2C9PA

Cu(i)cu(ii)-copc at ph 4.5
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
b'HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER RESISTANCE PROTEIN C
molecule tags Electron transport
source organism Pseudomonas syringae pv. tomato
publication title Intermolecular Transfer of Copper Ions from the Copc Protein of Pseudomonas Syringae. Crystal Structures of Fully Loaded Cu(I)Cu(II) Forms.
pubmed doi rcsb
total genus 19
structure length 102
sequence length 102
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c9pA00
1LYQA 2C9RA 1H6TA 2WQUA 1O6VA 2OMYA 4AW4A 1O6TA 1IX2A 4CC4C 2WQWA 2WQVA 3FAXA 3BCDA 2RA1A 2WQXA 1NM4A 2Y5QA 2OMWA 1M42A 1XEUA 2UZYA 2C9PA 1H6UA 2OMZA 4CC4A 2OMUA 2UZXA 3FAWA 3BZ5A 1OT4A 4AQ1A 3BCFA 4CILA 1O6SA 2OMTA 2OMVA 1M9SA 2C9QA 5ICUA 2OMXA 2YA1A 3BC9A
chains in the Genus database with same CATH superfamily
5KSBA 5IJKC 1E4WL 3RVWC 1BOGB 1CF8L 5GGTA 2ZXEB 5F1NB 2C9VA 5KSUB 3L1GA 1RU9L 4HHGA 1WHOA 4PJ5B 5JQHC 4ONGL 3OKNB 2OFQA 4OLUH 4PY8J 1BG1A 3FCTA 1U8PA 1MCWM 1G87A 1AZBA 3VRLE 1Q94B 3FTGA 4X2UA 4AWJC 1YECL 1NGYA 4JR9L 3OC8A 3ZZLA 2P42B 1KIUB 4BZYA 3L3OA 4IU3A 3GMOA 3MV8E 1S78D 4Y5XB 4UT9A 1U92B 4AYFA 2HFEA 2Y1YA 3H3KA 5DUBA 3JWDC 4KO5A 4YSAA 4AW7A 4RX4D 3BKCH 4XN1A 4EI0A 1GJUA 5AVUB 1CDIA 1P5UC 1TTGA 1YDPA 4FQHB 1HXMB 1SM3L 4BA8A 1SN2A 1DBJH 2OQJB 1D5IH 4JY6A 4AE0A 4FA6A 8FABB 4JFHE 3MRPB 2F58H 1QSFE 4BFJA 4EDWH 1KV3A 5BS0B 5EU6E 2CHXA 2ALWA 3IDIA 3MRGA 2G5BA 4PP2B 4PWJA 4S2SA 3RWFA 3S35X 1SHSA 2I7SA 4M3JA 1RIUL 3WE1A 1AQDA 1GGCL 2HKFH 5I1KH 1ZT1B 2Z92A 1KEGL 1BEXA 5D96C 1CDHA 4FP8L 5GS1A 3WHE0 2D7MA 2O5YH 2J72A 5I1HL 3MV7B 4JKPL 5EZIL 5CD5D 4DZBA 5E2TH 4CW1A 1G0YR 4PJBF 2V2TB 4I5BA 3NACL 2XXMB 2EDBA 2X28A 1Q1JH 2X89A 3C08H 3NBNA 1L0YA 3EFOB 1OAJA 1P84J 1NPNA 1LO5B 3BKMH 3CVIH 1T03L 5D71L 1AI1L 4LP4A 1VFMA 4YSDA 4CN4A 2PTVA 2CR6A 2ADFH 3LSOA 4RNRB 4JFSA 2BJMH 2J6EA 4JM2D 2BERA 1BA9A 1FNLA 1JXGA 4D7PA 3U4KA 3MDJA 3QRLA 3WAKA 3QGVA 4F7PA 4U31A 3KYNA 4YZWA 2F9BT 1GSKA 5D7JC 4Z95L 5K9KA 2IVFC 1HILA 4CJ1A 4WUKH 3FO0H 4YE4L 5HGHA 3VRIA 4O2FB 2DJUA 5DFVD 3QUKA 2Q8AL 4WW2B 4LHQB 1AR1D 1INDL 3MLRL 3RZCB 3HR5A 2X4OA 1MNUL 1ZLDA 1IBGH 2DQCL 1OWRM 4R7NA 1ES0A 2RFXB 1GY1A 1KTDA 4IDJH 1A6WH 4KKLC 3UC0L 3CFBB 3GGWB 1AAJA 5D2LA 5IVXE 1KGXA 1JI1A 4LEOA 3MGOB 2YIHA 3MUUA 3UZVA 4WNQA 1J9QA 4OD3L 2K4WA 1E8WA 4M02A 2NW3B 5J7CC 1F3JB 1RXLA 3UACA 5E6IB 4BQ9A 3FOMA 2D2OA 1RJYB 3OX8A 2W1NA 4JPVL 5SX4I 1LK2B 5EB9A 1MUJB 3WFDH 3WJLA 4D8PB 1BHGA 2HVKB 4ABUA 5E4AA 2J1WA 4HIXH 4DNLA 3QJOA 1VB9A 4N0RA 1AR1B 1EEYA 1YNTA 4PB9L 4FTVD 1T3FB 2AXGA 3LNHA 4YSQA 5D72H 2BZ7A 4R96B 4NQVB 5L88H 2G75B 3VM7A 2R27A 4PGBA 3NIDF 1IQWH 1KCLA 4LPUA 2ZAIA 1E6JL 3ARFD 3GRWA 4I0KA 3TBVB 3HHSA 4NQDD 5DHEA 1J1PL 2Y25A 5CZXD 4LEBA 1MRFL 3UABA 3BVUA 3BH9B 4WENB 3D52A 4P3WA 5DI8A 2AERT 2R2HA 5B8CA 2NY4B 1V7MH 3WHXA 1V8HA 4PBDA 5EEVA 3R1GH 1BLIA 2ATAA 4K8RD 4WQOA 1B4TA 3NESA 1W0WA 4GXVL 3Q5TA 4Z8FL 2N1KA 4XC3H 4XX1G 5GGQL 1CDYA 1DSYA 4JFQB 2YEZA 5HHOA 3B8YA 1KIPB 4EN3A 3O4OC 4U7MA 4L8SB 4NRXB 5DD3H 1FLTX 3GJEB 3GS7A 4NM4L 5IHHA 4JW3A 4ANXA 3U7WH 1KCWA 3BZDA 2HJFB 1OCCB 1ZA3B 1A5FL 4WEMB 4W4OA 5I1KL 1RZKH 1YG9A 5BS0D 2WXHA 3EFDL 4GG8A 5I1HH 1AQ8A 4WDIB 3BT2H 5EZIH 3LD8B 1KC5H 2NY3D 4Z3FA 3UYOD 2X0WA 3TBYA 1BWWA 1ZV2A 3MV01 4MJ5B 5T1LD 2IH1B 4G70B 4NI6A 2IAMB 4U1GB 2UUDK 3EH5B 4ONHB 1P7KB 4QGTA 2UVFA 5E1AA 5GSRB 4IIQA 3CVIL 3QP3A 5L6YH 3HJEA 3LPGA 3RNQA 1MFNA 1UG9A 4Z77B 2XRAL 2I69A 4EXPX 5GRXG 1Q9KB 2AAAA 1MLBB 2IH3B 3IAQA 1GOFA 4PH8A 1DDHB 5CR8A 1CE6A 3N1PC 4NBXB 4R26L 3SE4C 4D9RD 2AEPH 1SXSA 2WNXA 2Q7AA 3BW9A 1JPST 4Y5VA 5JOFB 5D7LD 4HZLB 3QXDB 5C09A 2VC2B 3BQUD 5I8KH 3LJ3A 4NBYB 2WTPA 1TZIA 5IBLC 5KTEH 2WN2A 4M03A 4XN7A 2V7NB 2Q8AH 4FOMA 1ETZA 1YLBB 2CUAA 5IEKA 3MA7A 3HS0A 4LASH 2QL1A 4L8DB 4M00A 4S1QH 4DKFL 3IFNH 5F9DC 4U1MA 3ZDWA 1A6WL 3BN9C 4NCC2 5F7DA 3UC0H 2X6MA 5K9JL 3N85H 1QYGH 1AKJD 2GK2A 1TVHA 3GTVA 3NFPA 2ISDA 2EDWA 4QHPA 2O5ZH 3R4RA 3SBPA 1RPKA 1HE8A 4AYSA 2XBZA 2ZUUA 3N40F 1INEH 4QOKB 2VZUA 1T20A 3GXDA 2V4LA 2XPYA 4I3GA 1MY5A 3B4NA 5CS7A 1T80A 3QEHA 5L88L 2XWXA 5ENWB 3OKKB 2E7CA 3H9SE 5BQ7A 2B1AL 2DI7A 4LLMB 3NCMA 4Q14A 1C7SA 3PWJB 3OGOE 2LE9A 2NY0B 2ZCZA 2ZIDA 1VFAB 3C87A 3H9SA 4U3SB 1T0NA 4P46B 4X6DA 2JKWA 2R29L 2BC4B 3MUZ1 4BDVA 1P4BH 1XGRB 1YC7A 4HIQA 4HSQA 3F6JA 1BZ8A 1E4XH 4PJXE 4RFNB 4PM1A 3OAZH 4AMWA 3ARFB 3EBIA 2DTSA 1DVFC 1GOGA 2EVHA 3PP4L 4FNRA 2IWGA 4HULB 1MFBH 4P23B 4UQBA 2VLJA 3CDFA 2ZUQB 4XC3L 3GSOB 3C5SB 4GLRH 3FN9A 4KJYB 4BSWB 3D39E 4F24A 2YR3A 5I9QC 1JWMA 3QAZB 3PWUA 2ICEA 3L3DB 2K70A 2VERN 4P2OA 4B7LA 1N2RA 2WXQA 4G7VH 5B1JA 2XWZA 3OM3B 1T7XA 2AJZB 5AWNH 3VFTB 2OSLB 2HFFB 4ELMF 5L2KB 1XF2B 3EYFB 4ZSOB 1XEUA 4PSPA 2MPVA 3ZMNA 4H20H 2AJUH 1CD1B 3VSUA 3LS5L 1T21B 4MS6A 3DIFB 4UWQB 5C0RL 2NY4C 2DV6A 4KKCC 4CMHC 3NJKA 3LKPA 2VAJA 4XO8A 2KZWA 1FJ1B 5EUOF 4E9VA 1JPGA 5A2BA 5HDQL 2YO3A 1BD2E 2A6JB 2OTUA 2OXHA 4GMTH 3CNKA 5L6YL 2QSVA 4F8PA 4Q7DA 3EH4B 4KNSA 3TCLB 1BD2A 2ZWLT 4L0YA 2P7TB 2G3XA 2W9EL 4TL4A 5E9DD 4QYOA 3AS1A 3ARZA 1JGEB 1KT2A 1JCKA 3KGSA 1BAFH 2GHZA 3E1F1 3QORC 1KJ2B 2RB8A 1NEZA 2CCLA 2VC2H 4Y16D 3GWJA 1G94A 2Z64C 3BYYA 3RX9A 3I3EA 2PNDA 1LO3H 3ZE2B 4GKNB 4GSXA 5FR3A 2CR0A 4H0IA 4FX5A 4IBYA 5C07B 2BWQA 5HI5D 2ZOTA 4MCNA 3B7YA 5EIIG 3SJVB 3ABZA 1M7XA 2ED9A 3QXAB 4QRRA 2YAFA 1AD0B 4BK5C 3FQRB 1QYGL 3CHSA 3QIBA 4N2HA 3KLAA 3Q8FA 2BIIA 3C60D 3ET9F 1ZT4B 4HOXA 1O6SA 1VF5C 4IYKA 2ITDB 2X4RA 1IBHA 1KDJA 4GI6A 4TLSA 3IMTA 5E8NA 1B2WH 4ZMZA 3D39A 2E7LC 5KUKA 1FVCA 3UPRB 3LYRA 4L8BB 4RFEB 3L5IA 1EBPA 2B1AH 4HJIA 3V5DA 2E27L 5LWYL 5I0YA 1DBKH 3RBGA 1Z5YD 4LLWB 1S9WB 1A4BA 4JFDE 1CN4A 2QPFA 4U1LB 3ZTJG 4AEHL 1KSRA 1LEGB 2W38A 4HGMA 4OGYH 1BQUA 4NC1C 2XV6B 3WJJA 4AKOA 3K71A 3L3IA 2HRGA 3PXLA 4Z7UA 4QWWD 1KYOK 2R59A 1R3JA 4PRPA 3U1SL 2FEEI 1BSIA 4AQZA 4FQPA 5J1AA 2B39A 5TQ0L 5E1HB 1U8QB 4K7PL 4R0LC 1QRNB 1M53A 5D9SB 3KPLA 3L1FA 1EFXB 2FVNA 1U8CA 2BLFA 4HWEL 3WEXA 3GRBA 1ZMYA 5F7MC 3GFUA 2ZUYA 1QLRA 4PJBA 1ODUA 5J6SA 4B9FA 1N8OE 3QQ9C 5I75B 4AQ1A 3ILPA 2AQSA 1AZCA 3IKCB 3BXNB 4YGVA 5F9JB 1KELL 3SCMC 5AWNL 4JK0D 1D6EA 1QBLH 1LYQA 3GMPB 5C08E 3MRLB 4X8JB 1H5BB 1I9RH 1M9WA 1HINH 3K8KA 3D69A 1Q9WA 4ZUSB 3J27A 3ARGB 2EUVA 4E42B 5D93C 1CCZA 1P2CA 1N68A 1BOYA 1KCSL 2OMWA 3P0GB 3D85B 5FA4B 5GZNA 4E5XG 1JTOA 2V7HA 1QRND 3DOIA 3G5XB 2CO3A 3K4ZA 3LEVL 4OQTH 1PFOA 4LVNB 3QUZB 3V9CA 1MCIA 3ZKXC 4YBQC 5IR1B 5F9OL 1ACZA 4GMTL 1J5DA 1N70A 4X5WA 4XP1L 1VGKB 3SKOA 1U8NB 3NJJA 1P4UA 4UQEA 1F2QA 3EGDA 1GAFH 3ARVA 4TUKH 3WS6A 3FB8B 3LRSA 4RMUA 2MQCA 4EKXA 1ET7A 1SGKA 4R9HA 2MTPA 1UUNA 4XT1C 2V3EA 5IVXB 3IFOB 5E6ID 3F64A 3WO3B 3KPMA 3DSNA 3WYRA 4M8VA 1HNYA 1NCOA 5DRXA 3WCYA 3UPCA 2MHAB 3QT2A 5D1QE 1CG9B 3RPBA 2MNUA 3AZUA 3EJCA 5K93A 1L5GA 3SDDC 2AKRA 2Y23A 4LU5H 4R90L 3MGAA 4XO4A 5C0BE 4ALAL 5ICYA 3NCYP 3CH1A 2IC2A 4S1SH 5I1JH 2W65A 4BQBA 3MROA 1ADQA 3SJVD 4P5MA 4J4PA 2VUOA 4ERSL 1FE8H 1V7NL 4PRIA 2DQGH 5DYFA 1RVFL 2W0FA 4ODBD 2BSED 3CBJB 3WUWG 4MGXA 4UTBA 4TSBL 1CDCA 2OCCB 3TF7C 4KKAC 5D5MB 4LOUD 4GP4B 4DUXA 3UROR 4QIRA 2IDSA 1XIWA 5KANG 4KKPA 4XMZA 4WHDA 5TGBA 3US9A 1UOVA 2D7PA 4AKQA 4Q6IA 1IX2A 3CMOL 4FS0A 2F8IA 2O72A 2EIZB 4F3FA 3RJDA 4H8WC 3VXUA 4IGBB 3K4AA 5I6OA 4GG6E 4QNPF 4ZAKA 1BIIA 1E8YA 1Z66A 3MRMA 4BYHA 3DX7A 1HSBA 4C4KT 3CUPA 2XWJB 3VFVB 5ALCH 2LLLA 1EJOL 5I6PA 4ZFZB 1VERA 1N8ZA 1IM9B 1E50A 3O3EB 5CCHE 4Q97A 5EZLB 1JNNH 1OAUL 4KAQH 2VDPB 1L9RA 2LW3A 3BWUC 4KZCA 5SWQA 4NGHL 1LILA 1T04B 1N7ML 3BVTA 4G3YL 2Y5EA 1HOEA 4P5KA 1G7HB 2JTYA 4LSVL 4ZPTA 3VFRB 4XNUL 4GAFB 1N59A 3M6DA 2CR3A 4I18C 1E3ZA 2FLRT 4TKWA 1KB5H 4AH2A 3CJJA 1N12A 4I4WA 1R3LB 4QRFA 5HHXH 3MMEA 2HN7A 5DT1L 2YPVH 2YARA 5FV1L 1IAMA 5B3NA 3QDAA 4R7XA 4J3OD 2E9WA 4A38A 5DRWA 4LLUB 4OAWA 2FGWH 5CIPB 2FIKB 5EIVA 1OSEA 3QJUB 4PJBE 1NUDA 1QFWH 3SOBL 5GZOD 1JWSB 2FHCA 5CSBA 2OCFD 5IKCA 4IRZL 4K8RC 4NP4H 3UAFA 12E8L 3C6LB 4C58B 5DEFA 3UTTD 4M93C 2VZ3A 2CO7A 3VFNB 4MJ6A 4JRWA 2BIHA 3NCJH 5DHVB 3KYKH 1RSYA 5HDLA 5HHPB 3SPVA 3UJTL 4OU3A 5IHUH 3CDGB 3IN2A 4B0MB 4B95C 3CBRA 4H44C 1E65A 2A74C 4MB5A 4PRBB 2OR9H 4WTZA 4XVUD 4CVUA 1K9TA 4O02A 4XCNA 5KVFE 4U6YB 1YMMA 3RY4A 1HESA 3Q2WA 4WNJA 2OKMA 1S7VA 1N9PA 2KPWA 1GIGL 1WA1X 4YK4B 4M6AA 4TUKL 5EO0A 1Q0XL 2NLJB 4X6EB 1HFUA 1O6VA 1MCLA 4UU9A 4EVNA 2G0KA 1Z5LA 3GSUB 2DW5A 2WN3A 1SOQA 3K8MA 3BN3B 1JIBA 2Y06L 4Y4KC 4F7MA 5I1IH 4KKRA 4FCHA 4LBEB 4YZFF 1AD9A 2ZXGA 1VEPA 3DC0A 1HHHB 4DN4L 3WLBA 2BMKA 5FFOA 3KGUA 3ZT7A 2ENPA 5CN2A 2VTFA 2Z1KA 3IPBA 3U9PH 4K9EC 3OV6A 1U2HA 1IRAY 3RZCD 5AW7B 1KYAA 3QUGA 1FSKB 3GM0A 4NHCH 2XZZA 1BVKB 3H4HA 3FU7B 5GGRY 3GHPA 4JFVA 3G6JB 2B3RA 1U58B 3NPSB 3GSNL 3U46B 4APXB 5AB9A 5BJTB 3B56A 4HP5A 3ZE0F 5HYQA 3VXNB 1HL4A 2EDXA 2JJTC 1DFBH 4LXFA 3TA3C 2H0EA 1VKXB 4BINA 4WUUA 5C3TA 3VGBA 1UXSA 4CL7A 2B5IC 2FGZA 3FQUA 2FX8H 1T0MB 4JPKH 2X70B 3GKWH 3CZNA 3SDXE 2F53A 2DPKA 3ARBD 1T89C 2F19H 1M6OA 1SMDA 1O7SA 2A4CA 2JCCE 5E23A 4G43B 3L3GB 1FH2A 3ATEA 3FF7A 4TULL 1QR1B 2K78A 5ALBH 2C5DC 3MV9E 1IB5A 4N0UE 4G80A 4Y1AA 4D94A 3WU1A 3DARA 4DTGL 2X4SB 1MVFA 4UIMA 1KIQA 3FFCB 4CU6A 2KYIA 4F7EB 1SBSL 1SJHA 3DGDA 5LG6A 3WFZA 4AYGA 4NWTH 4QXUL 1JZHA 3LIZL 5JHLL 3HZMA 1KCRH 2A77L 1S7XB 2FJHA 4NUMA 1JYXA 2GUOA 4D0BB 3H2QA 4HZ1A 4PY8I 2BHFA 4JANA 2XFXB 3TA3A 4P2QA 3N2JA 5K9QG 1TQCC 5I1GL 2BFVH 3GT6A 5IEHA 3DBXB 1RUPH 4NPJA 5JXAH 5L0QC 3T0WA 4KJWD 3ZE1B 3GSVA 2F8VA 4KDWA 1M4KA 2FGWL 3HG1A 4UDUA 3SOBH 1QFWL 4LDEB 2ZUTA 1JK9A 2FYYB 3BMVA 1VEOA 3AQYA 4YHZL 4Y16B 3SE6A 4HFWB 1J05A 3IMSA 1GYCA 3I9GL 1D7BA 1GKEA 1OGAB 2WSDA 4FMKA 3SDXB 2KPNA 3UGXA 3REVA 4WHTB 4OFQA 2CCVA 3CSGA 4M48H 1IJNA 1RQ5A 4D9QD 3LQAH 3DV4B 3H3PL 1D7DA 2YAPA 1XTLA 1AO7B 2BOBB 2K7QA 4Y2OB 1RZJC 2WMPB 4LPWA 3TEZA 3DGCR 1Q90A 1THCA 2K3HA 5F6IC 4F9PA 3OR7B 2PPDA 5IMMA 4N2FA 5LN8A 1U3HD 3KH3A 3MRRA 3US1A 4IOFC 3ARDD 1I1FA 2V8MA 3ULUE 4TUJA 3KWWA 3KEDA 2YBRA 2JKTM 3OZLA 4WZ9A 7PAZA 4JRYA 5BUPA 4KK8C 3QG6B 4MMXA 4BSVA 3EGSB 3QQXA 2FR4B 3BUYB 1YEKL 3N91A 4DN4H 5B39B 1MCOH 3OR6A 1MW1A 3RFZA 4NWUL 5E7BA 2NZIA 3AT9A 3UP1A 3WE6B 1E42A 3KDPB 3G9AB 2AEWA 2PW2B 4I3SL 4HJEA 1FRGH 2VSMB 2H8PA 4NI3A 3WIHL 2B5IB 1EZSA 4N0FA 5IW3A 4Y7MA 3PAZA 3QHFL 4G5ZH 3GSNH 2H0PA 1U8KB 4U6TA 1I7TA 3IGUA 5ACZA 3CPUA 3FRPG 5FUOH 4PJ9D 2YSTA 4NQSA 3MRJA 5EZOH 5D2NC 2DLEA 4GW4A 2FO4A 5DR5H 3LRMA 3Q2CA 1B0RB 4L3EA 4NZTH 4OFKA 2HPOA 4LF3B 1LE9B 3ESVF 2C9PA 2Z91A 4POYA 5A16A 1AOHA 5JDJA 2VRAA 3HJ0A 4PHXA 5CCKH 1XCTA 4LCWE 2GITB 3MRDA 1S46A 4I0PD 3AABA 3X3GH 5C09E 5IOPB 2HKHL 5T3ZL 2W07A 4M5ZH 4PYHA 2Z1PA 1B6UA 1R5VA 3VXMB 1OALA 3GSXB 4LRNL 2VR5A 3NJFA 2KDGA 4Z7VF 2WXMA 5E5LA 1PY4A 4WV1A 3ZKQD 2X7LB 4Z7NB 1LJMA 4Y4FD 1O5DT 5LXGH 5EBLA 4A2MA 4O00A 1Y0LB 2KLRA 2FECI 2JKXA 3D48R 2F5BL 4WWKB 1KPVB 3LZNA 2YPLB 1DYZA 2ZCHH 1TJIH 3QO1B 5DHVH 3MV9A 3V5KA 5B3JF 2FT8A 5IGXH 4Y5YC 2MPAH 1J9CT 4APQD 3NSXA 5HJ3A 1NC4D 2VQTA 2EYTA 1RLWA 3E3QE 4J27A 4U1KB 3RHWK 3BP6A 1EJFA 3QFJE 1XX9C 4ZPVA 5M7QA 1J1OL 3EDEA 1JF1A 3UADA 5EF0A 2EE3A 4EBQL 1T1ZA 5T3ZD 4DVRL 3MACL 2IQAA 3H1ZA 1FVEA 2E9IA 5CILL 3CV5A 3DPDA 4N8VB 4QRPA 3MXVL 1A02N 3CFDA 4IOIA 1F11B 4LNRA 5JMOC 1UWGH 1OQOA 2YXVA 4XCYB 4XN9A 1NSNH 5EWIL 3ENEA 2XN9D 2BSBA 1LWRA 2DIJA 2COQA 3BLKA 1JWUA 3VFMB 3VXOB 3W9DB 2FEDD 3PNRB 3DX4A 4MXQD 1PL3A 5FKAA 4FFZA 4KTEL 1TU2B 4Y4KD 3UTZA 4NNXB 5EDSA 5IVOA 2YGPA 1W8OA 4BH7A 3SPGA 1BZ7A 4NZ8A 3MNWB 3VXSB 2JKIS 4PGJA 3H42L 2AXHA 2J88H 1XD1A 3QC6X 1TENA 1ECZA 3QJQB 1OTTD 4YSOA 3PIQB 2JLPA 5J57B 3BP5B 4PTTA 3WFHA 4NN7B 5KYUB 4N2LA 4R7DB 5EEXA 4MDIA 3MRBB 2PYEE 3LD8C 4AVKA 3ZDXF 5AOKA 4EIUA 3HPLA 1W8NA 3PDDA 3QFJB 4K9EH 3QDME 4KRNA 5TJWK 4JDTH 2J20A 1MF2L 1TJMA 3TONA 2EVJA 3Q44A 5FLVA 4UIKL 3UC2A 1C12A 3R06A 3U48A 4XNMA 4ENED 2X53A 2VN3A 5CBAB 4PJIB 2OYLA 2DEWX 3EOAA 1O5PA 1G7MB 4XAKD 2KI6A 1T66D 1G9MH 3N06B 2CHNA 4W6YB 3PHQA 2DTMH 3BP4B 3BFOA 4NKOA 4M8UA 4WU5B 4CU7A 1URLA 3ZKMD 2FSEB 5FYLE 4I9XA 5FUOL 1P7HL 2PYFA 2XN0A 5FO9A 4PS7A 3C5JB 5E2WH 2PO6B 2AXWA 4IOSD 3NSYA 2F54A 2R4SL 4U05A 3TCTA 1K2DB 4JCMA 3KL0A 5DC4B 3CZFB 4A7UA 3JYBA 5DEZA 5JNYA 1FZKA 3MBEB 3INUL 3EF4A 5DK0A 2Y07L 1FZMA 4HUVA 3F85A 4UT6A 2E3VA 5DK2A 4WWKC 4F7TB 3ETTA 2NXYC 3LQAC 3SDXF 4YIQA 4GINA 3X3GL 4H4NA 3U30C 3WO4B 5CJOH 4HLZH 2GTWA 4JFOA 1S6NA 3ZZ1A 2N4IA 5FF6A 4JLRB 1MDTA 1LD9A 3A23A 1NGQL 1T5XB 2CGZA 5LXGL 4FHBD 5JW3L 1E2VA 4JREC 1G0XA 1G5AA 3M88A 4LMQI 2CIIA 2AS5M 1E9QB 1NMBL 1FFTB 1ZSDB 1WICA 2XQYK 1OTUC 2R1YB 3QJFA 4JZOB 4XNXH 4OLYL 5CO1A 5PAZA 4YPJA 4AC4A 4DVRH 3IVKA 1HYSC 5IB3A 1P7QD 1X7SA 1LWJA 4CVWA 1T0PB 2UWEF 2E4FA 2WUBL 4FQQB 5IG7B 2XU9A 5JLZA 2C7UA 1PX8A 2FDBP 5IQ7H 4DH2A 1PEZA 2HKAA 1CDJA 1G1YA 5KVEL 3HBGA 3QUZC 1R75A 3CN2A 2OV0A 5IB4B 4JAMA 4ORZC 3Q3GA 5FCSH 4FZEH 1IT9L 1E7UA 3BQUB 3BHBB 1BPLB 4F2FA 5T5FL 1EA9C 3MV9D 1NSNL 3RB7A 3QZPA 5GRJL 4M3KB 4JPIB 3UG4A 5EMYA 5EOTA 2JCWA 4LESA 4Y2DC 2H32B 3ZQXA 1B90A 3QYNA 2ZSVA 2R7EB 4A63A 5IW1A 5MENE 3BVXA 2NUTB 1IC7L 3DECA 2GY7B 2DQMA 4ZZKA 4R3SA 1DVFB 2IOIA 3HPJB 4YBHA 3RJQB 2BH0A 2Y1AA 4LLYA 2I9LA 2Y3AA 3GDCA 4HK3J 4XMXA 4X6BA 1DEEA 4CUCA 1UM5L 4E36A 4YXLL 2PXYA 3CFNA 3QIBC 4FLRA 3VWKD 1DDTA 3HG4A 2E74C 3ARUA 3IKKA 3G08B 4LPCA 1YJDC 5A2KH 4QHLA 2OMXB 2GSIA 1LVEA 1UM6L 5C08B 4PAZA 4PJAA 3WDJA 4ALAC 1UT9A 4IIZA 5HXMA 3GIZH 4PJ8B 4N8UA 2A6IB 2VDLL 1EZLA 4UIKH 3ARPA 5DJ0A 1R9FA 3O9WC 1BZDA 2NQDA 2BSEA 4W6XB 1ZLUH 4WKZB 5TH2A 3ZXAC 1FIGL 4N2OA 2GFBA 2D3NA 1Z7JA 5GS2H 1OAZH 3F04A 4OBSA 2NY1C 4YSSA 5F3FA 5EC2A 5FYKL 3VH8A 2GW5A 3L3HB 4TQ8A 4TL5A 3D12B 4EOWH 2VABB 1SY6H 3ZHFA 5IHLB 2AZAA 1R5IB 3BN9D 4ODUB 3M86A 4EDXA 5H94A 1W72L 4XOCA 4F80A 1YPZE 1WS7A 2V33A 3CG8A 5K39A 5CD3A 1MWAB 4MXWL 4OIBA 2A74B 4JFYB 4JFZL 3IRCA 2Y07H 4OJAA 5KN5A 4GG6F 4UQIM 1JK8B 2NYYD 1ZDSA 1X9LA 2QHRH 2VLRE 1AR2A 1Q9OA 4LP8A 4PBXA 4P2OD 1C08A 3FL7A 2EE9A 5KEZA 2K3TA 3A21A 4JFDB 3GIVA 1KB9K 2IWFA 2AZUA 1TMCB 2CJUH 2H47C 3O6FC 3RB5A 1DBMH 4S1RH 5AKRA 1G7QB 4NENA 1UVQB 2BNRE 2YPVA 4LFHD 2CDGB 1YEDB 2AMGA 4YUEH 1DUYB 3FONA 1L9PA 4ETYA 2XWEA 4WJKB 1CXFA 1EMTL 1OHZA 2QQLL 4XNXL 3FT4B 5HGAB 4YFLF 2XQBL 2YRLA 3S3CB 4Q0XL 4NQDA 5DUML 3OKDB 3QUYB 4H1LG 2WUBH 4JN2A 3PABB 4JRXE 2XV3A 1NEZG 3QWQB 4I0PC 5KAQG 4QY8B 4Z7UF 5CEZL 2YD9A 5C0FA 1OT2A 3T65B 1TTFA 3IJ7A 1M7DB 2EIEA 1I7RB 3HBZA 3DX2A 3KD4A 5T33L 2R0WH 4TNFA 2E8ZA 5H35A 3KPPA 4UV4L 4D0CB 4Z7WF 1WWAX 3SCMA 1UB6B 5ETUA 2FBJH 3FSOA 3F7LA 5EU3A 4YQXH 3GMRB 3IJHB 1KGIA 1UXLA 5D1XD 5TTRA 3JV6A 3WJMB 4DZ8A 1BBJB 4OGAD 2QMKA 5ITBL 2DLFL 4EMZA 4MFHA 2EIBA 3ZDZB 5FDWA 3OKEA 3O6FA 4I48B 1ILUA 4MWFA 1GPOH 2VLMD 4JQIL 4PJFA 4HG4J 3WFEL 2AQQA 1FORL 2OMNA 3F8UB 4HHWA 4W70A 5KS9A 1UQSB 3TO4C 2HT3D 5DD0H 5DO2C 3RPKA 4MMZA 2VXSH 1H8SA 2HWZL 2UZYA 2DYPB 4IMKC 4LP5A 5H37G 1FQ9C 4GO8A 1PNCA 1XR8A 5BNXD 1NAMB 3PJLA 4XNZC 5GGSB 2CRMA 2ZXDA 4ZFFB 1MCDA 3E7JA 3CPLA 1JNHB 2JI1A 3WKML 4NN5C 4KV5E 3X1FA 2FJSA 1JHKL 1OOWA 1MKFA 1E5BA 3SDAB 3D39D 1Q1PA 1RHHA 2X6UA 2Y7SA 4XO9A 3JYCA 2F7QA 3MXWL 2J8UA 5ERWA 2NDGA 4HT1L 2X6CA 3B83A 4WFFE 5TQ2L 5BO1H 2Q86A 4LOVA 4PWKA 2CRIA 1X5KA 4FTDA 3VFSA 3N55A 2MKLC 4LCWD 4W93A 4H8VA 2HTKD 4UQ9A 1TCRB 2F7IA 2J6WA 1KN4L 3IMWA 3SO3B 3VQMA 2CQVA 4R8WL 4GRWH 3SQOL 3VB8A 4GNKB 3KVQA 3MBWA 4OTXL 4WJG3 5H2BA 4ORGA 4ZQKB 4Y9BA 2VR8A 5DU7A 3NFSL 4I18B 1XGYL 7FABL 5CXPA 3HI1B 1I1AB 2YEVB 4OW6A 3BPCA 2DJ4A 5F3BB 3FH8A 2IADB 2FNWA 3F65A 3KPSB 4LGSB 1RHFA 1XCQB 5E4EB 5AG9A 3KLQA 4XC1L 4FNSA 5GSVA 2PWFA 3FUDA 4PG2C 4R4FH 4NQEE 3O3BA 5JW4Q 2WLMA 2EYRB 2LAGB 1YMMD 1VFBA 4S1RL 3IJ8A 4XVTL 3UX9B 3NG5A 3FUHA 4FNLL 3SBQA 1ADQL 4NHUA 4Q2ZA 3FQYA 5LAPA 4KQ0A 2WXGA 3MLSL 2HTLD 4JY5H 4NRYA 3T0EE 1YN7A 3JZYA 4GAGL 4UB0L 1CK0H 1IQDA 3JUZA 4BUHA 4NQTA 2DBLH 3V0GA 2VITB 1I85C 1IIIA 3HMWL 1E4WH 2QKIB 5JOEA 2G60H 4WHYG 5T1DL 2WNGA 1O9WA 1U3NA 1YQVH 1B0GA 3EOTL 1ZPUA 3EJYC 4Q8BA 4DFIA 3AQZA 3DO4A 1NGPH 4PJCA 3QZLA 1DBBH 1NANH 1UKSA 4N2CA 1SFHA 3IU4H 4RFNC 1HAWA 2YUWA 2G9HA 4W9KC 2EO9A 3STLA 4C83A 2LAAA 4GSRA 2H1XA 4DVBB 4CNIA 3HN8A 2TRYA 2LHAA 3BKCL 4LHUB 3DXAE 4E5XB 1DLFH 1EXUA 3DROA 4HPOL 3QULB 5EIIA 5AW0B 5SV3A 4J6RH 3DO7B 2UYLA 3EH2A 5DMJB 3CN0A 3OF6A 1MFDL 3MV8B 1E9PA 3L5WB 5FGRA 3RPIA 4J3BA 2PTTB 4WSJA 4EKJA 5I30L 2I5YL 3VGHA 1RAMA 3MNZA 5F9WB 2HKFL 1IAIL 4P4KA 2BHZA 3Q2LA 5DJCA 43C9B 1F5WA 3BLBA 2R1XA 1SJEA 3K7UA 3HZVB 4OF7A 1KB5B 5KBMA 1I4FA 2MMXA 2J21A 2O5YL 3ZU8A 5FW6A 3RY5A 2IDCA 3D06A 4LSSL 1EAJA 5I0DA 1A1NB 1R47A 2B59A 2Y36H 4FADA 3APNA 1CJYA 1J9TA 1U8JB 3AITA 2QADB 2Z35B 2OMBA 3LKOA 1YUKB 4IBLT 1GS8A 5C07D 5BO1L 4F8NA 3M1BB 3QZWA 4PJ8C 5CP7B 3BD5A 2H26A 3GMNA 3A0OA 5CEYB 1EO5A 4FD0A 5JOPE 3EYOA 4M4PA 3B2UC 1J0ZA 3TVMC 3SY0B 3DOSB 1HSAA 1H5BC 5D71H 5F88A 5C0JA 2IPTH 4WFHE 3OKLB 5IJVB 4KUZL 2FL5A 4OFDA 5EU5B 4DKTA 4EI5D 1CL7L 1FV1A 2W81C 4CC0A 5EU6A 5T5FA 1KTRL 1YPZF 2WXLA 3PXJA 3EGXB 3JTBA 2CHDA 5FO7A 3PREA 5IW6A 4X5RA 1ZWIB 2HP4A 3VRJA 5C09D 1LGVA 1WTLA 1YY8A 4GRWF 4WO4A 1H6UA 1LP9F 2OP4H 3N1FC 1CFQB 5E6SB 4UQ3A 1R17A 4UOW0 1WAAF 2DMBA 1GGIH 1ZHNA 4E9SA 1JDCA 4NYLA 4UUJB 3TJHC 3WGUB 4PJDA 1TXKA 4K23H 4PW9A 3LRLA 4CILA 4ZNEA 3ZDZF 1KULA 5SV4A 3QORA 1EERB 4C59B 1FFPA 1U2YA 4PRHD 2X9XA 4RSYA 1NOLA 2FAUA 3CFQA 5DA0B 3U6XA 1TQUA 3L3JA 1ADQH 4FN0A 2CM5A 3MSPA 2H3NA 1OANA 1O9VA 1QP1A 1U42A 1GY2A 4JVUA 3S8WA 2XN9A 2HFEB 3QI9D 5J0BA 1M2OA 3KJ4B 1J0JA 4OI8A 3UERA 4LPYA 4JPVH 2B1OA 2VZSA 2K8QA 1C5CH 3FTUA 1YDPB 3BKJL 3OPZH 5F1IB 1G6RA 4MSWB 4NKDA 2WHVA 2V5SA 4KMLB 3FFDB 2G60L 1BQRA 1YMHA 2WUCH 5KYYA 1VACB 3GMQA 5BS0A 3SGDI 2NZ9C 4NO5A 4PGZA 1OQXA 1VPOH 3L13A 3ECBB 3VB9A 5MEND 2HT2D 4PJ6A 1PDKA 3CFTA 4MAUL 1VJSA 3B9KD 1DBAH 5BZWA 3CFUA 3B37A 1GYAA 1MOEA 3CSTA 4B9CA 3QDJA 4A6YB 1FL6B 1I8MA 3ARED 3GJFK 3FYIB 5HHMB 5JIKA 3WMQA 4XHQA 1DLFL 1NLBH 3AU0A 3VFOB 1UB5A 3UBFA 1OEZW 4X8GA 5DK3A 4PJXA 4YK4C 2WQUA 2W0LA 2Z34A 4OZIA 4AEIL 1NOAA 1WBZB 4UINH 4V33A 1IILE 5DD3L 4R7LA 4AEFA 4NM4H 1UXMA 4OCNC 3VWJD 4BGLA 5I17B 1REIA 4Q9QH 4M9PA 2I5YH 1J5HA 1F13A 3V0EA 1Z5HA 1KLUA 1RUQH 2OJEB 1MG2C 1QNIA 1KENL 2WSPA 4FXKA 4WSKA 5AYUH 3WDIA 1ORQA 1DQMH 5F44A 1L9MA 1O75A 4HWBA 3O4LB 1SEBB 4AMKL 3K72B 2VDMB 5L2JB 2Z93A 1AGDA 5D2NA 5C9KA 5FCUL 2G30A 3NJIA 2C1PA 1H3TA 5LKNA 3W57A 4NZDA 1P7QA 3NJGA 3BIKA 1CR9L 4O02L 1RJZB 5DMKB 5KW9L 1MDAA 2EH8L 3UTPE 3FQNA 1UFGA 4OF5A 1Q8MA 3EO0B 3QXTA 5CZVH 5BV7B 5HVHC 4HEPA 2X4PB 2IPTL 4OUUA 5IV2A 2WBJD 2BNQB 1I8LA 4KUZH 1OB1B 5EA0L 1MCBA 4FI7A 2DIBA 3IGAB 3W39A 2LU3A 4GEJA 4DP4X 1SMAA 3Q9QA 1B9KA 4YZFE 2OPCA 4MA7H 3LN4B 2IPKA 4JQVA 4QXTA 4HXAL 4OCXL 5FAAA 5C0DA 5T3XH 5C6WH 4FQXC 1OM9A 3KDMA 1R3KB 3DK2A 2EUXA 5JPMA 5BRZE 4GAJL 4NQCE 4OJFH 5I8KL 2ZXAA 3BESR 3FSZA 2IAND 1WO2A 5KTEL 1PNDA 3RFZC 2HZHA 5FK9B 3WNLA 4F58L 1OLZA 5KSBF 4J8RB 4K23L 4L3FA 2VR3A 2ZOWA 2P44B 5KVDE 3DIVA 5CEXB 1YPZA 3QUYC 1M05B 3BO8A 1E4KC 1NJ9B 1MFVA 4BZ1H 4LPVA 4L1TA 4OCYH 3HZKA 4F57H 5F6HJ 3PDGA 5JO5B 4FZ8H 4PRHB 4WI0B 1IGIL 2OX5B 5F8RC 5JHDB 1ZT7A 2OSXA 5AB1A 1DJWA 2ZSWA 5EUKB 1KBGH 2O5ZL 3F7KA 3G6AA 5GRVK 4XCEA 4ZW8A 4WY7L 2PTUA 3DGGA 5FUZH 3VGDA 1INEL 1FO0A 3GXPA 5AKVA 4GQ9H 4EAEA 5IIEA 2IANB 2YBGA 4KRLB 3BT0A 4X7SH 1BZOA 3QDMA 3TJEH 2FNBA 2N7SA 1MZZA 3OD3A 5ID0B 2D73A 1H19A 1EHKB 1KIPA 3D4ZA 1CFTB 4MJ4A 3GJEA 2VDNL 1G9EA 2QZ5A 3EDKA 1LDPL 2ZZUT 3QEUA 4FF9A 1VPOL 4A1RA 1KPRB 1N5AB 5CLTA 2EDKA 1W80A 4NB7A 1CB4A 1G9NC 2W59A 2GYSA 4GI8A 4MJHA 5E2VL 3VDCA 3X12A 3QBTB 4OM0L 1PYWB 2R29H 2A73A 4KRPD 1EIBA 3E1ZA 5J6GA 4PREB 1QSEA 3Q8EA 3RVXD 3LXAA 3PNWB 5DVMA 2XIBA 1BXUA 1QRNE 1RURH 1W0VB 2PCFB 3LNIA 1CPUA 3RWCB 1T7WA 5CJQH 4ZX5A 4LVOB 2JF1A 3IRPX 4ZYKA 1MFBL 2OL3H 4FFVC 2FO8A 2VDRB 2RHEA 4YVNA 1GGUA 1BMZA 2BY1A 4F8OA 1QW8A 3LKNB 3GEWB 1PF3A 4E9LA 5E1AB 3VGEA 5KBNC 4IIQB 2Q6WA 4L3AA 4BH8A 1QSED 4AZ8B 3EJZD 5E8EB 1ACYH 4HIPA 4P2RE 2ATKA 2DIAA 5F7AA 5HDBE 4X50A 1T2XA 2EKJA 3RDTD 4Q9QL 1A2YB 3DYMA 3NJNA 2KHAA 1ZS8A 3MOQA 4RBPK 1RUQL 4YOKA 4ANKA 1J8HE 4AJVA 1NCTA 4MHHG 2COVD 3L1EA 4M1DL 1X5LA 3AUVA 1NIDA 2FBOJ 2YD8A 5I18L 1M1XB 2EDMA 2FJFB 2WWOA 4M4RA 4FJZA 5CU5A 3B9VA 2B7DT 1JD7A 5KYXA 3EJQA 1M3IA 2AK4E 1SRDA 2WWMD 1TEYA 3HN5A 5J3HC 5IBTL 5KW9H 2LU7A 3KBHE 5CMAB 3S37L 3QWOA 4AGPA 4Y9CA 5CZVL 2NOYA 1KXQE 2P9RA 2R69H 2ZKYA 4ZS7H 5D2NE 4NLHA 3JWOH 3FO1B 5SWSE 1FAKT 3LXBA 3MUY1 5DWUL 3DJSA 2GT9B 2R69A 1WZ1H 2F61A 4XHJD 5FGCB 5JXEA 2BRQA 4HXAH 4OCXH 2FWSA 3UTSA 4BCZA 2XVGA 3VX1A 1AIFB 2X1XR 3QFDA 4OIFA 4X5PA 5KG9A 3RWEA 1IAKA 4GRWE 2IF7A 4X5LA 2BNRD 5DD1H 3EFFB 3SE9L 1QWNA 3TEYA 2YQ3A 4RWYL 4LLMA 2XWBA 1P4LA 4OVUA 2ZP0T 1UJ3A 3ZR6A 1VFAA 5EU4A 3VWJB 3B2DC 1T0NB 4P46A 4PJ9C 2ODHA 2D31A 1OCWL 1JD9A 1OARL 2N0MA 3BEVB 3GMLA 1Z9PA 5CSZA 1CTMA 5B4MD 1MHEA 2XWCA 4NQCA 1E7VA 3T6QC 3VQ2C 1HXYB 3D18A 3L5XL 4UTBL 3IU3B 5JW5B 2BVPB 3IDYC 3ZTEA 5KVGH 3LIZA 2IGFL 5CF3A 4WY7H 3CC5A 3DVFA 3U36B 2RR3A 4KXZI 4KC3B 3UTTA 4G8GD 2C1OA 4ETQA 3IJ9A 4HS8H 1QASA 3G5YA 4Y4KB 1TOXA 4B60A 4OM1L 1JWMB 3JSSA 3NH7H 1TIUA 3VXUE 3T4AB 5AW8B 3NRQA 2VDNH 1T2JA 4GIOA 4FQJH 3B9KC 1U30A 4R2GB 4DEPC 3ZQWA 2Z7YA 2A0LC 4I88A 1PLBA 5D7IA 4Z3JA 1D2OA 5E2VH 4DOHB 1XF2A 3EYFA 2A9BA 3NFNA 4OM0H 5CEZE 1SVZA 1NUNB 1S7SA 1UATA 1FUNA 5A7BA 1D6VL 3F6IA 3FQWA 5CR1A 2V3DA 2WC7A 4G8IB 3MLWH 3QNXB 3ZZQA 3P3TA 1L7TL 2WB1A 3P3SA 4DKDC 3P30H 3NIFB 2PWEA 2BWIA 2CO4A 3AXLA 3QUXD 4QRUB 4DEUA 2FJGB 5TQ0H 4M93B 3MLTA 3S5YA 1A7PH 2QADD 4PJ5D 2A38A 2QT6A 5BRQA 1MCHA 4K73A 5LAXA 3ARQA 4ZO6A 3TN0B 3K1DA 2OSWA 1FNEB 4U0RC 2B1HL 3RVVC 2V5MA 5E99L 4X5QA 5JYMA 5IHZB 3FSWA 2PWGA 2CLRB 1J1XH 1KELH 2D3VA 4XOEA 5BUGA 3N0AA 2DEYX 5G5DB 3MJ9H 4CSZA 1KJVB 1JGEA 2DKMA 4XMLH 4FQ1L 3QNZA 1UT2A 4LKCA 5CJ5A 3SYAA 2HRLA 1SHXA 4B6ZA 4P8QA 5ESVA 4M1DH 1CLYL 2EKSA 1SHWA 3RRQA 4ZAKC 4Z7OE 3ZHLA 2IALA 5CHNB 1PKQB 2OK0L 1HH6A 4OLWL 1AZZC 1LNUB 1YUHB 4UM9B 4JO4H 5E51A 2UWEA 3U2SB 4G72B 3S8GB 3BZEA 3CU1A 4YDIL 1QA9B 2LVCA 5IBTH 4YDJA 1CLOL 2J44A 3P73A 2DOCA 4J23A 5DQDH 1QLFA 3MOAH 5IFHH 1HZLA 3Q2NA 1B0IA 3T6WA 3GRWH 3SGEI 1UD3A 1H15B 4J3XA 2WQWA 1HN1A 1GL4B 3V5HB 1YVLA 4JGMA 4JFUA 1FZJB 4PJFE 3UMNA 4XNDA 4V2CB 3ARDC 5CSGA 5FOBB 4PV8B 4ZUUB 1AZVA 4DSYA 2JIXB 1OSPL 2VL5B 5ANMA 4BHUA 4G9DA 3CGTA 4GP5B 5GRVL 1YC8A 2VR9A 4FFYH 4YFDB 1OGTB 4BFIA 3A4EA 4FMVA 3DX8A 1L9SA 3SE9H 3OZKA 4DGWC 3NN8A 4G1EA 5SWSA 1WFNA 5AOJA 4O2CB 3P40A 4F1ZA 5INDB 5FO8B 3V0WH 3KXFA 3O6MH 3TESA 1XB8A 3ALXA 1IEBB 1KTCA 3PXHA 4TSCL 2DI8A 4FQLL 4FC3E 1K8DB 4I85A 5F71A 1OP9A 1W15A 4HV8A 4QCIA 1GZQA 2F74A 3UP6A 3TO4A 3PJSB 4YR6A 1TEGA 1QNZH 2GSMB 3WTVA 4XNQA 2IGFH 1RVFH 3CXDH 5F3HA 3ROLA 4X9YA 1TUPA 1KTKE 2KERA 4AG4H 4H40A 2HA1A 1KYUA 1K3ZA 1KXVA 2UXTA 4KVCL 3EYUL 1HVXA 4Z7UE 2X2JA 3QIWA 5KJ7E 4L4VB 3L3KB 1EXHA 3GI8L 1TZHB 1XB6A 3FQ2A 1L3WA 1CTOA 2WO3B 4YGVB 5FYJH 4MA1B 1D5BA 5F8QC 4ADGA 5IFJB 4C54A 1A6UL 4MDJA 5I16A 4NQDE 3OKOB 1OL0A 4Z5RA 5KOVC 4F1SA 2GJPA 4F20A 3HZYA 1E6OL 2EVGA 5E7FA 1ZHBB 1EJOH 4K5LA 2AQ2A 3FF8A 3LNDA 3NSJA 3HCVB 4IMKA 4D2NA 3L54A 3G5XA 3AU1B 2A0LD 4U33A 3NA9H 5HYJB 3L2MA 4QDGA 1HU8A 2G5RA 1Z9SA 1A6VH 1NUFA 3QUXA 4B53A 3HNTL 1DR9A 1HQ4B 4W9GC 4UZUA 3AREA 1FA4A 1TJGH 3HG2A 4YDKL 1ZVSB 3EH3B 4N0CD 2DQFA 4KRMB 4LSVH 5KVMC 3ASWA 1HHIB 1H3WM 1V10A 3QZOA 4JJ5A 4WEUD 4X5WB 5DA4A 3VRLF 2CCWA 3PGFH 2YOAA 4MJIB 1EO8H 5IB1A 1YMME 2NYZA 2OXGA 2WXIA 1A4AA 3PY9A 4N6RB 5HDBF 1WGOA 5HHXL 5EUOA 3VG9B 3FQTB 5DCCA 3CD4A 4N5ED 4B27A 2B14A 3T77A 1KTJA 4YAQB 4Y2LA 1Z0NA 5F7EL 4MAYB 5IVXA 5ECGA 3TPKA 1XF4B 3F62A 3O45A 2EADA 3QEQB 1QEWB 3SBWA 1B3IA 5G55A 4OZIE 1PQZA 2O61B 1E8ZA 1XBDA 1GKOA 1NM4A 2ALAA 3MRIB 1C9SA 3CXFA 4ZDHA 3FKUS 3IJYA 1MCPL 4EZMA 3FT2B 2WLIB 4U0RB 5B22A 3MOAL 2BWDA 3FCSB 1BVLB 5BRZD 1MAMH 1QVOB 1SHMA 1ZEAL 2Y7LA 2VDQB 1ETA1 1VADA 4C56A 3N3EA 4DGUA 4U1JB 5IMLB 4HIIB 1QTYT 2VDLB 4MASA 5DRZA 4E9RA 1PU0A 3VDAA 1U8MA 2F8XC 3F7YA 2AQTA 3NJHA 3V7AG 2XXGA 1CO1A 2AJXL 3ZMRA 4WHCA 3BWAA 2HX7A 1WAAE 3GPEA 4ZMYA 4PRHE 2WTOA 3IJEB 3RLSA 2A99A 4JHWH 2KLTA 3U0PA 1MWAH 1PAMA 5TDOB 4XO3A 3T2NL 3FCTB 5I1DB 1UH2A 4K15A 3ML8A 1PZ5A 2D4FA 3OMZA 4LEXL 4UT6L 4X80H 4ZFGL 2GJZB 1OP5H 3MRMB 3UIZA 1F18A 2X9ZA 5E8OA 4JBSA 3NIDB 5IUSA 1ML0A 3DRQA 2K0RA 3PP3K 4U49A 1HL8A 3TBTA 3Q1SH 3RUGE 3KHOA 4E0RA 1N8ZB 4YHMH 4NHCL 1QMUA 2PR4H 4ODTL 4AVIA 4UNUA 5TDPB 3T8MA 2R56L 5D7LB 4Z9KB 5MI0B 3CXDL 4K4KA 3U83A 4NPYA 4AJWA 3U6RB 3PJNA 3RP1A 1AACA 2Y9RT 3NGBC 1OK8A 2VERA 5H37A 3CVHB 3AG1B 4KVCH 1C5BH 2ZX9A 2BRRL 1IZKA 5LN4A 4CVXB 5JW4R 2R1WA 3DPBA 4HJGB 4Z76A 3UO1L 5I5MA 3UBHA 3LZRA 4PV9A 4J2QA 2FX7H 3E2HC 4PJHB 3VWKA 2FX8L 3N0PB 5GS1B 2GJ6B 3FHEA 4FNTA 2WTRB 1A6UH 4PRAB 3KW7A 2FZ3A 1RUKH 3RZCC 4I3RH 1JNLH 2EXTA 4P2AA 3X1GA 1YZZA 3SPIA 1PX4A 3W2DH 1E6OH 1T1WA 4OF8A 4K8RL 5J13B 3RVVD 4P2RD 1JV2A 1T5KA 2MJWA 4UMSA 1ANUA 3B2XA 5INCA 3NA9L 4L2YA 5B1JC 5KSAB 1JXKA 3HBQA 2YPLD 5DYOA 1HCVA 4YPGB 6PAZA 1TJGL 3QQ3B 2FT7A 4PP1D 1DJXA 4WK2B 5DC9B 5DD6B 5HJGA 4YDKH 1N5YH 3MQIA 5LGYA 4Y2DB 5EO1A 1QKZL 4KTDL 4N0UA 1R24A 4Y1AE 2I9TB 2CGRL 2OZ4A 4UTAA 2YD1A 4BFEA 1QFUH 2QQNL 4BQCA 3BWUF 4FQXB 5D5MF 1BQSA 4QO1A 3P3YA 4JHAH 3WY1A 2WM0A 1SF5A 5C0GA 3MUGA 4L4TB 3F7RA 1FGNL 4OGQC 4AM0Q 6FABL 3RL1B 1HZKA 3I02B 3CIQA 4JL2A 3SGEH 4JEGB 3SBRA 5AVXB 3H3PH 3JTTB 3ZSSA 5CBEB 4WNQB 2JJWA 3DVIA 3IF1A 4AQEB 3KR3L 4G6MH 2Q1EA 3RFRA 1G7LB 3FK3A 3QW9A 4QRRD 3NCEB 3RDTC 3RI5K 3WEMA 3OX8B 2CXKA 2X9YA 1NCJA 2NY0C 3FO2A 2JXMA 4HDIA 4PJAF 3KPRA 1T2QL 1PJWA 4YLCA 4RDQG 4WEBH 4XI5D 1B88A 5HD8C 4CGTA 3LRKA 1WT5C 2WSKA 3ZJAA 1O7DE 2DIEA 5E6IC 1NCBH 4H2AA 1JZFA 3HKFA 4TNWF 1MAJA 3L48A 1NC2B 4HW6A 1SYVA 3DXAB 4JNXA 1DUZA 3MV7D 2ZP9A 3OZ9L 1MCOL 4KTYA 5EOCH 3M1CA 3ULUL 2DQTH 4K55A 4RZCB 4AQOA 2FD6H 2BSSB 4JRYE 2FECL 4NQXB 3ABGA 4YWGL 5B8CB 3PL6A 1X5JA 1KLFB 3Q1SL 3ZT6A 3QZMA 3T4AC 4YHML 5ES4B 5AUMB 4TPRH 1D5RA 4G5ZL 1ZXKA 2QQKL 3TP4A 3QIBD 3VM5A 1CT8B 1SMOA 1UOWA 5J3HD 2WCPA 3DMMA 4H13C 1WJ3A 4I9WE 5DR5L 4KDTC 5ICZA 2B0SH 2E5EA 4NM8H 4QRSB 1WP6A 2WLZA 1DLHB 2B9AA 2JQAA 3IEAA 4WF7A 2CRZA 3FRUB 2R0LL 5ESAA 2KS0A 4ZMVA 5CWSA 3JWNH 3S2AA 2WXJA 3ARTA 5I5IA 2NR6C 2YUVA 4GG8B 3CLEL 2VKWA 1BJ1J 1P6WA 5I75C 3HNSH 4OJYA 5ESQB 2AW2A 1RUKL 2DWDB 2FEJA 4WFHD 1J5IA 4TQIA 5DJAB 2HKHH 3BVVA 1P7BA 3CFEB 4Q89A 3I6GA 3EDDA 1T7YA 2FATL 1AP2A 4FXGB 2H6OA 3SDDD 5AZUA 1WCQA 1EAPB 4E9XA 1QW9A 1ZV5A 4XTRD 1KYOJ 3ETSA 2HLAB 2H6PB 3HG1E 3UH8A 4E41D 3QFGA 1AHWC 5DZ9A 4FA8A 5JTWA 2H9GA 1HCYA 3PWLA 2NQ3A 4WK0B 3RNQB 4EN3C 3REWB 5IM7A 3DI3B 5DD5H 5DJZB 2ZCHL 4H8HA 3MTRA 3Q9PA 3V6ZA 3QVAA 2WD0A 1ZLSL 3S34L 3S88L 2CGRH 2ZP8A 5HGBB 2CKNA 3S5LG 5BOZG 1CE6B 2C3VB 3SN6N 4Z0BL 4OLVH 4Z7VA 4JRFA 3U6XS 1LO4H 3C5ZB 4N2NA 4UT7H 3BQVA 3QXDA 2HYMA 2BY3A 4L23A 2QSCH 3MRCA 2VDML 3QG6A 2DLTA 2BW5A 3CE1A 4OKVA 3VSVA 4KPHL 3TBWB 1E4KA 4IMLA 1FGNH 3GXFA 4WGVB 4FJ6A 4BWTA 1F58L 4TNVK 1RK1B 5IF0B 4WFFD 5A7EA 1G9NL 3V6BR 4A2DA 3APCA 1ASOA 2X4QB 4V2BA 2P43B 1AQMA 2CKBH 4X9IA 3DUSA 1O9ZA 3GRGA 3QG7L 3WUWB 2V8LA 1ZK5A 2XZCL 4PS4H 1WIOA 3KR3H 4G6ML 4L5FH 4Y9FA 4YH6A 5FFLA 3OXSA 2J1KA 4ODVH 2PP9A 3CX5J 1TTCA 1MI5B 5GGTL 3MCLL 1A1OA 3QDJD 1T66C 1G4MA 3O9WB 5A2AA 4DGVL 5I1LB 2Q76A 4HAGA 3PHOA 4I13B 4BXSV 4AVJA 5I2IB 1PKOA 2AXFB 1MEXL 4MA3A 1GGTA 2HLFD 2IBBA 4FI6A 1FFNA 1L6PA 1PLCA 4R6UA 4AL8H 4DGIH 4ODXB 3M1OA 2UVEA 5EOCL 3VNYA 2X6BA 2O6CA 4JVWA 3QDGA 5DDHA 4N9GB 3CQPA 4IOSA 4OZIF 4KDVA 1QFPA 3IPFA 4RCAA 1HC1A 5AAWA 4YHIA 3SJVE 1YSOA 4HJJH 3GXMA 2Z7WA 5ABDE 2B3IA 3EOYG 5DS8B 2GQHA 5EBLB 3X17A 1J8HA 2X4UA 2IEPA 3T4YB 4RMSA 2JI2A 1KTLB 2NY4D 1GGYA 1BZ9B 32C2A 3LZQA 1Z9OA 5DMYA 1WCBA 3DX1A 4HS6A 3LPWA 2EO1A 3QO1A 4PHZA 1CFSA 1CL7I 3W0WA 7CGTA 3ALWA 2R2EB 5BV7H 1LQBC 4B96A 3BGFC 3ISRA 1XGTB 2LFGA 1A6TB 5EFIA 4E2OA 3CHQA 2HFGL 4O4YL 3L2LA 1I1YA 2WLLA 1FNHA 4ZMOA 4ZSOE 3LZOA 1A6AA 4H7VA 3OTTA 5FKPB 3H0TB 5CJOL 5GS1C 3VJ6A 5EO9A 3DRTA 1FL3A 1GTFA 1CS6A 3C8DA 1S3KL 4KTGA 3WY4A 1EGJH 3NPSC 1JXFA 4ZUVB 4X99A 1FF5A 4JE4B 1NGQH 4IEFA 4AL8C 2ARJQ 1H8NA 1YA5A 4UYPA 4L0ZA 1UGNA 4KI5D 1BV8A 2ED6A 2P5PA 3A3YB 4IJTA 3DXAD 4N86A 4UYQA 2TSAA 4A6YH 5MHSE 4FA7B 4L2LA 1E67A 5F9AC 2O6FA 5DD5L 3BLPX 5DUPH 1DL7L 3TC9A 3QA3A 3CZLA 1QHPA 2K6YA 1JFQL 3MNDA 4HALA 1HJCA 5FW7A 3UTZB 4YHPB 5F97E 4DGYH 1ZCRA 4YX2L 1KJ2A 1Z32X 5DWPA 2NNXA 3OGCA 1L9OA 3N5AA 2ZG3A 1XSOA 1LMIA 3S3PA 1CQYA 2X44D 2DM3A 4O5LL 1XGPB 1X7QA 2WOBA 3T1FB 4HKBA 1T0OA 4I2XA 4WW1A 3ZYIA 3ZHDA 1I3RA 4AENB 1GCFA 4JRXA 5HI4D 5E5MA 1YO4A 2ADIA 3HC3L 4FZEL 1T89A 4PJEB 3TZVA 3FAXA 1AHWA 2K4AA 1WC7B 2X5PA 3E3QC 2ED8A 3V8OA 2VMDA 3H7BB 4GG6B 2EE2A 3GSWA 5BVPL 1CDUA 4J12A 1RK0B 2QHLA 1IZJA 4HPYL 3QG7H 4HK3N 5EUOE 5JDSA 5E56A 1A21A 5IK3A 3UTQB 2J5WA 4RRPM 3C6SA 4WFGD 1A7BA 3OJMB 4ODVL 1WFJA 5CBAA 4MDRA 3I75A 3SE8L 3ECUA 1UTDA 3GMMA 5GGTH 3NRFA 4S0HA 2C9QA 3NEOA 5DZAA 3BP4A 4NKOB 4PRNB 1NBVH 4UOQA 4HFUL 2NPLX 1CGUA 3JVGA 4IHBA 4DCQB 2GB2A 3P0VH 3VXQA 2CBPA 3H85A 3ULVL 1U4FA 5D6CB 2XNAB 2R4RH 3L7EA 4X7FC 4YXLH 4N8CH 3UBXB 5BMFH 5IB5B 1UGKA 5HTSA 3VTAA 5DUJA 1XR9A 4AM0A 2EC9U 4H5SB 5B1CA 2Z31B 4DAGH 5I8CA 2HRHA 4XBPB 2A6DA 2BVEA 4OZ4A 2E86A 2A9NL 3ARXA 1AS6A 1A9VA 3DMMD 1UZ8B 3EO9H 2MOVA 2HTKC 1UC6A 3GLZA 4JFOB 5I66B 2BSRB 3DO3A 5H4YA 2D3LA 2MCPL 1U8QA 1DVSA 3LQZB 3NCWA 3S97C 1LP9A 1CFVH 3B2UD 1TVBB 3Q05A 1EFXA 1U8CB 1IAOB 3ESMA 3G5WA 4X9FA 3PG2A 1MNNA 1EQWA 2F0CA 5D1QB 2WGXA 3G04A 3HE7B 3K6NA 3MRNA 1IGYB 3BKYL 5DFVC 2Q8BH 3X3FL 5DVOA 1SXAA 4BSJA 4MNQB 3ATDA 4AYEC 5ADPH 4OD1L 2CALA 3RYMA 1EDYA 2AK4B 5JLZB 5KSAC 4X4YA 2QHRL 1A6ZA 3GSQB 3P4NA 5C2UB 1I9JL 3GEFA 4HAKA 4P48A 1NMCB 2RA1A 4DFHA 1L6XA 2P8PB 4HWNA 3RTLA 3P2TA 3ES6A 1P1ZA 5I0ZA 1IBDA 1L4IA 2DQHH 4PVBA 3GPSA 4KUCD 4M5YL 4PWGA 4ZMXA 1M7IB 2WAHA 3MO1A 5K5YA 4G7RB 1NFIA 3AG4B 1IGMH 3FN3A 4JPIA 4NXKA 2QQLH 2F6AA 2FT6A 2BS9A 1UWXK 4PFEA 3ZTCC 2ZSVB 4PR5B 3PWPE 4MMXC 4POZD 2OTWB 3QDGD 4KQ3L 4R3SB 3EJYD 5DRNA 4GIPD 1CGXA 2GCYA 4O5LH 3T8XB 3II3A 5MEOA 1OGSA 1JV5A 1P69B 4H88L 3GXNA 4PP1C 2FQFA 4PJXF 1EFQA 4ZXBD 1I8KB 2OMTA 3KCPB 2Y6TE 2GSGB 3TIEA 4DO6A 4YQXL 3MV11 4IQHA 4OT1L 3P77B 4JFFA 3TS8A 2V6HA 3CLFL 3P9MA 5LDSA 4YMPA 3HC0A 3JTSB 4ACTA 2NY6B 3EBHA 1T7ZA 1XHHA 4NUQA 1TQWA 3OJVC 3QCUL 4KJQC 4PEEA 5F7NC 4A2LA 2CDEB 5TH2B 2DH2A 1S78C 2GFBB 2EAEA 3SE8H 1H3VA 2Y2TA 4X4XA 2D7OA 2VIRA 2QDVA 3BZ5A 4N2MA 1IE4A 2VXSL 3L95A 4GT7A 2XA3A 3TBSB 3UFIA 1J5CA 2Y6SC 2BY2A 3FTYA 2EIZA 4YDNA 4HC1A 3VFGH 1VSCA 4RH4A 4AITA 1FG2B 4JFYA 3D2UA 4ZAKB 2I07B 2C3GA 3FRPA 3N43B 3QIUA 4WI2A 5DMGD 4EO5A 3TLRA 1JHKH 3WIFA 3F01A 1G84A 4HETA 1XIWD 1GSMA 2E9JA 4LCVA 4F33B 1BM3L 4H1LB 4ZOBA 2ED7A 3EJPA 4JHUA 4ODSL 1AJ7L 1K8IB 2A9NH 2FUQA 5TD4A 5CJXA 2Y7MA 2QPEB 4CKVX 2OQJA 4X4ME 1RUMH 1H0DA 4TM9A 4TYUA 1MFCL 4PRID 1FSKC 3B6SA 3KXFE 1MCNA 4LPTA 3QHTC 5I6XB 3DYPA 4QF1B 4UM8A 2DQUH 5TF0A 1X5MA 1E5YA 3JWNC 2DBJA 3DMMC 2EDQA 5F1SA 4UNIA 4K5PA 3ABMB 4MD0A 3V9FA 4AGNA 4HD5A 1CF1A 4I4WB 4OTXH 3TPUB 3QRFM 3HNVL 4EI6A 3D51A 1J0YA 4P59H 4JO3H 3VD7A 3X3FH 3GINA 4XBGA 4OD1H 2DYRB 1LP9E 1SOKA 4JG9A 2GVYA 1XGYH 4Y4HD 4P9ML 3FAWA 4GFTB 5SWZE 4OB5L 3HUJB 7FABH 3PGCA 1Z9NA 4I5BB 3IDGA 4GRLC 4DP1X 5KUMA 4BKLB 5DZLA 3D07A 5EC1B 5E00B 3KLSA 3O11B 1JUFB 2X40A 3QCVH 4HLJA 2WY3B 3T71A 1BMWA 3MFFB 1E9OA 5C0CA 3LDBC 2W9DH 4MJ2A 1P5VA 5DO2D 1U33A 2EDTA 4JCLA 5CUSL 2IV9A 2CLVA 4JO1L 5D1ZD 1BGXL 3LSOB 2NDFA 4PRBA 2DRUA 3QYCA 4M7JH 1EAQA 3QI9B 1JRHH 2P5WD 4FNLH 5HYSA 2M26A 4HGWB 2WINA 4G83A 1W72B 2XXCB 3LPOA 3WMSA 2Q20A 4JZJB 4NZFA 2ZCKL 3DBSA 5K9KB 1ONQA 1HILB 3UYPA 3LNGA 4YSEA 3TT1H 5KBPA 3GSUA 5D7KE 3T09A 5TDNB 3TTYA 4NAJA 1RMFH 4NQEB 5K9OA 1A1MA 1OTUD 4ZOEA 3FB7A 1X5YA 3NZ8A 2C9XA 2X4OB 1H8OA 3KPOA 2H1LM 3EDFA 3TFKD 3EOTH 2CLZB 3WLBB 1KTDB 4BWUA 3FU8A 2BMKB 2W5PA 3VGAB 3QO0B 4MNHA 2CO1A 1NGPL 4Q9RL 5C0EA 3OSVA 5TK4A 2SEBA 1EVUA 3RL2A 1AGBB 1E28B 4LIQL 2DLGA 4M7KH 3CN1A 1FN4A 5IBUG 5DEGA 4QKXB 4JDEB 1RJYA 4XRCA 4G8GB 4K5OA 2YGVA 5AD0A 5HBBA 3D9AL 4R0LB 4DP9X 3QJHB 1UHVA 4HWUA 3K6IA 4HPOH 4NQVA 5IHBA 2VLKB 1LEKB 1FNGA 2ADJB 4GI9A 1BX2A 4J6RL 3EDJA 2M83A 4PJ7A 2YPLE 2APVA 2X70A 3LHPH 4GRMB 4HWBL 3VFGL 3O4OB 1I7UB 4BIKA 4MCZB 2ZX5A 3MJ9A 2D4DA 2QEJA 4KV5F 4PLOB 2B20A 1T22A 3X13A 4G43A 3D50A 3BMWA 1KXHA 1BWMA 3SE4A 1LK3L 1R3IH 1U91B 2NY7L 4R83A 5I71C 5J4MA 1AJ7H 3QDMD 1SLXA 1FGVL 3D25A 1BQHA 2XY1A 3FB6A 4M29A 3DVNA 5C6TL 4P23C 3I50L 1MFCH 3RIFK 1MJUH 2ADYA 1DJYA 4L8SA 4N0YH 5DQ9B 2NY1D 1ADWA 1HZHL 3DJZA 1AKJA 1X4YA 2HJFA 2G3NA 4JKLA 3BZFA 4YSRA 4ZUTA 1PD6A 5IJCC 2O93L 1NFDA 3ZDYF 1V54B 3UGEA 3GYRA 1WISA 2CBQA 1UH4A 4NO0A 1AS7A 3F5WB 3IXAB 1E5AA 1A14L 1KNOB 4CA4A 1GRWA 2XA8L 3QPXH 2EE6A 15C8L 4OCLC 2DWSA 1KXVC 1U8IA 4DJMA 3RDJA 1ZVNA 1R5WB 3A67H 3VXTB 3QS3A 2IBZY 4N2IA 1QFWI 3GS4A 4ANUA 5F7UA 1DQLH 2EYSA 2GKIA 3HB3C 4J4PC 3U25A 5FYKE 4MAYD 5EU6D 1CYWA 1OGAE 1MREL 5J6HB 1BGXH 1BF5A 3LHAA 5AENA 4ADJA 1ND0B 1UCBL 3S35L 4LL9A 2ZUWA 4KK6D 1RKRA 1CLCA 1RZGA 3H6AA 2O5XL 4AXWA 1MVUA 2X89D 3ILQD 3QCTH 4U1SB 4KH9A 3MRRB 2O26U 1T5WB 3W5NA 1XB3A 1MW3A 2YMXH 1C5CL 1D9KC 1EXUB 3OPZL 2JE8A 1QATA 5I6NA 2I25N 1H9VA 2XDHA 1KLGB 1GS6X 4XP4L 2XG4A 4XPAH 2ZCLL 3KPNB 5GQBA 4B0MM 4GYBA 5C9JB 2XKUA 3WEBA 4Y4FC 1QSEE 4Q9RH 2VM3A 1ZIBA 4MAUH 3PQYB 1D5XA 4NN7C 2IAAC 1MHHB 4UQ2A 4XAWL 5ILTL 4XB3A 4K94C 4BBWA 2R0KH 4HIEB 1CGSH 4BZ2A 3PU7A 4X6FB 3HS8A 4GQRA 5DQJB 1OAKL 2IAMC 4L37A 4NUJA 2PLTA 3T3MB 5C08D 1NLBL 1WWCA 3MJ6A 3F7VB 5HDBB 4AOFA 2GJRA 3QE5A 4NQSB 3KYOB 2V17H 4P2RA 2VZ1A 1A4JA 3NABL 4L3EB 3PDOB 1KGYE 4MD4B 1I75A 3GXTA 5D1ZB 1HHKB 5IJVA 2WANA 5HHQA 3S7GA 4AV0A 2BC4A 4QD2E 4I0PA 1HHGB 2VLLB 4CVZB 2C9SA 2AV1B 4LCCB 1TYEB 3FW6A 4KVNL 4WWKD 1JGDA 1KGWA 5CFAA 2XTLA 3CAFA 1JZ4A 5EZJB 1Y1UA 4AK1A 2VM9A 2PYEB 1SFDA 4WUUD 4G82A 4JHBA 1M9SA 4Y5VC 4G1MA 3P02A 4KHXH 3MA9H 4P5TA 4BKTC 3A6CL 1FCCA 1DVFD 5FPIA 1FYHB 1X6NA 4PJ7F 4N0YL 3GBMH 2ARJA 4J4PD 4P2OB 4YXHL 4OY9A 1TZ8A 4G6KL 1RP8A 1NBYB 4YDVB 4H8PA 1CUOA 4C4BA 1U95A 3VWKC 1HIML 1KJMA 4WO0A 4D9LH 4KK8D 4OD2A 4FLSA 3LN5B 3OMNB 1C16B 4ZNCD 3Q7JA 4O51B 1SUJA 3L4ZA 2O1AA 4OJEH 2CRYA 2B9BA 1FBIL 2XN9B 1DQTA 1N64L 1U3HC 2V2XA 3CTTA 4P57A 2WYIA 5L9DH 1UACH 4YHKH 4JS7A 1P84K 3K6OA 4ZW6A 1H6TA 1MCWW 1Q94A 1T1ZB 3FTGB 1B9ZA 3V55A 5CINL 3MR9B 1EBAA 4OQTA 1FVEB 3APFA 5AW3B 4NT6A 4F58H 3ARDA 1RJCA 4QHUB 1MREH 4RESB 3ULSA 3S96B 5F70A 3WNMA 3IETA 5BRZA 4OCYL 3UJJL 1R1CA 1TQBC 3MCKB 1IBBA 1RULL 4Z18A 3EJJX 2IH8A 3UO8B 1F1GA 1F42A 5DURD 2O5XH 3L9RB 4H0GA 3LKQB 4YHOH 1KBGL 2PETA 3CZKA 3S2CA 2BP3A 5A3IC 4KWUA 4AGLA 2AGJH 1TLKA 2OYMA 2Z0BA 4LRIA 3GK8H 2NUPB 2AJYL 4NCC1 1OTSD 4KX8A 3LVTA 4L18A 4M8QB 3ZYJA 3O8XC 1NGZA 3MV7A 1WV7T 2VXQA 1HYSD 1YEFL 2ZCLH 3W38A 2ICEC 4URTB 4YHLL 1IGJB 1LO2L 4TOYH 3FQXA 4PUBH 5TE7H 4OFVA 1KLUB 4DK5A 4NAQA 2X4NB 2HX9A 4XZUB 1MQKH 3NIFE 5AB0A 2VN4A 3QEQD 3W37A 1IKFH 2F5AL 5HY9A 2DWXA 4GKZB 1HQRB 4AE1A 2CG9X 4PJIA 1RURL 2F1BA 3S37X 1AGDB 1S7WA 4H26B 4QT5B 4JN1L 5FECB 3SDAD 1Z0MA 3MREA 2VLME 4G6AC 1OAYH 3SPCA 1E2WA 3CSBA 4KQ4L 4J3UA 3C9NA 1GYUA 2K9FB 3THMH 3L6FB 2WP3T 2J12B 1MIEL 2JTDA 3KNBA 2XJLA 1DEDA 1ACYL 3QC5X 1NINA 4JFWA 3WBDA 4UILH 4B9PA 4HCRH 4QXWA 1OB1A 2ZT9C 4MX7B 4MQ7B 1ERNA 4G42A 4FL4B 5GS0H 1YYML 3FUJA 3D8MA 3PHSA 3H9HB 1G1KA 4DT2A 4PRPB 2ZE0A 2ZG1A 3CSYA 4HCRA 5D70L 1SVCP 3FNKA 4HKXA 4XN2A 2ICWA 5B3SB 5TF1H 3SDCD 1V55B 4KJWC 5I18H 5KSVA 1NC4A 3BEWA 1UWYA 2NNRA 4K94L 4NIKB 3NTCH 1RIVH 1LD9B 4XVJL 3DA0A 5C0BB 4AV4A 3MA9L 3UZVB 3A6CH 5JPNB 4MCYA 1UA7A 4FFZL 1DQQB 4JQIA 3ARRA 3FOMB 2A7BA 3C8HA 2X2UA 2LT9A 2AJ3B 1TTUA 4Y5YB 1NOFA 4PS3A 2PPFA 3I2CL 4ZTPL 4E9QA 1N3NB 3BRDA 4Q6KA 1Z3GH 1YYLH 4GS7B 3ZIMA 5MEPB 4FQXD 1CLZH 1Q9WB 3G6AB 2HXAA 3QJRB 1TNNA 5T1MB 3KPSE 4NRZA 1S7TA 1S9YB 2HVJB 2LR4A 4ODHL 3KM1A 5AVZB 2P5WE 4ELDA 3QNYB 2W9LA 2UY7A 3DX0A 4Y4HA 5E94A 5KJ4A 4NKMB 4ELMB 4IBSA 3O41A 2V9QA 3AACA 4OJDH 1XQ4A 2MQ0A 2DQEL 1MRCH 2YKKA 2WNWA 2ZJSH 1OCWH 4IRSD 4LSPL 2ZX8A 3Q13A 5DTFB 1QUNA 3OHXC 4B41A 1MFAH 2BNUA 2BCKB 4GAYA 4J3OC 5J11C 1PX3A 1SQ2N 3KWUA 4BK4A 1CE1L 2CO6B 2AJVL 3MJ7B 2MFNA 3K1KC 2QFRA 3PWPA 3PL6D 4GO9A 3BH8A 4LKXA 4NBZB 1MZYA 1H3XA 1F41A 3KCWA 4E9WA 3J2PA 4W4OC 2IG2H 1X9RA 4OM1H 1M3JA 4PJEF 1YAZA 3AB0B 2YSSB 3RGVB 5FHAH 2TRHA 3APDA 4WTWA 4XP5H 1A25A 3PS6A 2Z0UA 3NCFB 4XPGH 5FYKU 1MIML 4U6HA 4N2BA 3PAVA 4YHLH 3G08A 1EXGA 2BP0B 3U4EA 1S7QB 4PUBL 3VA6A 3RAJL 2DICA 2WLHA 1Y18B 4XN8A 4MYPA 4KX7A 3X2QB 4Z7OF 1SLWA 1RFDH 2W0FB 3MLWL 3AJ7A 1OGAD 1XGUA 2YD0A 1BJ1H 3M8OH 2FJFA 3JVGC 1ZGLA 2CJTA 4TRPL 3TBCA 3IDXH 1A9EA 5D5MA 2IV8A 3N44B 5C0AE 4ZXBC 3LV3B 4S11A 3UEZA 3NIGB 3OKNA 1N0LA 4XP6L 4ODUA 1HI6B 1DDHA 1MWOA 5EBMA 3O8XD 3THML 4UQAA 3BW9B 1CGVA 3IWUA 5JOFA 1PCXA 4IU3B 4BRVA 4DEWA 4UILL 3QUML 1OOAA 3OJDB 2H3XC 1PZSA 1J1XL 1P4IH 2Z8VC 2P5EB 3HE6B 4R84A 4AYDC 1BFOB 2ZYIA 3IJSB 1EUUA 1IM9A 4PV1C 1EHXA 3TNMA 3U9WA 3PGDA 5HJBA 1B4LA 2YLKA 3HFMH 1JZJA 4LSTH 1BCIA 1CLYH 1J18A 4KKAD 4LHUD 5C0AD 5MERB 3V0FA 3QRGH 4JFED 4PJFF 5SWQB 1CICB 4GW5A 2F7RA 4TQHA 4GT0A 1G1CA 3AWFA 4X4MA 4OLWH 1FL5A 3TA3D 5GZOC 2G5BB 4JO4L 1VCBC 2EABA 4BFRA 1MFUA 3GZOA 3DVGA 1F4AA 5TE6L 3SKNB 3E6HB 4P3DA 5LGHH 2GTZA 4G8EA 3T0EC 2IJ0C 3WXWL 4D7BA 4U1NB 3PABA 3QEHB 2C9RA 3VXRE 5EN2B 1HH9B 4PJEE 1DBJL 4R5TA 1D5IL 4FQ2H 2GJ6E 4MTMA 4GSDH 1QOKA 2D2CC 2CA3A 4IRJA 2ZQKA 4JO8A 5EOQH 4M1CC 2C1OB 2WWKT 4ETQB 1UEYA 4ODHH 1NA8A 4QI3A 2EE0A 5H35B 3VFNA 1JHLL 1ZLUK 5AYQA 4FFYL 4WLCA 5DMIL 4HKZB 2BHYA 2XG5A 4I1RA 1KEGH 2JCCB 3OQ3B 2ADGB 4CU8A 3N43F 1ZK9A 4OGXH 3VI4A 4LVEA 2DN7A 5L4JA 2NRDA 4LLDA 3DX9A 3HMXH 3UGUA 2GK0A 4EN2A 5C7XH 5E08H 1YEWA 3PWUB 2ZWZA 5FYLL 5D6DC 3KH4A 5IB2A 2F1AA 4YLQT 1GW6A 5CLWA 1U92A 4AYFB 3ABKB 4QRUA 3I6SA 5DJ2B 4LL4A 1PFCA 2HRPH 2J4WH 3MLTB 4JFXB 4UQDA 1FDLL 1XF3B 5GZND 4DETA 4X6CA 1GHFH 4QYAA 2ADFL 1CZ8L 3KXFD 4ZODA 1FNEA 1WVZA 2Y7QB 3HVDA 5HVHB 3D08A 4ZFFA 4PY7A 4XOAA 5DJ6B 1LXMA 5GJSH 5IQ9A 5SWZA 1WIUA 5DC0A 4F9PC 1F3JA 3LZFL 1AQDB 5E6IA 1ZT1A 2Z92B 4D3CL 2CMRH 4XH2A 5I1EL 4M9OA 1U2CA 2HVKA 1NBZA 2DDQL 4I1NB 1SPDA 1ZE3C 2WWKO 2QADC 5DEJA 3LIUA 4OZGF 5EF2A 3S4SB 4TRPH 1L9TA 1YUHA 4WUUB 4Y8AA 4PWIA 4R4NC 3HNTH 4WK4B 5IT2H 2NY3B 1MFEL 3IM1A 3ISWA 1ZHKB 1NC2D 3M07A 1QLFB 3OXRB 1ZIAA 4X98A 3U4AA 4ZQKA 1QBMH 1FH5L 1A7RL 3BH9A 3EYVA 2AEQH 1P4IL 1MFMA 4QAWA 2QR0A 5JR1H 2VDOH 5L4FA 3KGTA 4L05A 5F7EH 1IM9D 3DTXA 4L3CB 3RWGA 2VL5A 2WKOA 4G9DB 2WLNA 1IQWL 3AG2B 4HJSA 3RTQA 2UV3A 3OWRA 1HXKA 4H0HB 1KFGA 3ZO9A 5BOJA 4KXDA 3UBXG 2JSFA 3RGVD 5CNHA 5IREA 3H55A 4C8XA 3AM8A 4KKZA 1PEWA 1NDGB 1JG9A 3MUJA 4OGZA 5LGHL 1WK0A 4OFYA 2RFXA 4NRYB 1V7ML 2ZKMX 4RFOH 3WY3A 3GDBA 1SDDB 4JDVB 2D9QB 5LUMA 2A6KA 5ADOH 3UPRA 3HHRB 4RFEA 5GGQH 2H2PD 4IRZA 1H3UA 1K85A 4FQ2L 4U2YA 5F3HB 4P07A 3CHPA 2J56A 1IC5H 2CBMA 3U7YH 25C8L 1X3DA 1QO3A 2NT1A 2WXRA 1Y07A 1JHLH 3L2NA 4ZT1A 5T1LB 3REVB 3STZA 1ETB1 2OA9A 5DMIH 5LBSA 1ZHLB 2X1QA 2AEOA 4QOKD 1RZKL 1K5NA 5CKGA 2XTJD 3EFDH 4D0DB 2ODIA 3Q6FA 4QXGH 1AOZA 1QLEL 4CSPA 2BOCA 2WKLA 5SX4H 4A7VA 2IMNA 4NO3B 1THAA 4HWZA 3MV8D 3TBVA 2RQEA 3SSGA 3EYSH 2WBJA 1E5ZA 3U1QA 4DVBA 5DJYA 4P04A 2F2HA 3HMXL 1ZVYA 2C3HA 2Y24A 3IDNA 4QPEA 1ID2A 4M7ZB 1F6FB 1DN0B 4N3UA 4TVPH 5BXFA 3ZTJH 2BSCA 3CVBA 5IWLC 2KC0A 1JZ3A 1MY7A 1WYJA 2EQDA 3MKKA 1ETZB 2R2CA 4MA1C 4TUOA 4PTUB 1RZQA 3WTXA 3ATBA 1CFMA 2GC7C 3CC1A 4ZX3A 2XRAH 2VSCA 2NYYC 4IS6A 4F7KA 5L8LB 2EC8A 2Y7OA 5FA4A 3FT1A 5K1JA 3N50A 3NFPB 4N6RA 3MRHA 4AY0A 3TYFB 5LNEA 3QH3A 2R9HD 3LZFH 5CGTA 1JNLL 5HI5C 1V05A 2BIMA 5E8DL 4Y16C 3DX6A 3X1EA 2BW4A 3BDYL 3QZWB 1VGKA 3EAKA 4K07A 4ZZFA 2BZDA 3MRJB 2YN5A 2ZUVA 3OKMA 4DKFH 1DVYA 2B4CH 2Q9OA 3RWJB 1JN6A 4FXKC 5K9JH 4LSUL 3HE6C 3MRIA 4WI7A 4OFYD 3ERXA 3HAEA 4LAJH 1T1YB 2QSQA 1MFEH 3QZBA 3II1A 4ISVA 5I19L 1LE9A 3CDZA 3FOLB 1XH2A 1XGRA 2ESVE 1Q72H 1FZOA 3FCSA 5D1XA 4BV1A 4ZFOA 3CMGA 2FWOB 3DSNB 4LOFA 1Z6JT 3IBEA 1KIRA 1QQDA 2AEQL 4OF3A 2FEEL 3WNOA 4NQUA 1UH3A 1PG7H 1HHJA 2AKRB 1UD4A 1TFPA 2J43A 1WBXB 5I15H 3C5SA 4KJYA 1XMWA 3P9LA 1WFTA 4NYLB 4UUJA 4CN1A 4J5VA 5E9DB 2W65B 2YD6A 2ENQA 1RJLB 1SYSA 2XKNA 4C4KO 3CSPA 4S1DC 4TNGA 5I8EB 1SOXA 4HMDA 2EDOA 3Q8CA 4EUPG 3DHMA 4TV3A 4YHYC 3MAWA 2R39A 3V5KB 3L1OL 2ICES 2ZOOA 4RFOL 2EYTB 3QQ4A 1DFXA 2PUQT 1UD2A 1XH3B 3NDZE 1T83C 2VNCA 4A7QA 4Q6IB 4WW2F 4DPAX 1T2QH 5KZCD 1A0QL 4ZD3L 4Q6IC 3TYGH 1EEZB 3AG3B 4OZFB 3AXHA 1IC5L 2HJKB 2J73A 4K3DH 4HVBA 2F58L 3V4PB 5B7MA 2VAAB 1T20B 1UZ6F 4A7SA 3CVCA 3SPHA 3RILA 3GTNA 3SYCA 3FPYA 4CMMA 3DX7B 3NSDA 3OHXB 2XWJA 5IFAL 1ZY9A 4HIJA 1AC0A 3WL9A 4J1UB 2XWDA 1F90H 3ZT5A 5F6IB 5LNDA 5IVZB 4L9LB 1JWUB 3WTWA 5GS3A 1HXMA 1HEHC 1NCNA 2A1WL 2GAZA 1KZYA 2BNQE 3F84A 1F4WL 3N42B 5E8PB 5LG1A 2YRPA 1ZD6A 3ZHNA 3CQQA 2VLKE 1TU2A 3BFQG 4KO7A 1XCWA 3LNEA 5E2TL 5C0RH 3GSRA 4BDVB 4UNVA 4GRLA 2PCPA 1NMAH 4P5KB 4ZPTB 1ID5I 2W88A 3GI9H 2VDPH 1T1WB 1U3HB 2HSIA 3NT0A 4RISH 4LCWA 3VFOA 1Q1JL 4IOFD 4TPRL 4AH2B 1TJHH 4X0KB 1HK6A 2ZF8A 5AALA 4OZIB 2BVQA 2HN7B 1AI1H 4LVHC 5E4EC 5J89A 3EH1A 1QPPA 1B4JH 2QDWA 3M7FB 2Q3AA 1NFKA 3BCDA 4KXBA 2W9EH 4ZMQA 4JHZA 3TH3T 5EO1B 1UM4L 2PWDA 1KCUH 3DUUA 4FQCH 3WS6C 1IO4C 4J8QA 4HUMB 1BAFL 4DN3H 3JV5A 3CLEH 3TVMA 3L5JA