2C9NY

Structure of the epstein-barr virus zebra protein at approximately 3. 5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*AP*CP*TP*GP*AP*CP*TP*CP*AP *T)-3'
publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 23
structure length 59
sequence length 59
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9nY00
3OAKA 2H7HA 5AVYB 5AW2B 3A5TA 5APWA 5AW7B 3LIEA 2WWWA 3O8ZA 3IR9A 2WPQA 4M3LA 3TK1A 5AW9B 1GU5A 1OWAA 3NXSA 5AVTB 5AW3B 1DH3A 5AW6B 1FAVA 1GK4A 3HTKA 3V4QA 1JNMA 3HE5B 1HWTC 1HBWA 2IPPA 5APUA 4B86A 2E42A 2ZFCA 5APSA 3TNUB 5AW1B 3VN0A 1OXZA 2YNYA 3SWFA 1JUNA 2XV5A 2XU6A 5AVZB 2BASA 1S9KD 1CI6B 2JJLA 2YO2A 5AVSB 5AVVB 4AQRD 2WT7B 1HUCA 4DZOA 3L37A 4AUWA 3VYIA 3L35A 1NAFA 1H8AA 3A7OA 1MV8A 3VTPC 5AW8B 3NTNA 3HE4A 2Q5UA 3KDPB 2ZXEB 2WPSA 5AVXB 2W27A 3LIDA 1GD2E 5APTA 1A02J 4KHXA 2N9BA 1NWQA 1MUUA 2P2UA 1X8YA 4C7NA 2P7JA 4EOTA 3V4WA 1S9KE 5AW4B 2R5BA 2WTYA 1SP4A 1GZLA 4C46A 2QM8A 1HJBA 5APXA 5AVRB 2VRSA 3KQGA 3NMDA 3VMYA 2R5DA 3NFQA 5AVWB 5AVUB 3M0AA 5CMZA 3M06A 1GK6A 3A2AA 1FOSF 3M0DA 1KQLA 1CSBA 3I5CA 4JYBA 2Q7CA 3V5BA 1IO4A 3L36A 3MD0A 1GU4A 2Z5IA 1YYCA 2WT7A 2XZRA 3P7KA 2R3CA 4HYTB 5AVQB 1A02F 2P67A 4AYCA 4I2LC 3T97A 3VMZA 5APVA 3TYYA 3B8EB 3HE5A 4GT1A 3A3YB 1J2JB 2YO3A 5APYA 1T2KD 3MGNA 2C9NY 3M9HA 3P8MC 2C9LY 5AW0B 5APQA 3HE4B 2QM7A 3M9BA 3UIAA 3TNUA 2WPRA 1T2KC 1G2CB 4LC1A 3P32A 4RESB 4JYCA 1H89A 2Z5HA 1MFZA 4C7NB 5AW5B 4GKGA 1CZQA 2KP8A 3M91A 1CI6A 2R32A 4I6MC 4XE5B 2W6AA 2Q3IA 1SLQA 1FOSE 3VMXA 1H88A 1GTWA 2E43A
chains in the Genus database with same CATH superfamily
1ZRTD 3L70E 3L71J 4HJGH 5TISH 2HLOA 1SQVE 1OWAA 3Q2YA 1SQVD 1GK4A 1K9MQ 2MKVA 2FFDB 1EZVE 2I8DA 5L8RJ 2G3AA 5EFWB 2O01N 3CL3D 2D2CC 1S5LX 2KSEA 1EZVD 3VN0A 2W90A 1URQB 4N3YB 1KILE 2JJLA 1NTKD 4GOEA 4AUWA 1JOCA 2A45H 3L35A 2XNDH 2M8RA 2ZT9D 1YITP 3HE4A 1NKNA 2WPSA 5C39A 1NTZD 2W27A 3SSUA 3C1LA 1SFCB 4RO0A 2P7JA 3CPWO 3HD7B 5AVRB 4D6TD 4ZKPA 1PL5A 3M0AA 4DCKA 3ITKA 2K9YA 1LTAC 1CSBA 2L5GB 3Q5PA 1SQQK 1J1DB 3L73E 2KS1B 1BCCG 4IFDK 4N6JA 1YI2P 3CX5E 1IFDA 1LTJC 3F5HA 2O01J 2E75B 4H13D 1J1EB 3CX5D 2BEZF 3M9QA 2WVRA 3AEDC 2KP8A 1YTZI 1SLQA 2FYNC 5B66H 1GTWA 1BGYG 1PGQA 3O8ZA 1NU1J 1X79B 3L71D 1KB9E 2HG5D 1HBWA 1HWTC 1PFIA 4H0LB 3G6EP 2J5UA 4OVNF 4JF7A 5APSA 3N7NA 3AE7C 5BU8B 1QVGO 3VTPC 5AW8B 1SQVG 3L72J 2B88A 4KHXA 3L74E 1LTBC 1SQQJ 4C7NA 2V7QJ 1EZVG 3L74D 4C7RA 2ZXXA 5CHXA 1K04A 4NPDA 1URQA 2NPSA 4BXLA 1N73B 3CCSP 1KQLA 1NTKG 3B5NB 5GTHE 1NVOA 3MIWA 4I2LC 2YIUB 2N1TC 1T3UA 1NTZG 1LP1B 2HR3A 2V4HA 2C9LY 4N78E 1VQMP 3AE2C 1JTHB 1H89A 1MFTA 2O1KA 2ZYAA 4D6TG 3RK2B 2FBWC 1PP9E 4XA4A 1DEEG 1GW3A 2CK3H 1VQ6P 3H1KD 3GHGC 2IZ0A 3USSA 3II6A 4A7PA 1KYOH 2H7HA 1T8ZA 2IFMA 2H88C 3U1CA 3JCUE 4YXWH 1RF1B 1NU1D 4RKUJ 5AVZB 2GUVA 3CXHI 2E5TA 2WMMA 2YO2A 3BCCJ 1OW6A 2YMKA 1NAFA 1VF5B 1EXJA 1ZLLA 2YKOA 3PH0A 1ZP0C 3LW5H 3L71G 5AVXB 2YXRB 2OYHC 1JCCA 1S2EA 4EOTA 2OYOA 5CBNA 3L75E 2R5BA 3L72D 5GTIE 1SQQD 5AVWB 2PGDA 1M57D 3L75D 2J59M 2FFDC 3L36A 1KTMA 2W6BA 4HH2A 4H44D 3T97A 1M90Q 5KAIE 1W5CE 3CCQP 3HE5A 1ZOYC 4HB1A 1FZFA 3HUSB 3Q5SA 1HJ0A 2ZAEB 1QL1A 5KKZC 1P84I 2PFXA 1VQ5P 1K73Q 3L74G 1NTME 2W6AA 1KILB 1FOSE 2QJKB 3TGUE 1L0NK 1SFCC 1CW5A 4IOIH 2KYVA 2WPVB 4LGDE 3PHLA 3HD7C 4QMAA 3D6ZA 1GDTA 2OTJP 3P8CD 3KPEA 1J1DC 2ZFCA 3BRVB 1VQ7P 1FZCA 2QSIA 4KJMA 3H1KG 1SVFA 3CMEP 4DZOA 2B87B 2E75C 1J1EC 3A7OA 2K37A 1EDKA 3R2PA 5KJ7D 4H13B 1AQ5A 5KAFH 4U3FE 1NWQA 1NU1G 2WZ7A 1RF1A 2BCCE 2O1JA 1QEXA 1KYOE 2R5DA 1T6AA 4TT3H 2OGUA 3U59A 4OGQD 1PIXA 1MZ9A 4H0LC 1KN7A 3SWKA 4IFMA 1EDJA 3IF4A 3H6PA 3V2NA 2FY8A 2KOGA 5KLVK 2A06E 3TNUA 1PPJD 2WSFJ 1T2KC 3P32A 3L72G 1GL2A 2A06D 5KTBA 1AFOA 1SQQG 3L75G 2E43A 1T3JA 4PV1B 5H2FH 1K05A 2Q1KA 2WSCH 4L76A 5CCHC 1NO4A 3TK1A 3D71A 3IFMA 5AW6B 1E5WA 1JNMA 1N73C 3FXEA 3HUSA 1FDIA 3B5NC 1M1KQ 2YIUC 4GODA 4RJTA 4Y99B 1JUNA 1KILA 1DX7A 1L4AB 3PRJA 2DW3A 1HGZA 5M1BA 1FJPA 3RK2C 1QVFO 2OQQA 2B89A 1SQBD 2QVAA 2E74B 3L70J 3IN6A 3CX5H 3V4WA 5AW4B 3TDKA 3KYQA 2AXCA 2QA4P 1H0TB 1HJBA 3MHVA 1BCCE 3CWBJ 5KLVJ 1U7MA 3GW6A 2Z5IA 3E1IA 2BEQD 2XZRA 4UB6E 4W7YA 1PV3A 3B8EB 4W80A 3V2RA 1J2JB 1KB9H 2WPRA 1BGYE 3H1IJ 1VF5C 4I6MC 1LTJA 2OYIB 1Q7YQ 4UB8E 2HPCB 1YTZT 1AVYA 3B4SA 5AW3B 2FXPA 3A0BE 1JY3N 4CPGA 3SFDC 5CJ4A 1BE3J 3G9RA 5E79H 3WMM0 1SQPJ 1PPJG 3H1HJ 5APUA 4B86A 1ZRTE 1L0LJ 1Z56A 3RK3D 2A06G 2K88A 1VQPP 4Y28J 2QIWA 3HUSC 1CI6B 1HUCA 1LWUB 1LNQA 5GTHH 4ZMDA 1NKZB 3TSIA 1KILC 4GDOA 3ZDMA 3E1RA 2QJKC 1QL2A 3M0DC 1NTKE 5APXA 1VQKP 2HODB 3KQGA 3AE5C 3VMYA 1GMJA 5H2FE 5KKZB 5CMZA 2JKVA 1IK9A 1IO4A 3I5CA 1NTZE 3CMAP 3CWBD 1YYCA 5KLVD 2P67A 4AYCA 1DIPA 3H1LJ 4D6TE 1SQBG 4JQ0D 2KZJA 3UIAA 3D6YA 3JCUH 4L75A 2N1TA 2D2CD 4JYCA 1UIIA 3AEAC 3BASA 1JB0J 4HKZH 3CLQA 3H1ID 4H13C 3VMXA 4Z1MH 1H88A 2FYUD 3I56P 3Q3DA 2H89C 3RBXA 4PJ0H 1JEKA 2WSSH 3GHGA 5AVTB 2B9BA 1AQTA 1Q90D 4IFFA 2OTKE 1BE3D 1RF0C 1IZNB 3KHUA 1SQPD 2M5AB 3H1HD 1SQXE 1OIPA 5GTIH 2OYIA 1L0LD 3FGAD 3L71E 3N4XA 1SQXD 2Y9ZA 2JP3A 4IL6E 1H8AA 2P1JA 4XFJA 2IYOA 2Q9IA 2M0BA 5KAIH 1NJIQ 1ZMEC 4JPZB 1K8AQ 1A02J 4PD4D 3C9IA 4PV1C 1NTMK 2OYHA 3R4YA 3OW2O 3MP7B 3V2PA 1VQ4P 1RH5B 1A02F 5E79E 4WVZA 1KZUB 2FFDA 1JM0A 4Y99C 3CD6P 2E5YA 1L4AC 3PP5A 3PJSK 4PD4I 1YBKA 3O6QB 3SFEC 3AE9C 1FE6A 2QG4A 1XTCC 2E74C 1OW7A 2YKQA 3CWBG 2AEFA 5KLVG 5APWA 2JDIH 4I1LA 1SFCA 2WITA 1M56D 1JY2N 1TU3F 3HD7A 3H1KE 1N7LA 3CXHD 2YKPA 1FC2C 2KIKA 3H1IG 1NH4A 2QJYB 2XV5A 2KS1A 4WBAA 1N2DC 2FYUG 4ASVA 3L37A 1NU1E 2K9JB 2GM4A 2N1TD 5DJUB 1VQOP 2FXOA 3TGUJ 1LT9B 2OYIC 4ZKUA 2CPSA 1Y8AA 3A0HE 2KLVA 2YXQB 3RL0B 1GD2E 3AE6C 2N9BA 1BE3G 3H1JJ 3CI9A 1SQPG 3H1HG 5AVUB 1GK6A 1L0LG 1FOSF 4PJ0E 1N7SB 2W83C 2E76D 3KXDA 1SQXG 4WY4B 2R3CA 4HYTB 1GW4A 1P84D 3BATA 3L72E 2YO3A 3AEBC 3HRNA 1SQQE 1AJYA 4BRYB 1ZR4A 5DJTB 1LWUC 1RE3C 2A45I 5CCGC 2P58A 1Q81Q 2IX7C 1IFIA 1KD1Q 1NHLA 2W6JH 3S9OA 1OVRA 2ZVOB 1U7JA 1X0TA 1LT1A 2IZ1A 1G1JA 1R8EA 5CCHA 1EC5A 1IFNA 2ZT9B 1N73A 2H43A 1EDLA 3B5NA 3P8CE 5AVSB 3WUTA 1D7MA 1LP1A 4UB6H 3CCUP 1URQD 3KDPB 2NPSD 2NRGA 1JTHA 3LW5J 1R5LA 1M1JB 1MUUA 4DJGA 5KJ7C 2CPBA 4C46A 3PTZA 3M06A 3H1JD 1SFCD 4UB8H 3E7KA 1RQUA 3BCCD 5APVA 1OVUA 2KNCB 1DEBA 1WMKA 1IFPA 4R4MA 2P10A 2A45G 2WQYC 3A0BH 1JMBA 3K5BA 2ZYGA 2HYNA 1G2CB 1KFMA 3B71A 3M91A 4GIFA 1DD4A 5CJ0A 1SQVK 2KSJA 1OVVA 3JC22 3EQ2A 1W2BO 3Q1MA 5CBOA 2E75D 2I1JA 1PPJE 3LIEA 1L0NJ 1OX3A 1GU5A 1NTKK 2E42A 1KFNA 2IBZD 2YNYA 3SWFA 4KT0J 2FYZA 3FWLA 3CCRP 2Y9YA 1NTZK 1S3JA 2RKLA 1BGYJ 3W67A 2FXMA 5AVVB 4ZNCA 1YIJP 2XKMA 3GF3A 3AEEC 1LTTC 2NZ2A 5APTA 3AE4C 1KYOI 3FWNA 3GLMA 2IBZI 3M0DA 1SQBE 1Q86Q 1JCDA 2AEJA 4I7ZB 3VMAA 3TYYA 3OJAB 2KK7A 2QJYC 1SQVJ 2FKWB 3HE4B 3VOPA 3M9BA 1JY3P 2WSEH 3RGUA 1Y9BA 2C0XA 3B5ND 3BVHA 1AV1A 3OA7A 3ABVC 4XE5B 3IAOA 1LT9C 3H1JG 1VQ9P 2B87A 3RL0C 3BCCG 4IL6H 2HFED 2WSCJ 3IR9A 2KNCA 2Y0CA 1NTZJ 1KORA 1N7SC 1L0ND 3KZIE 4WY4C 1G2CA 4D6TJ 2KLUA 1OZHA 1FBMA 1RHZB 2XU6A 1YQ3C 1S9KD 1RF0A 3MUDC 2WT7B 2XDJA 2C0WA 2KI7B 3L73J 3RK3E 1RY3A 1BDCA 3LIDA 1VQLP 1EQ7A 1VF5D 3CC7P 4H44B 1HF9A 2IBZG 2LXCB 3TF5A 2K3RA 1NYHA 2Q7CA 2Q6QA 4L74A 1GL2D 1S1CX 2Q3EA 3H25A 3SWYA 2ZT9C 3FX0A 1VPCA 3AE8C 3V6IA 4U7JA 5APQA 1S5LH 3CXHH 2MJZA 2O01H 3L70D 1IFMA 3S4RA 2JO1A 4R4LA 3CWBE 2Z5HA 1MFZA 4C7NB 2ZJSE 5KLVE 3AEFC 1L4AA 1Q2NA 1JY3O 1NU1K 1M1JC 2IDBA 3A5TA 2NPSB 1RE4C 4EDFA 1HGVA 4M3LA 1KILD 2R3SA 3H1IE 3A0HH 1H0TA 3MTUE 2FYUE 2IYPA 3L74J 1OXZA 1IFJA 2H8PD 2OTLP 2QJPB 1P84H 1EZVI 2GUSA 1MV8A 2QRXA 4NPEA 2LR2A 3NTNA 1BE3E 4YPCA 2K1AA 3AEGC 1SQPE 2N9YB 3H1HE 1L0NG 3WU2E 3L73D 1L0LE 4OGQB 1X8YA 2V7QH 1GZLA 3NMDA 1VL2A 2HPCA 2I1KA 3H1KJ 4O9BA 4OH8B 1PP9J 1WT6A 2M3EA 2W8ZA 2WT7A 4PD4E 1KC8Q 1QX8A 3VMZA 2KB7P 3EFFK 3AE1C 1MKMA 4GT1A 3A3YB 3MGNA 3P8MC 5AW0B 2QM7A 3CCEP 4K35A 1JY2P 4LC1A 1PGJA 3GG2A 3VP8A 1CI6A 2KXPB 1KB9D 1WRGA 1LWUA 1RE3A 5CCGA 3RL0g 2Y0EA 3CX5I 3H1LE 4DOJA 1R5SA 2WPQA 1FZGA 3H1LD 3T97B 4TLFA 5K5GB 3V4QA 4DT0A 3HE5B 3L70G 4PV1D 2HODA 2IPPA 4I7ZC 3D70A 3L75J 1LGHB 1PGOA 2SPZA 4EIJA 1KB9I 5TISE 3QH9A 1S5LE 3CXHE 5B5EH 2ZXEB 3CCVP 1L4AD 2LXBA 1UIXA 3I55P 1LTSC 1KMIZ 1SP4A 2QM8A 1IJDB 1ZXGA 3NFQA 5KLIB 4N78D 2G8YA 4EYYQ 1KQFB 2E74D 4GOFA 1NTMJ 3RBZA 5KJ7A 1FZCB 4JYBA 3V5BA 1ZR2A 3MD0A 4ASWA 1QGKB 3P7KA 3EFGA 3AECC 1PP9D 4NPFX 4MN4C 2E76C 3VP9A 3HTKB 3G4SP 3L73G 2M5AA 2RH0A 3BRTB 2RMZA 4GKGA 1P84E 1HVVA 2UWJE 1RQVA 1FU1A 1JY2O 5AW2B 2AXTH 3RK3B 2WWWA 4H44C 1Q82Q 2YMYA 2GA1A 1FAVA 1EXIA 1KQSO 1AA0A 1PGPA 4U3FJ 3H32B 3TNUB 1SS1A 2BCCJ 5AW1B 2PP6A 5B66E 1OMIA 3WUVA 1S4XA 1GL2B 2QEXP 1SQBK 3W68A 1IK7A 4AQRD 1AVOA 3VYIA 4WWIA 3H1LG 2R44A 1VQ8P 2LKMA 1N86A 1URQC 1NGMB 1FDMA 3QWOC 2OARA 5CCGD 2NPSC 3O6QA 3C8VA 2VRSA 3G3ZA 2O3JA 3MZWB 1PZQA 1GU4A 2JEEA 2JR8A 1KQGB 1NTMD 2D2CB 1ZN5A 2J58A 3G71P 4YXDC 4L73A 2Z4EA 3GF7A 3TGUD 3M9HA 2QJPC 3FXDA 2WSFH 3H1JE 4EI2A 3KZIH 1YJNP 1ZV8A 3BCCE 1CZQA 4K3AA 2Q3IA 3HD7D 1YHQP 1YQ4C 5B5EE 4OGQC 2K9JA 3OAKA 1N8RQ 5TJHA 1LT9A 1PP9G 5AW7B 5BU5A 3CC4P 1FJKA 1HH0A 1SQBJ 3HTKA 2Y0DA 4OWFA 1X22A 1VQNP 1HTLC 1N7SA 1FZBA 1XTGB 4WY4A 4U3FD 1BSHA 2BCCD 1BCCJ 1LTJB 3CCLP 1IC2A 4LLHA 1KYOD 1L2PA 1FS0E 3MUDA 4BRYA 2IBZE 2FYNB 4WB4A 2KZIA 3CCJP 3EWKA 4W7ZA 2PAJA 2P2UA 1USDA 2QE7H 2WTYA 3H32A 1FZAA 4H0LD 1BDDA 1OW8A 2AXTE 5AVQB 3F89A 4YTPC 5APYA 1T2KD 1LTGC 2FYUK 1DD3A 3U1AA 3Q5RA 1NAYA 4RESB 1YJ9P 3JSVC 5AW5B 4BWNA 1S72P 1W2EA 2JWDA 2AEMA 5CCHD 1LJ2A 2ITAA 1X9VA 2XNXA 1EDIA 5AVYB 1NTMG 3L4FA 1SQPK 5AW9B 3V2QA 3NXSA 1DH3A 5KLIC 2ZYDA 3TGUG 1M1JA 3GMAA 1JO5A 1L0LK 3WUUA 1FZCC 3CC2P 1RE4A 1SQXK 2JWAA 1NOHA 3WU2H 3PLNA 1FZEA 2N1TB 1NTKJ 2POHA 2BASA 3RK2D 1LTIC 1L0NE 2PRRA 1USEA 4PD4H 1BCCD 1RF1C 2Q5UA 1U57A 3CCMP 4IL6X 3GHGB 1Y47A 2E76B 1S9KE 1G1IA 1FDOA 3RK3C 2KUBA 4U3FG 3RL0D 3A2AA 1BSNA 2BCCG 2FYUJ 3AE3C 1BGYD 1E79H 1YJWP 1ZW0A 1JMMA 2RN0A 2M3BA 5BVZA 5KAFE 1GL2C 1QLED 2C9NY 1N7SD 4WY4D 2WSEJ 1M8OB 1M7LA 2ZVNB 2L91A 1OFCX 1VDFA 2R32A 1KV4A 2OYHB 2IFNA 3S1KA 1SQXJ 4JBZA
chains in the Genus database with same CATH topology
1T3JA 2WSCH 5CCHC 4DOJA 1NO4A 2HLOA 2WPQA 3TK1A 1OWAA 1G1JA 1FZGA 3IFMA 5AW6B 1E5WA 1GK4A 3V4QA 1JNMA 2FFDB 1N73C 3HE5B 3HUSA 5CCHA 2HODA 2IPPA 3B5NC 3CL3D 1IFNA 3VN0A 1N73A 1URQB 4Y99B 1JUNA 2H43A 4N3YB 1KILA 1DX7A 1LGHB 3B5NA 1L4AB 2JJLA 4EIJA 3P8CE 1HGZA 5AVSB 4AUWA 1JOCA 1FJPA 2A45H 3L35A 2M8RA 3HE4A 3RK2C 1URQD 1NKNA 3KDPB 2ZXEB 2NPSD 2WPSA 1JTHA 2W27A 1L4AD 1SFCB 1M1JB 1MUUA 2P7JA 3V4WA 5AW4B 5KJ7C 2CPBA 1LTSC 1SP4A 3KYQA 3HD7B 4C46A 2QM8A 1HJBA 5AVRB 4ZKPA 1IJDB 3NFQA 4N78D 3M0AA 3M06A 1LTAC 5KJ7A 1FZCB 1CSBA 1SFCD 2L5GB 4JYBA 3V5BA 1ZR2A 3MD0A 1SQQK 2Z5IA 3E1IA 1J1DB 2XZRA 3P7KA 4W7YA 3EFGA 4IFDK 5APVA 3B8EB 1DEBA 4W80A 3V2RA 3VP9A 1J2JB 3HTKB 4N6JA 2A45G 1IFDA 1LTJC 2HYNA 2WPRA 1G2CB 1J1EB 1KFMA 3M9QA 3BRTB 4GKGA 2KP8A 3M91A 4GIFA 4I6MC 1LTJA 1HVVA 1YTZI 2OYIB 1SLQA 5CJ0A 1SQVK 2KSJA 1GTWA 1FU1A 1JY2O 2HPCB 3EQ2A 5AW2B 1YTZT 2I1JA 3LIEA 3RK3B 2WWWA 3O8ZA 1GU5A 2YMYA 5AW3B 1X79B 1JY3N 1FAVA 5CJ4A 2HG5D 1HBWA 1HWTC 3WMM0 1PFIA 1NTKK 5APUA 4JF7A 4B86A 2E42A 1Z56A 3RK3D 3H32B 5APSA 3TNUB 5AW1B 1KFNA 2PP6A 2YNYA 3SWFA 2FYZA 1GL2B 1NTZK 1SQBK 3HUSC 1CI6B 3N7NA 2FXMA 5AVVB 4AQRD 5BU8B 1HUCA 1LWUB 3VYIA 2XKMA 3VTPC 5AW8B 1NKZB 3TSIA 1KILC 1LTTC 2LKMA 5APTA 1N86A 4KHXA 1LTBC 1URQC 4C7NA 1FDMA 5CCGD 2OARA 1QL2A 2NPSC 3M0DC 5APXA 2HODB 2VRSA 4C7RA 3KQGA 3VMYA 5CHXA 5CMZA 1URQA 1IK9A 3G3ZA 2NPSA 1N73B 3M0DA 1KQLA 1IO4A 3I5CA 1JCDA 2JEEA 1GU4A 1YYCA 3B5NB 2P67A 1ZN5A 2J58A 3MIWA 4AYCA 4I2LC 3TYYA 3OJAB 2Z4EA 2N1TC 1T3UA 3M9HA 2C9LY 2FKWB 4N78E 3HE4B 3VOPA 3M9BA 1JY3P 2WSEH 2WSFH 3UIAA 2C0XA 3B5ND 1JTHB 2N1TA 1ZV8A 4JYCA 3BVHA 1H89A 2O1KA 1CZQA 3BASA 3RK2B 3CLQA 3OA7A 4XA4A 4XE5B 1GW3A 1LT9C 2Q3IA 3VMXA 1H88A 3HD7D 3GHGC 3RL0C 3II6A 3OAKA 2H7HA 1LT9A 5AW7B 5BU5A 1T8ZA 2HFED 1FJKA 3IR9A 3GHGA 5AVTB 1HH0A 2IFMA 3U1CA 3HTKA 1N7SC 1RF1B 4WY4C 4IFFA 1G2CA 1RF0C 1HTLC 1N7SA 1FBMA 1FZBA 1XTGB 4WY4A 2OYIA 2XU6A 5AVZB 1S9KD 2GUVA 1LTJB 3N4XA 1RF0A 2YO2A 2WT7B 2XDJA 2C0WA 1IC2A 4LLHA 1NAFA 1H8AA 1ZLLA 2P1JA 2Q9IA 2YKOA 1RY3A 3MUDA 3LW5H 5AVXB 4WB4A 3LIDA 2OYHC 4W7ZA 1A02J 1JCCA 2PAJA 4EOTA 2P2UA 3C9IA 1EQ7A 1NTMK 2R5BA 2WTYA 3H32A 2OYHA 1FZAA 5AVWB 3V2PA 2J59M 2FFDC 2Q7CA 3L36A 2W6BA 1GL2D 5AVQB 4HH2A 1A02F 3T97A 3SWYA 1KZUB 2FFDA 3HE5A 5APYA 1T2KD 1VPCA 4Y99C 1FZFA 5APQA 3HUSB 1L4AC 1LTGC 2FYUK 2MJZA 2O01H 1IFMA 1QL1A 3PP5A 3U1AA 4RESB 2Z5HA 1MFZA 4C7NB 5AW5B 1L4AA 1W2EA 2W6AA 1KILB 1JY3O 1FOSE 1XTCC 5CCHD 1L0NK 2YKQA 1SFCC 1NU1K 1M1JC 1X9VA 2XNXA 2NPSB 5AVYB 2KYVA 3A5TA 1CW5A 4LGDE 5APWA 1RE4C 3L4FA 1HGVA 3HD7C 4M3LA 1SQPK 1GDTA 5AW9B 3V2QA 1KILD 3NXSA 1DH3A 4I1LA 1SFCA 1M1JA 1JO5A 3P8CD 1L0LK 2WITA 1FZCC 1JY2N 1RE4A 3KPEA 3HD7A 1SQXK 1NOHA 1N7LA 3MTUE 1J1DC 2YKPA 2ZFCA 1FZEA 3BRVB 1OXZA 1IFJA 2N1TB 2H8PD 1FZCA 1NH4A 2XV5A 2POHA 4WBAA 2BASA 1N2DC 1SVFA 3RK2D 1LTIC 4DZOA 3L37A 1J1EC 3A7OA 2GUSA 1MV8A 2GM4A 1RF1C 2N1TD 3NTNA 2Q5UA 3R2PA 1LT9B 2OYIC 5KJ7D 2CPSA 4ZKUA 1AQ5A 2KLVA 3GHGB 3RL0B 1GD2E 2N9BA 1NWQA 1X8YA 2WZ7A 1S9KE 1RF1A 2O1JA 1G1IA 1GZLA 3RK3C 3CI9A 3NMDA 2R5DA 2HPCA 5AVUB 2I1KA 1GK6A 3A2AA 3RL0D 1FOSF 4O9BA 1N7SB 4OH8B 3U59A 1WT6A 1MZ9A 4WY4B 2WT7A 1JMMA 4IFMA 2R3CA 4HYTB 1GW4A 3BATA 3VMZA 2KB7P 3H6PA 2M3BA 3V2NA 4GT1A 3A3YB 5BVZA 2YO3A 3MGNA 1GL2C 3HRNA 2C9NY 2KOGA 1N7SD 3P8MC 5AW0B 5KLVK 2QM7A 4WY4D 3TNUA 1JY2P 1ZR4A 1LWUC 1RE3C 1T2KC 2A45I 3P32A 4LC1A 5CCGC 1M7LA 1GL2A 3VP8A 2IX7C 1IFIA 5KTBA 1NHLA 1AFOA 1VDFA 1CI6A 2R32A 1WRGA 1LWUA 1RE3A 5CCGA 2OYHB 2E43A 2IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAK A;  2H7H A;  5AVY B;  5AW2 B;  3A5T A;  5APW A;  5AW7 B;  3LIE A;  2WWW A;  3O8Z A;  3IR9 A;  2WPQ A;  4M3L A;  3TK1 A;  5AW9 B;  1GU5 A;  1OWA A;  3NXS A;  5AVT B;  5AW3 B;  1DH3 A;  5AW6 B;  1FAV A;  1GK4 A;  3HTK A;  3V4Q A;  1JNM A;  3HE5 B;  1HWT C;  1HBW A;  2IPP A;  5APU A;  4B86 A;  2E42 A;  2ZFC A;  5APS A;  3TNU B;  5AW1 B;  3VN0 A;  1OXZ A;  2YNY A;  3SWF A;  1JUN A;  2XV5 A;  2XU6 A;  5AVZ B;  2BAS A;  1S9K D;  1CI6 B;  2JJL A;  2YO2 A;  5AVS B;  5AVV B;  4AQR D;  2WT7 B;  1HUC A;  4DZO A;  3L37 A;  4AUW A;  3VYI A;  3L35 A;  1NAF A;  1H8A A;  3A7O A;  1MV8 A;  3VTP C;  5AW8 B;  3NTN A;  3HE4 A;  2Q5U A;  3KDP B;  2ZXE B;  2WPS A;  5AVX B;  2W27 A;  3LID A;  1GD2 E;  5APT A;  1A02 J;  4KHX A;  2N9B A;  1NWQ A;  1MUU A;  2P2U A;  1X8Y A;  4C7N A;  2P7J A;  4EOT A;  3V4W A;  1S9K E;  5AW4 B;  2R5B A;  2WTY A;  1SP4 A;  1GZL A;  4C46 A;  2QM8 A;  1HJB A;  5APX A;  5AVR B;  2VRS A;  3KQG A;  3NMD A;  3VMY A;  2R5D A;  3NFQ A;  5AVW B;  5AVU B;  3M0A A;  5CMZ A;  3M06 A;  1GK6 A;  3A2A A;  1FOS F;  3M0D A;  1KQL A;  1CSB A;  3I5C A;  4JYB A;  2Q7C A;  3V5B A;  1IO4 A;  3L36 A;  3MD0 A;  1GU4 A;  2Z5I A;  1YYC A;  2WT7 A;  2XZR A;  3P7K A;  2R3C A;  4HYT B;  5AVQ B;  1A02 F;  2P67 A;  4AYC A;  4I2L C;  3T97 A;  3VMZ A;  5APV A;  3TYY A;  3B8E B;  3HE5 A;  4GT1 A;  3A3Y B;  1J2J B;  2YO3 A;  5APY A;  1T2K D;  3MGN A;  2C9N Y;  3M9H A;  3P8M C;  2C9L Y;  5AW0 B;  5APQ A;  3HE4 B;  2QM7 A;  3M9B A;  3UIA A;  3TNU A;  2WPR A;  1T2K C;  1G2C B;  4LC1 A;  3P32 A;  4RES B;  4JYC A;  1H89 A;  2Z5H A;  1MFZ A;  4C7N B;  5AW5 B;  4GKG A;  1CZQ A;  2KP8 A;  3M91 A;  1CI6 A;  2R32 A;  4I6M C;  4XE5 B;  2W6A A;  2Q3I A;  1SLQ A;  1FOS E;  3VMX A;  1H88 A;  1GTW A;  2E43 A; 
#chains in the Genus database with same CATH topology
 1ZRT D;  3L70 E;  3L71 J;  4HJG H;  5TIS H;  2HLO A;  1SQV E;  1OWA A;  3Q2Y A;  1SQV D;  1GK4 A;  1K9M Q;  2MKV A;  2FFD B;  1EZV E;  2I8D A;  5L8R J;  2G3A A;  5EFW B;  2O01 N;  3CL3 D;  2D2C C;  1S5L X;  2KSE A;  1EZV D;  3VN0 A;  2W90 A;  1URQ B;  4N3Y B;  1KIL E;  2JJL A;  1NTK D;  4GOE A;  4AUW A;  1JOC A;  2A45 H;  3L35 A;  2XND H;  2M8R A;  2ZT9 D;  1YIT P;  3HE4 A;  1NKN A;  2WPS A;  5C39 A;  1NTZ D;  2W27 A;  3SSU A;  3C1L A;  1SFC B;  4RO0 A;  2P7J A;  3CPW O;  3HD7 B;  5AVR B;  4D6T D;  4ZKP A;  1PL5 A;  3M0A A;  4DCK A;  3ITK A;  2K9Y A;  1LTA C;  1CSB A;  2L5G B;  3Q5P A;  1SQQ K;  1J1D B;  3L73 E;  2KS1 B;  1BCC G;  4IFD K;  4N6J A;  1YI2 P;  3CX5 E;  1IFD A;  1LTJ C;  3F5H A;  2O01 J;  2E75 B;  4H13 D;  1J1E B;  3CX5 D;  2BEZ F;  3M9Q A;  2WVR A;  3AED C;  2KP8 A;  1YTZ I;  1SLQ A;  2FYN C;  5B66 H;  1GTW A;  1BGY G;  1PGQ A;  3O8Z A;  1NU1 J;  1X79 B;  3L71 D;  1KB9 E;  2HG5 D;  1HBW A;  1HWT C;  1PFI A;  4H0L B;  3G6E P;  2J5U A;  4OVN F;  4JF7 A;  5APS A;  3N7N A;  3AE7 C;  5BU8 B;  1QVG O;  3VTP C;  5AW8 B;  1SQV G;  3L72 J;  2B88 A;  4KHX A;  3L74 E;  1LTB C;  1SQQ J;  4C7N A;  2V7Q J;  1EZV G;  3L74 D;  4C7R A;  2ZXX A;  5CHX A;  1K04 A;  4NPD A;  1URQ A;  2NPS A;  4BXL A;  1N73 B;  3CCS P;  1KQL A;  1NTK G;  3B5N B;  5GTH E;  1NVO A;  3MIW A;  4I2L C;  2YIU B;  2N1T C;  1T3U A;  1NTZ G;  1LP1 B;  2HR3 A;  2V4H A;  2C9L Y;  4N78 E;  1VQM P;  3AE2 C;  1JTH B;  1H89 A;  1MFT A;  2O1K A;  2ZYA A;  4D6T G;  3RK2 B;  2FBW C;  1PP9 E;  4XA4 A;  1DEE G;  1GW3 A;  2CK3 H;  1VQ6 P;  3H1K D;  3GHG C;  2IZ0 A;  3USS A;  3II6 A;  4A7P A;  1KYO H;  2H7H A;  1T8Z A;  2IFM A;  2H88 C;  3U1C A;  3JCU E;  4YXW H;  1RF1 B;  1NU1 D;  4RKU J;  5AVZ B;  2GUV A;  3CXH I;  2E5T A;  2WMM A;  2YO2 A;  3BCC J;  1OW6 A;  2YMK A;  1NAF A;  1VF5 B;  1EXJ A;  1ZLL A;  2YKO A;  3PH0 A;  1ZP0 C;  3LW5 H;  3L71 G;  5AVX B;  2YXR B;  2OYH C;  1JCC A;  1S2E A;  4EOT A;  2OYO A;  5CBN A;  3L75 E;  2R5B A;  3L72 D;  5GTI E;  1SQQ D;  5AVW B;  2PGD A;  1M57 D;  3L75 D;  2J59 M;  2FFD C;  3L36 A;  1KTM A;  2W6B A;  4HH2 A;  4H44 D;  3T97 A;  1M90 Q;  5KAI E;  1W5C E;  3CCQ P;  3HE5 A;  1ZOY C;  4HB1 A;  1FZF A;  3HUS B;  3Q5S A;  1HJ0 A;  2ZAE B;  1QL1 A;  5KKZ C;  1P84 I;  2PFX A;  1VQ5 P;  1K73 Q;  3L74 G;  1NTM E;  2W6A A;  1KIL B;  1FOS E;  2QJK B;  3TGU E;  1L0N K;  1SFC C;  1CW5 A;  4IOI H;  2KYV A;  2WPV B;  4LGD E;  3PHL A;  3HD7 C;  4QMA A;  3D6Z A;  1GDT A;  2OTJ P;  3P8C D;  3KPE A;  1J1D C;  2ZFC A;  3BRV B;  1VQ7 P;  1FZC A;  2QSI A;  4KJM A;  3H1K G;  1SVF A;  3CME P;  4DZO A;  2B87 B;  2E75 C;  1J1E C;  3A7O A;  2K37 A;  1EDK A;  3R2P A;  5KJ7 D;  4H13 B;  1AQ5 A;  5KAF H;  4U3F E;  1NWQ A;  1NU1 G;  2WZ7 A;  1RF1 A;  2BCC E;  2O1J A;  1QEX A;  1KYO E;  2R5D A;  1T6A A;  4TT3 H;  2OGU A;  3U59 A;  4OGQ D;  1PIX A;  1MZ9 A;  4H0L C;  1KN7 A;  3SWK A;  4IFM A;  1EDJ A;  3IF4 A;  3H6P A;  3V2N A;  2FY8 A;  2KOG A;  5KLV K;  2A06 E;  3TNU A;  1PPJ D;  2WSF J;  1T2K C;  3P32 A;  3L72 G;  1GL2 A;  2A06 D;  5KTB A;  1AFO A;  1SQQ G;  3L75 G;  2E43 A;  1T3J A;  4PV1 B;  5H2F H;  1K05 A;  2Q1K A;  2WSC H;  4L76 A;  5CCH C;  1NO4 A;  3TK1 A;  3D71 A;  3IFM A;  5AW6 B;  1E5W A;  1JNM A;  1N73 C;  3FXE A;  3HUS A;  1FDI A;  3B5N C;  1M1K Q;  2YIU C;  4GOD A;  4RJT A;  4Y99 B;  1JUN A;  1KIL A;  1DX7 A;  1L4A B;  3PRJ A;  2DW3 A;  1HGZ A;  5M1B A;  1FJP A;  3RK2 C;  1QVF O;  2OQQ A;  2B89 A;  1SQB D;  2QVA A;  2E74 B;  3L70 J;  3IN6 A;  3CX5 H;  3V4W A;  5AW4 B;  3TDK A;  3KYQ A;  2AXC A;  2QA4 P;  1H0T B;  1HJB A;  3MHV A;  1BCC E;  3CWB J;  5KLV J;  1U7M A;  3GW6 A;  2Z5I A;  3E1I A;  2BEQ D;  2XZR A;  4UB6 E;  4W7Y A;  1PV3 A;  3B8E B;  4W80 A;  3V2R A;  1J2J B;  1KB9 H;  2WPR A;  1BGY E;  3H1I J;  1VF5 C;  4I6M C;  1LTJ A;  2OYI B;  1Q7Y Q;  4UB8 E;  2HPC B;  1YTZ T;  1AVY A;  3B4S A;  5AW3 B;  2FXP A;  3A0B E;  1JY3 N;  4CPG A;  3SFD C;  5CJ4 A;  1BE3 J;  3G9R A;  5E79 H;  3WMM 0;  1SQP J;  1PPJ G;  3H1H J;  5APU A;  4B86 A;  1ZRT E;  1L0L J;  1Z56 A;  3RK3 D;  2A06 G;  2K88 A;  1VQP P;  4Y28 J;  2QIW A;  3HUS C;  1CI6 B;  1HUC A;  1LWU B;  1LNQ A;  5GTH H;  4ZMD A;  1NKZ B;  3TSI A;  1KIL C;  4GDO A;  3ZDM A;  3E1R A;  2QJK C;  1QL2 A;  3M0D C;  1NTK E;  5APX A;  1VQK P;  2HOD B;  3KQG A;  3AE5 C;  3VMY A;  1GMJ A;  5H2F E;  5KKZ B;  5CMZ A;  2JKV A;  1IK9 A;  1IO4 A;  3I5C A;  1NTZ E;  3CMA P;  3CWB D;  1YYC A;  5KLV D;  2P67 A;  4AYC A;  1DIP A;  3H1L J;  4D6T E;  1SQB G;  4JQ0 D;  2KZJ A;  3UIA A;  3D6Y A;  3JCU H;  4L75 A;  2N1T A;  2D2C D;  4JYC A;  1UII A;  3AEA C;  3BAS A;  1JB0 J;  4HKZ H;  3CLQ A;  3H1I D;  4H13 C;  3VMX A;  4Z1M H;  1H88 A;  2FYU D;  3I56 P;  3Q3D A;  2H89 C;  3RBX A;  4PJ0 H;  1JEK A;  2WSS H;  3GHG A;  5AVT B;  2B9B A;  1AQT A;  1Q90 D;  4IFF A;  2OTK E;  1BE3 D;  1RF0 C;  1IZN B;  3KHU A;  1SQP D;  2M5A B;  3H1H D;  1SQX E;  1OIP A;  5GTI H;  2OYI A;  1L0L D;  3FGA D;  3L71 E;  3N4X A;  1SQX D;  2Y9Z A;  2JP3 A;  4IL6 E;  1H8A A;  2P1J A;  4XFJ A;  2IYO A;  2Q9I A;  2M0B A;  5KAI H;  1NJI Q;  1ZME C;  4JPZ B;  1K8A Q;  1A02 J;  4PD4 D;  3C9I A;  4PV1 C;  1NTM K;  2OYH A;  3R4Y A;  3OW2 O;  3MP7 B;  3V2P A;  1VQ4 P;  1RH5 B;  1A02 F;  5E79 E;  4WVZ A;  1KZU B;  2FFD A;  1JM0 A;  4Y99 C;  3CD6 P;  2E5Y A;  1L4A C;  3PP5 A;  3PJS K;  4PD4 I;  1YBK A;  3O6Q B;  3SFE C;  3AE9 C;  1FE6 A;  2QG4 A;  1XTC C;  2E74 C;  1OW7 A;  2YKQ A;  3CWB G;  2AEF A;  5KLV G;  5APW A;  2JDI H;  4I1L A;  1SFC A;  2WIT A;  1M56 D;  1JY2 N;  1TU3 F;  3HD7 A;  3H1K E;  1N7L A;  3CXH D;  2YKP A;  1FC2 C;  2KIK A;  3H1I G;  1NH4 A;  2QJY B;  2XV5 A;  2KS1 A;  4WBA A;  1N2D C;  2FYU G;  4ASV A;  3L37 A;  1NU1 E;  2K9J B;  2GM4 A;  2N1T D;  5DJU B;  1VQO P;  2FXO A;  3TGU J;  1LT9 B;  2OYI C;  4ZKU A;  2CPS A;  1Y8A A;  3A0H E;  2KLV A;  2YXQ B;  3RL0 B;  1GD2 E;  3AE6 C;  2N9B A;  1BE3 G;  3H1J J;  3CI9 A;  1SQP G;  3H1H G;  5AVU B;  1GK6 A;  1L0L G;  1FOS F;  4PJ0 E;  1N7S B;  2W83 C;  2E76 D;  3KXD A;  1SQX G;  4WY4 B;  2R3C A;  4HYT B;  1GW4 A;  1P84 D;  3BAT A;  3L72 E;  2YO3 A;  3AEB C;  3HRN A;  1SQQ E;  1AJY A;  4BRY B;  1ZR4 A;  5DJT B;  1LWU C;  1RE3 C;  2A45 I;  5CCG C;  2P58 A;  1Q81 Q;  2IX7 C;  1IFI A;  1KD1 Q;  1NHL A;  2W6J H;  3S9O A;  1OVR A;  2ZVO B;  1U7J A;  1X0T A;  1LT1 A;  2IZ1 A;  1G1J A;  1R8E A;  5CCH A;  1EC5 A;  1IFN A;  2ZT9 B;  1N73 A;  2H43 A;  1EDL A;  3B5N A;  3P8C E;  5AVS B;  3WUT A;  1D7M A;  1LP1 A;  4UB6 H;  3CCU P;  1URQ D;  3KDP B;  2NPS D;  2NRG A;  1JTH A;  3LW5 J;  1R5L A;  1M1J B;  1MUU A;  4DJG A;  5KJ7 C;  2CPB A;  4C46 A;  3PTZ A;  3M06 A;  3H1J D;  1SFC D;  4UB8 H;  3E7K A;  1RQU A;  3BCC D;  5APV A;  1OVU A;  2KNC B;  1DEB A;  1WMK A;  1IFP A;  4R4M A;  2P10 A;  2A45 G;  2WQY C;  3A0B H;  1JMB A;  3K5B A;  2ZYG A;  2HYN A;  1G2C B;  1KFM A;  3B71 A;  3M91 A;  4GIF A;  1DD4 A;  5CJ0 A;  1SQV K;  2KSJ A;  1OVV A;  3JC2 2;  3EQ2 A;  1W2B O;  3Q1M A;  5CBO A;  2E75 D;  2I1J A;  1PPJ E;  3LIE A;  1L0N J;  1OX3 A;  1GU5 A;  1NTK K;  2E42 A;  1KFN A;  2IBZ D;  2YNY A;  3SWF A;  4KT0 J;  2FYZ A;  3FWL A;  3CCR P;  2Y9Y A;  1NTZ K;  1S3J A;  2RKL A;  1BGY J;  3W67 A;  2FXM A;  5AVV B;  4ZNC A;  1YIJ P;  2XKM A;  3GF3 A;  3AEE C;  1LTT C;  2NZ2 A;  5APT A;  3AE4 C;  1KYO I;  3FWN A;  3GLM A;  2IBZ I;  3M0D A;  1SQB E;  1Q86 Q;  1JCD A;  2AEJ A;  4I7Z B;  3VMA A;  3TYY A;  3OJA B;  2KK7 A;  2QJY C;  1SQV J;  2FKW B;  3HE4 B;  3VOP A;  3M9B A;  1JY3 P;  2WSE H;  3RGU A;  1Y9B A;  2C0X A;  3B5N D;  3BVH A;  1AV1 A;  3OA7 A;  3ABV C;  4XE5 B;  3IAO A;  1LT9 C;  3H1J G;  1VQ9 P;  2B87 A;  3RL0 C;  3BCC G;  4IL6 H;  2HFE D;  2WSC J;  3IR9 A;  2KNC A;  2Y0C A;  1NTZ J;  1KOR A;  1N7S C;  1L0N D;  3KZI E;  4WY4 C;  1G2C A;  4D6T J;  2KLU A;  1OZH A;  1FBM A;  1RHZ B;  2XU6 A;  1YQ3 C;  1S9K D;  1RF0 A;  3MUD C;  2WT7 B;  2XDJ A;  2C0W A;  2KI7 B;  3L73 J;  3RK3 E;  1RY3 A;  1BDC A;  3LID A;  1VQL P;  1EQ7 A;  1VF5 D;  3CC7 P;  4H44 B;  1HF9 A;  2IBZ G;  2LXC B;  3TF5 A;  2K3R A;  1NYH A;  2Q7C A;  2Q6Q A;  4L74 A;  1GL2 D;  1S1C X;  2Q3E A;  3H25 A;  3SWY A;  2ZT9 C;  3FX0 A;  1VPC A;  3AE8 C;  3V6I A;  4U7J A;  5APQ A;  1S5L H;  3CXH H;  2MJZ A;  2O01 H;  3L70 D;  1IFM A;  3S4R A;  2JO1 A;  4R4L A;  3CWB E;  2Z5H A;  1MFZ A;  4C7N B;  2ZJS E;  5KLV E;  3AEF C;  1L4A A;  1Q2N A;  1JY3 O;  1NU1 K;  1M1J C;  2IDB A;  3A5T A;  2NPS B;  1RE4 C;  4EDF A;  1HGV A;  4M3L A;  1KIL D;  2R3S A;  3H1I E;  3A0H H;  1H0T A;  3MTU E;  2FYU E;  2IYP A;  3L74 J;  1OXZ A;  1IFJ A;  2H8P D;  2OTL P;  2QJP B;  1P84 H;  1EZV I;  2GUS A;  1MV8 A;  2QRX A;  4NPE A;  2LR2 A;  3NTN A;  1BE3 E;  4YPC A;  2K1A A;  3AEG C;  1SQP E;  2N9Y B;  3H1H E;  1L0N G;  3WU2 E;  3L73 D;  1L0L E;  4OGQ B;  1X8Y A;  2V7Q H;  1GZL A;  3NMD A;  1VL2 A;  2HPC A;  2I1K A;  3H1K J;  4O9B A;  4OH8 B;  1PP9 J;  1WT6 A;  2M3E A;  2W8Z A;  2WT7 A;  4PD4 E;  1KC8 Q;  1QX8 A;  3VMZ A;  2KB7 P;  3EFF K;  3AE1 C;  1MKM A;  4GT1 A;  3A3Y B;  3MGN A;  3P8M C;  5AW0 B;  2QM7 A;  3CCE P;  4K35 A;  1JY2 P;  4LC1 A;  1PGJ A;  3GG2 A;  3VP8 A;  1CI6 A;  2KXP B;  1KB9 D;  1WRG A;  1LWU A;  1RE3 A;  5CCG A;  3RL0 g;  2Y0E A;  3CX5 I;  3H1L E;  4DOJ A;  1R5S A;  2WPQ A;  1FZG A;  3H1L D;  3T97 B;  4TLF A;  5K5G B;  3V4Q A;  4DT0 A;  3HE5 B;  3L70 G;  4PV1 D;  2HOD A;  2IPP A;  4I7Z C;  3D70 A;  3L75 J;  1LGH B;  1PGO A;  2SPZ A;  4EIJ A;  1KB9 I;  5TIS E;  3QH9 A;  1S5L E;  3CXH E;  5B5E H;  2ZXE B;  3CCV P;  1L4A D;  2LXB A;  1UIX A;  3I55 P;  1LTS C;  1KMI Z;  1SP4 A;  2QM8 A;  1IJD B;  1ZXG A;  3NFQ A;  5KLI B;  4N78 D;  2G8Y A;  4EYY Q;  1KQF B;  2E74 D;  4GOF A;  1NTM J;  3RBZ A;  5KJ7 A;  1FZC B;  4JYB A;  3V5B A;  1ZR2 A;  3MD0 A;  4ASW A;  1QGK B;  3P7K A;  3EFG A;  3AEC C;  1PP9 D;  4NPF X;  4MN4 C;  2E76 C;  3VP9 A;  3HTK B;  3G4S P;  3L73 G;  2M5A A;  2RH0 A;  3BRT B;  2RMZ A;  4GKG A;  1P84 E;  1HVV A;  2UWJ E;  1RQV A;  1FU1 A;  1JY2 O;  5AW2 B;  2AXT H;  3RK3 B;  2WWW A;  4H44 C;  1Q82 Q;  2YMY A;  2GA1 A;  1FAV A;  1EXI A;  1KQS O;  1AA0 A;  1PGP A;  4U3F J;  3H32 B;  3TNU B;  1SS1 A;  2BCC J;  5AW1 B;  2PP6 A;  5B66 E;  1OMI A;  3WUV A;  1S4X A;  1GL2 B;  2QEX P;  1SQB K;  3W68 A;  1IK7 A;  4AQR D;  1AVO A;  3VYI A;  4WWI A;  3H1L G;  2R44 A;  1VQ8 P;  2LKM A;  1N86 A;  1URQ C;  1NGM B;  1FDM A;  3QWO C;  2OAR A;  5CCG D;  2NPS C;  3O6Q A;  3C8V A;  2VRS A;  3G3Z A;  2O3J A;  3MZW B;  1PZQ A;  1GU4 A;  2JEE A;  2JR8 A;  1KQG B;  1NTM D;  2D2C B;  1ZN5 A;  2J58 A;  3G71 P;  4YXD C;  4L73 A;  2Z4E A;  3GF7 A;  3TGU D;  3M9H A;  2QJP C;  3FXD A;  2WSF H;  3H1J E;  4EI2 A;  3KZI H;  1YJN P;  1ZV8 A;  3BCC E;  1CZQ A;  4K3A A;  2Q3I A;  3HD7 D;  1YHQ P;  1YQ4 C;  5B5E E;  4OGQ C;  2K9J A;  3OAK A;  1N8R Q;  5TJH A;  1LT9 A;  1PP9 G;  5AW7 B;  5BU5 A;  3CC4 P;  1FJK A;  1HH0 A;  1SQB J;  3HTK A;  2Y0D A;  4OWF A;  1X22 A;  1VQN P;  1HTL C;  1N7S A;  1FZB A;  1XTG B;  4WY4 A;  4U3F D;  1BSH A;  2BCC D;  1BCC J;  1LTJ B;  3CCL P;  1IC2 A;  4LLH A;  1KYO D;  1L2P A;  1FS0 E;  3MUD A;  4BRY A;  2IBZ E;  2FYN B;  4WB4 A;  2KZI A;  3CCJ P;  3EWK A;  4W7Z A;  2PAJ A;  2P2U A;  1USD A;  2QE7 H;  2WTY A;  3H32 A;  1FZA A;  4H0L D;  1BDD A;  1OW8 A;  2AXT E;  5AVQ B;  3F89 A;  4YTP C;  5APY A;  1T2K D;  1LTG C;  2FYU K;  1DD3 A;  3U1A A;  3Q5R A;  1NAY A;  4RES B;  1YJ9 P;  3JSV C;  5AW5 B;  4BWN A;  1S72 P;  1W2E A;  2JWD A;  2AEM A;  5CCH D;  1LJ2 A;  2ITA A;  1X9V A;  2XNX A;  1EDI A;  5AVY B;  1NTM G;  3L4F A;  1SQP K;  5AW9 B;  3V2Q A;  3NXS A;  1DH3 A;  5KLI C;  2ZYD A;  3TGU G;  1M1J A;  3GMA A;  1JO5 A;  1L0L K;  3WUU A;  1FZC C;  3CC2 P;  1RE4 A;  1SQX K;  2JWA A;  1NOH A;  3WU2 H;  3PLN A;  1FZE A;  2N1T B;  1NTK J;  2POH A;  2BAS A;  3RK2 D;  1LTI C;  1L0N E;  2PRR A;  1USE A;  4PD4 H;  1BCC D;  1RF1 C;  2Q5U A;  1U57 A;  3CCM P;  4IL6 X;  3GHG B;  1Y47 A;  2E76 B;  1S9K E;  1G1I A;  1FDO A;  3RK3 C;  2KUB A;  4U3F G;  3RL0 D;  3A2A A;  1BSN A;  2BCC G;  2FYU J;  3AE3 C;  1BGY D;  1E79 H;  1YJW P;  1ZW0 A;  1JMM A;  2RN0 A;  2M3B A;  5BVZ A;  5KAF E;  1GL2 C;  1QLE D;  2C9N Y;  1N7S D;  4WY4 D;  2WSE J;  1M8O B;  1M7L A;  2ZVN B;  2L91 A;  1OFC X;  1VDF A;  2R32 A;  1KV4 A;  2OYH B;  2IFN A;  3S1K A;  1SQX J;  4JBZ A; 
#chains in the Genus database with same CATH homology
 1T3J A;  2WSC H;  5CCH C;  4DOJ A;  1NO4 A;  2HLO A;  2WPQ A;  3TK1 A;  1OWA A;  1G1J A;  1FZG A;  3IFM A;  5AW6 B;  1E5W A;  1GK4 A;  3V4Q A;  1JNM A;  2FFD B;  1N73 C;  3HE5 B;  3HUS A;  5CCH A;  2HOD A;  2IPP A;  3B5N C;  3CL3 D;  1IFN A;  3VN0 A;  1N73 A;  1URQ B;  4Y99 B;  1JUN A;  2H43 A;  4N3Y B;  1KIL A;  1DX7 A;  1LGH B;  3B5N A;  1L4A B;  2JJL A;  4EIJ A;  3P8C E;  1HGZ A;  5AVS B;  4AUW A;  1JOC A;  1FJP A;  2A45 H;  3L35 A;  2M8R A;  3HE4 A;  3RK2 C;  1URQ D;  1NKN A;  3KDP B;  2ZXE B;  2NPS D;  2WPS A;  1JTH A;  2W27 A;  1L4A D;  1SFC B;  1M1J B;  1MUU A;  2P7J A;  3V4W A;  5AW4 B;  5KJ7 C;  2CPB A;  1LTS C;  1SP4 A;  3KYQ A;  3HD7 B;  4C46 A;  2QM8 A;  1HJB A;  5AVR B;  4ZKP A;  1IJD B;  3NFQ A;  4N78 D;  3M0A A;  3M06 A;  1LTA C;  5KJ7 A;  1FZC B;  1CSB A;  1SFC D;  2L5G B;  4JYB A;  3V5B A;  1ZR2 A;  3MD0 A;  1SQQ K;  2Z5I A;  3E1I A;  1J1D B;  2XZR A;  3P7K A;  4W7Y A;  3EFG A;  4IFD K;  5APV A;  3B8E B;  1DEB A;  4W80 A;  3V2R A;  3VP9 A;  1J2J B;  3HTK B;  4N6J A;  2A45 G;  1IFD A;  1LTJ C;  2HYN A;  2WPR A;  1G2C B;  1J1E B;  1KFM A;  3M9Q A;  3BRT B;  4GKG A;  2KP8 A;  3M91 A;  4GIF A;  4I6M C;  1LTJ A;  1HVV A;  1YTZ I;  2OYI B;  1SLQ A;  5CJ0 A;  1SQV K;  2KSJ A;  1GTW A;  1FU1 A;  1JY2 O;  2HPC B;  3EQ2 A;  5AW2 B;  1YTZ T;  2I1J A;  3LIE A;  3RK3 B;  2WWW A;  3O8Z A;  1GU5 A;  2YMY A;  5AW3 B;  1X79 B;  1JY3 N;  1FAV A;  5CJ4 A;  2HG5 D;  1HBW A;  1HWT C;  3WMM 0;  1PFI A;  1NTK K;  5APU A;  4JF7 A;  4B86 A;  2E42 A;  1Z56 A;  3RK3 D;  3H32 B;  5APS A;  3TNU B;  5AW1 B;  1KFN A;  2PP6 A;  2YNY A;  3SWF A;  2FYZ A;  1GL2 B;  1NTZ K;  1SQB K;  3HUS C;  1CI6 B;  3N7N A;  2FXM A;  5AVV B;  4AQR D;  5BU8 B;  1HUC A;  1LWU B;  3VYI A;  2XKM A;  3VTP C;  5AW8 B;  1NKZ B;  3TSI A;  1KIL C;  1LTT C;  2LKM A;  5APT A;  1N86 A;  4KHX A;  1LTB C;  1URQ C;  4C7N A;  1FDM A;  5CCG D;  2OAR A;  1QL2 A;  2NPS C;  3M0D C;  5APX A;  2HOD B;  2VRS A;  4C7R A;  3KQG A;  3VMY A;  5CHX A;  5CMZ A;  1URQ A;  1IK9 A;  3G3Z A;  2NPS A;  1N73 B;  3M0D A;  1KQL A;  1IO4 A;  3I5C A;  1JCD A;  2JEE A;  1GU4 A;  1YYC A;  3B5N B;  2P67 A;  1ZN5 A;  2J58 A;  3MIW A;  4AYC A;  4I2L C;  3TYY A;  3OJA B;  2Z4E A;  2N1T C;  1T3U A;  3M9H A;  2C9L Y;  2FKW B;  4N78 E;  3HE4 B;  3VOP A;  3M9B A;  1JY3 P;  2WSE H;  2WSF H;  3UIA A;  2C0X A;  3B5N D;  1JTH B;  2N1T A;  1ZV8 A;  4JYC A;  3BVH A;  1H89 A;  2O1K A;  1CZQ A;  3BAS A;  3RK2 B;  3CLQ A;  3OA7 A;  4XA4 A;  4XE5 B;  1GW3 A;  1LT9 C;  2Q3I A;  3VMX A;  1H88 A;  3HD7 D;  3GHG C;  3RL0 C;  3II6 A;  3OAK A;  2H7H A;  1LT9 A;  5AW7 B;  5BU5 A;  1T8Z A;  2HFE D;  1FJK A;  3IR9 A;  3GHG A;  5AVT B;  1HH0 A;  2IFM A;  3U1C A;  3HTK A;  1N7S C;  1RF1 B;  4WY4 C;  4IFF A;  1G2C A;  1RF0 C;  1HTL C;  1N7S A;  1FBM A;  1FZB A;  1XTG B;  4WY4 A;  2OYI A;  2XU6 A;  5AVZ B;  1S9K D;  2GUV A;  1LTJ B;  3N4X A;  1RF0 A;  2YO2 A;  2WT7 B;  2XDJ A;  2C0W A;  1IC2 A;  4LLH A;  1NAF A;  1H8A A;  1ZLL A;  2P1J A;  2Q9I A;  2YKO A;  1RY3 A;  3MUD A;  3LW5 H;  5AVX B;  4WB4 A;  3LID A;  2OYH C;  4W7Z A;  1A02 J;  1JCC A;  2PAJ A;  4EOT A;  2P2U A;  3C9I A;  1EQ7 A;  1NTM K;  2R5B A;  2WTY A;  3H32 A;  2OYH A;  1FZA A;  5AVW B;  3V2P A;  2J59 M;  2FFD C;  2Q7C A;  3L36 A;  2W6B A;  1GL2 D;  5AVQ B;  4HH2 A;  1A02 F;  3T97 A;  3SWY A;  1KZU B;  2FFD A;  3HE5 A;  5APY A;  1T2K D;  1VPC A;  4Y99 C;  1FZF A;  5APQ A;  3HUS B;  1L4A C;  1LTG C;  2FYU K;  2MJZ A;  2O01 H;  1IFM A;  1QL1 A;  3PP5 A;  3U1A A;  4RES B;  2Z5H A;  1MFZ A;  4C7N B;  5AW5 B;  1L4A A;  1W2E A;  2W6A A;  1KIL B;  1JY3 O;  1FOS E;  1XTC C;  5CCH D;  1L0N K;  2YKQ A;  1SFC C;  1NU1 K;  1M1J C;  1X9V A;  2XNX A;  2NPS B;  5AVY B;  2KYV A;  3A5T A;  1CW5 A;  4LGD E;  5APW A;  1RE4 C;  3L4F A;  1HGV A;  3HD7 C;  4M3L A;  1SQP K;  1GDT A;  5AW9 B;  3V2Q A;  1KIL D;  3NXS A;  1DH3 A;  4I1L A;  1SFC A;  1M1J A;  1JO5 A;  3P8C D;  1L0L K;  2WIT A;  1FZC C;  1JY2 N;  1RE4 A;  3KPE A;  3HD7 A;  1SQX K;  1NOH A;  1N7L A;  3MTU E;  1J1D C;  2YKP A;  2ZFC A;  1FZE A;  3BRV B;  1OXZ A;  1IFJ A;  2N1T B;  2H8P D;  1FZC A;  1NH4 A;  2XV5 A;  2POH A;  4WBA A;  2BAS A;  1N2D C;  1SVF A;  3RK2 D;  1LTI C;  4DZO A;  3L37 A;  1J1E C;  3A7O A;  2GUS A;  1MV8 A;  2GM4 A;  1RF1 C;  2N1T D;  3NTN A;  2Q5U A;  3R2P A;  1LT9 B;  2OYI C;  5KJ7 D;  2CPS A;  4ZKU A;  1AQ5 A;  2KLV A;  3GHG B;  3RL0 B;  1GD2 E;  2N9B A;  1NWQ A;  1X8Y A;  2WZ7 A;  1S9K E;  1RF1 A;  2O1J A;  1G1I A;  1GZL A;  3RK3 C;  3CI9 A;  3NMD A;  2R5D A;  2HPC A;  5AVU B;  2I1K A;  1GK6 A;  3A2A A;  3RL0 D;  1FOS F;  4O9B A;  1N7S B;  4OH8 B;  3U59 A;  1WT6 A;  1MZ9 A;  4WY4 B;  2WT7 A;  1JMM A;  4IFM A;  2R3C A;  4HYT B;  1GW4 A;  3BAT A;  3VMZ A;  2KB7 P;  3H6P A;  2M3B A;  3V2N A;  4GT1 A;  3A3Y B;  5BVZ A;  2YO3 A;  3MGN A;  1GL2 C;  3HRN A;  2C9N Y;  2KOG A;  1N7S D;  3P8M C;  5AW0 B;  5KLV K;  2QM7 A;  4WY4 D;  3TNU A;  1JY2 P;  1ZR4 A;  1LWU C;  1RE3 C;  1T2K C;  2A45 I;  3P32 A;  4LC1 A;  5CCG C;  1M7L A;  1GL2 A;  3VP8 A;  2IX7 C;  1IFI A;  5KTB A;  1NHL A;  1AFO A;  1VDF A;  1CI6 A;  2R32 A;  1WRG A;  1LWU A;  1RE3 A;  5CCG A;  2OYH B;  2E43 A;  2IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...