2C9PA

Cu(i)cu(ii)-copc at ph 4.5
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Electron transport
total genus 19
structure length 102
sequence length 102
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9pA00
1IX2A 1O6TA 2OMYA 3BC9A 1H6TA 2RA1A 3BCFA 2OMVA 1O6VA 1H6UA 2WQWA 1XEUA 3FAWA 4AW4A 4CILA 2OMZA 2OMTA 1LYQA 4AQ1A 3FAXA 2C9PA 2Y5QA 4CC4A 2OMUA 2OMWA 2WQUA 2C9QA 2WQVA 2YA1A 1M9SA 2UZYA 4CC4C 3BZ5A 2C9RA 1M42A 2OMXA 2WQXA 3BCDA 1O6SA 1OT4A 2UZXA 1NM4A 5ICUA
chains in the Genus database with same CATH superfamily
1JPSL 2FBRA 3CH1A 5DJXB 3UH8A 4LL4A 2V7NB 3B1UA 5ELIA 3V4UH 3WFBL 1W8EA 5KSBF 2UVFA 3VXMB 5C6WH 4YMPA 2NR6A 2IDFA 1A6WL 1MFAL 3D3VD 3EFOB 3GPEA 4M93C 3W37A 2FR4A 4CN4A 2D7MA 1OIOA 1YEJH 1PDKA 4U1JB 4Z7WB 4QHKI 3TPKA 1KF9B 4MDIB 4HDIB 2HLEB 3OHXB 2J6EL 1G7QB 1QRNA 2L04A 4H1LB 4KXDA 5H37H 5IMOA 4TQHA 4YO0A 2X1XR 3VACA 4I1RA 1BGXL 2XOTA 2R0WL 4I5BA 2X70A 2NY4D 3ZGHA 1NQBA 2MKLC 2P8MA 1PSKL 5DHYA 5GZNA 4C4KO 1Z0NA 1BX2A 4G8IA 3SJVD 3O6MH 5MHSE 4LEBA 2AK1L 1JK8A 4KH9A 3A4EA 4E9RA 4BDVA 1FYTA 3GPSA 1PY4A 1FFQA 2F8OA 4QO1A 4TSAL 1X5KA 5DK3A 4QKXB 3UCRA 5TDOA 1AXSB 1MFNA 1LK2B 1Z5LA 4WHYG 5DQDL 2K9UA 1NIFA 3GBDA 1T80A 3HE7A 5I8CB 3PWJA 3QPQD 4ZXBC 3TNNA 1Q9WB 4XO9A 3VU2A 5CCKL 5C0CD 2B1HL 4GP8B 2EEDA 4JVWA 5TE6H 5C09A 2BCMA 2HFFA 3VXQB 1KGCD 3VGBA 2IXQA 3OMZA 1QSEB 2CIKA 3WV0A 7PAZA 4HHAA 1PTZA 2UVEA 4OFKA 3SGKC 1D9KB 3HIZA 5LVEA 4WFFD 5E8DH 4QRTB 1P9MC 2MOVA 4ZD3L 4W6WB 2KT6A 2YBRB 3S5LB 1WT5C 4KDWA 5KYYA 4N2FA 5IROA 4R97B 4M7JL 1RZJL 4JM2A 4ENED 5AOMA 1E5BA 4L4VA 4AT6B 1TQCC 1WEJH 1J9RA 2C9XA 3IDNA 3O0RL 2BVUA 2XYCA 4N85A 5DA0B 4UINL 5F96H 4GRLC 3GSNA 3QHTC 2OK0L 3KGTA 3RI5K 2P5EE 2DQMA 3LAFA 1RVFL 4P99A 3QUXB 2ITFA 4JX0A 3V10A 2QADD 1KIRB 2X4TB 4V33A 4U6HB 2YA1A 4NQDE 1WWAX 1AGEB 2IWEA 2IMMA 4YSPA 5JIQA 5T5FL 5J9PB 2BP0B 3DRTA 3DJ9A 3LRGA 1F4XL 3D30A 3X13B 4ONOA 2EVHA 1T04B 1NLDL 3ASNB 2PTTB 4MD0B 1WC7A 3ILPB 5I73B 5JXEC 5LAXA 1GOGA 4FYTA 3VSTA 4OF7A 5FC9A 4FABH 4YK4B 1GS8A 5JDSA 3TYFA 4BFGA 1J8SA 2IBGA 4KX7A 2YKKA 4PGCB 2HN7B 3SO5A 1WTLA 4NFDA 2C4FU 1A9EB 4LLDA 1WV7T 2VXUL 2ALWA 3ABMB 4YDIL 4MNHA 5MEOB 1ZAGA 3FT3B 4MBRA 1G7IB 4HK0B 3B3IB 1EPFA 3HNSL 4MMXA 1SVCP 3UEQA 2BDNH 5DJZB 3K4DA 5DDHB 3IMWA 2H0JA 3DDGA 3MO1A 3ZDYE 1YYMH 3RWIB 2JB6A 1BAFL 5CMAA 3MXWL 4IU2B 4J4PC 1G0XA 3OX8A 2BH0A 3LIZH 3MCKB 4BUGA 4M48L 4LOUD 3HJEA 1MCLA 1JPTH 3CVBA 3WTYA 5F7NC 3KL3A 5IOPA 4LIQE 5H2BB 4MCZB 4Y19B 1XH1A 4I9WD 4YHOL 4MDJB 1WE5A 4IJ3B 4DP1X 1QLRA 2DM4A 1WZKA 3WMPA 1CI3M 4O5LL 4XPGH 4XVUC 3DX1A 1A5FH 5ADPH 1D2OA 2YZ1A 3GMPB 4KK8D 1SF3A 4MQSB 4PJ8A 4S1DC 4YHKH 4B27A 1LVEA 3HG0A 5CLTA 3CMOL 1EO5A 3MGTA 1P6WA 1TSHA 2WLHA 2X4NA 4HBCH 2UX7A 4JFFD 3WHE1 2HRPL 1HSAA 3DDFA 5J5EA 4MMYB 4P2QE 5EU6A 3MRJA 5FCUL 4ZQKB 3ZXAC 2ZSWB 3ZL2A 2HH0L 2AQNA 2X3BA 1FIEA 1IM9B 4PJAB 4YNYA 4G7YH 1MVFA 1THCA 3GJEB 4M00A 4TRPH 1INDL 1RZKH 1ZEAL 2RFXA 1CFMA 3BSZL 5EEZA 5F7LB 5HJ3A 1F3JA 3UOAB 2IDUA 5JDJA 2CO6B 1GW0A 2DBLH 2DRUA 1SQ2N 3ZTEA 3UJJH 4RAUB 2J6WA 4K8RD 5DSCA 3TVMA 2V2TA 4ES8A 1XR9B 5AW2B 1MJ7H 3QXAB 2WKGA 3QI9D 1AD0A 2VL5B 3FONB 1U42A 4S2SB 3FFDB 4R3SA 1T20B 2H2PD 1EO8H 3QAZC 3Q8CA 3U46A 1U93B 2WB1A 3AY4A 2NY3B 4WI0B 5DHVA 35C8H 3QQ9C 1MI5E 2FWLB 1RFDL 1YEFL 2Q76A 3U0WH 2VLKD 1DQVA 2VXVH 4J3XA 4HWBL 3G6JF 1VFUA 3IE9A 5FYLH 5L2KD 4K23H 3ME0B 4CJ1A 1NDGB 4JHVA 4C8XA 1ZPUA 1BP3B 4ZW7A 2BLFA 3DMMB 1RERA 3V5DA 4M3KB 3CMGA 4OJFL 5CXPA 3X3FH 1U8LB 2ORBH 1QEXA 3WL9A 2BSSB 2WLIB 3QORD 1X9UA 5CR1A 2CRIA 5L6YH 4A2FA 1BD2A 4A37A 4Z95H 2ZXEB 1QVOB 2F58L 2Y2YA 4QHMA 4HX1A 5IVXB 1AYRA 2BOBB 2Z31B 3ESPA 1BBJB 4JM4H 4J3OF 5JZ7C 3PUUA 1KC5H 4LCWD 1INEL 4W9HC 3KCPB 2CIIA 2E9WA 4JG1L 4MNGB 5ECJE 5B1BB 5GGRB 4GRWF 3ML8A 1GZHA 2HP4A 1J0YA 3VFVB 3HHMA 3CWGA 3M86A 2GJ6D 1IGIH 4LCYA 5E4EB 3LPWA 2P7TA 3CFDA 3HB3D 3SQOH 1H5BB 4LK4A 4LPVA 2WZPD 4TPRL 2IPKA 3FCGA 1A7RL 2MNJB 2NY0D 3QXVA 1EVTC 1S3KH 5BQ7B 3V7AE 3QWRA 5TPWH 2YHGA 5ESVB 3OZ9L 2QQNH 4B7LA 1U36A 3B9EA 1UKTA 2LE9A 1G43A 1WCBB 5EIIA 2E74C 3H42H 4K5MA 5E9AA 1IEBB 1NFDE 2W38A 4PRBB 3D3VB 4IGBB 2YAQA 1HYSD 1NGYA 1XVSA 5IJVB 3QUYB 2AV7A 3EYFB 4ODVH 1VKXA 3BEVA 3SGJC 2QVMA 3AQYA 1M05B 4BHUA 4IBWA 2GSIB 2IAMC 3VTMA 5IMKA 4LAQH 3A6BL 1UACH 5KS9E 2YBGA 2VT0A 4PJ5D 2P48B 3ZE2F 4P48A 2NXZC 2OQJB 4NQCA 5KSUA 1LO4L 3CU1A 4WGVB 2ENYA 1MF2L 4DVBB 4OUUB 5C0EB 4ODXB 2NY4B 1KT2B 1F6AA 1OAZH 1RJYA 3RDTB 4I7ZC 3AACA 3GF8A 3SJVB 3L3GA 1ZTXH 4JDZA 1T1XA 4KFZC 3CK0L 4QXWA 4HIPA 4NIYE 5E6UB 1RZ8B 1I1YB 4UUJA 3P4MB 4X5WA 2EYSB 1A25A 3SD2A 4O58H 4PD4J 2I32A 3IK2A 2YGVA 2ZUTA 4RWYL 4LSRH 5GGRY 3NFNB 3GM0A 3O2VL 4LRIA 4NT6A 4YZWA 3N40P 5I24A 2A74C 2IDQA 3V0AC 4DHLA 1NCWL 4K2UL 5TE7L 4I77H 1LE5A 2A9ML 5IR1A 4P0DA 2R29A 2QGBA 1R3IH 3OZKA 1P1ZB 5C0CB 2R15A 4EN3D 2Y07H 2JJTA 2COVD 4N8VG 5KJ4A 1L6ZA 3EFDH 4Y8AA 4CVWA 4LEOA 5LQBH 1AHMA 4P9HC 2AXFA 3ZLQC 1MAKA 4JFUA 2EEBA 2O1AA 3QI9C 4ODHH 1Q8MA 1F1DA 2FQDA 3MDJA 3FN0H 1VFAB 4AC4A 4HKJB 4TXVB 5E99H 3IFPB 4Q6IC 1YECH 2M2DA 4LT7A 4JMXA 3QQDB 4UOW1 5D2NB 2FD6L 1A6PA 3BWAB 5JOEA 2QEJA 3ARFB 5EO0B 4IU3A 1IGCH 3MROA 4K3EH 4MQ7B 4RMUA 3VI4B 4F37K 1I7TB 4LLWA 3ZO9A 2CO4A 1GZQB 4FP8H 1RH8A 4RGNC 4R7LA 4H20H 3X3GH 4YHML 4OV5A 1EFXB 3CX5K 5MHSD 2D3NA 1JGLL 3QJTB 5ALBH 4LRNH 3LRKA 4MJ6A 4YHYC 3W2DL 3QXDB 2VM9A 2WXNA 1XGTB 2J4WL 1XF5A 3TZVB 2MHAB 4WKZB 4GS7C 5F7UA 5DQ9B 4WNQB 3HHSA 4U4IA 2UXTA 4M5YL 4ZMLA 3KMDA 2X10A 5I71B 4KBPA 2EDJA 5CLYA 1O6VA 2VO8A 2WZ6A 2QGDA 5IG7B 1X5JA 4KJPD 2VLJE 2CUIA 5BRQA 4V1DA 4JN1L 3US9A 4DK5A 5DGRA 1IKNC 3D0LA 3I50H 2EP6A 2LLLA 3GZKA 1CF1A 2EDNA 1UM6H 4PJ9C 2CUMA 5DQJB 2QKIC 3UZEC 1DDHA 5D1QB 5HI5C 4O2CA 4TNEA 2D7TL 4HFWB 1CFQA 3DURB 4K7PH 1DQDH 4MA8H 3ARTA 3FQ1A 3VX0A 3WY1A 1FO0A 2MOQA 5CBEB 2BXZA 1I8IB 2IBBA 1A7PH 1VHPA 1DVFB 2ED8A 4M1GH 4HUWB 1F45A 1EJFA 5J12C 3WXWL 1H3PL 1PF3A 4FTVA 1G7MB 1UA3A 4DGIH 1WZMA 5DD0L 5KG9A 1AS7A 5D4QA 3F12B 2P5ED 5EBGA 2QGEA 1ACYH 2VXTL 4O4YL 2XNAA 3GSNH 4RX4A 4ZFFB 3GD1C 2QPSA 3KEDA 5I1DA 3CU7A 1LWRA 3H9HB 3IU4H 5C8JA 1AGFB 3IFOA 2Z91B 3DYPA 4G3YH 5A6LA 4NQDD 5IHHA 1RIUL 4PJXE 3WMSA 1NEZA 3QWOA 3AWFA 1JFQH 3N0PB 4F57L 3NA9L 3HS0B 4C54A 1J1OL 5FO9A 2QHLA 1U4FA 1FDLL 4K7FA 5DMIH 4XXDA 4EI0A 3FMGH 2DQFA 1MCHA 2DQTL 4X5PA 2CMRH 2KLSA 1XMEB 4XPFH 4NRXA 4QOKE 2VLLB 4XPAH 5DXWA 1G0YR 1YUHA 1ZWIA 4QYOB 1A4KA 1CXLA 1UCTA 4KJYA 4CNIA 1MRFL 3WJJA 1QR1B 4Y5VA 4BSWB 2OTWB 3HLAB 2EXSA 4X99B 4AIZA 4UIKH 2V9UA 4EZJA 2I07A 4AMWA 1ZDQA 1RHHB 5IM7B 1A4JB 1E43A 4XCYA 3ES6A 1KIQB 3HAEG 4J6RL 3RA7H 1JZ4A 3LNHA 5SWSA 4JGJA 3TYGH 2BVOA 4PBVC 1AGBA 4ANVA 4PJDB 3RWCB 4AV5A 2CGYA 1R5IA 5BZWB 1CD9B 3VXUB 2O30A 3OQRA 4F58H 4ICWA 4J8RA 3SDXA 5HYSG 3O6FD 1AXTH 1KJMB 4IRSD 1W6WA 5T3ZH 2Y36H 4LPYA 2HTKC 3D69B 5KW9H 3FO1B 2YAPA 4ZPVA 4LXFA 3E7JA 1AS8A 1UD4A 3LRMA 1DQIA 3FYEB 3KLSA 4ZUTB 1MRDH 1T5WB 3F64A 5K39A 2DWSA 4Z7QB 2YEQA 4E0RB 2CO3A 1RULH 2H0PA 5AUMB 3BFWA 4JBSA 2VLKB 4X7EC 3UTZA 3FTSA 2IC2A 7PCYA 5I1JH 3ZMNA 4KHTL 4PJEB 1YPZF 3WUWA 4BRJA 2FX8L 2WXHA 3BVNA 3K1KC 4FG6D 4K55A 4X7SH 1XGRA 1P6AB 4F1ZA 1MLCA 3V0VA 3GMLB 3BZDA 4P2QD 4ZS6D 5A6MA 5IREA 5MERA 2R0KL 4XP4L 1NMCC 4RFOH 1MPAH 5K59E 3WLBA 2B4CH 3BH9B 1BQHB 4Y4HA 1T0MB 4YDJB 4X6BA 4H88H 2WQWA 1PNCA 1I85A 2V5YA 4XCEB 2Y1VA 2VR4A 4WI4A 5GZOD 3BWZA 2HT2C 3CFBA 4QGTA 4MLIA 5E94A 1OF0A 2JJVA 2A1WH 2R0LL 3NQIA 2HT3D 4QMEA 1OP3H 2O5YH 1RUKH 1RK0B 1I8AA 1OGTB 3HC3L 3TEYA 2OJEA 4IIZA 4JPVL 3REVB 2HFEB 2E9JA 1NGPH 3EYUH 4GRMB 5HHNB 3RGVA 3GUTB 1KY6A 5EZIH 2GJ6B 4B0MB 1KN2L 4FEIA 2VDNB 1K5WA 3QEQB 1KXQE 3EH5B 5H4YA 1F02I 1D5IL 4JPIB 3SDYL 1MI5D 4M4PA 4BUHA 5IMMB 1ZGLB 3MMEB 2UY6B 1MH5B 3CFIC 5MEQA 4KUCF 1CT8A 1BZOA 2NY0B 4BD4A 5DHVH 4ODSL 1Z3GH 1A6AA 1E9QB 2FATH 2ZXCA 5IB2A 4KY1H 1UUNA 3VGEA 4Y2OA 5F0LB 2EECA 5CGTA 5F3HB 3EGSB 4F8QA 4YH6A 5F1NA 5IB4B 4GG6B 1RIHL 2SEBB 5C6PB 4ZTPL 3VXPB 4KVPA 3NJFA 5B8CC 1U9KA 2EEFA 5GS2H 3UBXI 2CD0A 4TQEL 2YPKB 1JXFA 5AZEL 4A6YB 2PYFB 2LTQB 3P2BA 15C8L 1XZWA 3S88H 4YDNA 5GS1A 1FG2B 5JW4M 1EHLH 5E08H 2UXFA 4L8SC 1CLYL 4DKEL 2EVGA 1TKWB 1TETH 2R1WB 3T2LA 2AS5M 1NOAA 3NZSA 3PNWB 3WFDL 4HUNB 4UV7L 2EKSB 2W07B 1KB3A 4NHUB 3L1OL 2YK1H 2EDFA 2FSDA 3RLSA 3SY0A 4KGJA 5A2IH 4FLOA 3T2NL 1KYOK 5ICXB 3MLZH 5TQ2H 5CD5D 5TF1H 1IFGA 1M71A 1LO0H 2F53E 2E86A 3WY3A 4P3DA 1R1CA 3RPIA 1NIAA 1U8HB 3GXFA 3IDGB 5I9QB 3KPLB 1XIWA 4X4KA 4IRZL 1IAKB 4HIXL 4IOFD 4E9SA 1IARB 4AL8L 3BDYH 3FTWA 4UT9A 3RX8A 2OCCB 4JM0A 5CBAA 4XPGL 1HL8A 2V7NA 3PWLB 2E4FA 3EOBA 5EU4A 1FFPB 5JPNB 4N87A 5KN5A 4PJHB 2XY1A 3ERXA 2EYTB 3BZ4B 5C3IA 2O61A 4U3XA 2CLVA 4MD5B 4KKCD 4WU5A 4EN3B 3EDEA 2YUWA 4U1JA 5IBTH 4Z7WA 4HDIA 3OHXA 4OJDH 1G7LA 1D7CA 1FYHB 3KGUA 1G7QA 2IWGA 4H1LA 4L8BA 3MV11 2B9BA 5I0WA 4RWHA 1X5AA 4UT6H 1GAFL 1NCIA 1QATA 4IKKA 5CP3A 1SEQL 4AQ1C 1OZTG 3VI3E 1USQA 1SN2A 5DVLA 2CA3A 5FM4A 4Q9QH 1HS6A 3EGDB 3O9WB 2DQIH 1NSNH 4WWKC 4NO5B 1WGVA 3CZSA 3IKCA 3AS3A 5DHDA 2QQLL 1IAIM 1A6TA 1JNLL 1IAOA 2WSDA 2ZAHA 3LH2L 2YQ2A 5D8JL 5FA3B 3S6CA 1FSKB 2GPZA 5KAQG 1C1EL 1F90L 1MJ7L 1O7DC 3OF6D 4NQEB 1JPST 3PHQA 5D72L 2X0UA 2BZCA 2FQFA 1OK0A 3L5HA 3ZE1F 3S2CA 3SPHA 3L5JA 3MV8B 3N91A 2VN6A 4A7VA 3LRLA 2EIDA 3AG3B 5ADOH 4X80H 1CDGA 5AAPA 2EACA 1Q9WA 4HJUA 3GS4A 4C83A 1SLXA 2F19H 3L4ZA 1GOHA 3MJ9A 2NX5E 1AO7A 1WA0X 1OAKL 3SQRA 3QP3A 4OZ4B 4L3CB 4PRHB 4CUCA 1V3LA 1JF5A 1Q0YH 1MLBA 2H9GB 2YSSB 2Z8SA 5DEFA 1NCAL 1L7TH 2XRAH 3QDGB 3RFRA 1UXSB 1CICB 4WTZG 3IVKA 4S1QH 1JBJA 1D9KA 4YUEH 2AZAA 1OGAA 4QRTA 3VRIA 2NNRA 2YBRA 3WNJA 3EIFA 4YR6A 2YKLH 4F3FA 2XN9E 4NCC1 2ZICA 5D2LE 4PJ7E 1MFBL 3FTXA 2EDYA 5GGSY 5E2TH 4HJGB 1GYCA 3TM6A 2W59A 3PIQB 3WO4C 4BKSC 2N56A 1YN6A 2G5BB 3PCYA 1L9NA 3QUXA 4FF9A 1KCKA 4FQCL 3I3DA 1KIRA 5D6CB 4KOCA 2VW7A 4DAGL 1F2XK 5CWSB 1FFRA 3ARED 2VDRH 5JHMA 2LR4A 3KPMA 4TNGA 4LPCA 4JFQA 3E8VA 3GDBA 4N6RA 3FCBA 2XUWA 4N5UA 4PRAA 4IOSA 3IFLH 1RZGB 3JSSA 1UTDA 5EBMA 3WFCL 4MD0A 5CEZH 4KQ3L 3KAAA 4IRJB 2B8OT 1A47A 2Y7NA 2VLJD 3INOA 3U4AA 1H3XA 5L9DL 3PF2A 2IH8A 2ZP9A 4PGCA 1SDDA 5F1OB 5F7EL 2PO6B 5AVTB 1E7UA 5JA9A 1TENA 2D03H 3GBNL 4G6ML 3HMWL 5MEOA 3ZJAA 3FT3A 1WFJA 2Y5TA 3B3IA 5AW7B 2G5UA 5EPMB 3DV4A 4NZRH 2K8MA 4QHKJ 4N0UE 4XTRD 3QISA 2FEJA 4XZUB 1UWFA 2H1LM 3UAEA 1MAMH 5DJ8A 4ZUUB 1NAKL 1S5HB 3KPSA 1U8MB 4CVZB 3MBED 1UT1A 4NKQB 3ZDYB 1IJNA 3ZMEA 4KWUA 3H9SB 3DI2B 3EUUA 2AJVH 4MCZA 4Y19A 3PL6C 1CFNB 1UM4L 4J3OC 5E5MA 1L3NA 1J8KA 4ONHB 2EDMA 4XWOC 1QWNA 3ILEA 1MQKL 5D1ZD 1VAHA 3GK8H 4EUPB 4R4BB 4TOYH 2HMID 4R9HA 1Z0MA 1NGXA 1NBZB 2CGRL 4YX2L 2BSDA 3GMPA 3S3JA 4XT1C 5C0AE 1QSFB 4TTGA 2BRRH 2C9VA 2D7QA 2OYLA 1GSMA 2DQHL 1RAMA 1IIKA 1RMFH 4YBHA 3L95B 3W81A 4LSRL 2EH7L 2FLRT 3CTTA 4KQ4H 2ESVE 3KM2A 1WISA 1WAAF 4ACPA 5JHLL 5LGHL 1SN0A 3TC9A 2GBUA 4PRPA 2WMPB 4MMYA 5GS3A 1FVDB 4YHPA 1R3JA 2CCLA 4ZQKA 5DD6A 5E1GA 4QOKD 1UWXH 5BV7H 5HSFA 3E8UH 5I5IA 1H19A 3DPBB 3GJEA 1HDMA 2QPDB 3ZKXC 2CRMA 2WQUA 4M3HA 5BVJB 3QIBD 2CO6A 5I15H 5E9DE 1ZLSL 5J1AB 4M6NL 1WFTA 1PW3A 1DANT 1JPGB 2AI0L 3AT9A 5ALCL 4Z5RA 4RAUA 4LMQE 5HVWA 1JV2B 3C08H 2V6HA 4WENB 1XR9A 2X44D 3QXTA 4CVXB 5AD0B 3QXAA 3FT0A 5CILH 4B6ZA 1CD0A 2MTAA 2VL5A 1RURL 3FONA 4S2SA 2G2RB 1ES0A 2DV6A 2EDBA 1E4XI 1T20A 3SE8L 2AK4E 2LU5A 4NO2B 1UOWA 1LE9A 4NYLB 1HI6B 1TO5A 3CFMA 5EU3B 1UUSA 3G9AB 2VE6A 1EBPA 2ZXWB 3M7FB 4L5FL 3SPIA 3S35X 4Z3GA 2BSTA 2BW4A 1ITCA 5I0XA 3MUUA 3FU7B 3LEXA 3DMMA 5JW3H 4UAOC 1GL4B 1GC1H 2HG5B 4R90L 4I0PB 5D93C 2WLIA 4AQAB 3NUKA 2E7HA 2QTEA 1V54B 2EIMB 5FA4B 1QVOA 1UFUA 3S4SB 1TLKA 1S78C 3D6GA 1LDPL 1DL7L 3UEZA 4ELKB 2D7NA 4KZEL 5IJKC 3K81A 4HWNA 1GPOL 1X5LA 5DJCB 5T8IA 4JFDE 4N5EC 5I1CH 1J1PH 4L1SA 3NCJH 1I1AA 1J9CT 5DYOB 3GYRA 5MP6H 5T1LB 1ICTA 4OLWH 2DLGA 4M6ML 3RL2A 4RMTA 4UYPA 1A6UL 1K6QH 3MACH 1HILB 2BIQA 3D2UA 3WJMA 3DYMA 2B59B 2E9BA 3MCG1 3OWEA 3RWEA 1R5VB 1QSZA 1MCWM 4N2OA 4AENB 4N26A 4NHCH 1H5BA 1EJ8A 5SV4A 3F85A 5C7XL 3C5SA 4MAUL 3HBPA 4IQHA 3QXUA 4N8VA 2NXYD 2H6PB 3ULVL 1IKFL 5L7XH 2OFQA 3PNRB 4PSRA 3RWJB 4CGUB 4ZODA 3KLAB 4W9DC 5BQ7A 1L7IL 3A47A 2JKNA 4Q6KA 5ESVA 1P5VB 3HCVA 4LKCA 5I5JA 3LQAL 5L8KB 3VXRA 4X8CA 4M43H 2Q3ZA 5A2JH 1XAUA 3OPUA 1SBSH 2AJXL 4L8CA 5INDB 2ADIB 4FG2A 2NOYA 4E42B 5AAMC 4L9DA 3D3VA 4PRBA 3RJQB 3U36B 1P5UA 3UBXB 3BLKA 5E1AB 2VAJA 2WLNA 2OCFD 3D25B 3RIAK 5IJVA 4I13B 4MA1B 1NFDB 4KRNA 4RA0C 3SCMD 5EEYA 4OCYH 4JFEB 4X6FB 5CCJA 4HEPA 1M05A 5EO1B 1AI1H 1E8YA 1PFOA 3QDHA 5BVPL 1FIGH 1N7MH 1BJ8A 3MNZB 4B5EA 4MAZA 4WIQA 5BPPA 3HMXH 4U2ZA 2QVTA 5GHWH 4TF4A 5HGDB 4XWGH 2AAAA 4NNPH 4H40A 2OSYA 1THAA 2LFEA 3MRRA 3ILQC 3I02B 3L3JB 3WEOA 2XTSA 3SJVA 4FQ1H 4CADA 1CC3A 3G04B 3SE6A 1DJGA 2GI0A 2F53D 1BQLL 2WNXA 4PJCE 5A40E 4PJFF 3NFNA 2HLAB 2KERA 3DPDA 3VWKC 1XCTB 1HIMH 2DH2A 1K8IB 5IFAH 3UP1A 3QIUB 3R0MA 3VA2C 1YEIH 3MJWA 5KJRH 3SIKA 4WEBL 3K7UA 2A3TA 1A2YA 2BOLA 1TQWA 1DUYB 1X5FA 4UT9H 1W16A 5DLML 5F8QC 5C0CA 4S1SL 2K1MA 3GMMB 3HR5B 1T4WA 1J0KA 3VFOB 4L4JA 3R1GL 3OB0H 3SBWC 2CBMA 1L9RA 3QJHB 3IFPA 3IDUA 3QNXB 5D2NA 1KLGB 3T77A 3BWAA 2DMGA 5K69A 1QOKA 2ZOWA 1QFWH 5E5LA 1LEGA 1ZJBA 4W9KC 3DI3B 3UGEA 4MQ7A 3PJSB 2GB2A 3RY6A 4H1LH 4XI5C 2NYZA 3OAZH 3UAAA 4QXUH 1GZQA 1Y0LB 1AE6L 3ARDD 4POYA 4Y9EA 1ROCA 5A2KH 1KENH 3NN8B 4TUOB 4FNPA 3EZ8A 4OZHA 3RAJL 1Q0EA 4EZLA 5DS1A 4APQC 2V9QA 2ID5A 3QXDA 3V4VL 3BW9A 3DSNA 4UTAA 2LU4A 3B5GA 5D55A 2MHAA 2VR7A 3ZO0A 4WKZA 2V0AA 3WHXB 2P26A 4WNQA 1G4RA 4HUVA 4P46C 4Z18A 3V5KB 4LP5A 3O4OB 1QZ1A 1CTMA 2XIDA 2ZYHA 3DX9B 3EYUL 3VQ1C 3CFKB 1A4CA 4N8UA 1LGVA 5LN4A 3F7VA 4RMSA 4EKXA 4M9OA 4KKRA 3BOVA 3VWJB 5I1IH 1QX1A 1AHWB 3Q3GA 1KTDB 1YRKA 5AL8A 2DWEB 3HN3A 1WDAA 2NX5D 3T1FB 1VADB 4FQ2H 1UC6A 3CHRA 2EAEA 2VH5H 5DQJA 3MBWA 3ZK0A 5B21A 4YDZA 2Q8BH 3DURA 1E9PB 1KELL 4Y2DB 4YDLC 5ANMA 3WNPA 3BP4B 2KBGA 4GW5A 1MCBA 2XQYG 1IM3B 3QRGH 1EXHA 3MI6A 4QTIH 5HYQB 5CBEA 5L8LB 4YDKL 1AGDA 3IJEB 3FPXA 1RIVL 1VJSA 2C3XA 3NSDA 1T83C 2XN9D 3EJYD 3PRZA 2ZD0A 4OVUA 1IGYB 3CXHK 4G9FE 2WZAA 4NM4H 5E8EA 1HJBC 1KCVL 3AQZA 3GIZH 5IEHB 4N8PA 1KGYE 1JGDA 1B0GB 1N5AB 4E9YA 4ZFFA 4I2XA 1KGJA 1NOFA 5D6DC 2DD8H 2Y23A 5K9JH 4ADGA 2RH0A 3H9HA 4MNQE 5MI0B 4PLJD 3RVWC 2EE0A 1Q94B 3VRJB 5CEXA 4POZC 1UB5B 4XMKH 4NRYB 3ESNA 3LB6D 3RVUC 4AEIH 1XBRA 1VLXA 1TLMA 4FS0A 4WUUB 4QF1A 4JQXA 2DS4A 4OLVL 5CFHA 1PCSA 3HS0A 4IBLT 1UWGH 3KYKH 1OQOA 2JQZA 1QHPA 1CI5A 4MXQD 3PHOA 4W6YB 3KWTA 4KKAC 4Z0BH 1XGPA 2DQDL 1BFTA 4JFFA 1Q38A 1N18A 3IJYA 1ZA3B 1VENA 4ETYA 4QYOA 4ZAKD 4HMDA 4JL2A 1E7VA 1CGUA 1KB9K 4YS4A 4X99A 2DB8A 1DLFL 2PW2B 1RHHA 4KMTL 1A4JA 1DQQA 4X7CC 3RTQB 4DUWA 1A6VH 2KC0A 2R0ZL 3KYNA 3VJ6B 2A7BA 3RWCA 4YQXH 4HH8A 4WV1C 3HS9A 1PLGL 25C8L 4I88A 4MS8C 5FHAH 5KYWB 4QRRE 4EE2A 3T3ME 4XNUH 2PYEB 3HKZA 2ZP0T 3D69A 4G9DB 2VDKL 3FO1A 4ZMXA 5B22A 2VQUA 3UBGA 4ZUTA 4LLVA 1FH5L 1HQRA 1T5WA 3JWNC 4XXCA 2ZCHL 1KBWA 1MZZA 4EDXB 1PIGA 3H3PH 1MWAB 1CZ8H 2QQKH 1I9JL 1QR4A 1TFHA 4RESB 2F1AA 3FTGA 5C0AD 2VLKA 3V6BR 4AC2A 4YHLL 3L4UA 4I18B 1TTFA 2CKBB 5L2KA 1QFUL 3STBA 1F8TH 2ESVD 3TXAA 2OW7A 3ESVF 4NM8L 2A73A 4ONGL 4BJLA 2DMCA 4Q74A 3M1CA 1E3XA 3EUDA 4L9LB 3I3BA 4Z7OF 3GMLA 1R4XA 3DJSA 3BKCL 2R39A 4G43A 2X42A 3QORA 4OR1A 3PDGA 3PLYA 3UFIA 4W4OC 2XQ0A 3BH9A 3QS2A 4NPJA 2W9DH 3BJ91 5IF0B 1T0MA 3GZQA 4YDJA 3RKDC 1TJMA 1ZLUK 2R29L 1NWOA 2VSMB 1MW0A 1AZRA 3CC5B 2Y22A 4LCWA 5E9DD 3MUZ1 4MAYD 1FORH 3TO4B 1J5HA 4P49A 3X11A 4MJJA 1RK0A 1BCIA 4PTTB 1HNFA 1WZLA 1YEHH 5T33L 1OGTA 3KZ8A 4R5XA 2WINB 4HT1H 1HOEA 1KTCA 1SDYA 3BISA 5GGVL 2V8LA 5HHNA 3GUTA 2H26B 1SJVA 2UWEA 3GI8H 4FQXB 2GJ6A 2AK4D 4KJQD 3P73A 5JHBA 2Z7YA 3QEQA 3TBYB 2MOGA 5H35A 3C60B 4HD9A 3QZMA 2YUVA 2WZPA 1IT9L 2FL5B 3QYMA 2UY6A 4RLDA 5KTEH 1BPVA 2DI9A 1YEEL 3HZ3A 1GTNA 1IKOP 1A1MA 3P0GB 5HGHB 4QNPE 1BVLA 3L4XA 1LHZA 1UEYA 2NY7H 3IJSB 2MWCA 2XYBA 3LCYA 1XL6A 3A22A 4E9TA 5F3HA 1UJ3B 5IWLA 3IFLL 4LSQH 1DJWA 2Y0SA 2ITDA 5DEGA 3RUGE 4H7VA 4N86A 5CJBA 3V0JA 1RUAH 3SDCB 5TDPA 2R1YB 5IV2A 2XKNA 4HWEL 1FG2A 1Y6KR 3RVVD 3JWOH 4GAJH 3APCA 5I18L 2R1WA 5KVGH 4JFDD 2JTDA 1I9RH 3KWWA 4Q6YA 1EK3A 3NH7H 4YHIB 5AAWA 4BKLB 2EKSA 3AABA 3QK0A 3EHBB 4EVNB 3O8XC 3UYRL 4PJ5A 1J48A 3KBEA 4NQSB 1XTMA 2FH8A 3SYPA 2R83A 4TSCL 3UC2A 2OSWA 2DM7A 3PWPB 2PR4L 4P2AA 4U1NB 3VFMA 3RNQA 5E2WL 1FO0L 1S7VB 2CHWA 1LNUB 3FH7A 3TFKD 1VCAA 4YWGH 1EAOA 3LIUA 3ULUH 1ND0A 3RWHB 4DO5A 1MXDA 3Q5OA 5FUOL 4WTZA 1GCYA 3IN0A 4DEPB 4XP9H 4DETA 1JDAA 3OG4B 2PUQT 4F9LC 3QHFL 4KXZH 2YRLA 5DK0A 2GG1A 4OZIE 4BK5C 3FUFA 2CM6A 4BRVA 2FJHB 2VR8A 4JJ5A 5KZCD 3PWLA 1FFPA 3DARA 4PJHA 2BVYA 5KSAD 1ZT4B 3L9BA 4CC0A 2OMBA 1GMIA 3W9DB 4PLOB 1HHGA 3RX7A 4EN3A 1BEYH 2RGSA 3FULA 3U7WH 4HOXA 4YAQA 1D3CA 1WAEA 3EADA 3GMOB 5AENA 3QR1A 2CHDA 2EXYC 2ZNXA 1AP2A 4L0PB 2OMUB 4UMSA 2HJKB 3MJ6A 5AYUL 2A9CA 4BH8B 3MLXL 2Q6WB 1G5GA 1T66C 1ADQL 2E7BA 3HBQA 1RSYA 1O6SB 3KBFA 1WZ1H 3VM7A 3QPKA 1A14H 5J6SA 3EGDA 4WEUD 1M7XA 3ZL1A 5FUCE 3HW7A 2Q7AA 1ZLVH 3V0DA 4YFEA 5BS0B 4Q89A 5FGSA 5KVDL 4QPEA 2X7LB 1N19A 1ZS8B 2IMNA 1T22B 3B9KB 1G1KA 4Q2ZB 1DEEB 3EOTL 3EYVB 4L3EE 4Y88A 2JELH 1YEKH 3IFNH 5D7JB 3SYOA 4UBDC 3GHPA 3MV8A 4JY5L 1J05B 4OM1L 3S36X 1W15A 1YJDC 2CCWA 1WRFA 4G11A 4PJAF 3EFFA 3UIYA 4ZFGH 5IHZA 4P2OD 2VRQA 2AEPH 3V6OE 1GIGH 2J5LB 3NIDF 4L3CA 1Q9LB 4M93B 4J3BA 4ELME 4OZGB 1H0DA 4L05A 3EZJB 4UU9A 2NX5B 2KPNA 2F74B 3QDGA 5DHMC 4GUPA 2X0VA 4N8CH 4H0HB 2F18A 1X44A 3GTNA 1BIHA 4JVPA 2YN5A 3OKOB 1IGJB 3AW5A 2C3VA 4PS4H 1SJEA 3KPNB 2XQYK 2GVYA 4G8GE 5DFAA 3ZTDC 5JQHC 4JQIA 1HZHL 5BW7A 4F91B 4LASL 4JRLA 3TESA 3MLUL 2FHFA 4R7XA 4UOZA 2OMZA 1M56B 1RZPA 2ZYIA 4KTDL 3WO3B 2ZX7A 4IK6A 4J8QA 4DVRH 4P5TD 2PWEA 4I0CC 4KXBA 1T1ZA 4KK9D 1ZSHA 1N0XL 2HB0A 4F8PA 3LS4H 1U95B 1E9OA 1J1PL 2YS4A 5EUOE 2G5BA 1DSWA 3JWNG 5IK3A 2FO8A 1S9XA 1C7TA 2KZ1B 2P5EA 2ZZUT 4ODTH 5E6SB 1QAWA 4BFNA 4DZBB 3QFJB 3MACL 1DCLA 2E4TA 4F2ME 3RZCD 3RFZC 4UTAH 4J1UB 4XC1H 1IGML 4GBXC 5D7SH 3BKJL 4NQDA 3FDWA 3L5WB 4X5RA 1KN4H 1RZGA 4TL5A 1ETZB 1HNYA 1JF1A 1FE8H 4NENB 3KHQA 3QZBA 5IHUH 2X6BA 4BGLA 1S9KC 5DTFB 1PYWB 4AKQA 1KXHA 2AQ1A 4GIAA 4OCLC 4G1MB 4OKDA 4XHJC 5DZPA 3ZHLA 1JXGA 4R2GC 4FI8A 1G5AA 4L2YA 3CLFL 4BSVB 3B2PA 4PWHA 2GI7A 4LO9A 1B3IA 4IM8A 3DX8A 3VH8B 5GGTA 1AHKA 1E8XA 1IQDA 2P28B 4JRYB 4NFCA 3NOIA 5G2NA 1TZGL 1YG9A 1IC5H 5AVZB 2XZAH 3H9YA 5E2UH 3MLRH 1I82A 1OAQH 3O6LL 2DOCA 4W9ZA 2WXMA 1OAJA 5EPMA 3ULUF 2DYPD 2R2BB 1TQCB 1W8OA 4N3UA 2QSCH 4XOAA 3FB5A 1KCRH 2VDLL 2Z35B 1PD0A 3MLYL 5ABDE 4KZDH 4ZUUA 4G9FD 1U8MA 2HTLC 4CVZA 1RZFH 2ZG2A 3WD5H 3O2WH 2BP8B 1FFOA 1ID5I 3GS7A 4NERA 3K6OA 2FX9H 4JO1H 1KYAA 3LYRA 2NZIA 4L4TB 4HQQL 2Y1AA 2KS0A 4HUXB 3O6FA 2O6CA 4ONHA 4IRSA 1DQLL 4JREB 5H8DA 1E5YA 4MNQD 3RRQA 4WO0A 3TA3C 4KGLA 3MRHA 4KPHH 5B38G 4MWFB 4YXHL 2PWGA 1QSFA 3B4NA 3GGWA 4O02L 5EV7A 4YSQA 3MUGB 4M4RB 4J3TA 5I66B 2WLLA 3L95A 3VD9A 2R4SL 3NVQA 3NCYS 4P4RA 3OLDA 4JGMA 5K33A 4S1RH 5C0AB 1A9BB 5DJ0B 1PCXA 2P5WB 4MMZC 4X6DE 3G6JE 1DP0A 3IN2A 4QHLB 4HCRH 2V2WA 2IWKA 3GSVB 2WMPA 3UC0L 1ACZA 1RUQH 3TCTA 1FVDA 4YLQT 2NYYC 1DVXA 2OR9L 3GINA 4JFOB 4P2QA 4A2MA 3C9NB 2XWJB 4OI9A 5JXAL 3ET9F 1PKOA 3SDAC 3LNGA 4D8OA 4HCIA 5BVJA 3G5ZB 1OP5H 1BOGA 4LQ1A 4NAQA 2EDXA 4TQ8A 3FQXA 1JYNA 3D2TA 5GZOA 4PW4A 1ZANH 3H0TB 4ZS7L 2WN2A 1CD1B 2IGLA 1JV2A 1ZSDA 5E9DB 3SDDC 5AD0A 1E4XL 1JNNL 1RZJC 5ACLA 2A9NH 1TFPA 3PAZA 4QRRD 2JKIS 1IEAA 2MSPA 3KYMB 1HQ4B 1R19A 5IFHL 1HI6A 2L4OA 1NAMA 3A5VA 4OIIH 3ZYIA 3QIWC 2D3JA 4B9FA 1N8ZB 2P1YA 1JTTA 1MI5A 3F8UB 5E8OB 4MXWH 4FDWA 4NZUL 1F97A 3FU7A 1E6OH 2FK9A 4HJ0C 2C3HA 2HG5A 1MW3A 4XNMB 1PKQE 3CXFA 3QCTL 4AQAA 1AIFA 3S5YA 2DQUL 3JZYA 4Y5YC 5EA0H 1GY2A 1NDMB 5FA4A 5F9OL 4EIUA 2ZWNA 3U0PB 1OPGH 2DQ6A 2CO7A 4WI5A 4ELKA 3GXUB 1F11A 1MCNA 3MJ9L 4UI2A 2YLHA 2FJFA 1JTOA 2C3WA 2X9YA 3CN2A 3NBNA 1SHXA 5F1IB 5DYOA 3FF8A 4JFDB 3SE9H 1Z32X 1CLCA 4FQPA 1TJGL 1HILA 3LKRA 5DVMA 2IV8A 3WG7B 1JHTB 2YD4A 3Q7JA 1FN4B 2ZCKL 1YAZA 3O4LB 3ZE2E 3OB8A 5GS0D 3BP5A 2DJSA 3QAZB 4LAJH 2OV0A 5JORA 4LSPL 1XEDA 4P05A 3KM1A 3QZWG 5AB9A 1P69B 2FHBA 2H6PA 3ARUA 1NCDH 4OLUL 3W0WB 1U41A 5HPMA 4HZAA 2VDNH 2ICWA 2YQBA 2H45A 3VFRA 1YMHA 5CZVH 1RUPH 3NTCH 4PV1C 1P5VA 1GGTA 2IPUG 1BPLB 1FC2D 2HPOA 3QB7C 1MHEB 1A8ZA 5F2FA 2WYHA 1OF2A 3GXIA 4W9CC 4I4WB 2JKJA 4UF7C 5KEZA 1BAGA 5INDA 1X5GA 4F7PA 2GFBB 5IB1B 3KVDD 3KVPA 4LSDA 3B6SA 3EYSH 4Q9BA 1ZXKA 5DU7A 1C16A 2AQTA 5KSAB 5F9JA 3U36A 2NNAA 1F4WH 1HSBA 3FH5A 5E1AA 3UBXA 1CUOA 1NUFA 3D25A 4KKBC 2HG0A 1NFDA 3P77B 4OM0H 1JHLL 4JLRA 4A6YH 4GI8A 4A7GA 5I23A 5EO1A 5E4AA 2RD0A 4X83A 3ARBD 4M56A 2IQAB 1XV8A 3FZUD 1KFAL 1KGUA 3VFUA 3CFCH 3IGAB 1UD6A 4HWUA 4LKXA 5HGDA 4K15A 4JAMA 2KLTA 5KS9A 1YY8A 2DJUA 1XF2A 3I02A 4HF5H 4OCRL 5FO8A 2XV3A 2X2IA 5FYLE 1NC2B 4DOHB 1KLUB 4LNVA 1JWMB 3K5RA 5B1CA 3DBXB 1OVZA 3G04A 4DPCX 1UOVA 5HYSB 1G9MH 1IILE 3P69A 3PGDB 1OK8A 4XE0A 3OF6A 1K8IA 1AXIB 4IBZA 3QIUA 5CUSL 4JG0H 5SX4I 3BPCB 1R3LB 4AI7A 4OAWB 4PJCB 1TO4A 1BLNB 3C5XA 4RGOL 3SSGA 2X1WL 4J23A 1HCYA 5KSVB 4GOSA 1DUYA 1CLZH 3D85B 1AJ7L 3ZDZF 2JQMA 1CZ8L 4OD2B 2A6IB 1TMQA 1RK7A 1RV6X 3HI1B 3FQRB 2YXMA 3VFOA 3QG7H 4BK8A 3BE1H 2DL2A 1AAJA 1I31A 3HNTL 2H32A 4OGYL 3HZMA 3EJZC 3GB7A 3JV0A 2DTSA 1MFEL 4NEHB 3S3DB 3BPLC 1QP1A 5EDXA 3QNXA 2D8KA 3CCHB 2VJ8A 1XT5A 3EH3B 4GP4B 5FS5A 4NFBA 1M1XB 1CB4A 2CK0H 2IAMB 4GAAA 3GRWH 2BY0A 1E5ZA 2YAMA 2XFXB 2NXZB 4ZMTA 1YDPA 3CSYA 4AQOA 2W0FB 2IGFH 3UPCA 4CW1A 5DMYA 5IQMA 5DS8B 3NN8A 4TUOA 3P40A 3R7RA 1NBVH 1HE7A 3G5VB 2ZOUA 5GIRB 4DGWC 3WFHA 3FQ4A 4ZO9A 1AD9B 2D7PA 1RZ7H 1NGZA 1UB6B 3VXSB 1FAIL 4DGYH 3TO2B 1AQMA 2EUZA 3NK4A 3V5KA 4L3ED 1Q9OB 2AJ3B 3LKQA 3AREA 3CXDL 2Z7WA 4QIRA 3U0TA 2IANE 2LT9A 1H8LA 1CDUA 2A74B 1BAWA 1C12B 3L48A 4PJIF 3RZCB 2VKWA 3DA0A 4D7PA 4XVJH 2GW5A 1J9QA 4G83A 3I2CL 3KJ6L 2NUTA 3SB3A 5FFLA 4KK5C 4KK6C 1BZDA 3WJLA 1DQMH 4HG4K 3TIDA 2DWEA 4KRMB 1VADA 5CGBA 3EYOA 4WUKH 2RBLA 3KNBA 4JHWL 4WY7L 2VLJA 4U4BA 4NSKB 2Y7SA 4ZZFA 4HJJH 2QHRH 3F7YA 2V8MA 3IGUA 4GMSH 1E9PA 1MN4A 4HS8L 5TGBA 4D0BA 4Y2DA 4JPWH 3C2AL 1L0QA 4IBSA 2JK5A 2W0KA 1QI3A 3ZTJG 2QPUA 4HAFA 5I1KL 4G8GD 3IJEA 4Y89A 3F6JA 2BS9A 3S37X 1IGYA 1F2QA 4EKJA 2KMWA 3MXVH 1WICA 4RGNB 3FL7A 4IKIA 1HXMA 4HIJB 1MDTA 1QTYT 4FXTA 3FO9A 5IBLC 3WN5C 1NCJA 4HIIB 5HDBF 4YHYB 3MBEA 1XZ0A 5CGYC 2BJML 4GS7B 4ETQB 2G60L 1MFMA 3WKQA 4YC2C 2QFPA 4YSAA 3B9DA 1FL6B 1UB5A 5A16A 2UZXB 1S7TB 1E8ZA 1MCOH 4UQBA 1NCNA 1PU0A 4K5OA 5D1ZA 1QG3A 4PMFA 4AG4L 4WUUA 3K5SA 3PABB 3PG2A 1SXZA 2XWDA 3MUY1 4IDJL 1A3LL 1DBAL 3NQKA 2XZCH 5DC0A 5JHAA 2VMFA 1C9SA 2B0SH 3WBDA 1KEGL 5GSRA 1WBZA 1FPTH 3I6SA 3I9PA 3WMQA 2VQ1A 4PJ9B 1HINH 2QKIB 2K8QA 1CLOH 2VLRE 5B7EA 4CDHA 1QRNE 3ARGD 4FFWC 1YPZE 1XSOA 3IAQA 3WY2A 5I1EH 1JZHA 3T2OA 2CJUH 2HJLB 4QOKA 1I8UA 1TITA 4N2EA 5D1XC 2X1OA 5AZ2L 3GZOA 4XNYH 3FSZA 5EZLB 3EYQC 1HHJB 3KLHC 1U3HD 2HX9A 2NLJB 3PWNB 2DQGH 4C59B 1NCHA 3WGVB 4ZNEE 5J12B 3QIBA 1KJVA 2OTUA 1MY5A 4BZ2A 4ZNCD 4Z7UB 3BGFC 3OSVA 3DX0A 2CDFA 3C5ZC 5JR1H 2H0EA 4LLAA 4ZMYA 3EDFA 2GSGA 3IB4A 2OMYA 3NSYA 3ULVF 1F6LL 3QA3B 1NCCH 1JXKA 3PAVA 5HHXL 3HE6C 5FW8A 1TVDA 1T2JA 1TYEB 4ZG1A 4IBYA 2Q8AH 5DJDB 3P30H 3CVHB 4EDXA 1MWAA 3AXLA 3ZPDA 1IGTA 4UILL 4X5XB 2GY5A 1ZVYA 4LSSH 1V5JA 4YN3A 4EUPH 4P4KC 3TBSA 5GGUB 4ZDHB 1QYGL 5A2LH 2EXWD 4I3SH 4K9EH 1QQDB 1ZLUH 2W81C 1DBBH 5C08E 4ADJA 3GDCA 4AK2A 3NSXA 1GYAA 2TSAA 1TVBA 4YSCA 5DO2C 3GTVA 4PB0H 5KVEL 5F1KC 1FFTB 3QEGL 3NDZE 4CMHC 1N59A 5IF0A 4NUJA 3LKPB 1AC6A 5C6TH 3SGDI 3MLPA 5DWPA 1EAQA 4UTBH 3IEAA 4HBQA 2EILB 3VRLE 5CM1A 1KBGH 1YY9C 4QHPA 3T4YB 2PCXA 3NIFB 2BIIA 3W11D 2CH8A 1P0SE 3WXVH 3HC4H 1OE2A 2P80D 5T5NF 3NCYP 4OLXH 4PTTA 3ZT7A 3M17A 4QRQA 1RJLB 5I17B 1NEUA 2CO2A 1CTOA 2UYLB 2WINA 1BBDL 3HZKB 4TNVK 43CAA 4YGVB 1G7HB 4FLRA 2B2XH 4MSWB 3GMQB 2XG4B 5LDSA 4YXLH 2AEQL 4YVNA 2GJRA 3L3IB 3SZ6A 4PGBB 3EO1A 2BSRA 4Y1AE 5HGHA 3CIAA 4TNWF 2XWZA 3CE1A 4P2CG 1X4YA 4TSBH 4HU2A 3UAJC 5I75B 5J13B 1T3FB 12E8H 3IJSA 3DUSB 3WEXB 2IPUK 1R3HB 4B9JA 1XGUA 3GSUA 4Y4KC 3TP4A 3ZDXE 1BXVA 1ZHKA 3O11B 4OU3A 3MA9H 4ALAH 5MENE 1JUFB 4WNSA 4LHUG 3SDCA 3IS0X 3NP3A 4KC3B 2R1YA 3GEFA 4XNXH 4UT7H 5I5RA 3KDPB 2MPAH 2LLGA 3ZTCC 5KSBB 5EDSA 5T3ZE 3SCMA 3RILA 1M4KA 2X4PB 5EOCL 4AGLA 3S35L 1FNFA 3L3DA 4OQTL 2HAZA 5FGRA 2G5RA 3GSXB 4WCYH 5AW0B 2QSVA 4LPXA 1OTUD 4NQSA 3V4PA 5IW1A 3F7RA 4U1NA 1KCRL 3U2SB 3CQFA 3D34A 2QGCA 4U6VL 3MSPA 4MXVF 3RL1A 1LNUA 5JPMC 2ED6A 5IQOA 4TLSA 4KAQL 4AK1A 4HLZH 1VACA 3IJHB 5DZVA 3OKMA 4KV5F 2F53A 1KCSL 4OT1L 2X1PA 4QRUB 4JDTH 2DZEA 3CJJA 1TJXA 2IG2H 2WB7A 2MQ0A 2AITA 1UH3A 1YQVL 3Q1SL 1BLIA 2FJHA 3FTUA 1U3HC 4PY8J 5EU6E 2V2XB 5B8CB 1CL7I 1PS3A 2YSTA 2X4RA 1ZT4A 5BXFB 3ZE0F 1N68A 5CFAA 1OM9A 1Q72L 3W9DA 5SWQB 4F7EB 4NCC2 4ZUSA 3R7QA 1O7SA 5A43C 3FHEA 4PCYA 3O45A 1DJSA 4L8SB 4BE6A 3MNMA 3GBLA 3A4DA 2HJKA 4JHAH 3NJIA 3QRLA 4BH8A 5GSVA 4KI5F 1JGUH 3BCDA 3RWDA 1AS6A 1E5CA 4N24A 1CIUA 4G71B 1IRAY 2BNRB 2DICA 4XPBL 1HHIB 3NSFA 1A9VA 3ARDA 5E2VL 3VI3A 5FGBC 3WNMA 2X7LA 1J5OL 1X6NA 5FYLD 3VDAA 4WW1B 2HSIA 1ZS8A 1T22A 4Q2ZA 3WFEL 7CGTA 1JYWA 3EYVA 4OF0A 3MZGB 4PS3A 3K2MC 1S9YB 5T1KB 1HFUA 3KHOA 3CZNA 1BZ8A 2UY7B 3FCSB 4NXSA 2DWDB 4L3EB 4K8RL 2EICA 2ZP8A 3IF1B 4H8UA 4P9HL 4WW2C 5FLUA 3TN0C 4P59L 1B2WH 3RB7A 3CHPA 2OMWB 1UT2A 1JRHL 4P5MB 3PWVA 4OZGA 5JUEH 1EAPA 2NX5A 2FJSA 4PU2A 3A4AA 3RBGA 1TDQA 4BM7A 1QBLL 2QMKA 1NCBH 3U25A 1IGJA 4WI7A 1A7NL 5AB0A 4QRFA 4F93B 2W94A 1T4KA 3OAWA 1L3WA 1K5NA 1EQWA 4ABVA 4DH2A 5KANG 4DTGH 1XSKA 3LKOA 4AQ1B 1OPOA 3OKDB 3GMNA 4G8GB 4UOJA 3BAEL 5JOFB 3FT2A 3B2UD 3H4FA 3E6HB 5B38A 3LPGA 2XN9A 3NJKA 5D2LA 3BN9D 5EOQL 4PJ7A 4WWKB 1JZ3A 3D0VA 3C6LC 3RVTD 4K3GA 4U1HB 5DC2A 5F70A 5SV3A 1F86A 2AJUL 3W56A 4XAKE 3OR6B 4XCFH 1C5BH 1IAIL 3WSQL 4P06A 5IOKA 3CZFB 1RLBA 4EQ2A 2LVEA 4EMZA 4XVSL 4I48A 1LWJA 3OJVC 2A9AA 4J1UA 1I8MB 4BIKA 4AH2A 2E6PA 1O9VA 1XD1A 3P11H 2IAND 3L5WA 3ZBMA 4UB0L 4HXBH 4HZ1A 3I6LE 3BMVA 1V7NH 4NENA 3UADA 2KUTA 1YAIA 1AZVA 2BP5M 4G1MA 5DD3L 5FECB 3UG5A 3UGUA 2CBPA 3QCUL 2OS7A 4AL8C 1QFOA 2XVGA 3FCUB 3HUJE 3VO0A 2VMEA 4BK4A 2DIBA 3FPYA 5F6HI 3VH8A 1I1RA 2AEOA 1WAAE 1MDAA 2BSBA 5AB2A 1L9QA 1G6VK 1SHSA 3FFCB 1FI8C 4ZAKA 5C2BH 2ZPKL 1D5ZB 5CHNB 2LOEA 4Z7NF 1NIBA 1WIUA 2XXFA 3T8XB 2BERA 1H6FA 4ECNA 2Z35A 3VFNA 1H9DA 3D39E 1XB6A 1M6UA 2UZPA 2XY2A 1Y6MR 4JKNA 4N0UA 1HOCB 1UT9A 4WI3A 3WO4B 1K9TA 2BP8A 2FH6A 2VWEC 3CDGA 4OZFB 5EC2A 3P0VH 2VDML 4HMCA 4QT5A 1MJ8H 1T89C 3KR3H 4HKXB 2IBZX 1AZNA 1XCQB 3QULB 4X0NA 5JQ6L 3JVGC 4UQ2B 4M5TA 4Q97A 3A6CL 4UM8B 3NA4A 4YPGB 1UH4A 2WWMD 4F20A 2VXSH 3C87A 3H7BB 5JMRA 3RHWK 1OTTC 3O3EB 4X9IA 2NQCA 3QUZC 3MV9E 3APNA 2OZ4H 2ISDA 4FCHA 4JZNA 3MUGA 4GO6B 4M4RA 1FGNL 3DTXB 3FRPB 5I66A 5IT2L 4IIQA 4U1KB 5T1DH 2QFRA 2OL3B 1A9BA 2H8PB 5C0AA 4CRPA 4LSVH 3VGFA 3LOWA 4YSUA 1HWWA 4K5LA 4LGSB 4QHLA 4PCSA 5CLXA 3GSVA 5EZJB 1DANU 1ZCRA 2ESVA 1ZK5A 1OARH 3CN4A 3NK3A 3FQTA 1IBDA 2VLRD 4FOMA 3IGLA 2KHAA 4E5XG 3CGTA 1QRND 4JFSA 1A4BA 2XHNA 4MBOA 4JFOA 2DQEH 2H2SD 3AZUA 4PRIE 1OCWH 3ELQA 3MLTA 5J89A 2OJZH 4AZ8A 2DYSB 2CXKA 4GFTB 5TTRA 1U58B 2VN5A 3ARVA 5KVFH 5DMJB 5EF0A 4OCWL 1XWVA 4U1LB 3CHXA 3TBCA 4LCCA 5E9DA 5EHFA 3DJRA 5GJSH 1Q0XL 5H37G 3QH3A 2L7QA 1W6LA 3DGDA 4H25B 1R33A 1SXBA 3PL6B 4FNUA 5F1SA 3UDWC 4Q58C 5CO1A 3KYMA 1SRDA 1HQ4A 3TV8A 2O5XL 3K80A 4HKZA 1HH6B 2G3NA 3NJHA 4XN1A 3MAWA 5ILTH 1DBJH 4GRWB 4RMWA 4FKEA 3CC1A 1RPQA 4HETA 2AK4A 4B5ZA 2FBJL 1N8ZA 4OGXL 3B43A 1JDCA 1QLFA 4PJBF 2V5SA 4G6FB 3PXJA 4NIKB 4UTCA 5FYKH 5AYTA 3O81A 1HCVA 1MWAH 3LHAA 4HLJA 1U6AH 4LARL 2ILLA 1W72B 3V79C 4KUCD 5AVQB 4XNMA 3LXAA 2CKBH 5BOZG 4Z8FL 1CXHA 3LEYL 1ETA1 5C08D 3RVTC 3GIVB 4Y16D 4YBLC 2N3JA 1NDMA 3SKOA 5D70L 1M6OA 5FOBB 2R59A 1UD3A 5ENWB 3ZKXB 2IH3A 2Z0UA 2Z8VC 3IPBA 3K72B 2IFFH 3EKCA 1HJCA 3BP7B 5DMGD 3II1A 4DN4L 1LK3H 3B56A 2HZHA 2K45A 3VFTB 4KKNA 4M1CC 1SY6L 3CH8A 3LZFH 4JFDA 3BIKB 2GKIA 1BZ7A 4Z77B 4YIQA 3S34H 2WK2A 2XWTB 1FN4A 3N1QC 2WLYA 4JQIL 4JFYA 4NO0B 1R47A 1RUML 1HHKB 2PW1A 3OJMB 4ACTA 3TFBA 3SDXF 1OCCB 1DQJA 4JGUA 3DRQB 5L4JA 4V2CB 4F8TA 2Y2TA 4U1SB 4Y1AD 2WD0A 3H2WA 5JIHA 4UAOB 3UJIH 2FHCA 3I3EA 5JIIA 3VQMA 2CA4A 5JTWA 3LSOB 2C9PA 5I28A 4D94A 1QEWA 5KSAA 3QARA 3DX7A 5MEND 4ZSOB 3ISWA 1GTFA 1FFNB 3HEIB 2HVJA 2ITEA 2V17L 2WXPA 3P77A 1GGBH 4JFTA 4PY7A 4FQQA 2GUOB 4WWOA 5T3ZD 4DN3L 1VA9A 1RXLA 1J8HE 4NP4L 4R5VA 3MYZA 3Q5YA 1OKEA 1P7QD 2WLZA 3ZX1A 5GGTL 3FO0L 1YNTB 2AKRB 3FT4B 3MRFB 5G4OA 3DOIA 2NR6C 4OFDA 1ORQB 1NC2A 4U3CA 1JWMA 4GUQA 3DBXA 3HPJB 4P5SA 4I1PA 5HYJB 3PGDA 3A3YB 1LLAA 1YYCA 5J8OA 2YC1B 3VD7A 1FG9C 2EZ0D 1FLRH 4GAYB 2WXIA 3CN1A 1R3LA 4OAWA 4PJCA 4XP5L 3CSBA 3L5XH 5DUPL 2W8CA 3H9ZA 5GZNC 3T0EC 1FNSL 3FAWA 4U0RC 3D85A 4LIQL 1SLUA 5E5RB 3EGXA 4P2OA 4QRSA 2NZ9D 4OD2A 2A6IA 2E46A 4HPYH 5EU6D 4WO4D 4PQXA 2VSDA 3L8QA 1OP4A 3HI1A 2MFNA 3RU8H 1A8JH 4R96B 1KUMA 4Q4EA 2Q86A 1OGSA 2IAAC 4R4FL 2ZX5A 5DZAA 2XKUA 5ACZA 5LHDA 2I9LA 5EN3A 4L18A 5DMKA 2IAMA 4A66A 1R5WA 4OFPA 4QHUA 5CJQH 5B3JF 2CHNA 2JCCE 1IBGL 3TVMD 1IFRA 3HE7C 2ZCLL 5DLLA 2W0FA 7FABL 4LLUA 4IEFB 1EUUA 1E40A 1Y07A 3C6SB 1A7OH 1IFHH 1P84K 3NCWA 2NCMA 1MRCL 2E47A 4U7KA 2VDQL 2WWOA 3LXBA 4P5TA 4L29B 5HGGS 5IGXH 3G5VA 4MHHG 3OKKB 1QTSA 3LRHA 3EJTA 3QDJE 3QJZA 4QY8B 3N43B 1IU1A 3DHJA 3UMTA 3VXSA 1TSRA 3VWKB 3T0DA 2APXA 3AG1B 1Q9OA 2AJ3A 3N44B 1X7TA 1AGCA 4BUQA 5IROC 3RZCA 5FO7A 3ASWA 4JM2C 5CJXA 5GS2D 2FYYB 3B5TA 5DJYA 1RJCA 4LCUA 5E8NB 1R34A 4GKZB 2RCSL 3GNML 4NPYA 3S8GB 3E6FA 1ORSA 4FA7B 3K71A 2FWSA 1AKJD 1T0NA 2BCKB 1MCPL 2AABH 1NFIA 4G7VH 3BGMB 4H26A 4NSKA 1NAML 3G6AB 2GEQA 2A6KB 4MLSA 4OB5H 3MRCB 2GTQA 4FFVD 3LQAC 3VCLA 4LVHB 4LSUL 3VDCA 4FA8A 2O6EA 4A7QA 4OJAA 3ABZA 1A1OB 1CYWA 3RX5A 2OP4L 1CGVA 2NSXA 2NNFA 3L3OB 3WYRA 1KIPA 4JKMA 1TCRB 1UVQB 3LJ3A 3QHZH 4J27A 1KB9J 1M2VB 2DYPA 5T1MA 4XPTL 4OCXL 4F8NA 2MPAL 4MKTA 1UWEH 3D9AL 3IMBA 4PVNA 4G9FA 4ZJ9A 3U4BH 4APQB 3CDYA 2P52A 1JN6A 3M07A 4XAKD 4P23D 3TBTB 1NBQA 3GZPA 4WCYL 4TTDC 1QPKA 4P46B 5HHQB 5J3HD 2WN3A 5L8JB 4MJIE 2F54B 3HBZA 4MNQA 3TF4A 3UPRB 1OE3A 4MMXC 3FO2A 1VSCA 2RA1A 3FF7A 3MRDA 3LS5L 2WXGA 5CKAA 1RU9H 3VXME 3I6LD 3Q06A 1MHHA 1I3GH 1IJ9A 1F4YH 3NSCA 4ZBJA 2WTRB 3ZL4H 1PQZB 4WJG3 2QKIA 4IMLA 2MTPA 3O0LA 2BXYA 4O9HL 4LPWA 3M8OL 4YDLB 2I60H 2WLJA 4NQTA 3QZLA 4MTMA 1PZBA 2VLRB 4PRDA 4Y0GA 5JW5B 2XDHA 2HJLA 1KGWA 3ROOB 4QXVA 5BO0D 2O4EA 3VE0B 4Z7OE 2VZVA 2HRLA 2F7PA 1YLBB 4DNLA 2OM5A 5CINL 2PCFB 5GGQL 2VAAB 4OCSH 3LN4A 2JI2A 4H44C 4PJ8C 1KZYA 3TL5A 3DROA 4NZ8A 3ZKMC 4YE4L 5G4MA 4FJYA 3D39D 4JKPL 4LEXL 5SX5H 1N2RB 3F58H 4JHAL 1DFXA 1T7ZA 4K0OA 2VITB 1IL1B 1U8PA 2WYIA 2HCZX 2IALA 4CC4C 4EF3A 3MV7B 3KH4A 4XMPL 1SYVB 3ECBA 2ZUUA 3DETC 5AQ0A 4QRRA 3QA3A 4JRXB 5ICUA 3BRGC 4UQEA 1QLEL 4MASA 4AYFA 5B4MC 4P9ML 3CVHA 4MJ2A 4NJAH 2X2UA 4KVCH 3MV9D 3V8OA 4X5XA 3JTSA 2YGPA 3DUHA 3D05A 4JR9H 4N0YL 5GPRA 5E70A 4JHUA 2F8XC 3BWUC 1QSEE 3DO3A 3MODH 3LKNB 4MQXD 4JY4A 3TVMC 1WHOA 3UZQB 4QXGH 4NNXB 2ZOKB 3V0FA 2E7MA 1YEDA 1ZT7A 1R24A 3UROR 1OO2A 4KUZL 1D7BA 5EZOL 5C08B 1KPRA 4Y16B 3AY4C 2MQGA 4FG4A 4FYQA 4PRID 4FI6A 3V2AR 3G6DH 2MQCA 5AVXB 2DTMH 4JFVA 3FW6A 1H6UA 4JVUA 4XOEA 3IETA 1SJHB 2AJYH 4L1DA 3UTTB 3PAYA 3HC0B 3QUMB 1HKLH 3EOAB 4WV1B 5D5MB 3TPUB 3TU6A 4DW2L 1GGIH 3HZKA 1WG3A 2A9DA 1LO2H 3MUHL 4R4ND 2KQMA 4WU7B 4YGVA 3NPSC 5LUMA 3PP4L 3VFGH 2B15A 1EEZB 1JPEA 3MFFA 1DN0A 2IPTL 1WUNT 4FYRA 2WKOA 3DHUA 4ZW3A 4RFNC 3HG1B 4RSYA 2HWZH 4X8JA 1TTRA 3EW3B 4L1LA 3ZIYA 1EIBA 1KLFA 4N0CD 1T3FA 1GZHC 3C75A 4HAGA 3DUSA 4Y1AB 1A0QL 3WEXA 2BWDA 3ZYZA 5HHVH 1U4EA 4K73A 1MFDH 2YWYA 4RQQA 2OAAA 4CJ0A 4YE0A 1BSIA 4IS6B 4WAFA 3O11A 1PZSA 1BM3L 3DKHA 3L54A 1AY1L 4QHNB 1ZLWH 4I87A 1DLHB 3UTSE 5IKCA 1RZQA 1AQDA 2J88H 2R69A 1DVTA 2D4FA 4OUOA 4YSTA 5KSBA 5AG8A 2FQGA 2X2HA 3K6DA 3NEOA 4X7TA 3WTTA 1L5GB 2X4PA 2ZQKA 3WS3B 3BSHA 1TTBA 3CLEH 3QPXL 4JE0A 3ARBA 3QCVH 1IE4A 2YRZA 4F8OA 2J1WA 4Y19E 1CMOA 5DA4A 2W9EL 1P7QB 4CU6A 2F68X 5EOTB 3U2SA 4PLKC 3TT1H 4LSTH 3K6SB 4Z3JA 4XAWH 2N0MA 5IQNA 3TV3H 3DSFL 3F00A 1PJ9A 2GJZB 4O51B 3OMIB 5F8RC 4HA1A 1GKEA 2IOMA 3Q13A 1GR7A 3MHZA 2UXVA 2WWKT 2FEDD 4KRPB 3KR3L 5HD8D 3FRUB 2EDOA 2FX7L 2PXYD 2EO7A 4QRUA 4LVOC 1R3KB 3VD2A 1G6RB 2XLLA 2XBTA 1LP9F 1UA7A 4EBQH 1IB5A 1I4FA 2E0PA 1L0XA 1OSPL 5IESH 4OZIA 4N2CA 4PJAE 5BXFA 3FTZA 4U2YA 4DQAA 3ZE1B 3NJLA 4FHJA 3AU1B 5SWQA 5E7BA 2UZIL 4DFHA 2AERT 5G5DB 3BP6B 1PEWA 2Z65C 3AADB 4G1EA 5HHOB 2C9SA 1V3MA 3QS3A 1OARL 4LRIC 5J6HB 3BXNA 3I6GB 1DQTA 3GUFA 2ATKB 2VJXA 2A6JB 3I85A 1NMAH 2OYKA 1CFVH 3O8XB 1J8HD 1OM3L 2ERJC 4YLBA 2HJFB 1KWGA 1NPNA 5HP5A 1HHIA 3JT0A 4XBEL 4AOFA 1A64A 5TDNB 2JJTC 1NC4B 3MRKB 5H4ZA 4WW1A 2ITCA 4AKOA 2YPVA 5T1JA 2FZ3B 4OCMC 2P45B 3GI9H 3U9UA 3CZLA 3QNYA 4JNXA 2BZ7A 5I8EA 4CA4A 2GK0A 3K4ZA 1FF5A 3CPLB 4M6AA 4BZ2L 4KO9A 4HULB 3C6EA 2MJWA 1XAKA 3ROLB 1TVHB 2UY7A 3FCSA 2D73A 4RAHA 2DWDA 4L3EA 3SBRA 5B39B 4QLRA 4XBGB 2Z9TA 4HV8B 4PP1D 3N1GC 2VMDA 5I8KH 2APFA 4NKDB 1DZBA 2DH3A 4G8EA 2NTFA 3EF7A 2WAQA 2XVKA 4OJCA 2QV4A 4X4XB 4PLNC 1MJUL 3V6OA 1VEPA 5KVGE 1AKJB 1RP9A 5IVXE 3QT2A 4ELMA 2NY1D 3Q2WA 4H8WL 4MNGE 4M8QA 1F00I 2BSEA 3JWDL 5IQ9A 3MX0B 3P4OB 3T2QA 1JV5B 2FSEB 2IVFC 3DV6B 4HS3A 3OR7B 3O3DB 4X4ZA 4WTXA 2XT1B 3OKDA 3ISYA 4G8GA 5JOFA 4N0FB 1B9ZA 2C7FA 2OMVB 2F61A 3ULUE 5L88H 3PWUB 4XH2B 3A0OA 4U1HA 4Q14A 2VUYA 3QUGA 3GLDA 5DR5L 4H2CA 1W2KT 3SKNA 4G6AD 3ZZQA 1SN5A 4NDMB 2DJ4A 4JZJA 5DRNB 5CGMA 1AR1D 1C8QA 3QDJD 2QKSA 2P5PA 2KDYA 5M94B 1JWUB 1SYSB 2LQRA 3CFEA 3SPVB 1I8MA 1L9MA 1BYOA 1DBML 5DRXB 4FQHB 1OGPA 4E5XA 3BQUD 3FUEA 2Y24A 4GMTL 5A2BA 3EO9L 3U4EB 1FZOA 4F2MA 4C56B 4MQTB 2MCPL 1T03L 2CLZB 3VYPA 1EEUA 2R2EB 2JMRA 3PV6A 2D3LA 3SO3C 3GHEL 4FG0A 5IW6B 2NSMA 3A24A 3S98A 5DO8A 4HJ1A 1O9ZA 2HKFL 1MNUL 4FADA 4JFWA 4NBYB 4X6CB 4JL1A 3NGBB 3SQBB 2YMXH 1M53A 4UM9B 2FBOJ 4DFIA 5DEZA 3ARGA 4EI5D 2NW3A 3NJJA 3KE0A 4XXWA 3PDOA 4IBUA 5ITBH 1IAMA 2K3TA 4ERSH 5CAYB 3HZYB 4J12A 5EN2B 3M1BB 4EIZC 1M1SA 1CCZA 3V5HB 4OZFA 1W0YT 4CSZA 3D39B 5LBSA 2W65B 5LNDA 5ESQB 5IHLB 3MRBA 4HKXA 4GKNB 5JIMA 3JQOB 4CAGA 3QULA 4UQ2A 4ORGB 3WJJC 1DSFL 4GBXB 3H7BA 4K94L 4MJID 4Y5VC 3JTBA 1JGEB 2FT7A 3O3EA 4OLZH 2FTAA 3GMRB 2RHEA 4IKJA 3V4PL 4AEHH 3US1A 1MCDA 3QFDB 4FL4C 3OGCA 4XCCL 5CN1A 3DVIA 4OF6A 3VYNA 1PZ5B 3S37L 3VXMD 1JMZA 2O72A 3LKSB 4R2GB 2OL3A 2VIRB 5E1IA 5I1HH 2NY2B 5IUSA 2D31B 1USZA 1Q9KA 4LP8A 4ZPTB 1NUNB 3BZEB 1JPFB 2MRYA 3G6JA 3TNMA 2AXJA 3NYKA 2DMHA 1FNLA 3UGXA 3QVAA 1YEGH 3VI4E 4KDTA 3PGFL 2O26U 5E7FA 3MZTA 5EIIG 3MVSA 3LQZB 3BH8A 1WTGT 3TCLA 1GC1C 1QI4A 4L8DB 5JIKA 5BO1H 4DIXA 4Q9RL 2BS71 4JDVA 4LP4A 1OT4A 4DKFH 4JG9A 2P80A 2WUCH 1ACCA 1HAUA 1GZPB 3UJTH 1GOFA 3TA3B 1AZBA 4EOWH 1HH6A 1TEYA 3CZKA 1ZT1B 2EUWA 4Y4HC 2DEWX 2VDPL 1DUZA 3MRMB 4NC1C 1I85C 1Q1JL 4UOQA 3BLPX 1VFBB 1DSYA 1U3NA 4YDMA 1V10A 5DHEA 1S5IH 4MMZB 4PUBH 3CVHH 4H0LC 3SHSA 4A38A 3STLB 5KUMA 1LD9B 3QEHA 3SOBH 3VGAC 3CBJB 2H41A 3MTRA 5D1QE 1QSED 5DFVC 1NGQH 1RI8A 1SMDA 2VW6A 1D9KD 2NY5L 3ATFA 3JV4B 3RGVC 2R4RL 1OAYH 2PWDA 1PKQA 1DJYA 4H8HA 1KDJA 5F6HJ 3INUL 3WY4A 5AVUB 1Z3RA 3WIHA 3LIZA 1UWYA 3P4NA 3FSWA 3WLWD 5BQDA 1RJZA 2F5AL 4K3HA 4RZKA 1KXVA 3ULSB 1EHKB 4OGZA 4YSDA 5BJTB 2VRAA 3SDDB 4CU7A 3BIKA 4XNZC 1OSZB 4ZOCA 1FUNA 2DWYA 2WQSA 3QHZL 1ZV5A 5CCGE 2N1KA 2GIXA 3WU1A 1KBVA 2YD7A 4NO0A 1UQSB 3T0WA 3FU6A 1RSFA 1FZJA 4R7NB 1HHKA 1QD0A 3LPPA 5BZDB 1LO5B 3E3QC 3U79A 3QIWB 3H85A 3MGOB 3GBMH 2FWUA 4G5AA 3DRQA 4GXUN 3OKNB 4M7KL 1VRSA 4GQPH 3JYBA 4U1SA 3Q2VA 2A83B 2VQTA 3K2UL 1QBML 2JVUA 2OXGB 3MRGA 4J3SA 5DURD 2YD0A 3U7YH 3FU0A 2PXYB 3TJHD 4FGMA 2WYZA 2YJLA 4NI3A 1F0LA 4H8PA 2DDQH 1I1FB 4PJFB 3HG2A 2BFVL 4Y5YB 1RKRA 4ZFZB 1CFSA 3IJ9A 3QQ3A 3BVDB 5TF0A 5FXCH 2I5YL 2HKHL 4XP1L 5HY9A 4Y5XA 4UCFA 3X1FA 1FFNA 2ARWA 1X9RA 1NTDA 3UTSD 2YUZA 4OFQA 4XO8A 2GAZA 3L6FB 3H6AA 1IQWL 2CK2A 2WCSA 1XIWC 3NACL 3HVNA 5EC1A 5I5MA 4PJDE 4BCYA 3J8F7 4XGZB 1NLBL 3VXUE 3ZRSA 1QABA 5LWYH 2R69H 2H3NA 3FB7A 1A3RL 1N4XL 4B7IA 2W60B 3REWA 2M8XA 2WTOA 4BV1A 5PAZA 4Y19D 2AQ3A 1J8HB 2AKRA 1X7QB 2VN3A 4FZ8H 4OCSL 1U8IA 4YBQC 3ZKND 2YXWA 1DJHA 1JNHB 4ZUWB 5FW7A 2FGWL 2XX1A 1ORQA 2IFGA 3BZFA 4HJIA 4F2FA 1E4JA 1E28B 3HPJA 4QXTB 2BMKA 2IBZY 2NPLX 3HI6H 3F58L 4XC3H 2N7BA 2CLRB 3EJSA 4XX5A 1JWSA 5ETUA 3KDMB 3OHXC 5C97A 2YC1A 1NL0H 4KVNH 3N55A 4Q7DA 4BWUA 4EDWH 4GAYA 1HXYB 4AMXA 4K7PX 1DFBH 4G6JH 5CZXD 2VERA 3MLSH 3L7EB 4PJEE 3KL0A 4JMNA 2A0LD 3D50A 4X0KB 2JKLA 4JDEB 2Y5EA 3ZZLA 1I3RA 4RBPH 3IT8D 2VC2H 3RIAF 2E76C 3BD4A 3MCLL 3B9VA 1IM9D 4PB9H 3PQYB 4UZSA 4HG4J 4R96A 4L0ZA 1NEZG 4KRLB 4Z7UF 1ULVA 1G9NH 3L1GA 4OSUH 1WS7A 3BD3A 1Z9SB 2K7PA 3V8CA 2V3DA 2YO3A 3QO0A 1EANA 4P3CL 1H3TA 4AKPA 1K4DB 1S7SB 5DF0A 4CN1A 5DUMH 4FFZH 4IEFA 3BKYH 5HJGA 1PZUB 4OLYH 4ZW6A 4RNRA 2HLFC 1PBYA 3U2JA 3X1GA 1A7QL 2EDLA 1OAXH 3QEQE 3OKKA 2NY3D 1HKLL 3LV3B 5CSGA 4TULH 3V6FA 4OTXL 2R56L 2HPTA 2EH8L 2LW3A 1OP3K 1D9KC 4CMMB 1I7ZA 2WUBH 3B7YA 3L2LA 3ZQXA 4NWTL 1AR1B 1D7DA 5EFIB 5F88A 3DMMD 3BQUB 3CUPA 1I7UB 2R9HC 4GG6E 1EEQA 2Y6SC 2IANA 4AUJA 3J2PA 1G9HA 4AE1A 1JHKH 2NY6C 4JJHA 5SX4H 2EVIA 2BCKA 2Z4QA 5JLZB 2EADA 4GG8B 1HH9B 3Q6FB 3G6AA 2JFCA 2JNZA 2JB5H 3L9EA 3BKML 3QUXC 4H8VA 3T0AA 2OLDA 3U1SH 1KB5L 2A38A 5B1KA 4HHWA 2Z31D 2ATPB 1NZRA 1U8CA 3BPLB 1A1OA 3MOBH 3ECWA 3QUKB 4NKMB 5EU7E 4WSKA 2XWCA 5CNHA 2KQNA 1N6UA 2P24B 3IRCA 3VUAA 2ENQA 3L3OA 3GHBL 3WEBA 1UVQA 3JTTB 4JKLA 3UYPA 1M7IA 4BFEA 2Q7YA 3GO1L 5I73C 2Z7UA 3ULUD 3ARYA 3NP4A 2KLRA 1KACB 4YK4C 2D0GA 1KPVB 1E27B 2NW2B 2AGJH 4TQIA 3HZVA 1KG0B 5LXVA 1XB3A 2K4AA 5EORL 3G7TA 4EQ3A 1OAUH 2ZJSL 5GRWA 4HXAL 4P46A 1MFCH 1XH0A 2IQ9L 2VR6A 3K91A 5F9WC 3S0PA 4L37A 3HBGA 1T2QH 2G30A 4XCNB 4XRCA 2F54A 3ULVE 3UPRA 4DUVA 2WXLA 5JIPA 3IU3A 4QWWC 4MJIB 3G08B 3MBXL 4ZW8A 4RZCB 4UQ3A 1FBIH 1K8DB 3ISRA 4MA7H 3OLGA 1MNNA 2AZUA 4FQJH 1SEBA 2WTRA 4XZ4A 2ZUQC 4IGBD 2EE6A 4JFZL 4HOMA 3HA0A 3OAUL 5F7AA 4G5ZL 5A2AA 2Q5BA 3SKMB 2FWOA 4NN7C 1KIUA 2YGNA 3QUYD 4OGAD 4DF9A 5HDRA 4Z6AT 2VLRA 2XTJC 3OMAB 3RKPA 3IMVA 3O6KH 3ROOA 3KPPB 2BVQB 1YPZA 2GT9B 3DX4A 4LQFH 2PCFA 2OYMA 1HKFA 2VAAA 4O2FB 1Z1WA 3IXAB 4ODUA 2E27L 4XNQA 5EWIL 5I8OH 3RDTD 3WN5B 1N2RA 3K0YA 1S7QB 4JB9H 1KTJA 4NQXB 4ZNEA 3O3BA 5IIEB 4NKIH 2DQCL 2VITA 1IL1A 1S8DA 3MLVH 1V7MH 1ZS2A 4PW9A 5AW6B 4D7BA 5D9SB 4WQOA 2E7LA 4NQEE 1SYVA 4OZFH 4YC2B 5LBSH 1OWWA 3K1DA 4BQCA 3MV8E 2KZWA 3H6JA 2Y06H 4JRXA 3HS8A 4LHQB 4NPKA 4XN9A 3S36H 1KEMH 4ZYKB 4R26L 4R8WL 3G5XB 1J1XL 3N85H 3AY2A 4FKKA 3WIIH 5ERWA 3KGSA 3OGOE 2HRHA 4PRHE 4D3CH 2C4FT 1A22B 3C8HA 2V5TA 2C4XA 3DGGA 5FUZH 5GXBB 1S4IA 1GHFH 3QDGE 4QTHB 1F3DJ 1CK0H 1HESA 4I3RH 2Y6TE 2FIKA 4FULA 5ESAB 3L16A 4NNXA 1UCBH 3NIGF 2ZOKA 4PJGF 2OL3H 4P2RB 5I8KL 1TQUA 5J0BA 4LCIH 1VEOA 4NZJA 5DT1L 1FNEB 1CBJA 4HFUH 2CKNA 4RISH 5C08A 3ARFD 4Y16A 5D1XB 4KJWC 1FHGA 2C26A 3H54A 4LLQB 4ATTA 5BMFH 1CE6B 1MIMH 3VSUA 1P7KB 4KROC 2VMCA 1WFUA 2GBAA 2WVUA 5J56B 2ZX9A 1JZ8A 3EH2A 5E8PA 3UTTA 1EFXD 3BUIA 3QUMA 4FQIH 3EOAA 3TPUA 5EEUA 4D9LH 3C5ZB 1XF3A 2YGQA 2P4AB 5C0FB 4XVTH 2H6UA 1OD9A 3TZVD 3VW3L 4H1LG 4WU7A 1W0VA 2ZT9C 3P3UA 3JWOC 5AVWB 3HE6B 4KKLD 4DP7X 2BO0A 3O41B 1F58H 5GRXG 4JRFA 4J3OH 4DJMA 4AXWA 1PD1A 2O5ZH 4NUGH 4DP2X 4MXVE 5SWZB 4K9JA 1OV8A 4GRWH 2A77H 2AJSL 4P4KB 4FZEH 1I1AC 5C0DA 4XMLH 2WKLA 1U3YA 1T5XB 5LGJA 1H6TA 4Y1AA 2QL1A 2QZQA 5DURB 2RR3A 3ASOB 5JNYA 4YSEA 5D1QD 1P1VA 1VGKA 1KZQA 3P9LA 2EXTA 4KHXH 3NABL 5E4EC 4CKQA 1KYUA 1TTCA 4GSRA 1W72H 1ONQA 3POHA 2ADGB 1OQXA 3N9GL 3AAZB 1H5BC 5FKAB 3Q2NA 3N1FC 4CMHB 3BT0A 1GKOA 4EO5A 5MENA 2BX5A 1DVFD 3VSQA 2F7QA 1PG7L 5I19L 1X4ZA 3UTSB 1WVZA 3LX9A 4PG2A 4AQ8A 1L5GA 1KJ2L 4JPKL 5I30L 4YEEA 3MA7A 3H9SE 4OH2A 3WIHH 3SGDH 1QFWM 2WXOA 5D7LB 3CPUA 3ZT5A 3W9EB 1I8KB 2ZX6A 4HCGA 1P7QA 4K71C 4KI5E 5DZOA 2X6UA 4W81A 5AKTA 5FKPA 1JP5A 4FHBD 4O51A 3J7HA 3TBWA 3THML 3T6WA 1OL0A 3BRFA 2X41A 1P5UC 3L17A 4HPOH 2FVNA 1K3IA 4HC1H 1QSFE 1N64L 3OSKA 1VERA 5CD3A 3MRIB 2EYRB 3GSOA 3FRUA 4X6EB 1N6QL 1CS6A 3G5YB 4FFYH 1CF8H 4N2LA 2P8LB 1ODUA 3V0WL 4YHNA 1R3KA 1P7BA 2C1OA 4TVPH 1S3RA 1G6RA 1IC7H 1VESA 4ANUA 2WBKA 4OLZL 1MIEL 1U8KB 1TZHB 2NY4C 3IDIA 3KWVA 3MNVB 1WQVT 2BRQA 2J44A 1HEZA 1U8NB 3AU1A 5E6YA 4E41E 5L2JA 3LVTA 4WO4A 1KBBA 4PGEB 1XGYH 1PLAA 4B3EA 2OR7A 3RJOA 4PP2A 1BYPA 2VDOL 3RGHA 3V9EA 3RGBA 3NIDB 3I6GA 4QEGA 2MMXA 3WHE0 4M7LL 3KPOA 1TXKA 5KYUA 4E9XA 3PJLA 1E4WH 1XSIA 3VXUD 1NKOA 1JTPA 1UWXK 2P49B 3H3BC 3CDFA 2BY3A 3GSQB 4G8FB 1XQ4A 2ZG3A 3QPQC 5DD5L 3NSJA 3EO0A 2RACA 4LGPB 1NMBL 4I89A 5TDNA 3DOSB 4F92B 5FFGA 4KMLB 3HNVL 5JPMB 1D5BB 2FJGB 1SHWA 1QMUA 4KKZA 1VB9A 1JGVH 2OSXA 5DRZA 4DKFL 3QJFB 2OMTB 5C0RH 2J8UB 1N0LA 5F7DB 3TASA 1X9QA 5D2NC 3VD3A 3DOHA 4F9LA 2AXHA 1J0JA 2QPFA 2AQQA 1YN7B 4XBGA 3OXSB 5EF2A 2F1EA 3RY6C 4NKDA 4ENEC 2YPLB 3HFML 4FLSA 5DS2A 3VXNB 1DHKA 5DK2B 1JCKA 1ZHBB 3EDKA 3KPRB 3UO1L 2MCAA 5ANHA 4JO2H 5DJ2B 3V0HA 3IDXH