2C9PA

Cu(i)cu(ii)-copc at ph 4.5
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Electron transport
total genus 19
structure length 102
sequence length 102
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9pA00
2WQUA 1LYQA 1O6VA 1M9SA 2C9RA 2RA1A 2OMXA 4CILA 1M42A 2OMUA 2OMYA 5ICUA 2WQWA 3BZ5A 3BC9A 4AW4A 1IX2A 1NM4A 2UZXA 3FAXA 2C9PA 4CC4C 2UZYA 2Y5QA 1H6UA 3BCDA 1O6SA 2WQXA 2WQVA 4CC4A 2OMVA 2C9QA 1OT4A 3FAWA 2OMTA 2OMWA 1H6TA 1O6TA 2YA1A 3BCFA 2OMZA 4AQ1A 1XEUA
chains in the Genus database with same CATH superfamily
5GS3A 4XR8C 1EZSA 1JPEA 4UDUB 4Y9EA 3SBRA 2XKNB 3MJ9A 5C0AE 4DQOH 2HT4D 1S3RA 1KJVA 5CUSL 5ESAA 3C08H 4IMLB 1OCWH 2CO1A 4PCYA 3O0RL 3GS7A 5T3XL 3VH8B 5HSFA 2QFPA 3MYJB 3K0WA 3PGDB 1A4BA 5F7YC 2E47A 4K4KA 3RWJA 4HSAC 2NOYA 4LEXH 4AYDC 5C0BD 3BX7C 2NX5B 2XFXB 3CHQA 4XN4A 3TN0B 3W11C 1CTOA 3QUML 3EJRA 3ZDZE 1KELL 2CCVA 1KZYA 4TUUA 4K2UH 5BV7L 4UDUA 1IBYA 4PEEA 2QPSA 3K0YA 4JR9H 1K72A 5FW6A 1PZAA 1HHIB 4PRIB 4CN6A 1HXYB 1Q1PA 3CVDA 2XZCH 3CVIL 2XKNA 2LTQB 4KV5E 3QB7C 4Y2DB 3UP6A 4IMLA 3IU3B 4OSUL 3NBNA 4ONGH 2Z91B 3LRHA 5EO9B 3VH8A 3BN3B 5AAPA 5IROD 1Y07A 3MYJA 1SOSA 2DM2A 3PGDA 1FVCB 4MS8D 3GJEB 1LO0L 5MEND 2WXFA 1KJ2L 1CQKA 1HT6A 2NX5A 5DLMH 3TN0A 4RAUB 3GBLA 3MXWH 3FTVA 3P02A 1J1PL 4E36A 1Z5YD 3B7RL 1PEZA 1IC7L 3LS4H 1TZOA 1XT5A 4Q4EA 3LMJH 3M17B 2MH4A 5DRNB 4I7ZC 3T3PE 5IQNA 2IFGA 5H37G 4AL8H 4UB0L 3QH3B 4L8DB 1HHIA 4MWFB 4PRIA 2NR6D 1HXYA 3FFOA 3UTTE 4AGMA 4U0RC 2FRGP 4CGTA 3DX7B 3G5XB 1WUNT 4Y2DA 3BJ91 3IU3A 3QO0B 4YSTA 1YECH 2Z91A 3HNSL 5EO9A 1QFUL 4FZ8L 1FVCA 1GA2A 3GJEA 3D07A 4XVJH 4XB8A 1SHSA 1KB9J 1FJ1B 2WLLB 1FQ9C 2ZD0A 4C4UA 1J8KA 4RAUA 4GEJA 2DQHL 4J7RA 4OGZA 4Y5XB 3FQYA 4OR1A 2VERA 3RURA 5DRNA 1CC3A 3M17A 4HK3N 4XC1L 1V8HA 1XH3B 2X1PA 4LFHD 1NIBA 2W8CA 3RI5K 4OV6F 5A2FA 4H8QA 3QH3A 3Q7JA 1D9KC 2ROXA 4L3FA 4L8DA 4MWFA 4OGAC 5IGXH 4B9CA 5KBPA 4NZFA 5E2VH 5AAWA 5E94B 3DX7A 3G5XA 3KBHE 2KQMA 2JCCE 3QO0A 3T2QA 1QA9B 3EYSH 2NPLX 1G9NL 2OQJB 4PJAE 1FJ1A 2WLLA 4JL1A 2ESVB 3SQRA 2XV2A 4YSSA 4V2BA 1PZUB 5DZPA 4NUGL 4EMZA 4DFIA 3KW8A 3S97C 4Y5XA 4YIQB 3HN5A 3MSPA 4GUQA 3QDAA 4G6MH 1XH3A 2VB5A 1RU9L 1OW0C 4IOFD 1W8OA 3JYCA 2GI7A 3WIIL 2YKLH 2PYEE 2EACA 2ZSVB 5GZNC 4Y5VC 2VAAB 3K80A 2NX5D 1HESA 5E94A 4FP8L 5F9OL 1F4XL 2JIXD 2DQCH 5LCVH 1J48A 1JK8B 1QA9A 3STLB 3CFDA 5EUKB 1SJVA 2OQJA 4JFVA 2XACC 3RILA 1CLCA 1LO3H 1JVLA 3QEGL 4PRID 4PM1A 3AWGA 5F1KC 2ESVA 2AV7B 4ZMPA 1QBBA 5I0DA 2BRRL 3MV11 5A6LA 1XCQB 4YIQA 3BP6B 1OE1A 4QD2E 2VCOA 1CYGA 4YWGL 5HHQB 3RRQA 3RJQB 1PIGA 2M8XA 2ZSVA 1U2HA 3HNVL 3IGAB 5JTWA 3B9KB 3HBPA 1IZJA 2VAAA 3QZWB 4YBQD 2NYYC 1KCSL 4AYSA 2NTSP 3CX5J 1KJMB 4XVUD 3T6QC 2JV6A 3BVVA 1OAYL 3VE0B 3CH1B 1JK8A 1MDAA 2A9NH 3NTCH 3STLA 3VI4F 2CWRA 2D03L 2VDLL 5EUKA 4KY2A 5ACZB 5GRJH 1PD0A 2A73B 4LIQE 4GO9A 2FX9H 3BH8B 4M93B 2AV7A 5F3HB 3GJFB 1RUPL 2J12B 5TK4A 1R6VA 1XCQA 5IUCA 4EBQL 3BP6A 4F1SA 4GW1B 1CFQB 5C6PB 1LP9B 5HHQA 1YC7A 4JY5H 1FRGH 4S1QH 3IGAA 4DO4A 4LLQB 3B9KA 2FX7L 3QZWA 3LXCA 4OM1L 5F3BA 4X6CB 4MJIA 1KJMA 2WO3B 3WLBB 1WAEA 5HHMB 3CH1A 3UJTL 3VE0A 4AGLA 3UJJL 1FP5A 1JWUB 2XQYG 5AVVB 2H0PA 5ACZA 3QAQA 3NPSC 4N2IA 1BJ1H 5KYNA 2A73A 1RUAH 1RP9A 4F7CB 3BH8A 4X9YA 1EDHA 5T5NG 4L05A 5F3HA 3GJFA 3GSVB 1SQ2N 4UU9B 2YO3A 4UNTA 4F7MB 4GW1A 1CFQA 4XRCB 1LP9A 5B8CB 1QPXA 4UT9H 2V5RA 4LLQA 2F54B 4X6CA 4JFDD 2DLEA 4CDGC 1C1EH 3VFWB 3ULSB 3QCTL 2Z93B 1JWUA 3IGFA 2DJSA 4FA7B 1T5WB 4QRUB 2IQ9H 4U2YA 4F7CA 4AM0Q 3PP3H 3D34A 4IBUA 2ZUTA 2AXFB 2D7TH 3GSVA 1T66C 4UU9A 3BAYA 2Q8BL 4YC2B 5LUMA 1Z1WA 2EZ0C 4F7MA 2WTRB 4DF9A 4XRCA 3OAUL 5B8CA 4I3RL 3VD1A 5CGTA 1RH8A 4OV5B 4MQXC 2IJ0C 2F54A 4UCFA 3FB6B 3IU4L 1ZLUK 3WSQL 3CV5A 4WHYG 1C16B 2E75C 3E2HB 3ULSA 1H3UA 1FO0L 2Z93A 3EOTH 1HAWA 2JE8A 1KBVA 3EO9L 1T5WA 4QRUA 5EEZA 2YSSB 3B9KD 5FUCE 2R83A 4JFSA 4GRLB 5CD5C 2AXFA 3K6FA 3A4DA 2PWEA 4MJID 3WU1A 2WTRA 2Z65C 2VSKB 1BJ8A 5TQ0L 3L1GA 3X1NA 3NEEA 1GY2A 4AE1A 4CMMB 5ADOH 4I18C 3FB6A 3QA3B 1UWGH 2OMTB 1F90H 3L3HB 4I2XE 1C16A 4XP6L 3WY4A 5KSBB 3LKQB 1NKRA 4Q8BA 4U05A 4UNIA 2A4ZA 3BPCB 3LIUA 2DICA 5EU3B 2OTUB 1UWEL 4BHUI 5AAMA 1W0YT 3QNZB 2YSSA 4GRLA 2YUVA 4YDJB 2ZG1A 1SLUA 2OL3L 2VIRB 2OMYB 1SHXA 5EV7A 5HHMD 1XIWB 3Q6GL 3TJHC 3ZL4H 4B97A 4C58B 5CAYB 1XVSA 4FEMA 4QRRE 4CMMA 4MXQD 3HLKA 5CCGE 3QA3A 4Z7QE 2OYMA 1CIDA 1CK0H 2OMTA 4JG1L 4O4YL 5HGAB 1MCPL 1MFBH 3L3HA 5FOJA 3MGTB 4N90D 5KSBA 4IBWA 1A9VA 5J56B 2VLKB 4ZX3A 3ULUE 3LKQA 4HKJB 5FGRA 5EU3A 4AQ1B 3BPCA 2HH0H 3QRGH 4KI5D 4NZDA 2W80C 4YK4B 5D1QC 2OTUA 4OVVA 3QNZA 1KYUA 3CC1A 2OMBA 2F54D 4UV7H 4YDJA 3ZGHA 2BZDA 3SO3C 2VIRA 2OMYA 4OZGE 5LVEA 3WFBH 1XIWA 3QPQD 1E4KC 1JL8A 1XD1A 1NCNA 2F53D 2YZ8A 3HUJB 5FO2A 3QXUA 3FFDB 5D7LE 1FDLH 3HS0C 2E46A 5HGAA 3RUGE 3SKJH 1D2OA 3UBXB 3MGTA 3JV0A 2VLKA 3QSKB 1T80A 4HKJA 1YYLL 3RWGB 4AQ1A 2BZ7A 2ZXGA 3D25B 3DHUA 4P46B 4J3OF 4XO4A 5CJXC 1A6WL 2DI8A 4Y0GA 2WGXA 5BRZE 2J8UE 4LSVH 1BJMA 1BBDH 4PLOB 2W0KA 3RPIB 3ALXA 1WWAX 3MRQB 4KQ4L 3N9GH 3RU8H 2QMKA 3HUJA 2Y1AA 2QFRA 4WTQA 3FFDA 1QI3A 4KKLC 2BSDA 1RY7B 4HALA 5F70A 2IAMB 4GRLD 1UEYA 1WA2X 3KXFB 3PPEA 4M48H 4DKTA 2F1EA 3UBXA 2WBJB 2R56L 3RIAK 4JFUA 2LLNA 3RWGA 3GM8A 1YYCA 3HMWL 4EZLA 4P46A 3D25A 3MUZ1 2R69A 2FHFA 3LAFA 3O3BB 4PV1C 1NC4B 2UXTA 1E2ZA 5DTFB 5C7XH 5IMOB 4OIIH 2UVEA 1N0LB 5IHZB 4O5LH 1TF4A 3HC4H 3N91A 5HDBF 3QFDB 4XO3A 2B77A 4KH2A 1J87A 1WD8A 1A9EB 3RPIA 3WLWC 2E4TA 3MRQA 2A9AA 2NT1A 1NJ9B 3V4VL 2NQDA 3LKNB 4ZOBA 4ZNEA 2IAMA 4NAMA 1NC2D 2GJZB 3AZUA 3KXFA 4WWOA 1MFNA 3CFEB 3IJYB 2R4RH 2WBJA 4P49A 5IHUH 2OZNA 4PJBB 1W8EA 1XIWD 3V10A 5E03A 4RAHA 5EEWA 1A5FL 2XETA 3RVXC 1YY9D 4O02L 3EHBB 3O3BA 5CEZE 1NC4A 1ODUA 5DTFA 3AT9A 5IMOA 2D3LA 1N0LA 3J07A 5DSCB 5IHZA 3ZTJH 1G43A 3GXNA 3QFDA 5BPPA 5JNYB 5CKGA 1A9EA 4FS0A 3UZVB 1ET5A 1KTBA 2VLKD 4NCC2 3UDWC 2I9TB 3OAWA 1NJ9A 1GXEA 1UM5H 4AJVA 3U1SL 3LKNA 4XCEB 3ZYOA 4JMXA 4NN7B 2R2CA 3VUAA 2VLJE 1U21A 5LNGA 2GJZA 3QO1B 1FLTX 1X4XA 3CFEA 3IJYA 4HU8A 3O45B 3MOQA 1KN4H 3MLSH 4PJBA 3X14B 4XTRC 5I0ZA 2EDTA 2E4FA 1OAXH 3E9UA 4OKDA 4GBXB 3RY6C 3SGDI 3Q5YA 3WN6A 3AWEA 1S46A 1E8YA 5JNYA 1U0QA 3UZVA 2VN3A 1M6OB 5G4NA 3TXAA 2I9TA 3DRTB 4P46D 1XGZA 1UWFA 3FCTB 2OK0H 4WFFD 4XCEA 3TZVB 2VXQA 5C0AB 4XBMA 4MXVF 4B0MM 3QO1A 4L9LB 3O45A 4HOZA 3A6BL 1BA9A 1H3GA 4HD9A 3X14A 2WLHA 2ZZUT 2G5BB 1B9ZA 2M1KA 5D7JB 4GBXA 2IAMD 3ZDZB 4H44C 3WN5A 3CFCL 3KXFD 4RGND 3QEQE 2WBJD 4KY1H 3X3FH 1M6OA 2M2DA 3DRTA 1MCSA 5LGHH 3FCTA 3IS0X 1N8OE 2NW3B 4NZRH 3TZVA 1NC4D 1IKOP 4W4OC 5C0AA 3GXTA 3QQXA 4BRJA 5LJYH 6CGTA 4IRSD 4L9LA 2JQMA 4KXAA 2H1XA 2HLFD 1SBBA 5AKRA 2G5BA 4LSRH 4Q9BA 5D7JA 3PY9A 1S7TB 1CQYA 4AQ8A 4QI3A 3TBBA 4N87A 2CA3A 1JF1A 1CZ8L 1L0XA 1MJ7H 4KROD 1U8LB 1OALA 3MLZH 3UTTB 1K5NB 2YD0A 2NW3A 3EHBD 3DVIA 1SN5A 3C08L 2Q6WB 1SXSA 5I71B 1HZLA 1PL3A 3DPDA 3EJTA 1BLNB 2VM3A 4UT6L 1K9TA 3C5ZC 3MNWB 4I0CC 4A1RA 1D5ZB 3N06B 5TDOB 4OI7A 4K2UL 1S7TA 2JQAA 4NOFA 4XX1G 5JZ7C 2J5WA 1MHPL 4JR9L 2H6PB 3BGAA 3C75A 2BCMA 3DOHA 1U8LA 1F4HA 4JRYD 5DHEA 4WJ5B 4IKLA 5CZVH 1K5NA 3GTTA 2CJUL 3I9AA 3UTTA 3N1GC 1QNZH 1T7ZA 2Q6WA 3QDGD 4GBXD 1BLNA 3HZVB 1I53A 2WC7A 2JCCB 3MNWA 1DVFC 2AJUL 3MV7E 1CFVL 2TSAA 1D5ZA 3LDBC 4PJAB 4HF5L 4Z7AA 1C5CH 5DLML 5B22A 3S35L 2V33A 4G6KH 3MXWL 3GI9H 5TDOA 2BERA 3TZVD 1MCFA 3LS4L 5AB0A 3OSVA 2H6PA 1A4AA 2NXZB 3DUHA 4BWTA 1I1AC 2XIIA 4FJZA 1F1DA 4WJ5A 2PYEB 4ZMWA 5I0XA 4GG6E 4EEEA 1DVZA 4L5FH 1JZGA 2R2BA 3KDPB 3L4YA 2CIKB 3HZVA 4N0YH 2G2PA 2JCCA 2EINB 4HJ0D 4XVJL 3AS1A 3JV4B 4HK3J 4QXGL 4J3TA 4NB7A 4HUUB 1CU4H 2NNAB 4PJAA 3CZKA 3GTNA 1E43A 1NGPL 2MTAA 2XXMB 1G9MH 3ARBB 3KWVA 3FB5B 4W6XB 2EVJA 1ULVA 4OI9A 4EOWH 1UFGA 1E2VA 2B3IA 5GGVL 3DTUB 4E68A 3BPLB 3GI8H 4PVBA 2FK9A 3NQIA 2WUCL 2IAAC 2YHGA 3AS0A 3CHSA 1ZHLB 2NZ9C 2PYEA 1C7TA 1U58B 3DWTA 5LDSA 4JDEB 4NC1E 2CIKA 2ZONA 3B8YA 3JV4A 1HEHC 3X11B 4Q9CA 1GYWA 4HUUA 4OM0L 2NNAA 2H4EA 4UTBH 5FECB 5DO2D 1SOQA 3ARBA 3FB5A 5CINH 5E8OB 3AUWB 1THCA 3CHOA 1DYZA 4HBCH 4QTFA 1IIKA 4G6ML 3O4OC 4HGWB 1L9TA 3CFJB 2YKLL 5DJDB 5I16B 1ZHLA 1AQ8A 1VEOA 1JZJA 1ZK5A 2DWEB 1FF5A 3Q2VA 1U58A 3NCWA 4JDEA 2DQCL 1I9JH 5I8EB 1RIHH 2LFGA 5LCVL 1R3HB 5JIDA 5E4EC 4KK6C 4GAFB 1QBAA 4Y2NA 1LO3L 2C9SA 3IYLW 4XAKD 3X11A 4QNPE 4Z7OF 5ECJE 5FECA 1NEPA 2PO6B 4U3XA 5E8OA 1QRNE 3IGUA 4H8VA 5ABZA 4PMEA 1RUQL 4OAWB 3BEWB 4HGWA 3NFPB 3CFJA 3Q2WA 4JZJC 2UV3A 2GIMA 5DJDA 2WB1A 1NAKH 5AW0B 5I16A 3OWRA 3KGSA 2VZVA 2DWEA 4G7SB 5FYLD 3TIDB 1TEYA 1JV5B 5I8EA 2EC8A 1R3HA 2YPVH 3NTCL 4L4TE 5EU5B 1WICA 2HCZX 1UD6A 4X4KA 4F37F 2NXZD 2RJMA 2GBUA 1ADQH 1RZGB 5LBSA 5SWZE 3U2IA 4XNUL 2PO6A 2CUAA 4XX1E 4NN6C 4OAWA 3BEWA 3GBDA 4JY5L 3NFPA 3ZR5A 4S1QL 2PWGA 2EVGA 5H37A 3ZHNA 4J39A 5F1SA 1BSIA 2NW2B 4GUCA 4LEBA 3TIDA 1Q9LB 1JV5A 2WYTA 3ARBD 1OP5K 1AR1C 4FQHB 4YLBA 1KB3A 3VNZA 5EU5A 5LQBH 1UXWB 4PHXA 1E28B 2EYSB 4IJTA 2JKXA 2CBMA 5AW5B 1RZGA 2X4QB 5I82A 2KZ1B 4JVPA 1KGUA 5AVYB 4WQOA 5FHBH 1WS7A 4GFTB 4CW1B 5BXFB 1QI5A 4RMVA 2QQKL 1YN7B 3QYMA 2MCMA 4UT9L 3TV3H 1ZV2A 2GJRA 2R59A 1OQXA 1EUUA 1G4RA 2Y7QB 4FQ2H 2NW2A 1Q0YH 3OJ2C 3K74B 1Q9LA 4OD1H 3LH2H 3RG1C 1L0YA 1PG7W 1C1EL 4FQHA 4NIYE 1PLGL 4GIOA 4NM8L 3RPBA 3S2AA 4S11A 4NLHA 1UXWA 1E28A 2EYSA 3OLIA 4J6IA 3GBML 1MCDA 2X4QA 1CXKA 2LLLA 1R4XA 2O6PA 5F0JB 1QFOA 1YQ2A 2OAAA 3K6IA 3TBTB 3CWGA 1EH9A 4CW1A 5BXFA 3QHZL 4JGNA 4MHHG 2Y06H 1YN7A 3TT3H 5CO1A 2HRHA 5DEZA 4ELDA 4OLWL 4A55A 5T3XE 2Y7QA 5D96C 4QRRB 4LOFA 1YNTF 1OO2A 4FNTA 2X38A 2QL1A 5AW3B 4Z7QB 3WTXA 2R1WB 2QGEA 1AZNA 1ZLWK 3FUHA 2KC0A 1ZV5A 4XH2B 2P45B 3X1EA 3ZE1E 1H8LA 1JHLH 1A7PH 3N43F 2EEDA 2DQEH 3TBTA 2GK0B 2NSMA 2QLVB 4OZGB 3B2DC 3DSNB 1IC4H 3LPWA 4NUQA 3LKSB 2IFFH 3ZZSA 3RL1B 2QEJA 3WUZA 1MAML 5ADOL 4LLUB 4QRRA 1UWGL 4F8TA 1EQWA 4H20H 3A22A 4ZTOH 2R1WA 5D7LB 4ZO7A 2XA8H 1ZPLA 3ZOAA 3RUGB 5IJVA 3FTUA 4HOMA 3EAKA 4XH2A 4F91B 3MHZA 3MRBB 3WEOA 4L8SB 5C0CE 2APXA 1K2DB 1OKEA 1QWHA 5AVRB 4NO0B 1KGYE 5BRZB 2GK0A 2OW7A 2J8UB 4TOYH 4JS7A 4EPSA 4OZGA 1OEZW 3ZL4L 3DSNA 2JB5H 4J27A 1TLKA 5DD0L 5KANG 4EF3A 3LKSA 1XMWA 4O00A 3RL1A 3QXDB 3ZSTA 1I75A 4LLUA 3UEZA 3HEIB 4RRPG 1MFBL 1T2JA 2C4XA 4OLVL 4W70A 5D7LA 1UT2A 3RUGA 4DTGL 2HH0L 3V0GA 5C97A 4JFWA 3OZ9L 5IHWA 4L8SA 1K2DA 4MDIB 5DJZB 1AH1A 4NO0A 1BQ5A 3FSAA 5BRZA 4AMKH 4B6ZA 5E4OA 1D7FA 1RCYA 2J8UA 4K23H 1ES0B 3EZJB 3DX2A 5D7KD 5DYFA 1T2QH 4KHXH 4XXWC 4Y4HB 5I18H 5FDWB 2QKIC 4M7KL 1X7SA 1U3ZA 3QXDA 5A1AA 1KPVB 1FDLL 2W0LA 2OZ4A 2RACA 2ZNXA 1S7XB 3AUVA 3HG1E 5F7EL 3F12B 5LDUA 5JXED 1UD8A 4P99A 5DMIH 2X4PB 3OHXC 2FO4B 4YHMH 2FEEI 4MDIA 4N5ED 4LSVL 2V7NB 5DJZA 1DFXA 1QLEH 2APTA 1BBDL 1ES0A 4JBSA 4ZPTB 3F05A 3QYCA 1IJNA 1VZGA 1XSJA 4QKTA 4OCXH 4Y4HA 3ULUD 5FDWA 1IC5L 4HKZB 4NO3B 4XPAH 2G60L 1GKOA 2A74C 4JL2A 2UWEF 1EX0A 1KPVA 4FJ6A 4A38A 2X9WA 3NFSH 1OSPH 1S7XA 2VUOA 3GKWH 4ODXB 3F12A 1S7SB 4P2OA 2X42A 5DD3H 3DA0A 1RLWA 4DOHE 2X4PA 2FO4A 4DGYL 2XZZA 4FFVD 3ILQD 2B7DT 2V7NA 1SXCA 4O5LL 3HC4L 4FG2A 5HHOE 3JTBA 5D7LD 1I4FB 4ZPTA 5CZRA 2E6JA 4MYPA 5BQDA 4HKZA 3C60B 4DP6X 1DLFL 4XVSL 3UG3A 1FZMB 3L4TA 5BS0B 2I5YL 1CDIA 5IHUL 4ODXA 3DO7B 2WIIB 4LKCB 4PJXF 1S7SA 5T5FA 4M02A 1PKOA 4I85A 5D7IF 3ZTNH 1RZFH 4KK8D 3US1A 2BNQE 4WFEE 3ALWA 5FO8B 3UPAA 4AUYA 4GMSH 4WKXA 3AS2A 1TZ8A 3FO0L 1WSST 4JQXC 3JVGA 3TA4D 3V6OC 1UTDA 4KVCL 1V54B 1H3VA 1I4FA 2CE6A 3QEQB 1PF3A 3INUH 4HUWB 2N7BA 4OCLC 5I0WA 5C3IA 2QVFB 4X8JB 3C60A 1DQML 3QXTA 4WWID 1FZOB 1AE6H 5BS0A 1KWGA 4DW2H 4CL7A 4XC3L 1WAPA 1NKOA 5EF0A 3DO7A 2WIIA 4LKCA 4PRPB 3S36H 1IRAY 1E30A 4BK4A 4Y4HD 5FO8A 1OAXL 5CP7B 3SE3C 2XTJE 5GS2H 1TTRA 2OBGA 3RB5A 3WJJA 1AY1H 2GG1A 3S5LB 4YXHH 1INEH 4P2OD 4XMLH 4J5VA 3QEQA 4HUWA 2BRQA 4X8JA 1HX0A 3KPLB 3SYCA 3LV3B 1FZOA 1A6UH 3D6GA 1OY3B 5DD5L 2IDQA 4PRPA 4UILL 1N4XL 3F7YB 5F7BA 2DF3A 3CK0L 5T1KB 3K1DA 5CP7A 5I1DB 1J12A 1SPDA 3U7WH 3AREB 1ICTA 2CD0A 4LLAA 3S5LA 1UA6H 3S48A 1GSKA 1ECZA 2R1YB 2F15A 2VZOA 1ML0A 2E6QA 2V0AA 4Z3TA 2KMWA 4KK5C 1OWRM 4NZRL 3KPLA 1N5YH 2OP4L 3LV3A 3L8QA 2ZWKA 4GPVA 3F7YA 3T0VA 4LSRL 5T1KA 1Y0LB 3EFDL 1I1YB 3MBWB 4F1ZA 5CBEB 5I1DA 1C5DB 2V4LA 3AREA 5BS0D 1O5DT 1Q4NX 1D7BA 4WI9A 2R1YA 4N9OB 1MJ7L 1P5UB 4LSUL 1JVKA 3CZJA 2CBPA 3MLZL 3ZX1A 3HG4A 4N20A 2OXHB 2BVTA 4WVRA 4GG6B 3PNRB 2K9FB 3UYPB 4F7TB 1LMKA 2TSBA 2XNAB 3BJLA 1AHWC 1X44A 2H32A 2VRKA 3LKPB 3NJLA 5D7SL 3AGWA 1EUTA 4NKIL 5CD3B 3QEQD 1NWOA 5KBMA 3MAWA 1Y0LA 1I1YA 3MBWA 1WT5C 5CBEA 3MNVB 4YFEA 4APQC 5CN1A 3L45A 3TEUA 1CYWA 2QSCL 4URTB 4XI5C 4DP1X 1P5UA 3PWPE 4PRPD 3QCVL 2DPKA 2J71A 4B7LA 2R1XB 1NIFA 4JO2H 4TQHA 4JQIA 3WFEH 4CMHB 1Y6MR 2GC7C 1MVFA 4C83B 1F00I 2OXHA 2EDOA 2DQJH 4GG6A 4BQ8A 4F37K 1U92B 4U1HB 4FYRA 3UYPA 4F7TA 3PP3K 2XNAA 3QNFA 1DANT 1NSNH 3LKPA 2GJ6B 3ASOB 2WXLA 2BVUA 4PI0A 5DZ9A 1L6ZA 4RZKA 2OSWA 1WZMA 4PJFB 1XXFC 1PW3A 5CD3A 2CO7B 1P7BA 4G6KL 4GSUA 2WKLA 3KYNB 3MNVA 4KNTA 3ULVC 4MRBA 3MLWL 5AEAA 8CGTA 4DVRH 3MLYH 3RTQB 3DTXB 3LXAA 4OCMC 8FABB 3ASNB 2R1XA 2Z8SA 3EJYC 4XOBA 1S9WB 5T1KD 4WI6A 4L5FL 3PIQB 4C83A 3LRLA 3U7YH 4QRPE 2EDNA 1U92A 2W94A 4U1HA 4ABQA 3ARED 3VJ6B 1JG9A 2GJ6A 4D7BA 4A2FA 3UP1A 2CRYA 4MB1A 4PJFA 1UJ3B 2CO7A 3T2PA 3KYNA 2I27N 4OCRL 2B9AA 2WHVA 3VU1A 2G3ZA 1D5BB 2WQXA 3OZKA 3Q13A 1QRNB 5GIRB 4BFEA 2XWCA 3RTQA 1HYSC 1KTJA 3DTXA 3GI8L 4DP8X 4U2ZA 2G3XA 8FABA 1GIGH 2WPGA 3LHPH 3T3MF 1DL7H 1S9WA 1ZTMA 4HIQA 5IP4A 3PIQA 3L2NA 2VXVL 5CXPA 5CMAB 2W60B 2YRZA 5TF1L 3TNMB 3WENA 3AG2B 2D7PA 5J1AB 1TSHA 3DJ9A 3PF2A 4MVBD 3WKYA 2EDQA 4JDVB 4PFEA 4ERSH 4ZX4A 1MQKH 1SOKA 3VJ6A 4C8XA 2IGTA 1MDTA 4JHAH 4L4TB 5GGUB 1CGUA 3VFGH 4FG4A 1NCWH 4BWUA 5IIEB 1FSKB 4GY4A 1UJ3A 3PFQA 3TGXA 1BQHG 5K9JH 3ZYZA 1IBDA 1QTSA 4OQTH 5CINL 4LSPL 2H2SC 2D3NA 3L3KB 5SWZB 4ADJA 4HBCL 3GSXB 1D5BA 5GIRA 2WWKO 3KPPB 1QRNA 5MP6H 1RERA 2CAKA 2J7LA 5E6IC 2VSDA 1TJIL 4X4ME 3HAEH 2ISDA 3DV4B 5LAXB 3FONB 2X2JA 1A2YB 3NRQA 2F68X 4PV9B 2RR3A 3ZDYB 1I9JL 3TNMA 1TQCC 2W60A 1RIHL 5CMAA 3E3QC 1NEZG 4JDVA 5EC2B 4S10A 2MEJB 2CRMA 4L4TA 5GGUA 4Q74A 3RY5A 5IIEA 3MV9D 2OCFD 3BC9A 1PFOA 5CKAA 1MAJA 3II2A 4NZUL 1AZCA 4ZS6D 5B3JE 2B59B 5SWZA 3L3KA 4F57H 3MOAH 3GSXA 2FTAA 3KPPA 4OD3L 2GEQA 3TBSB 3FAWA 3RDTC 3K6DA 4TNWF 3DV6B 2GJ6D 3ET9F 3DV4A 4UBDC 5LAXA 5JUEH 3FONA 1A2YA 5KS9E 4PV9A 1O5PA 5EOCJ 4TQEL 2VDRL 4RGMB 5GGTA 2CIIB 2YWYA 5DQ9B 4AOFA 1KF9B 1LO4H 5EC2A 3HVNA 1NAMH 5EU7C 1A7NL 3RTQD 4LNVA 4NN5B 2FHCA 3GNMH 1ADQL 2IV8A 1AD0B 4LCWE 3IFOB 4NBZB 1MG3C 2AF2A 3FSOA 2B59A 4B60A 1KCVH 2IQAB 4EI5D 3TBSA 1AXTH 4NQVB 4ZOEA 3ISRA 4ODVL 4P5TB 3DV6A 2DQ6A 4HOWA 1ETJA 1QO3B 1U33A 3BAKA 3IDXL 43CAB 1IT9L 1NOAA 3PAUA 4Q6KA 3ZDXE 2D4FA 2DLHA 2N7AA 2R9HD 2W9DL 2CIIA 5DQ9A 1BREA 3GXPA 3KYOB 5DT1H 1G9EA 4N8PA 3OKKB 5LQBL 1QRND 2NY7L 2EDFA 4FI8A 3MA9L 4OJFH 3CDCA 3QUMB 2E0PA 1EO8L 3F65A 1AD0A 4NQCD 3IFOA 5BV7B 3HI6H 4K3JL 3ZE1B 3VFMB 2R0KH 3P2TA 1JTTA 3WTWA 2DKMA 2IQAA 3VG0H 5C09E 5T3ZH 2GUOB 4NQVA 3VRLF 5IFAH 4P5TA 3SJVE 1A3LH 1FH5H 4B9PA 1NUGA 1X5AA 1QO3A 1ZVSB 3FQ1A 4IRZL 43CAA 1KWKA 4OD1L 2B3RA 3T0BA 3KYOA 3MLRL 1JPST 3OKKA 3UOAB 3ZTEA 3ZLQC 1KJ2B 2L8AA 3QUMA 3BRDA 4L3EE 2P24B 5FKPB 1CF8H 4XMWA 5HJ3B 1BDYA 1PCSA 5C0CB 3IWUA 2ARWA 1EEZB 3AADB 1HXMB 2GUOA 3MRFB 4Q14A 4YDKL 3SCMD 4NNPH 5D1QE 2CO3A 2HP4A 4YAQB 5BMFH 2AI0H 1ZVSA 3PREA 4FNLH 2NTFB 3VWKB 1QP1A 3WTSA 4G8EB 3FCBA 3UCQA 1T03L 4CSTA 3MJWA 3QFJE 1YPZB 3HE7C 1KJ2A 4K71C 1EAPB 2P24A 4ZFGH 1VFUA 2BW5A 1JHLL 1UCBH 2GY5A 1A7PL 5CSBA 2WLZA 5FKPA 3BT0A 3VQ2C 1LL1A 2VW4A 1TFPA 1BQKA 2DQEL 3HB3C 5HJ3A 4ZQTA 5C0CA 3FHAA 4AQZA 1EEZA 5I6NA 5L4MA 4UTCA 1HXMA 3MRFA 5C0FB 1IC4L 3HN8A 4QHPA 1I82A 1S9XB 4KZCA 4P04A 2YD4A 4YAQA 1F8TH 2XQBL 2NTFA 3G6JE 2Q2LA 3HC0B 2AJYL 3VWKA 4B50A 2HKHH 2QELA 4G8EA 4IIQC 4MNGE 2XA8L 2X87A 1M42A 2HPTA 4E42B 2JI2A 1YPZA 4DP4X 3HG1B 3GHBL 4L37B 2X4SB 1EAPA 2IWEA 4LXFA 5GS0C 3JWDC 1FORH 2WBXA 2XXCB 4IU3B 4L23A 4AZ8B 4PJ6A 4TOYL 3ESPA 2ZKYA 4MS6A 3MCYA 5D8JH 3FTXA 3QUZC 1A1OB 2VKWA 5C0FA 1S9XA 5AOZA 5C9KA 1OANA 2J8OA 5K59F 1CE6B 3DO3A 4YQXH 1T0NB 1XAKA 2YAEA 5MHSE 4GKZB 3KBEA 3HC0A 4W9EC 4TPRL 4HS6B 4XHJD 4E42A 2VMEA 5D70H 3DO4A 3HG1A 1BFVH 4L37A 1NLDL 2X4SA 4Q9QH 3IBEA 4LHUD 1SJHB 5J11C 5E2TH 3PYCA 3AY4C 4IU3A 2FJGB 1N0XL 4AZ8A 4RMQA 2VR5A 4F3FB 1OD9A 4LO9A 5DUMH 5KVDL 4NRZB 5HHOB 1A1OA 2X6AA 3QR2A 1T2QL 3QK0A 5FXCH 1FNLA 3DDFA 5I18L 1UJTA 3KPQB 4JJHA 2R2HB 1CE6A 3CN2A 3I3EA 1T0NA 3VMNA 4KZEL 4JFHE 1HL9A 4GKZA 3CU1A 2RCSH 3C6SB 5AW6B 2VDLB 1N70A 3P4LA 4U7MA 5B3SB 5C0CD 4HS6A 4LU5H 1USZA 1T22B 1T6VN 4ZDHB 4ALAH 4LCYB 1HHJB 4YHML 1OK0A 3FN0H 2A0LC 1OP4A 3OMAB 3ZW3A 1Q9WB 1SJHA 2BNQB 3SY6A 4FXGC 4YHZH 1QLEL 4NJAL 2FJGA 4TVSa 1CDUA 1Q94B 4AXWB 5BOPA 3QUYB 2R2EB 1E6JL 4F3FA 3T0XA 1URLA 3J2PA 4NWUH 4NRZA 4XO9A 5HHOA 4EKJA 2Y6SC 3VGGA 3KPQA 3RVUC 2R2HA 4RNRB 3VD2A 2ZOLB 3BQUD 5HI4C 2ZXCA 3C6SA 4U6VH 1W91A 4ZW6A 4AJ0A 4ZMZA 2NMSA 3AMKA 2IVFC 3UC0L 1HIML 3L5XL 4NHUB 4X6FB 4ZDHA 4LCYA 4PGJA 2OS7A 1I8KB 4WFGE 1BLIA 1HHJA 2XZAH 3NPZB 3T2OA 3U30C 3HKZA 1G4MA 2BNQA 4IIZA 4KRMB 3BD5A 2XTJB 1EZUA 5H4YA 2X53A 4AXWA 1Q94A 2UX7A 4MJ5B 3DX9B 3QUYA 4W81A 2R2EA 2K9UA 5AB9A 3VSTA 4A7SA 3CPUA 5L0QC 2NSQA 3HG1D 4RNRA 2ZOLA 3ZMNA 1WCBB 2NXYD 1F02I 1KTRL 1U8OB 3BPNB 5BUPA 3MZGB 4GAGL 3NCJL 3C09C 3FFCB 5FAAA 1QYGH 4NHUA 4X6FA 2CGRH 2VMCA 1ZLEA 3H54A 1I8KA 3IJEB 1NIAA 3M7FB 1RVFH 4JO3L 2A9BA 1TXKA 4PJGE 4MJ5A 3DX9A 4KGJA 1NH6A 4XMTA 3ZTDC 5I1AB 3DX4A 4Q56A 2V3EA 4KXCA 1G94A 2APFA 1U8QA 1V3LA 3GXIA 3HC3L 3H9SE 1AP2B 1WCBA 2B0SH 2CM5A 3WFCH 1AE6L 1U8OA 2UVFA 1FO0B 4PJ7F 1YEFH 2EEAA 1VFBB 2GW5A 3FFCA 4RRPA 1EVUA 3S36L 1S78C 2NY1C 4GEIA 4J3OC 5HHOD 3IJEA 4DP2X 2HG0A 1G7PB 5JQHC 2DQMA 2CNYA 1TO4A 3CVHL 5FUZH 1KBBA 4U0RB 4U1MB 4EUPG 1JNLH 2Z4QB 4ICWA 2WXIA 5I1AA 5E08H 4HLZG 5IB2B 4DGWC 4HS8L 4U4BA 1PX3A 3RJDA 4M00A 3Q06A 2HTLD 1M7UA 3DTDA 4ZJ9A 3CDFA 1WP6A 3VMOA 4P2QD 1AP2A 4N25A 4JO1H 5DO8A 3BT2H 1FO0A 4FMFA 1TQSA 3QUYD 1A25A 4N28A 4WO4C 5DJYB 3V9EA 4DNLA 4MKMA 4DERA 1JZ3A 5E95B 3NSDA 4YH6A 1WF5A 1G7PA 2OCJA 2WXOA 2OL3B 1MXDA 3LNHA 3MC0A 4IJ3B 4Q52A 1D9KB 3WXWH 3BIAX 3N40P 1GVIA 4U1MA 3U7WL 2Z4QA 3PQYE 3HI5L 5I5MA 5DVNA 5F7LB 3BMVA 3C8HA 3NVQA 4GAYB 3U48A 5AB2A 5IB2A 2YQ3A 4ZZKA 4KVNL 3BZ4B 2LU5A 1EPFA 3OZLA 2FJFB 3K46A 2Q3AA 4U7SA 3PWPB 4GW4B 4OKVB 2WJ5A 5FGBA 1RIUH 4J6RH 2AK4D 1FG2B 2EDHA 3Q6FB 4UUJB 5GS0L 2AVFA 3JWDL 4BWWA 4A7TA 2Q7AA 3PDGA 4I0PC 5DJYA 5IBUG 3GZQA 4W9JC 1N64L 4HUXB 4WAFA 3ZTJG 1FNEB 1EAOA 2OL3A 1BW8A 3H42H 1D9KA 1O0VA 2DLGA 2WV3A 3O6KL 1TJHL 1F18A 3W11D 1DO6A 4D0CB 4GAYA 1QHOA 3FFCD 3Q8AA 3NA4A 2EE6A 3QR1A 3BZ4A 4I48B 2DQDL 2FJFA 2J21A 1G7JB 4UNUA 3PWPA 4GW4A 2I32A 4OKVA 1T7WA 4ZRGA 1T21B 4WCYH 4WK4B 4XMKL 2YGQA 4PLJD 1FG2A 3APFA 3Q6FA 4QRPB 4UUJA 3BZFB 1LDPH 4F2MB 4HWEH 4G8GE 1P4UA 2G3NA 4HUXA 3FUMA 1OARH 4GO8A 1OW0A 4DPAX 4G7VH 1H8SA 1B4RA 2EVHA 4DK5A 2QGCA 2D7NA 4Y5VA 1BZ7B 3NT0A 4JM2F 3B9VA 4TNWK 2P49B 3VQMA 4D0CA 2EE2A 3MXVL 3V0DA 5TE4H 1TU2B 4LSSH 4I48A 1FYTD 2DEXX 4JO2L 1J1XH 1T89C 1GYUA 5FA4B 1G7JA 5B4MC 4FOMA 4LQ1A 2YSTA 1T21A 4U3SB 3LZLA 2J3SA 1B6DA 3WJLA 4XP4H 3O6LH 5BZZA 4QRPA 4F5CE 3BZFA 1OAJA 4F2MA 1NSNL 3QJFB 2OR9L 2FQGA 1UD2A 2AEQH 4HHWA 3VYPA 3L7EB 1QVOB 3NP3A 1PD6A 4M4PA 4XVTH 5TE7L 2IGFH 1BZ7A 4XPFL 3TEXA 3T0EE 4PP1D 2J20A 3VYOA 3WY1A 5IJDC 1A4JB 3V4VB 4R8WH 4UWQB 1DFBL 1TU2A 1KCUL 4MMZB 3VB8A 5FA4A 4S0SD 1GRWA 3NPSB 3QP3A 1OM3H 5DC4B 4U3SA 3U7YL 1D9KD 1TITA 4OGAD 5CILH 3MN8A 5IV2B 4KU1A 2CUHA 3QC5X 3K1KC 2C5DC 3IAPA 5I1KL 5KW9L 5JQ6H 4AVIA 1Q0EA 3OAYK 1ZSHA 3QJFA 4O02B 2JKWA 5B39G 3L7EA 1J0YA 1UD3A 1QVOA 3E1ZA 2J73A 2WKGA 5IWLA 3N04A 2D8KA 2XWZA 1Q8MA 3MPCA 3FH7A 4A66A 3W39B 1A4JA 1DVTA 2FBJH 3V4VA 4MMZA 1JCKA 1YEGH 3BGFB 2WQSA 1YSOA 4Y4KC 1IAMA 2CLRB 4RLDA 5GZND 5EDXA 5KS9B 5IV2A 1SYVB 2I26N 1MQKL 2LW3A 1CLZH 3VFGL 4JHAL 4XVOA 4O02A 2XVKA 2DW5A 2NYZA 2R23B 3NFNB 2MRYA 4NUPA 3AVEA 2AJVL 4FJYA 1MW1A 5EUOE 4OQTL 1VKXB 1AKJD 4F8LA 1NPUA 5MP6L 1TEGA 1SHMA 4K9JA 1P84K 1U2YA 2PNDA 4QRPD 5DUBB 2CUMA 2JI3A 3W39A 4TRPH 3ZUCA 4ZMQA 2DH2A 2PPCA 3BESR 3NJJA 1IM9B 1VF5C 2CLRA 3X3GH 4KRPB 5KS9A 1UHVA 3ZDXB 4Z7UF 2EVIA 1NFIB 4XAWL 2ORBL 1J5OL 1GMIA 1SYVA 2NYYD 3WEAA 4XBPB 4NRXB 1FIGH 3KBPA 3NFNA 2R23A 4MNQE 2LLGA 1DDTA 2PCXA 1E3XA 3NDYE 4U6TA 1VKXA 3TTYA 2XBDA 2J4WH 2XY2A 2RGSA 3QEHB 3TEYA 4XNAA 3X17A 4QGYA 1ETA1 5DUBA 5DS8B 2MFNA 1FFTB 4PJDF 5C09B 1QLRB 5E99L 2W1NA 5IUSA 1IM9A 4GXVH 4FGMA 3CDZB 2RA1A 3SGEI 2IBGA 3L5IA 1CBVL 2F74A 2LABA 5FHAH 2CLZB 1NFIA 4YDIH 4EKXA 4EI0A 5TGBB 4XBPA 1NAML 3ETBF 4M56A 2XOTA 4NRXA 1IGFH 2IWFA 3GNML 3RIFK 5I15L 2VABB 5D5ME 1LNUB 3RPKA 4L3EB 4EIBA 1SFDA 1GC1C 1UC6A 1HE7A 2C7UB 3EYUH 9PCYA 3K6OA 2E9IA 4ZO9A 2NUPB 1KCVL 1AXTL 3CU7A 3L3OB 1EDQA 3FO2B 5DS8A 5C09A 1QLRA 5D6DC 2Q3XA 5D1QB 1XZ0B 3CDZA 4LL9A 2VQ1B 4LCCC 2XG4B 3S37L 2CLZA 5TGBA 3SO3B 2UUDK 4ZO6A 4AEHH 4GINA 3LH9A 4JKKA 2DMBA 3T5WA 1JXKA 1EXUB 1G87A 3QFJB 4E9LA 4M9OA 2VABA 2ETWA 1SUJA 2QGBA 1LNUA 3HI6L 4L3EA 5AKVA 4BRVA 2R0KL 1QFHA 2C7UA 4OLYL 4M5SA 1BQHB 4KWUA 2WWNA 2NUPA 5CR1A 5T3ZL 3HS0B 5L2JB 2DI7A 2HB0A 3FO2A 1T66D 3L3OA 4GLRI 4KUZH 1QFPA 2EH7L 2EZ0D 1ITCA 5AKTA 3OVUB 1UASA 2H41A 1ZT4B 4I3SL 5D1QA 1XZ0A 3HIZA 1OZUA 4JRLA 4TSAL 4UT6A 5KSAC 2VQ1A 4MQXD 2XG4A 3G6JB 2QQLH 3VI3F 1R3IH 1ZGLB 3KPRE 4R5TA 2P28B 1A6AB 3D1MC 1AQMA 4MNGB 5EOCH 1NEZB 1YO4A 1U4EA 3I3BA 4D3CH 4NZTH 2NDFA 1EXUA 3QFJA 4IHOB 4PD4K 3IMSA 3F01A 1E4KA 3W2DL 1K85A 4JZNB 1IM9D 1KCBA 3NZSA 1JV2B 5KVGL 2EQDA 1BQHA 2DQIL 2QPDB 2NY6C 4N68A 5HGBB 3LEXB 1RMFH 3HS0A 5L2JA 1M53A 4NNPL 4OCYH 1UH4A 3W9EB 2AI0L 3KCPB 1AAJA 4FNLL 1ZT4A 3UPRB 1HK6A 1Z9LA 1JI1A 1P4BH 2MNJB 3SYOA 2WD0A 3G6JA 2XJLA 4N2NA 1EZLA 1ZGLA 5I1JH 1A6AA 2V7HB 4MNGA 1NEZA 5HYEA 4G11A 4RGOH 2Z92B 1I8AA 4IHOA 3BDBA 4ZFGL 5EEYA 2ZAIA 1MHEB 4JZNA 1JK9B 2I60H 1V27A 4UAHA 2MOQA 1JV2A 1JZHA 4RESB 3O2DH 4OIBA 5HGBA 3LEXA 3LNFA 3INOA 4DK3A 4KH9A 2CCWA 1OE3A 1V7NL 3W9EA 7CGTA 2X6UA 2WXQA 3KCPA 3UPRA 4P57B 2ZOOA 2V5MA 3H85A 3IRZA 4ZTEA 4ZXBB 4ZX5A 2HKHL 3SKOB 3L9YA 4G1MB 5C3TA 3S4SG 2QVTA 1FIEA 2V7HA 3WGUB 1ROWA 1BFTA 5FB8B 2BP3A 4KKAC 3NJMA 2Z92A 1IAIM 2G5UA 2HUHA 1MHEA 3AXHA 1JK9A 3Q5OA 2AEWA 5D1QD 4WY7L 3VXRD 4WI3A 4PSRA 2BCKB 3AT0A 4UI2A 1HCYA 4KDTA 3FOMB 4Y9GA 2EYTB 4ANWA 4L5FE 4HJSA 1UM6L 2DLFL 4FDWA 3F58H 3GIZH 2E3VA 3OXRB 4YUEL 5DC2A 4P57A 3PUCA 4ZXBA 3EGDB 3HMXH 3G08B 1T5XB 3NESA 3SKOA 4G1MA 5E1QA 1OSZB 4DEUA 3SDYL 4N4YB 3PHSA 4U1IB 1X5JA 2WN2A 5FB8A 1BFVL 2V37A 3N42B 4CU6A 5B21A 2B1HH 2EYRB 3UDWA 4B41A 3UMTA 2FX8L 1G1YA 2FEEL 3AU0A 2BCKA 4JO4H 1MCQA 2O6FA 3FOMA 2EYTA 2YS4A 4KFZC 2CMRH 3ILEA 4C57C 1FGNH 1JPSH 3QQ4B 3OXRA 2XCMC 1MCLA 1HWWA 2FQFA 3QDMB 5LCVA 4E41E 3EGDA 1CMOA 3G08A 1T5XA 1OSZA 3RY6A 3FTSA 1TTCA 5K9QI 3ATDA 4JY6B 2O6DA 4LU5L 1WO2A 4PWFA 4U1IA 4ALAL 2JKRM 3WHXB 3SEPA 2BIPA 4Y88A 1MLCB 4NI6A 3AG3B 3KPSE 5ICXB 2EYRA 4I9WE 3QI9C 1NGXB 5ESQB 4GYBA 3RNKB 4F15C 3GK8H 5MHSD 3MLUH 2QGDA 3TTSA 2RQ8A 2HRPH 4ZD3H 5K1VA 4KKZA 4J3XA 3A3YB 1ZY9A 1MPAH 3AS3A 3QQ4A 1JPTH 3GXUB 5AALA 3WLWD 3QDMA 1IUZA 4MA7H 3D12B 3H9SB 4AM0B 5HD8C 3O3DB 2D7MA 4TXVB 2B1AH 3RFZB 3LRGA 3OJMB 5I6PA 3M45A 2FR4B 5J1SC 4JY6A 1GC1L 3LZPA 1OGPA 1XL4A 2PXYB 3WHXA 2DMGA 3O3AB 4KKCC 1MLCA 4FI7A 2XZAL 1CGSH 2NYKA 5ICXA 1EJOH 3OF6A 1NGXA 5GGQL 4Q0XH 1V05A 5ESQA 1T5KA 3RNKA 2EE3A 3RVXD 1ZJBA 4JFHD 4M3JA 4W4OA 5E5MB 2WXPA 1TZGL 4QKXB 3C5ZB 3D9AH 4Z3GA 3OV6A 3W57A 3APCA 2JH2A 3H9SA 4AM0A 3RFZA 3O3DA 2C1PB 2WXGA 2FR4A 2Q2EB 1OAKH 3R0NA 2OI9C 1GL4B 4FI6A 5JR1H 3O3AA 4QXTB 3N0PB 4UAOB 1HHHB 1RVFL 5KYXB 4YX2H 2DV6A 3FSWA 4PH8A 1IV8A 4XTRD 3RE0A 3TWYA 1AQKL 2A6IB 4UT9A 1DR9A 5E5MA 2P1YA 3M07A 3PQYB 3RY4A 4AMWA 3Q44A 3LNEA 4N0RA 2WBKA 2VITB 3C5ZA 2CZNA 4FRWA 4XB3A 1DVFB 1VGEL 3L9RB 3GWJA 4OD2B 4A67A 3EH1A 1X5MA 3A4AA 3LDBB 4Z7NB 4WFGD 3ZKNC 4YHLL 1KCRL 1HQRB 2C1PA 3D09A 2OSYA 4LSTH 1BEYH 4QXTA 3DC0A 2CHZA 1HHHA 5KYXA 4QAMB 3T8XB 3EOBB 4GOSA 5FUZL 3QDMD 4KQ0A 1JNLL 1ED3B 1I7TB 2A6IA 5CU9A 3PQYA 4BK5A 2FL5B 1JCVA 4FQXC 2VITA 1Z3GL 3MACH 1DVFA 3L9RA 2D73A 2YPLE 1E0OB 4GKLA 3AQZA 3GSWB 4EZMA 3OF6D 4FLRA 1IBHA 1IBFA 1HQRA 2H0FA 2QDWA 2WWMC 1MCRA 1SZNA 3U36A 4GAJH 1QUNB 4MQTB 4UQDA 1P4IH 2DMCA 1ZVNA 3S3CB 2BHZA 2VL5B 3VW3L 1MCJA 1K6QH 5DQJB 3T8XA 3EYOB 3EOBA 4G6FB 4ETQB 2VGLM 4XMPL 2IDTA 4J4PC 1JJUA 3H9SD 5C0DB 1ED3A 1I7TA 1LILA 2J1YA 2FL5A 4WU7B 4P2RE 4M8QB 2H1PH 4C59B 4A2MA 1IEHA 1NGWB 4EAEA 4N0CC 2XRAL 3I85A 3GSWA 1MELA 2WB7A 1RIUL 4KUCF 4PWJA 3BD4A 3QVAA 1CXLA 4M5YH 5D55A 1SDYA 2NNXA 4F27A 2X4NA 2BINA 3ZE0B 1CE1H 1QUNA 3AMLA 4MLSA 2DL2A 5HHXH 5IFHH 2VL5A 2XX0A 3QRBA 3C5ZD 3O4OB 1IAOB 5FYLH 5DQJA 1PZDA 2ZG2A 3EYOA 4ETQA 5ID1B 4PTTB 3GZPA 3SDXF 5C0DA 4K3HA 4MKTA 1L7TL 3MJ7B 3X12B 3T0EB 5HHVH 5J3HD 4WU7A 4M8QA 1PLCA 2YAQA 5JZ7D 4Y8AA 4M8UA 5AG9A 3IWVA 1NGWA 1U42A 1S3KH 2A1WH 3LSOB 2YMXH 1URIA 4K7FB 1G1CA 4X42A 5SX5K 1NM4A 3QQ9C 4RFEB 4F5CA 4JVUA 4B7IA 5ERWB 3PWNB 1EHXA 1JWMB 1OARL 1IAOA 1DVFD 1KBGL 2EEBA 5ID1A 4PTTA 4HXBL 3OR6B 5L8LB 2PCPA 3WNNA 4N8CH 4EUPB 4EIGB 2F5AL 3MJ7A 4GSRA 3X12A 3T0EA 5KVEL 4YSEA 3WS6C 4P5RA 1R75A 2DQFB 4KNUA 1ZVYA 3SSGA 2V9QA 3LSOA 1I1AD 1UENA 4K7FA 1MRFH 2PUQT 4NT6B 2WLNA 4FQ1L 4RFEA 3Q0HA 4JJ5A 4F92B 3FPXA 4PW9A 1WH0A 2AEQL 2HVJB 3OM3B 3PWNA 4NN6B 5ERWA 5IK3B 1JWMA 1CS6A 4PB9L 4PWIA 3I9IA 2IPUK 3P9LB 4LIQH 4EN2A 5KVDE 2IGFL 2IXQB 3B7UX 4D0BB 3OR6A 5DZAA 3FS9A 3O9WC 5EUOB 1RUMH 1T04B 4KBPA 2EADA 1KTLB 3VXSB 3X1BA 4EUPA 2ADGB 4R8WL 3VO0A 1AR1B 1TJGH 2DI9A 2DM4A 3UJIH 1CO1A 4WU5B 4X6CF 1SUHA 4M8RA 2DQFA 5HVWA 5J0BA 3P3UA 4O9HL 4Q4IA 5BVPH 5JMRA 2GABA 4YMPA 4G6FD 5CILL 4KTDH 2F1BA 5K1NA 2NZ9D 3VFSB 2PP7A 4D9QE 4LHQB 5E1HB 4BFNA 2B15A 5IVOA 1E8XA 5JW3H 3NH7H 3S34L 2HVJA 5GS1C 5IK3A 4MNQB 3T6ZA 1S7VB 4Z8FH 3P9LA 4FABL 4XBEH 2IXQA 4PJ5E 4OB5H 1XDTT 4D0BA 1QFWM 5EUOA 4B9KC 3KH4A 1T04A 3VXSA 1KTLA 2Z3FA 3H9ZA 2O5YH 3BVWA 3EJQA 2FBJL 4LPVA 2ADGA 2KPWA 5EU7E 3GHEL 1YEGL 2JTYA 4WU5A 1XCXA 3ATFA 2Y07L 4JG0H 3U83A 3KWUA 3SKMB 5IB1B 3VD9A 2JMRA 3QHFL 3VFSA 5A43C 4XNQB 2HX7A 1CLZL 4F9PC 4R5VA 2CRZA 5E0QA 3VGFA 4AMXA 1E9OB 4NQTA 3VGBA 1G9MC 3ZRSA 5GJSL 4KK6D 3AWFA 4UINH 4MNQA 4PLNC 1S7VA 4QXUH 3MBXH 3B2UC 1RPKA 3GUFA 5D96B 4B96A 1DQLH 2WVSA 1XEUA 1WJ3A 2JKJA 4GRWF 4OF3A 4OT1L 2BS8A 4WDIB 2YD9A 3ZBMA 3R0MA 4NZ8A 4J3WA 4CJ1A 3GF8A 4N6RB 1H19A 2GT9B 1LXMA 2Z9TA 5AYUH 4YLQT 5IB1A 3SKMA 5AVWB 4XNQA 3SGEH 1GCFA 4HGKC 4J2QA 4K5MA 1FIGL 3NAAL 1E9OA 4D9LL 5L9DH 2CDFB 1UOKA 3QJSB 1Y1DA 2V2XB 3U7AA 1XF3B 2EILB 5CJOH 3BYTA 4LEOB 2CALA 1IMHC 1DJZA 3ARVA 3COOA 3EJCA 4K5NA 1U8PB 2PTTB 1P5VB 1IZKA 2B9BA 1EAJA 4WDIA 5ILTH 1CGYA 1EDYA 4QEGA 3D08A 4YDNA 4BUQA 2Z35B 3F85A 3MKGA 3MU3A 4N6RA 1FFNB 3RZWA 2GT9A 4NUJB 2UZYB 4FKKA 2WM0A 2ZXEB 4WUUD 3IKCB 5LBVA 3VXSD 2WLMA 3FRUB 4NQDB 4PRNB 4YE4L 1AR1D 1QBMH 1IGFL 1QOKA 5C0GB 2CDFA 5EMYA 4LEEA 5B39B 1FBIH 2BM3A 3RWCB 5CJ8A 1P7QB 2V2XA 4TQIA 1XGUB 1XF3A 2WOYA 4FA8A 5I19L 1FYHB 1H6FA 4LEOA 3P0VL 5HDOA 2WJ7A 3F04A 1U8PA 2PTTA 1P5VA 4JE4B 3WHE1 4Z7VE 3KG5A 4MBOA 4R97C 1A7QH 5DJAB 1QMUA 5JYLA 1UM4L 2Z35A 2XC8A 1FFNA 3CAFA 3UTZB 4RMRA 4NUJA 5TDPB 1CXFA 4IOSD 3IKCA 4JHZA 1DTUA 2BHUA 3MJ8B 4MCZB 3FRUA 4MB5A 4NQDA 4PRNA 3ULUH 1U8MB 2FSDA 5C0GA 1VHPA 3LHAA 5B39A 3RWCA 2DZEA 1ONQB 2I7OA 3HAEG 1P7QA 1ORSB 2OR8A 1XGUA 4G1EB 5EFIB 2DMKA 2OPCA 1A47A 3IETB 3OAZH 1JD7A 1WIPA 4ILDA 1RZJC 4J3OG 4HZLB 3SO5A 4DP5X 4FQPA 5DJAA 4K7PY 5F3FA 3CE1A 1TO5A 3OHXB 3UTZA 1UACH 4AW4A 4LARH 1DQIA 5TDPA 3U9UB 1O6SB 3MJ8A 4MCZA 4D3CL 4PS7A 2VDQL 3LKRB 1U8MA 1AS7A 2YQBA 1E7VA 4FFZH 4XXWA 1ONQA 2NY5C 4XXCC 1ORSA 2X2HA 3AXIA 5GISH 2CUIA 4G1EA 4PCKA 5EFIA 4A68A 3IETA 3TBYB 3T09A 4CC1A 1UH3A 1YEKL 1ZS8B 2Y6TE 1GMEA 1J5HA 3V4PL 4MA1B 3TF7C 1FPTH 3UPCA 1QZNA 3HBZA 3OHXA 12E8H 3U9UA 1O6SA 2YXWA 3LKRA 3FW6A 3GRWL 1A21A 1S5IH 4OFVA 1KN2H 4YZFE 3UZEC 4OQ1A 4MRCA 2Q9OA 5F0LB 4GMTL 3O2DL 2H0JA 4BH7B 2A74A 3AM8A 3TBYA 1L0QA 3R1GH 4PHZA 2IGLA 5HY9B 1N67A 3W81A 3CZEA 3Q1EA 1ZS8A 4NQDD 1T20B 1F45A 5DS1A 5EWIL 4WI0B 4CJ0A 1U6AH 4NM4L 2DOCA 4KJYB 2VUKA 4E41B 5GRUH 1P7QD 1VERA 3NCYP 4GQRA 5FIEA 3W9DB 3GKZA 2IH8A 3I50L 4WHYH 1RZKH 1J8HE 5DR5H 5I2IB 2ARJQ 2R7EB 1MKFA 2VXUH 3VFVB 2DQUH 4PB0H 3KPSB 4N2HA 5ADPH 4BH7A 5L7XL 1EFXB 4XZ4A 5HY9A 1NCIA 1U8KB 1VPOH 1T20A 2CO6B 4Y16C 4WRLA 5L4FA 4W9IC 3HMXL 4LMQI 4WI0A 4KJYA 2W9EH 2EDBA 1E5AA 4N2BA 2C26A 4E41A 3WXVH 3W9DA 4JQXA 1O7DC 3KHQA 5I30H 1TQBC 5T5FH 4WGKA 3H3BC 4L18A 4HAFA 4YS4A 5I2IA 1DSFH 1X9UA 4G8FB 1CUOA 2B1HL 2R7EA 4OIAA 2K8MA 1FE8H 3VFVA 3KPSA 3UTOA 1VESA 1QSEE 4Z77B 3RX8A 5KAQF 3B2MA 3WGVB 4KKRA 1LJMA 1EFXA 3FUFA 2VXTL 4KK9C 1QBLH 4A2HA 1U8KA 4CAGA 5BZXA 2DTSA 1KLUB 2CO6A 2VDRB 1HC1A 5HBBA 4DO5A 1NBVH 4U33A 3CCHB 3KR3H 3MYZA 2MNWA 4G3YH 3SE3A 1IGCL 5CZXC 1J5IA 4MA3B 2CO2A 4BUHA 1TZAA 2Y1YA 1PTZA 3JVFC 4YHOL 4G8FA 4JKNA 3UL4A 3ILDA 2YFOA 1Z66A 2IOIA 1YN6B 3B2VH 4PJCB 4Z77A 3GK8L 2ZX8A 4RWYH 1GGYA 5DHDA 1I9RH 4CSZA 4K94H 4K9EC 2P26A 1SVBA 4ZD3L 1PPIA 1FH2A 4FLSA 4M1GL 1GJIA 1Z7JA 3HN3A 1KLUA 4KV5F 3BXNB 1DJIA 4MA7L 4MXWH 3CCHA 5FWQA 3EJJX 4UZSA 2FDBP 2MPAH 1QHPA 4MA3A 1GR7A 1ADQA 3S4SB 4JDTH 1U8JB 4KQ3H 4TUKH 4S1SH 4PJCA 1YN6A 4Q0XL 2WINB 5DF0A 4RFOL 5IT2H 5F7FA 5SV3A 2JJWA 1T83C 4DH2A 3T3PF 3FT1A 5KYYB 3ROOB 5E7FA 1GHFH 1PU0A 3D9AL 3MCLH 4XOCA 4FERA 4WI4A 2G0KA 3P4NB 1U8NB 5IQOA 3BXNA 4NOBA 2J8HA 1BFOB 2YPLB 3UTPE 1ZLVK 3BH4A 2F7PA 2ZICA 1G7HB 5HDBE 4QCIB 4APQB 1EFXD 1PLBA 4ZAKB 3S4SA 5JR1L 3FQ2A 1U8JA 4ZTPH 4R5XA 1SXAA 5L4JA 1TJXA 4LNRB 4GKNB 4NENB 1VAHA 4XHQA 4OFIA 5KYYA 3N55A 3ROOA 3FH8A 4XP1L 5SV4A 2DL9A 3GMLB 4IRZA 4DSYA 4LRIC 4IKJA 4P2RB 1MFAH 3MRKB 1U8NA 2P5ED 3P4NA 4ETYA 1BFOA 1Z6JT 2YPLA 3QXWA 1K3ZA 2JCCF 4YSRA 5B1CA 2AP2A 1WT5A 1G7HA 2ZKXA 4YDLB 1I31A 1TDQA 4QCIA 2JK5B 3GJFK 2H32H 4APQA 4PJAF 4HJJL 2YOAA 3BWUF 3ZHFA 4LSTL 1BEYL 4ZAKA 1GGIL 5F21B 2Z7YA 4A2EA 3N0AA 2J5LC 1JDDA 4LNRA 4GKNA 4NENA 5T3ZE 1PSKH 1SGKA 1QFWI 1R1CA 3KLHC 5EBWB 1CURA 1H3TA 1KMGA 1SY6L 3NSYA 1LEKB 4F24A 3GMLA 4Y5YC 2I07B 3D06A 4JQIH 4P2RA 1YJDC 3MRKA 4GS7C 4KK5D 3TL5A 1TZIB 2WQ8A 1CLYL 3WAJA 4GAJL 2JK5A 4P05A 4ZFZB 4QOKE 1AIFB 2VRAA 3CFIC 3LQAC 4Z0BL 5AVSB 5KVGE 1YEIH 1NM9A 2EDJA 1K6QL 3BN9C 3D2UB 4IK7A 1B0RB 4BHUA 4POYA 1RHHB 1MFDH 2J6EL 5EBWA 3V7AG 5EZOL 5IW6B 4Y4FC 1RUKH 4BA0A 1NMCC 1LTXA 1LEKA 2H1PL 3SBWA 3TVMC 2BS71 2F2HA 5CCHE 2V6HA 2I07A 2COQA 1YY8B 4R6UA 3AU1B 1ERNA 4JN2B 1B3JA 1W8NA 3CHPA 6FABL 2P52A 3UGEA 1INDH 2FHBA 1TZIA 4HT1L 1A7BA 5F6IC 4B3EA 4PJEE 4WUKH 4ZFZA 3EUUA 1AIFA 5IFHL 1MFEL 1RKRA 3BLBA 3D2UA 5E6IB 5FYLL 1B0RA 1J5DA 1XTLA 2K6YA 1RHHA 2O6CA 5EF3A 3DYMA 5ISZE 2X3CA 3HHRB 5I1EL 3ARFC 3K2UH 4IHBA 5IW6A 2X05A 3FNKA 3QCUH 3N41B 4PUBL 3D85B 3ZR6A 4APQD 4M29A 1WG3A 5FFGA 2D2OA 4H0IA 1XGYH 4LFHG 4ZAKD 3PWJB 1YY8A 3VG9C 3CXHJ 3CZLA 4XI5D 3AU1A 5E56A 3EOYG 4JN2A 4ANXA 3VM7A 4LQFH 4JLRB 4ES9A 3PRZA 5CS7A 2CKNA 4PJ9B 3PS6A 4OZFB 1JYNA 4JFYB 4TTDC 3QZLA 4X83A 2HMIC 5E6SB 3U6RB 1AD9B 5E6IA 2JJUA 1FGVL 3A21A 3MLPA 3RLSA 1QLEB 4P2RD 3VFPB 3HG3A 1M71B 3JZYA 3O4LD 3CHRA 2XPGB 5TF0A 3TCTA 4PJ5B 2BFVH 2IV9A 3BQVA 4CKVX 3QR0A 3D85A 1XX9C 3VH8G 3ULVD 2YMTA 3PWJA 4JM4H 1TMCB 1F1GA 4QAWA 5IMKB 3SN6N 4UNVA 1F58H 4NERA 1WVZA 3EJYD 4JLRA 2ITEA 3LN5B 2GK2A 4PJ9A 4YFLF 3B43A 3FT0A 4OZFA 4ZNCD 4JFYA 2PMZA 3WKMH 4DHLA 3U6RA 1AD9A 3GHPA 2YXVA 4ABUA 1OK8A 3VFPA 4EIZC 1M71A 1XCTB 3BAEL 3T1WA 2XPGA 4K8RC 4PJ5A 1GJWA 1KFGA 1DUZB 4P0DA 3ZKXC 1TJGL 1WA0X 4MDJB 3T2LA 5DJ0B 4U1NB 3BSZL 3UH8A 1HYSD 5KBKA 3D69B 5IMKA 2VOTA 5GGTH 1E4XL 3Q3GB 1FVDB 3LN5A 4WSKA 1IGIH 3ZXAC 5IJBC 4FQCL 2VXSL 4TLTA 3KL3A 4DJMA 4BH8B 4PMFA 1DJHA 1CBJA 4XBEL 4FA6A 5AZ2L 2A6DB 1XCTA 3HOGA 5JHBA 5AW7B 3SOTA 5FC9A 4XE5B 2O5YL 1DUZA 1F6LL 2H2SD 3FF8A 3PU7A 2NY2C 3HNTH 4ZBJA 4MDJA 4KNQA 5CHNB 3LB6C 5DJ0A 3BZDA 4HFUL 5JIKA 1SEQL 3FQRB 4U1NA 35C8H 4QYAA 5E6ID 1QKZL 1WC7B 4DUXA 5JQIB 3RGVB 3ULAB 1UXSB 3Q3GA 1FVDA 1BQRA 4GKOA 4KJWC 3MBEC 1RJZB 1NUDA 1U3JA 3L2MA 3TH4T 3D85D 5I74B 5JA8B 4BH8A 1D6VL 1HEZB 2GBVA 3CVHB 4AH2B 1HI6B 5MENE 3MBXL 2ZPKH 3FU6A 2A6DA 4JM2C 4X6EB 2RTTA 3SYQA 3LZFL 4LDOB 5TFSH 3V7AE 4G5ZH 5C8JB 1BVZA 2NDGA 3CN4A 5F7KC 4PJ9D 4KXZI 4FAAB 1IBGL 5TK2A 4QLWA 5CHNA 2E7MA 4IS6B 5CUSH 4D94A 1DBMH 3FQRA 4K71B 3O0RH 3OSKA 3RDTD 1WC7A 1E9PB 5AUMB 4MSWB 2P9RA 1HHGB 3RGVA 1UXSA 4UBDD 5D2LF 1RJZA 4PS8A 1KZQA 3VXNB 4PJ5D 5KBNC 3QIBB 1F0LA 1MIML 5L9DL 3QUMH 1JGLL 4L3AA 3V4UH 1AMXA 1Q0XH 1KELH 1HEZA 3CVHA 4L1HA 4OFYD 2ICEB 4AH2A 5BV7H 1HI6A 4BXVA 2Z7UA 2E9WA 4A7QA 3WIHL 5K5YA 4X6EA 2Y2YA 3IE4A 1NFDF 4N1CA 3ALPA 1YJDL 5C8JA 1CN4A 1JP5A 2AMUA 3K5RA 4IIQB 5ILTL 4FQLL 4IS6A 4Z7OE 4OSUH 3C6LC 1E9PA 1ZA3B 2XT1B 1IIIA 4MSWA 5AUMA 2FEDC 3BO8B 1HHGA 3LQAL 3OC8A 5AW8B 4J28A 3MUHL 4ODHL 2HX9A 2FIKB 1LO0H 4LPTA 4N85A 3VXNA 4EXPX 3QIBA 1KJ2H 2BVQB 1OM9A 2Z31B 2X0WA 3QUZB 5DU7A 1KT2B 1J0IA 5ESVB 1IC7H 2ICEA 3VD5A 5T5NF 2K8QA 2J8UF 1ND0B 3QZWG 3PHAA 1B4LA 3ATAA 1XSOA 4DEWA 4IIQA 3VTMA 1WEJL 1DN0B 4FD0A 1YEHL 1GKEA 1BPLB 4KRNA 2RD0A 5F9DC 1ZA3A 1IFHL 1UH2A 3BO8A 4I4WB 1E65A 5J11B 2WXRA 3FDWA 2NX5E 2FIKA 1Y1UA 4JQVA 4BFKA 2A9ML 3MRJB 4HIJB 2AAVA 2BVQA 1BZOA 1JXJA 4KKNA 2Z31A 2DQHH 3QUZA 4ODSL 3TA3C 1KT2A 5HJBA 4F7PB 5ESVA 4JCLA 1KGJA 1UEMA 2WO2B 1VLXA 5EG6C 4XC1H 5FM5M 1ND0A 3HBQA 5FCSH 3QIWB 1PYWB 5TE6L 5GJTL 3IDJB 4HIXH 2ZYIA 1DN0A 1VIWA 4U31A 1FNGB 4YBHA 2YD5A 4HG4K 1G9NH 4I4WA 4LLWB 3KJ4C 3AY4A 5MERB 3U0TB 4FXGB 3MRJA 4HIJA 1NIEA 3THML 3FTYA 5GRWA 3V0HA 1HWGB 2A7BA 2K7QA 1J8HB 4FFZL 5DC0A 4F7PA 4AE0A 3HE7D 4MD0B 1EBAA 1J1OL 5C08E 4B95C 4GB9A 4EVNB 1GGCL 1II4E 4KKBC 2R0LH 1JZ5A 3QIWA 2BS9A 4QTHB 2GQHA 3HB3D 1GZQB 4QRQB 3IDJA 4GI6A 4FP8H 1F4XH 1NCOA 2QKSA 1FPTL 4A39A 3NN8B 3OKYA 1FNGA 3R19A 4N0UE 1VCAA 1GW6A 4DP0X 2DKSA 12E8L 3I2CL 3U30B 2ODHA 4LLWA 4RDQF 3U0TA 5MERA 1YNLH 3B9DA 4FXGA 3RVVC 3U0PB 3QEGH 4XMUA 4XCFH 1S5IL 3QPXL 1J8HA 2BSSB 4K8RL 4U1JB 4MD0A 3FU3A 1HEJC 2WANA 3N1MC 4EVNA 4LPYA 4YWGH 2YAMA 5GS0D 2V17H 4ZO8A 1QSEB 5F9JB 3R1GL 1E50A 3HNVH 4QTHA 5KBDA 4KOBA 1MHCB 3VXUE 1GZQA 2AK1L 3SBQA 4QRQA 1KCSH 1R3KB 2WKOA 2Z31D 2X1WL 3WCYA 1O7VA 2FO1A 3QUZD 2CU9A 2FT6A 1DVYA 3B34A 3JWNH 3NN8A 2BPBA 2VDLH 2VLMD 3FF7A 4P8QA 2N01B 4G2AA 3JZ7A 1TMQA 4JFDE 3TNNB 2ID5A 1RZKL 5DR5L 5AENA 3ZK0A 3U0PA 4LDCA 3MRDA 4G83A 1RUPH 2BSSA 4U1JA 4R7XA 2NY0C 4PB0L 4PS4L 4QR7A 4EBQH 4OUUB 1IVLA 3KWWB 4IDLA 5ADPL 1KXVC 1P6FA 1CDJA 1CFMA 3PLYA 1QSEA 4RX4A 3HAEB 5F9JA 3DHJA 3BKYL 2TRYA 4TM9A 3UEQA 2FX7H 4HQQL 1MHCA 1VPOL 3L1FA 5BVJA 2YN3A 1KIQB 1R3KA 3SIKA 1S7RB 3QXAB 3ZKMC 2W9EL 3UJTH 5LB1A 5GZOC 3PABB 1E2WA 3UJJH 4IKIA 1BGXH 5I30L 3RKPA 1ILUA 4RFNC 2EEFA 3N85L 1MEXL 3OKOB 3TNNA 2GCYB 4W93A 3B5GA 1DSFL 4R83A 4OQTA 5B1JC 2YUWA 2P80A 5C1MB 1A64A 5CFHA 2V9RA 5DK3A 1DZ0A 2V9TA 4OUUA 5IM7B 3KWWA 3B56A 1SN0A 1L4IA 4LP8A 2A0LD 3A67L 3BGMB 4JREC 2MKWA 3HAEA 1M7XA 3M1OA 1MCOH 4FXKB 3RI5F 2WLKA 4MJIE 3HTLX 2PTVA 2PPDA 4WO4B 1KIQA 2W92A 2GKIA 3L2LA 3MLTB 2WK2A 4DKEL 1J8HD 1S7RA 3QXAA 3DARA 1NBVL 3KR3L 3FL7A 2Y6SD 3PABA 3QCTH 3RVUD 1F6AB 1NLBL 1LEIB 1NAMB 2WAQA 3NGBC 4KFMA 5HI4D 1CD0A 2FWUA 3OKOA 1BWMA 5HDBB 2GCYA 3DURB 2BX5A 5GXBB 3WO4C 4C4KO 2P48B 2Q8BH 3B2VL 1LP9E 2FYVA 2NLJB 4ZMNA 5IM7A 1EEYB 4RWYL 5EO0B 4NCC1 3WEBA 3RQ3A 3OAUH 1HTYA 3BGMA 4N1EA 4FXKA 4P23C 2YZ1A 4WO4A 4Y7MA 1ZV9A 3MLTA 4Q89A 4V2CB 1FO0H 2NY4C 3ARGC 1F6AA 1LEIA 1NAMA 3DYOA 4PY7B 1QSED 4PG2A 2Y2WA 4S0TD 3DURA 3A4EA 1N6QH 1L9NA 2J2ZB 4N90E 3UMNA 1FHNA 5BO0D 1PAMA 4UYQA 1UKSA 4XNZB 5F97E 4TUKL 1Y18B 5E8DL 4HPOL 4KI5E 2NLJA 3LZNA 4G7YL 1EEYA 5IT2L 3QEUB 4ZOAA 5EO0A 1S7WB 2H7WA 2F54E 5TQ0H 4BFJA 4RMSA 3V8OA 3SDAB 5I1CH 1GOGA 3MCLL 1MNUL 1HWHB 1MZYA 2VDML 3ABMB 4CVZB 4F8QA 4ABWA 2P80D 3VNYA 2BVOB 4U1SB 1G7LB 2F53E 4PY7A 2WZ0A 3V0IA 3AB0B 1UWEH 2I9LB 4HH9B 3BPOC 4JRFA 1NCGA 2J2ZA 4AI7A 3H3PH 5B7FA 4I1RA 1NGYB 2OL3H 2CDEB 3MRCB 1Y18A 1S78D 4D9RD 3TWCL 3PV6B 2NY1D 4M6NL 4DESA 4J3OD 1XGTA 3QEUA 1S7WA 3Q6GH 4OH2A 2ZG3A 2FBRA 4O58H 4WEBL 5TD4A 1HFUA 2SEBB 2O5ZL 2ADIB 3SDAA 4PJXE 1F1AA 1WZKA 4LLYB 4IBZA 3BUYB 3I74A 5H94B 1NMBL 3F6JA 5HYJB 4O4YH 2Y5QA 4CVZA 1MCPH 4MX7B 2N1KA 2BVOA 4U1SA 3D8MA 1G7LA 5F7MC 4BQ9A 5I75C 2BXYA 3ARDB 4U1GC 1TR7A 2I9LA 4HH9A 4IBQA 4PJEB 2FECI 3W3BA 3S0PA 4A6YH 1T1ZB 1MW3A 1NGYA 2CDEA 3MRCA 4WO4D 5I9QB 3T0DA 2YBGA 3PV6A 1BG1A 3SDCC 1T89A 1OSEA 2C9RA 5ETUB 3UC2A 4P2AA 5ISZB 4X0KB 4G71B 3WL9B 1JD9A 3UTPD 2SEBA 2IH9A 2ADIA 3E7JA 4H5SB 4MMXC 4ONHB 1JGIA 4LLYA 1UB5B 4LGSB 2BSCA 5H94A 3BUYA 5M94B 4UQBA 5HYJA 4HAKA 3WJMB 4MX7A 4DKAA 2VL4A 3NIGF 3IMTA 1MHHB 5AW2B 3VB9A 2HN7B 3ESOA 3LNGA 1WITA 3ARDA 3C5XA 3JV5A 3IMRA 2K4WA 1A6WH 1DBAH 4JRXE 4E9WA 1JVOA 4PJEA 4UIMB 1T1ZA 3S5YA 4LPXA 4I0PD 3OTTA 1MFDL 1ZLSH 4QHMB 4F80A 2BSED 3KS0J 4YHKL 4P9HL 5ETUA 3WMPA 5ISZA 4QHKJ 4X0KA 1RUKL 5A16B 3WL9A 4KQ4H 1XBDA 1AMYA 3PJNA 3VFTB 4H5SA 1BAGA 4ONHA 5FUOL 4PBWD 1UB5A 1SMDA 2ENPA 3IDNB 3NK3A 2ZCZA 3FJTA 4UYPA 2VLKE 3WJMA 1KOAA 1MHHA 5I26A 2HN7A 1XL6A 1RAMA 3HMWH 3IXTB 4YHPB 4MAYB 4UQ9A 2BY0A 3TN0C 1NOFA 4UIMA 2R39A 1BBJB 3KJ6H 1WGOA 1G5GA 5IBTL 2VTFA 2OMUB 5DGRA 2FATH 5A16A 1O75A 4PN6A 3VFTA 2VDKL 4MD5B 2DLIA 4NHCL 5AVQB 4YGAB 1XGYL 1QPKA 3MFFB 4Y2DC 3IDNA 4NP4L 1H6UA 3VFRB 2O1AA 2ZX5A 4P5KB 1QSZA 4HUNB 4KRLB 4LQFL 5B4MD 4WFFE 5E6UB 4HLJA 1T1YB 3IXTA 2B2XL 1UOVA 4MAYA 4YHPA 4O02H 2DEWX 1FL5B 1AI1L 4JX0A 3LOWA 1BBJA 1SYSB 2B4CC 5HYJD 3TV8A 1TQVA 1ASOA 5CEYB 1GAFL 2DJUA 2OMUA 2ENJA 3FTGB 3MTXA 4UOZA 4X6DF 4MD5A 4DUWA 3A5VA 1BVNP 3ARDD 3U1SH 5AAWC 5LAPA 1L9PA 3MFFA 4RGNE 1P7KB 2GTQA 4K3DH 5HDRA 3VFRA 3IDUA 4O2CB 4P5KA 4ENZA 1F58L 5AVXB 2XQYK 2KL6A 1JZFA 1T1YA 5TH2B 1GOHA 2YAOA 1D5RA 5DXWA 1FL5A 2JF1A 4AK2A 3KVPA 4Z18A 1SYSA 4Z3IA 2F9BT 4A7UA 3P3YA 4GKSB 1QRKA 4AT6B 1QUPA 5CEYA 3PHOB 4DGIH 5MENB 5ECGA 3FTGA 4QHKI 5DFTA 1NDGB 1AYOA 1VFOA 2H9GB 4OZHF 4YXLH 1P7KA 1I7RB 1B2YA 4O2CA 4UQCA 2DS4A 4X80L 1MF2L 4LAJH 3KGRA 3A6BH 1DQDL 3OG4B 5TH2A 4Y4KD 2NNRA 4FKHA 1IGIL 2KUTA 4P4RB 3CVCA 2E27L 2FCBA 2ICCA 1KFAL 3B7YA 3PDDA 4FNUA 3SHSA 4GKSA 1E90A 4AT6A 1HCZA 5D6DA 1U8HB 2PKDA 3PHOA 5MENA 3CVBA 4HETA 1NDGA 2H9GA 3CC5B 5LWYL 3HZ3A 1ZANL 3OX8B 1ZOXA 3CLEL 1I7RA 4Z7OB 5ES4B 2C7FA 4JRYE 3VX0A 3KPTA 1YEEL 3IN2A 3QDGE 4P4RA 1A4KB 2F08A 5I5RA 2NY6B 3D4GA 5M7QA 1IAIL 4N2LA 1H5BC 1L9OA 4MDRA 1QI4A 2ZPKL 3LVTA 1U8HA 2YEQA 3NSCA 1CXHA 5TFSL 4G5ZL 1CZ8H 2V5SA 4IMKC 4QRSB 2F1AA 2OJ1A 2FWSA 3CC5A 2IMNA 1DBML 3OX8A 4NDMB 2EIMB 3PWUB 4UT6H 3I9PA 4H1LH 1SXNA 4Y19B 5E2WL 5BUGA 4HXAH 1A4KA 4Q2ZB 4M93C 3V4UL 2JIXB 1Q0XL 2FJSA 1ZLDA 3RIKA 2J1XA 4XNYL 3Q8CA 1CFBA 3LS5L 1MHPH 4QRBA 1YLBB 2KI6A 4X9GA 1EFQA 5D2NE 2EXYC 4QRSA 5CU5A 1T7YA 2CJUH 3L4WA 1D5IL 5FV1L 4NDMA 2D2CC 3PWUA 2HFGL 1RV6X 4DAGL 2FUTA 4ZPVB 2IH3B 1OTTC 3NA9L 3V0WL 4WHDA 4Y19A 1JGVL 4XPHH 2AJUH 1CFVH 5E23A 4HF5H 4BINA 1TVHB 2WZAA 3S35H 1YEJL 4Q2ZA 2FZ3B 4TYUA 2JIXA 3KPMB 2OULB 3M46A 5EIIG 5J06A 2IALB 4N1HB 4PP2B 4UV4H 4JN1H 2R8SL 2HX8A 3L95B 5C08B 2X7LB 5F7AA 2D0GA 5ABDE 1SJXA 5ABAA 5L88H 2QSQA 3IRCA 2RH0A 1EJFA 2W0FB 3OG6B 3WTUA 4EN3B 1QSFD 2A6JB 4ZPVA 1U2CA 2IH3A 1IKFL 4LB8A 4N0UB 4JFFE 1KTKE 1TNMA 2DWXA 3Q8FA 2O5NA 4QXGH 5GRYA 5KSAD 1NGPH 1TVHA 3CFUA 2FZ3A 2YRLA 3H7LA 3DSFL 3KPMA 4XAKE 3H1ZA 4YC2C 4ATTA 2IALA 3L48A 2X28A 3OPUA 4PP2A 3TYGL 3NEXA 3FRPG 5GGVH 1SVZA 3DUSB 3L95A 5C08A 2X7LA 1YNTB 5JIPA 1YG9A 2WUCH 4A04A 2DQGL 3EJZC 4QJ4B 1B6UA 1VRSA 4HIXL 2NY6D 2PP9A 4E9QA 3VXUB 2NCMA 2W0FA 2PR4L 3FU0A 4EN3A 2A6JA 3CFDB 1TQTA 1GGBL 3Q2CA 1VZIA 2D0FA 4N0UA 1OGAD 3OMZA 3N43B 3QI9B 5E6RB 5IQ7L 5FYLE 4NPKA 4F15B 1N68A 1UZ6E 4OM0H 2LQRA 4WZ9A 1OTUD 1QQDB 4GQ9L 4WW2B 1N7ML 4JFDB 5HGGS 2QZQA 1IE4A 2ZOUA 4CA4A 4KZ0A 1UADC 4Y9BA 2PWDA 3ZN6A 4BZYA 3DUSA 2R0LL 1DCLA 3TBVA 2Y24A 1YNTA 3BVTA 4Y19D 4FTVE 4RRPM 2FD6L 2BZCA 3EF4A 3VDBA 1T3FB 2V8MA 3KAAA 3VXUA 3P9MB 1TT6A 3NP4A 1ZGLP 1EVTC 1QWUA 3QI9A 1NGQH 2ZUXA 1YNLL 2BWDA 3D5OF 1JGUL 4KAQL 1OL0A 4XCFL 1QQDA 1EK3A 4WW2A 2QQNH 4QTIH 4JFDA 4WHTB 3EDDA 3GPEA 1MCKA 5FS5A 1JTPA 2VDNH 3A6CL 43C9B 1RUQH 5D4QA 5HDQL 3HI1B 2V17L 4XX5A 4D7PA 5I6XB 5SWSD 4FFYL 5F3BB 1J10A 2ITFA 2XWRA 4OZIE 1T3FA 4N3UA 2QT6A 2CXKA 4MJIB 3P9MA 3V0FA 5A2JH 3BAJA 2BFGA 3FB8B 4AQ1C 4PRDB 1B0GB 5C08D 1DVQA 1IFGA 2GUYA 4ZFQA 1UA3A 3S3BB 4HMDA 4IQHA 4JHBA 4WHTA 4WI2A 4ZMXA 4MNHB 4XNUH 5C0NC 4TLUA 43C9A 1ACZA 4EN3D 2XVGA 4N2AA 3HI1A 4F33B 2DKUA 2QTEA 2H5UA 3GTVA 1A8JH 3V55A 2AEIT 2C4FU 1QTYT 3SZ6A 3CH8A 2GVYA 5DHVB 1PZSA 4H88L 1ESOA 2WLIB 3NABL 1PLAA 1BGXL 3FB8A 4PRDA 1B0GA 3FBKA 4WFHD 3FTWA 1S7UB 1I8LC 2V5YA 4YHYC 3V2AR 1V3JA 3APDA 1PY4A 4MNHA 1H3XA 1T7VA 4FQXB 3VXUD 4JPVH 3ZE2F 3VXPB 1UATA 5I5JA 2A83B 2QQKH 4F33A 2UXFA 1NTDA 3QI9D 4W9FC 1MCOL 5C70A 3ZGIA 4CC0A 1LHZA 1WFJA 3NSJA 1XGQB 2E7LA 2O5XL 4YVNA 4TTGA 3DYPA 2IG2L 4XNDA 5DHVA 4TMPA 4PWGA 4DKDC 1PLGH 5H8DA 2WLIA