APWA 1QVGO 3CCUP 1QEXA 1T8ZA 1AVOA 1VF5C 1SVFA 5AW0B 3RBXA 1RE3A 2WSSH 1SQPK 1M56D 1S3JA 2DW3A 3TSIA 1NJIQ 3AE3C 1IK7A 3KZIE 4L73A 3F5HA 4M3LA 1P84D 2NPSD 2HODB 1VQ7P 5APXA 3MZWB 1URQA 3CX5H 5CCHD 3H1LJ 1LTBC 1NWQA 3RK2B 1JEKA 1OW6A 1ZRTD 3VMYA 5GTIE 3MGNA 3O6QA 1Z56A 1Q7YQ 1LP1B 4N3YB 3MP7B 3VMAA 3H32B 2E43A 1T3JA 1SQVD 2XZRA 1SQQE 1LT9A 1PIXA 1J1EB 1VQPP 1RF1A 3K5BA 1SQQG 5CMZA 3OW2O 1Q86Q 2ZFCA 2WMMA 4U3FE 4LC1A 1DX7A 3Q3DA 1SFCA
chains in the Genus database with same CATH topology
1HUCA 2VRSA 2YKOA 1E5WA 2OARA 1URQB 3MIWA 1L4AA 1NU1K 2C9NY 3N7NA 5CCHC 1LWUC 2WZ7A 2C0WA 1WRGA 1FAVA 4RESB 3MTUE 3BATA 2FFDB 3NXSA 2FYZA 3MUDA 3O8ZA 3M0DC 3BASA 1SQXK 1A02J 1JTHB 1G1JA 1LTSC 3TNUB 1RE4A 3HUSA 4Y99B 3B8EB 4IFMA 1GTWA 3HTKA 2KYVA 4ZKUA 1XTGB 1GL2A 4EIJA 2HLOA 1RF0A 4LLHA 2R5BA 2NPSC 2A45G 1SQVK 3RL0D 1KILD 1DH3A 2WT7B 3TNUA 3U1CA 3HUSB 4I6MC 5APTA 1PFIA 3OA7A 3OAKA 2N1TA 1N7LA 1LTGC 1OWAA 2WPQA 3MD0A 1FZAA 5CCGA 1RE4C 3M9BA 1FZCB 4O9BA 1L4AB 2XV5A 3E1IA 4AYCA 4GIFA 2A45I 1SQQK 5AVQB 1JCCA 1CW5A 5APQA 1KILC 5AW7B 1T2KD 1M1JC 1SFCB 1HH0A 5AVVB 1IFIA 1MFZA 2R3CA 1IFDA 2R32A 2N9BA 2Z5IA 1LT9B 2HG5D 3B5NB 2Q7CA 3HRNA 2WITA 4Y99C 1SQBK 2HODA 4C46A 1G2CA 2A45H 3L37A 5AW1B 3L35A 5KJ7A 1IFMA 3A7OA 1CI6A 1MZ9A 3B5NC 3M91A 1G1IA 2M3BA 2IX7C 3N4XA 2YO2A 5BU5A 3HD7B 1IFNA 1GW4A 3T97A 1CSBA 3KYQA 2R5DA 2E42A 5AVYB 1IC2A 5AW8B 2WTYA 1AFOA 2YMYA 4JYCA 3CI9A 3L36A 2BASA 4W7ZA 3R2PA 1FZCC 1GL2B 3GHGA 1J2JB 3U1AA 2HYNA 1SLQA 1RY3A 4C7RA 3BRVB 3G3ZA 1WT6A 2P67A 5AVSB 2WPSA 2OYHB 3RK2D 3TK1A 1NHLA 1S9KD 2PAJA 1FZBA 1JUNA 2QM8A 1GL2D 4WY4B 2NPSB 2W6BA 1YYCA 1N7SC 5CJ0A 1KFMA 3I5CA 2OYHC 2IPPA 3M0AA 5AVRB 3V2RA 2FFDC 2C0XA 4DOJA 1ZN5A 2NPSA 4WY4C 3VTPC 2GUSA 1LWUA 5APVA 1X8YA 1T2KC 3HD7D 1HBWA 4JYBA 5AVUB 2OYIC 5AW9B 5BU8B 3KDPB 3M0DA 5APUA 3NFQA 4EOTA 3NMDA 1LTTC 1JOCA 1EQ7A 1ZR4A 2HFED 4XA4A 1KZUB 4I1LA 5CCGD 1A02F 3LIDA 1YTZT 4GKGA 1H8AA 1JTHA 1IK9A 4JF7A 2N1TD 2WWWA 1URQD 3C9IA 2XNXA 1IO4A 2Q9IA 1CZQA 2IFNA 1KQLA 2O1KA 5AVXB 3UIAA 1CI6B 2MJZA 1LGHB 2Z5HA 2O01H 2M8RA 2WSFH 1G2CB 5KTBA 2OYIA 4KHXA 1XTCC 1ZR2A 3H6PA 1DEBA 5APSA 2Q3IA 2Z4EA 1RF1B 1NOHA 1FU1A 1KILB 3CL3D 3V2QA 1M7LA 4IFFA 1URQC 3H32A 1S9KE 4IFDK 2OYIB 3EFGA 2KOGA 1LT9C 3V2NA 3PP5A 1NH4A 5AW6B 2I1JA 3IR9A 5CJ4A 1NTMK 4LGDE 3HE5B 4XE5B 2GUVA 2GM4A 3BVHA 3RK3B 2H7HA 3LIEA 1VPCA 2CPSA 1L0NK 1AQ5A 1MV8A 3GHGC 2H8PD 1FOSF 3RL0B 3SWYA 2L5GB 1FZGA 1N73A 5KJ7D 3VP9A 2YKPA 2YO3A 1H89A 1GL2C 2C9LY 3RK3C 2J59M 5BVZA 5AW5B 5CCHA 5AW2B 2ZXEB 3WMM0 1VDFA 1NKNA 2KP8A 1N73B 2J58A 1FBMA 4AUWA 3CLQA 4OH8B 2HPCB 3P7KA 5AW4B 1NTKK 1LWUB 4N78D 3VYIA 3P32A 2WPRA 2FFDA 1HTLC 1LTJA 2P1JA 3HD7C 3KQGA 3LW5H 1IFJA 1GZLA 3HE5A 4WBAA 2WSEH 3V5BA 3OJAB 1MUUA 2XKMA 1ZLLA 1HJBA 1JO5A 1SFCD 2H43A 3M9QA 3P8CD 1M1JB 1SFCC 1KFNA 5AVWB 1JY3O 1GK4A 1JY2P 1L4AD 1KILA 1HWTC 2OYHA 1OXZA 1JY2O 5CHXA 3VN0A 2P2UA 4GT1A 1J1EC 2YNYA 1N2DC 1NKZB 1JY2N 1SP4A 3GHGB 1GU5A 1JNMA 1M1JA 2IFMA 4N6JA 2WSCH 1RE3C 5KJ7C 1FZCA 1HGZA 3NTNA 3HE4B 2PP6A 3KPEA 3RK3D 1GK6A 1X79B 4C7NA 1L4AC 1FDMA 3L4FA 1LTJB 1FZFA 1JMMA 2FKWB 2FYUK 1LTIC 3VMZA 1FJKA 1L0LK 1IJDB 1FZEA 1RF0C 3HE4A 1NO4A 4B86A 2LKMA 1QL1A 3VMXA 2CPBA 1QL2A 2POHA 3A3YB 4ZKPA 4W80A 1J1DC 1ZV8A 2N1TC 3B5NA 1W2EA 3HTKB 3A2AA 4N78E 3RL0C 2FXMA 4WY4D 5CCGC 1NTZK 1N73C 3II6A 4DZOA 2XDJA 1H88A 3HUSC 1HVVA 1LTAC 1GDTA 1N7SA 1N7SD 1FJPA 1GW3A 2Q5UA 2I1KA 3EQ2A 3SWFA 1JY3N 2W6AA 1N7SB 1J1DB 2N1TB 4WY4A 2JJLA 2JEEA 2KB7P 1HGVA 2KLVA 4AQRD 1JY3P 2QM7A 3B5ND 3P8MC 1GD2E 3M9HA 3VP8A 5AW3B 2WT7A 2HPCA 5KLVK 3TYYA 1X9VA 1N86A 3V4QA 1T3UA 4W7YA 1NAFA 2XU6A 4HYTB 3VOPA 5AVZB 3A5TA 2W27A 1GU4A 1RF1C 3IFMA 3M06A 5APYA 5AVTB 3V4WA 2O1JA 3RK2C 2YKQA 4WB4A 3BRTB 4HH2A 1FOSE 3P8CE 1JCDA 2P7JA 1YTZI 3U59A 4C7NB 4I2LC 3V2PA 1LTJC 2KSJA 3HD7A 5APWA 1T8ZA 1SVFA 5AW0B 1RE3A 1SQPK 3TSIA 4M3LA 2NPSD 2HODB 5APXA 1URQA 5CCHD 1NWQA 1LTBC 3RK2B 3VMYA 3MGNA 1Z56A 4N3YB 3H32B 2E43A 1T3JA 2XZRA 1LT9A 1J1EB 1RF1A 5CMZA 2ZFCA 4LC1A 1DX7A 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC A;  2VRS A;  5AVY B;  5AW8 B;  2WTY A;  3HE4 A;  4JYC A;  4B86 A;  3L36 A;  5AW6 B;  2C9N Y;  2BAS A;  3VMX A;  3IR9 A;  1FAV A;  3A3Y B;  1J2J B;  3HE5 B;  4RES B;  4XE5 B;  1SLQ A;  3A2A A;  3NXS A;  3O8Z A;  2P67 A;  5AVS B;  2WPS A;  1A02 J;  2H7H A;  3LIE A;  3TNU B;  3TK1 A;  1S9K D;  1MV8 A;  4DZO A;  1FOS F;  1H88 A;  3B8E B;  1JUN A;  1GTW A;  2QM8 A;  3HTK A;  2YO3 A;  1H89 A;  1YYC A;  2C9L Y;  2Q5U A;  3I5C A;  3SWF A;  2IPP A;  5AW5 B;  3M0A A;  5AW2 B;  5AVR B;  2ZXE B;  2W6A A;  2KP8 A;  2JJL A;  2R5B A;  4AUW A;  1DH3 A;  2WT7 B;  3TNU A;  3VTP C;  4AQR D;  3P7K A;  2QM7 A;  3P8M C;  5AW4 B;  1GD2 E;  5APV A;  1X8Y A;  1T2K C;  3M9H A;  4I6M C;  5APT A;  3VYI A;  3P32 A;  5AW3 B;  2WPR A;  2WT7 A;  3OAK A;  3KQG A;  3TYY A;  1HBW A;  4JYB A;  5AVU B;  1GZL A;  3HE5 A;  3V4Q A;  5AW9 B;  3V5B A;  1NAF A;  1MUU A;  1OWA A;  2WPQ A;  3KDP B;  2XU6 A;  4HYT B;  3M0D A;  5APU A;  3MD0 A;  5AVZ B;  3A5T A;  2W27 A;  3NFQ A;  1HJB A;  4EOT A;  1GU4 A;  3M9B A;  3M06 A;  3NMD A;  5APY A;  5AVT B;  2XV5 A;  4AYC A;  3V4W A;  5AVQ B;  5AVW B;  5APQ A;  1A02 F;  3LID A;  5AW7 B;  1T2K D;  1GK4 A;  1FOS E;  4GKG A;  5AVV B;  1H8A A;  1HWT C;  2P7J A;  1MFZ A;  1OXZ A;  2R3C A;  2R32 A;  2N9B A;  2WWW A;  2Z5I A;  2P2U A;  4GT1 A;  3VN0 A;  4C7N B;  4I2L C;  1IO4 A;  2Q7C A;  2YNY A;  5APW A;  1CZQ A;  1KQL A;  1SP4 A;  5AW0 B;  5AVX B;  1JNM A;  1GU5 A;  3UIA A;  4C46 A;  1CI6 B;  3L37 A;  4M3L A;  3NTN A;  2Z5H A;  3L35 A;  5AW1 B;  1S9K E;  3A7O A;  1CI6 A;  1G2C B;  5APX A;  3HE4 B;  1NWQ A;  3M91 A;  4KHX A;  3VMY A;  3MGN A;  2YO2 A;  1GK6 A;  4C7N A;  2XZR A;  2E43 A;  5APS A;  2Q3I A;  5CMZ A;  3T97 A;  2ZFC A;  1CSB A;  3VMZ A;  4LC1 A;  2R5D A;  2E42 A; 
#chains in the Genus database with same CATH topology
 1HUC A;  2VRS A;  2KK7 A;  2YKO A;  3O6Q B;  1DIP A;  1Y8A A;  2BCC E;  1E5W A;  3A0H H;  1L0N J;  1URQ B;  2OAR A;  1NVO A;  2W8Z A;  1L4A A;  3CX5 D;  3MIW A;  4U3F J;  1NU1 K;  3TDK A;  1X22 A;  1VQO P;  3D6Z A;  1QGK B;  3H1I D;  1IZN B;  2C9N Y;  3IF4 A;  3N7N A;  5CCH C;  1LWU C;  1YIJ P;  2WZ7 A;  2C0W A;  1WRG A;  1FAV A;  2ZAE B;  3CXH H;  1KQS O;  4K35 A;  4RES B;  3MTU E;  3BAT A;  3H1H G;  2K3R A;  3CXH D;  1YHQ P;  3CXH E;  2D2C D;  3CWB E;  2OTJ P;  2FFD B;  2LR2 A;  3NXS A;  2FYZ A;  3AE7 C;  1L2P A;  3MUD A;  3M0D C;  3BAS A;  3O8Z A;  1SQX K;  4OGQ D;  1A02 J;  1JTH B;  1G1J A;  1NTM D;  1YQ3 C;  1LTS C;  3TNU B;  1RE4 A;  5AW5 B;  3HUS A;  4Y99 B;  2PGD A;  3CWB J;  3CPW O;  3CCL P;  3B8E B;  3S9O A;  4DCK A;  4RJT A;  2IDB A;  4L75 A;  1VQK P;  3A0H E;  2PFX A;  3IAO A;  2IBZ D;  3HTK A;  2KYV A;  4IFM A;  4DJG A;  4ZKU A;  4U7J A;  1GTW A;  1SQX D;  2QG4 A;  1OFC X;  1VQ4 P;  1BSN A;  1XTG B;  1GL2 A;  4BRY B;  1VF5 D;  4EIJ A;  5KLV J;  3AE6 C;  1PP9 E;  4R4M A;  3L72 D;  2HLO A;  1RF0 A;  2BCC J;  3GLM A;  4LLH A;  1S5L E;  5CBN A;  2FYN C;  2QEX P;  1FOS F;  5GTI H;  2R5B A;  3TGU D;  1KMI Z;  2A45 G;  1SQV K;  2NPS C;  3L75 J;  1KIL D;  2A06 D;  3PHL A;  3RL0 D;  3SWK A;  1DH3 A;  4H13 C;  3WUU A;  2WT7 B;  2ZXX A;  4OGQ C;  2KLU A;  3TNU A;  3I56 P;  2E5T A;  3HUS B;  3U1C A;  1DD3 A;  5B66 H;  3F89 A;  4I6M C;  5APT A;  2JDI H;  4I7Z B;  2I8D A;  2Y0D A;  4JQ0 D;  1PFI A;  2E75 C;  3OA7 A;  1AV1 A;  1BGY J;  3OAK A;  3D70 A;  3H1L G;  2KIK A;  4PV1 B;  4D6T J;  1EZV I;  3QH9 A;  1OX3 A;  2N1T A;  1N7L A;  1LTG C;  3H1L E;  3W67 A;  4XFJ A;  4H44 C;  2Y9Y A;  1OWA A;  2WPQ A;  3BCC G;  3CXH I;  3B4S A;  3MD0 A;  4QMA A;  1FZA A;  5CCG A;  1Q90 D;  1RE4 C;  2P58 A;  3M9B A;  5B66 E;  4U3F G;  1M1K Q;  1FZC B;  4O9B A;  1LNQ A;  5CCH A;  1L4A B;  2KSE A;  2XV5 A;  3E1I A;  4AYC A;  2QSI A;  4GIF A;  1USE A;  2A45 I;  1SQQ K;  2JO1 A;  5AVQ B;  1JCC A;  3G71 P;  1CW5 A;  1K05 A;  5APQ A;  1R5L A;  1S5L H;  1KIL C;  5AW7 B;  1T2K D;  2H88 C;  3CC2 P;  1M1J C;  1SFC B;  1HH0 A;  3E1R A;  5AVV B;  1IFI A;  3L71 G;  3Q1M A;  1MFZ A;  1UII A;  2R3C A;  1IFD A;  2R32 A;  3AE8 C;  1HJ0 A;  1SQB G;  2N9B A;  1L0L D;  2Z5I A;  3L75 D;  3WUT A;  1LT9 B;  2HG5 D;  2E76 B;  1KB9 D;  3B5N B;  2Q7C A;  4ASW A;  1KYO I;  5KAF H;  3Q5R A;  1VF5 B;  1LP1 A;  3HRN A;  1U57 A;  2WIT A;  4Y99 C;  1SQB K;  1EDI A;  3BCC J;  3L73 E;  1VQ6 P;  2HOD A;  4C46 A;  4D6T E;  1G2C A;  1PPJ D;  2A45 H;  5TIS H;  1BGY E;  3L37 A;  2QJK C;  1NTM G;  3CCE P;  3FXD A;  4D6T G;  5AW1 B;  2AXT H;  3JC2 2;  3L35 A;  5KJ7 A;  1IFM A;  3A7O A;  1CI6 A;  1ZME C;  2ITA A;  1MZ9 A;  2E76 C;  3B5N C;  3M91 A;  1G1I A;  3L75 E;  4NPF X;  1L0N E;  2H89 C;  4DT0 A;  2M3B A;  1PGO A;  2IX7 C;  2YO2 A;  2RH0 A;  1OIP A;  3N4X A;  2D2C C;  3HD7 B;  1IFN A;  1L0N G;  3L75 G;  4GOE A;  5BU5 A;  1PP9 J;  3C1L A;  1GW4 A;  1USD A;  2AEF A;  5KLV E;  3AE5 C;  3T97 A;  1CSB A;  3R4Y A;  2GA1 A;  3KYQ A;  3SSU A;  2R5D A;  2E42 A;  1K73 Q;  1SQQ J;  5AVY B;  2FY8 A;  1IC2 A;  3H1J G;  3CCR P;  3CD6 P;  1DEE G;  5AW8 B;  2WTY A;  1BCC D;  1AFO A;  2YMY A;  4JYC A;  1KQG B;  3H1J E;  3AEE C;  3CCQ P;  3CI9 A;  3L36 A;  2LXB A;  4ZMD A;  4AQR D;  2BAS A;  3JSV C;  4W7Z A;  3H25 A;  1LJ2 A;  2JWD A;  3CWB G;  3R2P A;  3USS A;  2AEJ A;  1GL2 B;  3KHU A;  1SQP G;  3AE9 C;  1YIT P;  1S72 P;  3GHG A;  1ZRT E;  2UWJ E;  4RO0 A;  1J2J B;  4ZNC A;  3CCJ P;  3U1A A;  2HYN A;  1KYO E;  1SLQ A;  1RY3 A;  2IYP A;  3D6Y A;  3MUD C;  3CX5 E;  4C7R A;  3BRV B;  3FGA D;  3G3Z A;  1SQP D;  1WT6 A;  4H13 D;  3SFE C;  2V7Q H;  4ASV A;  2P67 A;  4YPC A;  1KN7 A;  5AVS B;  2WPS A;  1D7M A;  2OYH B;  3KZI H;  4EDF A;  3L70 J;  3RK2 D;  1RHZ B;  3RBZ A;  3TK1 A;  1NHL A;  2KXP B;  1SQV J;  3L74 G;  2K9J A;  5GTH E;  2QA4 P;  2A06 G;  1S9K D;  2M5A B;  1FC2 C;  2PAJ A;  2XND H;  2KNC B;  1VQ8 P;  1FZB A;  4H0L D;  2WVR A;  1JUN A;  2E75 D;  2QM8 A;  1NTZ D;  1GL2 D;  4WY4 B;  2M3E A;  2NPS B;  4PJ0 H;  4EI2 A;  4HJG H;  2W6B A;  1YYC A;  5H2F H;  1QLE D;  1IFP A;  1N7S C;  1YJW P;  5CJ0 A;  1KFM A;  3I5C A;  2OYH C;  1EZV E;  2QJY B;  4GOD A;  4BXL A;  2IPP A;  1BCC J;  3M0A A;  3AEB C;  1UIX A;  5AVR B;  1BE3 E;  3V2R A;  2FFD C;  2C0X A;  4DOJ A;  1ZN5 A;  4CPG A;  2NPS A;  5KKZ B;  2KNC A;  1FS0 E;  2IZ0 A;  3H1H E;  5B5E E;  2M5A A;  1Q81 Q;  4WY4 C;  2M0B A;  1M90 Q;  2K9J B;  2R44 A;  1L0L J;  1VQN P;  2FXO A;  2NZ2 A;  3VTP C;  1PP9 D;  2GUS A;  1LWU A;  1SQP J;  5APV A;  1X8Y A;  1YQ4 C;  4I7Z C;  1T2K C;  3HD7 D;  4UB8 H;  5B5E H;  1ZOY C;  2OQQ A;  3L70 D;  3L71 J;  1SQX G;  1ZW0 A;  1HBW A;  2ZVN B;  4JYB A;  5AVU B;  1SQX E;  2OYI C;  1HF9 A;  1AJY A;  5AW9 B;  5BU8 B;  4GDO A;  1SQB D;  2O01 N;  3KDP B;  1Q2N A;  3CX5 I;  4OGQ B;  3L70 G;  3M0D A;  3H1I J;  4UB6 E;  5APU A;  1VQL P;  3L72 G;  3L72 J;  3NFQ A;  4EOT A;  4IL6 H;  2QJY C;  3AE4 C;  3NMD A;  1LTT C;  1JB0 J;  2ZYD A;  1JOC A;  5CBO A;  1EQ7 A;  1ZR4 A;  1FDI A;  2HFE D;  5KLI C;  1PPJ G;  3CC4 P;  2QRX A;  2BEQ D;  2FXP A;  5E79 E;  4XA4 A;  1KZU B;  4I1L A;  5CCG D;  4PD4 E;  1NGM B;  3LID A;  1A02 F;  1FZC C;  1OVR A;  1YTZ T;  1NTZ J;  3B71 A;  4H0L B;  2J5U A;  4GKG A;  1H8A A;  3G4S P;  1SQQ D;  1JTH A;  1IK9 A;  4JF7 A;  3Q5S A;  3AE2 C;  2QJK B;  1OMI A;  2N1T D;  1L0L G;  3CCV P;  2WWW A;  3L73 G;  3TGU E;  1URQ D;  3ABV C;  3C9I A;  1U7M A;  2XNX A;  2Q9I A;  4YXD C;  1IO4 A;  1CZQ A;  2IFN A;  1KQL A;  4IL6 X;  2OGU A;  3C8V A;  3Q2Y A;  2O1K A;  5AVX B;  1JMB A;  3UIA A;  1CI6 B;  1NAY A;  1S4X A;  2V7Q J;  2QJP C;  1SQB J;  1BE3 D;  1KB9 H;  2MJZ A;  3H1K J;  1LGH B;  2Z5H A;  1OW7 A;  2O01 H;  4OWF A;  2M8R A;  2WSF H;  1P84 E;  1G2C B;  2PRR A;  2G8Y A;  2YXQ B;  5KTB A;  3QWO C;  2OYI A;  1RQV A;  2B89 A;  4KHX A;  1KTM A;  1XTC C;  3BCC D;  1ZR2 A;  2JWA A;  2B87 B;  3H6P A;  1DEB A;  2OTK E;  3A0B H;  2Q3I A;  5APS A;  2AEM A;  1NTM J;  2Q1K A;  1S1C X;  2Z4E A;  1RF1 B;  1NOH A;  1OVV A;  1NU1 J;  1FU1 A;  1KIL B;  1Y9B A;  3CL3 D;  3V2Q A;  1GD2 E;  1M7L A;  4IFF A;  1URQ C;  3H32 A;  1S9K E;  4IFD K;  2K9Y A;  1JM0 A;  2RKL A;  2IBZ G;  3GMA A;  4BWN A;  3AEA C;  2OYI B;  1OZH A;  3EFG A;  3S4R A;  2KOG A;  2IBZ E;  1EDK A;  1U7J A;  1LT9 C;  2W90 A;  3V2N A;  1AQT A;  3PP5 A;  5KAI H;  1NH4 A;  3CME P;  5AW6 B;  1BGY G;  2I1J A;  1KV4 A;  3IR9 A;  4H13 B;  2O01 J;  1L0N D;  1M8O B;  2RN0 A;  1NTM K;  4LGD E;  4TLF A;  5CJ4 A;  3HE5 B;  1QVF O;  2IZ1 A;  4XE5 B;  1RQU A;  1ZXG A;  3L74 D;  3L74 E;  2GUV A;  1YJN P;  2BCC G;  2Q6Q A;  2GM4 A;  1Q82 Q;  2N9Y B;  5C39 A;  2Q3E A;  3BVH A;  3RK3 B;  4D6T D;  2H7H A;  3LIE A;  1NYH A;  1VPC A;  2CPS A;  1L0N K;  3V6I A;  1AQ5 A;  2KS1 B;  1MV8 A;  3S1K A;  3GHG C;  2FBW C;  2H8P D;  3EWK A;  4H0L C;  4IOI H;  3RL0 B;  2L5G B;  3SWY A;  1YJ9 P;  2P10 A;  4HB1 A;  1FZG A;  3GF7 A;  5KJ7 D;  3VP9 A;  1N73 A;  2BEZ F;  2RMZ A;  2YKP A;  4MN4 C;  2YO3 A;  1H0T B;  3MHV A;  1YBK A;  2FYU J;  4TT3 H;  1H89 A;  2B88 A;  1GL2 C;  3TGU J;  3ZDM A;  1K9M Q;  2C9L Y;  1W5C E;  2LXC B;  4BRY A;  3RK3 C;  2J59 M;  2Y0C A;  1NTZ E;  1WMK A;  2ZJS E;  3GG2 A;  2WQY C;  1EZV D;  3A0B E;  4GOF A;  2ZXE B;  1KYO D;  5AW2 B;  4NPE A;  3WMM 0;  1VDF A;  2JR8 A;  1NKN A;  2G3A A;  2W6J H;  1H0T A;  2KP8 A;  3ITK A;  3PTZ A;  4JBZ A;  1N73 B;  3H1H D;  2J58 A;  1FBM A;  5EFW B;  4AUW A;  3CLQ A;  3AEG C;  1P84 H;  1TU3 F;  4OH8 B;  2W83 C;  1NU1 E;  2HPC B;  1VQM P;  3P7K A;  5AW4 B;  1KB9 E;  1LWU B;  1NTK K;  3JCU H;  5BVZ A;  4N78 D;  3VYI A;  3P32 A;  1PZQ A;  2WPR A;  4H44 B;  2FFD A;  1HTL C;  1LTJ A;  2D2C B;  1E79 H;  1NTK E;  1QX8 A;  2P1J A;  2WSF J;  3HD7 C;  3KQG A;  1IFJ A;  3LW5 H;  3WU2 E;  2E74 D;  1GZL A;  1NTK G;  3HE5 A;  2WSE H;  4WBA A;  3WU2 H;  3V5B A;  3OJA B;  1MUU A;  2XKM A;  1ZLL A;  2Y9Z A;  2YIU C;  2QVA A;  3H1K E;  3D71 A;  1HJB A;  1JO5 A;  2E74 B;  3WUV A;  3CMA P;  2ZT9 B;  5K5G B;  1BSH A;  1SFC D;  2H43 A;  3W68 A;  3M9Q A;  3P8C D;  1K8A Q;  1M1J B;  1SFC C;  1KFN A;  3E7K A;  1BCC G;  5AVW B;  1BDD A;  4PD4 D;  3TGU G;  1JY3 O;  3EFF K;  1BCC E;  1GK4 A;  1JY2 P;  1L4A D;  1KIL A;  2KI7 B;  3L71 D;  1BGY D;  2IYO A;  1HWT C;  1P84 I;  1OXZ A;  2OYH A;  1JY2 O;  5CHX A;  4IL6 E;  1KQF B;  1W2B O;  3L73 D;  2E74 C;  3VN0 A;  2P2U A;  1MFT A;  4GT1 A;  2E5Y A;  4WWI A;  1J1E C;  3AEC C;  3G6E P;  2YNY A;  1VL2 A;  1N2D C;  1NKZ B;  4R4L A;  1N8R Q;  1JY2 N;  1PGQ A;  1SP4 A;  3L74 J;  2V4H A;  3GHG B;  2WSE J;  1JNM A;  1GU5 A;  4PV1 D;  1M1J A;  2IFM A;  5KLV G;  3RGU A;  1OVU A;  3H1I G;  1NTK J;  4N6J A;  2WSC H;  4PV1 C;  1RE3 C;  3FWL A;  3L72 E;  4YTP C;  4EYY Q;  5KJ7 C;  2JKV A;  5M1B A;  1FZC A;  1HGZ A;  3FWN A;  3NTN A;  1EXJ A;  1KOR A;  3HE4 B;  3G9R A;  1SQX J;  2IBZ I;  2ZYG A;  1PPJ E;  2PP6 A;  3PLN A;  3KPE A;  3RK3 D;  1VQ9 P;  1GK6 A;  1X79 B;  1EDL A;  5DJT B;  4C7N A;  1L4A C;  2ZVO B;  3L4F A;  1FDM A;  3T97 B;  1LTJ B;  1FZF A;  1JMM A;  1SQP E;  1KC8 Q;  2FKW B;  1Y47 A;  3PRJ A;  1L0L E;  1LTI C;  2FYU K;  2O3J A;  5KAI E;  5H2F E;  3VMZ A;  3CCS P;  1NTM E;  3H1H J;  1FJK A;  2BCC D;  4L76 A;  3RL0 g;  3Q5P A;  1L0L K;  1IJD B;  1FZE A;  1PV3 A;  1RF0 C;  2FYU E;  3GF3 A;  1FDO A;  3GW6 A;  3HE4 A;  1GMJ A;  5KKZ C;  1NO4 A;  3AEF C;  2FYU G;  4Y28 J;  4B86 A;  2LKM A;  1EDJ A;  4NPD A;  3FX0 A;  4OVN F;  5GTH H;  3PH0 A;  1QL1 A;  2WSC J;  2CPB A;  3VMX A;  2L91 A;  1AVY A;  2QJP B;  1QL2 A;  2K88 A;  2QE7 H;  2POH A;  2FYU D;  3A3Y B;  2HR3 A;  4ZKP A;  4W80 A;  3LW5 J;  1NTK D;  1KYO H;  1J1D C;  1LT1 A;  1M57 D;  1ZV8 A;  1W2E A;  2N1T C;  3B5N A;  3A2A A;  3HTK B;  3IN6 A;  4N78 E;  3RL0 C;  4Z1M H;  2ZT9 D;  4HKZ H;  2OTL P;  1EZV G;  2FXM A;  1NU1 D;  1PGJ A;  1BE3 G;  4WY4 D;  4A7P A;  1K04 A;  5CCG C;  1NTZ K;  2E75 B;  3RK3 E;  1N73 C;  3II6 A;  1PL5 A;  3L73 J;  4KT0 J;  4DZO A;  2XDJ A;  1H88 A;  3HUS C;  4WVZ A;  1HVV A;  2B9B A;  3H1J D;  4PD4 I;  1ZP0 C;  2MKV A;  1LTA C;  1NTZ G;  1GDT A;  3H1L D;  1N7S A;  1N7S D;  1R5S A;  1FJP A;  2YXR B;  1GW3 A;  2Q5U A;  2I1K A;  2OYO A;  3AE1 C;  3EQ2 A;  4JPZ B;  3CCM P;  3SWF A;  3FXE A;  1S2E A;  1JY3 N;  5KLV D;  3H1J J;  1VQ5 P;  1NU1 G;  2W6A A;  2YIU B;  1FE6 A;  1N7S B;  2AXC A;  3KXD A;  4PD4 H;  1J1D B;  2N1T B;  4WY4 A;  1YI2 P;  1KIL E;  2A06 E;  2FYN B;  2JEE A;  2JJL A;  2KB7 P;  5E79 H;  1HGV A;  3CC7 P;  2Y0E A;  2ZT9 C;  1MKM A;  2NRG A;  2KLV A;  1PP9 G;  2K1A A;  3L71 E;  2AXT E;  1JY3 P;  1EC5 A;  2E76 D;  2CK3 H;  2QM7 A;  1S5L X;  3B5N D;  2KZJ A;  3P8M C;  3M9H A;  3CWB D;  2QIW A;  3SFD C;  1SQB E;  4KJM A;  5AW3 B;  5TIS E;  3VP8 A;  1AA0 A;  5KLV K;  5DJU B;  4UB6 H;  4RKU J;  2WT7 A;  2HPC A;  3H1K G;  3TYY A;  1X9V A;  1KD1 Q;  2B87 A;  1N86 A;  5L8R J;  3V4Q A;  1R8E A;  5KAF E;  1T3U A;  4W7Y A;  1NAF A;  1BDC A;  2XU6 A;  1PGP A;  1X0T A;  4HYT B;  4H44 D;  5AVZ B;  3VOP A;  2YMK A;  1BE3 J;  3H1K D;  2W27 A;  1T6A A;  4UB8 E;  3A5T A;  1GU4 A;  1EXI A;  1RF1 C;  3IFM A;  4YXW H;  2K37 A;  3M06 A;  3AED C;  5APY A;  5AVT B;  3BCC E;  5TJH A;  1KB9 I;  3V4W A;  1RH5 B;  2O1J A;  2SPZ A;  2KUB A;  4U3F D;  3RK2 C;  3PJS K;  2YKQ A;  4L74 A;  4WB4 A;  2R3S A;  2KS1 A;  1DD4 A;  3BRT B;  4HH2 A;  5KLI B;  1OW8 A;  1FOS E;  3P8C E;  1JCD A;  1SQV E;  2P7J A;  2WPV B;  2KZI A;  3L70 E;  1YTZ I;  2ZYA A;  3U59 A;  1SQV G;  4C7N B;  3I55 P;  4K3A A;  3JCU E;  3H1I E;  4I2L C;  1SS1 A;  2JP3 A;  4PJ0 E;  3V2P A;  3TF5 A;  1LTJ C;  2KSJ A;  3HD7 A;  5APW A;  1QVG O;  3CCU P;  1QEX A;  1T8Z A;  1AVO A;  1VF5 C;  1SVF A;  5AW0 B;  3RBX A;  1RE3 A;  2WSS H;  1SQP K;  1M56 D;  1S3J A;  2DW3 A;  3TSI A;  1NJI Q;  3AE3 C;  1IK7 A;  3KZI E;  4L73 A;  3F5H A;  4M3L A;  1P84 D;  2NPS D;  2HOD B;  1VQ7 P;  5APX A;  3MZW B;  1URQ A;  3CX5 H;  5CCH D;  3H1L J;  1LTB C;  1NWQ A;  3RK2 B;  1JEK A;  1OW6 A;  1ZRT D;  3VMY A;  5GTI E;  3MGN A;  3O6Q A;  1Z56 A;  1Q7Y Q;  1LP1 B;  4N3Y B;  3MP7 B;  3VMA A;  3H32 B;  2E43 A;  1T3J A;  1SQV D;  2XZR A;  1SQQ E;  1LT9 A;  1PIX A;  1J1E B;  1VQP P;  1RF1 A;  3K5B A;  1SQQ G;  5CMZ A;  3OW2 O;  1Q86 Q;  2ZFC A;  2WMM A;  4U3F E;  4LC1 A;  1DX7 A;  3Q3D A;  1SFC A; 
#chains in the Genus database with same CATH homology
 1HUC A;  2VRS A;  2YKO A;  1E5W A;  2OAR A;  1URQ B;  3MIW A;  1L4A A;  1NU1 K;  2C9N Y;  3N7N A;  5CCH C;  1LWU C;  2WZ7 A;  2C0W A;  1WRG A;  1FAV A;  4RES B;  3MTU E;  3BAT A;  2FFD B;  3NXS A;  2FYZ A;  3MUD A;  3O8Z A;  3M0D C;  3BAS A;  1SQX K;  1A02 J;  1JTH B;  1G1J A;  1LTS C;  3TNU B;  1RE4 A;  3HUS A;  4Y99 B;  3B8E B;  4IFM A;  1GTW A;  3HTK A;  2KYV A;  4ZKU A;  1XTG B;  1GL2 A;  4EIJ A;  2HLO A;  1RF0 A;  4LLH A;  2R5B A;  2NPS C;  2A45 G;  1SQV K;  3RL0 D;  1KIL D;  1DH3 A;  2WT7 B;  3TNU A;  3U1C A;  3HUS B;  4I6M C;  5APT A;  1PFI A;  3OA7 A;  3OAK A;  2N1T A;  1N7L A;  1LTG C;  1OWA A;  2WPQ A;  3MD0 A;  1FZA A;  5CCG A;  1RE4 C;  3M9B A;  1FZC B;  4O9B A;  1L4A B;  2XV5 A;  3E1I A;  4AYC A;  4GIF A;  2A45 I;  1SQQ K;  5AVQ B;  1JCC A;  1CW5 A;  5APQ A;  1KIL C;  5AW7 B;  1T2K D;  1M1J C;  1SFC B;  1HH0 A;  5AVV B;  1IFI A;  1MFZ A;  2R3C A;  1IFD A;  2R32 A;  2N9B A;  2Z5I A;  1LT9 B;  2HG5 D;  3B5N B;  2Q7C A;  3HRN A;  2WIT A;  4Y99 C;  1SQB K;  2HOD A;  4C46 A;  1G2C A;  2A45 H;  3L37 A;  5AW1 B;  3L35 A;  5KJ7 A;  1IFM A;  3A7O A;  1CI6 A;  1MZ9 A;  3B5N C;  3M91 A;  1G1I A;  2M3B A;  2IX7 C;  3N4X A;  2YO2 A;  5BU5 A;  3HD7 B;  1IFN A;  1GW4 A;  3T97 A;  1CSB A;  3KYQ A;  2R5D A;  2E42 A;  5AVY B;  1IC2 A;  5AW8 B;  2WTY A;  1AFO A;  2YMY A;  4JYC A;  3CI9 A;  3L36 A;  2BAS A;  4W7Z A;  3R2P A;  1FZC C;  1GL2 B;  3GHG A;  1J2J B;  3U1A A;  2HYN A;  1SLQ A;  1RY3 A;  4C7R A;  3BRV B;  3G3Z A;  1WT6 A;  2P67 A;  5AVS B;  2WPS A;  2OYH B;  3RK2 D;  3TK1 A;  1NHL A;  1S9K D;  2PAJ A;  1FZB A;  1JUN A;  2QM8 A;  1GL2 D;  4WY4 B;  2NPS B;  2W6B A;  1YYC A;  1N7S C;  5CJ0 A;  1KFM A;  3I5C A;  2OYH C;  2IPP A;  3M0A A;  5AVR B;  3V2R A;  2FFD C;  2C0X A;  4DOJ A;  1ZN5 A;  2NPS A;  4WY4 C;  3VTP C;  2GUS A;  1LWU A;  5APV A;  1X8Y A;  1T2K C;  3HD7 D;  1HBW A;  4JYB A;  5AVU B;  2OYI C;  5AW9 B;  5BU8 B;  3KDP B;  3M0D A;  5APU A;  3NFQ A;  4EOT A;  3NMD A;  1LTT C;  1JOC A;  1EQ7 A;  1ZR4 A;  2HFE D;  4XA4 A;  1KZU B;  4I1L A;  5CCG D;  1A02 F;  3LID A;  1YTZ T;  4GKG A;  1H8A A;  1JTH A;  1IK9 A;  4JF7 A;  2N1T D;  2WWW A;  1URQ D;  3C9I A;  2XNX A;  1IO4 A;  2Q9I A;  1CZQ A;  2IFN A;  1KQL A;  2O1K A;  5AVX B;  3UIA A;  1CI6 B;  2MJZ A;  1LGH B;  2Z5H A;  2O01 H;  2M8R A;  2WSF H;  1G2C B;  5KTB A;  2OYI A;  4KHX A;  1XTC C;  1ZR2 A;  3H6P A;  1DEB A;  5APS A;  2Q3I A;  2Z4E A;  1RF1 B;  1NOH A;  1FU1 A;  1KIL B;  3CL3 D;  3V2Q A;  1M7L A;  4IFF A;  1URQ C;  3H32 A;  1S9K E;  4IFD K;  2OYI B;  3EFG A;  2KOG A;  1LT9 C;  3V2N A;  3PP5 A;  1NH4 A;  5AW6 B;  2I1J A;  3IR9 A;  5CJ4 A;  1NTM K;  4LGD E;  3HE5 B;  4XE5 B;  2GUV A;  2GM4 A;  3BVH A;  3RK3 B;  2H7H A;  3LIE A;  1VPC A;  2CPS A;  1L0N K;  1AQ5 A;  1MV8 A;  3GHG C;  2H8P D;  1FOS F;  3RL0 B;  3SWY A;  2L5G B;  1FZG A;  1N73 A;  5KJ7 D;  3VP9 A;  2YKP A;  2YO3 A;  1H89 A;  1GL2 C;  2C9L Y;  3RK3 C;  2J59 M;  5BVZ A;  5AW5 B;  5CCH A;  5AW2 B;  2ZXE B;  3WMM 0;  1VDF A;  1NKN A;  2KP8 A;  1N73 B;  2J58 A;  1FBM A;  4AUW A;  3CLQ A;  4OH8 B;  2HPC B;  3P7K A;  5AW4 B;  1NTK K;  1LWU B;  4N78 D;  3VYI A;  3P32 A;  2WPR A;  2FFD A;  1HTL C;  1LTJ A;  2P1J A;  3HD7 C;  3KQG A;  3LW5 H;  1IFJ A;  1GZL A;  3HE5 A;  4WBA A;  2WSE H;  3V5B A;  3OJA B;  1MUU A;  2XKM A;  1ZLL A;  1HJB A;  1JO5 A;  1SFC D;  2H43 A;  3M9Q A;  3P8C D;  1M1J B;  1SFC C;  1KFN A;  5AVW B;  1JY3 O;  1GK4 A;  1JY2 P;  1L4A D;  1KIL A;  1HWT C;  2OYH A;  1OXZ A;  1JY2 O;  5CHX A;  3VN0 A;  2P2U A;  4GT1 A;  1J1E C;  2YNY A;  1N2D C;  1NKZ B;  1JY2 N;  1SP4 A;  3GHG B;  1GU5 A;  1JNM A;  1M1J A;  2IFM A;  4N6J A;  2WSC H;  1RE3 C;  5KJ7 C;  1FZC A;  1HGZ A;  3NTN A;  3HE4 B;  2PP6 A;  3KPE A;  3RK3 D;  1GK6 A;  1X79 B;  4C7N A;  1L4A C;  1FDM A;  3L4F A;  1LTJ B;  1FZF A;  1JMM A;  2FKW B;  2FYU K;  1LTI C;  3VMZ A;  1FJK A;  1L0L K;  1IJD B;  1FZE A;  1RF0 C;  3HE4 A;  1NO4 A;  4B86 A;  2LKM A;  1QL1 A;  3VMX A;  2CPB A;  1QL2 A;  2POH A;  3A3Y B;  4ZKP A;  4W80 A;  1J1D C;  1ZV8 A;  2N1T C;  3B5N A;  1W2E A;  3HTK B;  3A2A A;  4N78 E;  3RL0 C;  2FXM A;  4WY4 D;  5CCG C;  1NTZ K;  1N73 C;  3II6 A;  4DZO A;  2XDJ A;  1H88 A;  3HUS C;  1HVV A;  1LTA C;  1GDT A;  1N7S A;  1N7S D;  1FJP A;  1GW3 A;  2Q5U A;  2I1K A;  3EQ2 A;  3SWF A;  1JY3 N;  2W6A A;  1N7S B;  1J1D B;  2N1T B;  4WY4 A;  2JJL A;  2JEE A;  2KB7 P;  1HGV A;  2KLV A;  4AQR D;  1JY3 P;  2QM7 A;  3B5N D;  3P8M C;  1GD2 E;  3M9H A;  3VP8 A;  5AW3 B;  2WT7 A;  2HPC A;  5KLV K;  3TYY A;  1X9V A;  1N86 A;  3V4Q A;  1T3U A;  4W7Y A;  1NAF A;  2XU6 A;  4HYT B;  3VOP A;  5AVZ B;  3A5T A;  2W27 A;  1GU4 A;  1RF1 C;  3IFM A;  3M06 A;  5APY A;  5AVT B;  3V4W A;  2O1J A;  3RK2 C;  2YKQ A;  4WB4 A;  3BRT B;  4HH2 A;  1FOS E;  3P8C E;  1JCD A;  2P7J A;  1YTZ I;  3U59 A;  4C7N B;  4I2L C;  3V2P A;  1LTJ C;  2KSJ A;  3HD7 A;  5APW A;  1T8Z A;  1SVF A;  5AW0 B;  1RE3 A;  1SQP K;  3TSI A;  4M3L A;  2NPS D;  2HOD B;  5APX A;  1URQ A;  5CCH D;  1NWQ A;  1LTB C;  3RK2 B;  3VMY A;  3MGN A;  1Z56 A;  4N3Y B;  3H32 B;  2E43 A;  1T3J A;  2XZR A;  1LT9 A;  1J1E B;  1RF1 A;  5CMZ A;  2ZFC A;  4LC1 A;  1DX7 A;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...