2C9ZA

Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
451
structure length
438
Chain Sequence
TNPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHTMQCNIKSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
publication title Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Transferase
total genus 154
structure length 438
sequence length 451
ec nomenclature ec 2.4.1.115: Anthocyanidin 3-O-glucosyltransferase.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA02
3IAAA 1XL0A 3T3IA 5D01A 3CUYA 3OTHA 4N3CA 5TMDA 3T3DA 4X7RA 4F9FA 1FC0A 3ZCUA 5ENZA 5IKPA 4BQFA 3WAGA 3S27A 1JG6A 1L5SA 4N3BA 2G9VA 3BCRA 1L7XA 2GM9A 2QN8A 2F3QA 1Y8ZA 4WACA 3OT5A 2X0EA 3D0RA 1Z6PA 2QN9A 4EL5A 2QRGA 1FU4A 5DLDA 2QZSA 1XC7A 2YJNA 4LDPA 3FROA 3NB0A 1NZDA 2VSYA 3E3LA 2X0FA 3OKCA 3MTAA 4NC9A 4MICA 3NP7A 2F3SA 2XA9A 2QNBA 1L5QA 3T5TA 2F9FA 3QKWA 2GEJA 1XOIA 1E1YA 3MTDA 3ZCRA 2XGMA 4RIFA 2X6QA 1SXPA 4EL0A 3ZCPA 2GPNA 5TMEA 3OKPA 3NC4A 5I45A 1V4VA 3T3EA 3S2UA 2X6RA 4EKEA 3GPBA 2QLLA 3BD6A 3TAXA 3T7DA 4MI9A 2QRPA 1P4JA 3ZCTA 2H1FA 2IV3A 3GUHA 4N9WA 4RELA 1F6DA 1LWNA 2XA1A 2QN3A 4X7PA 3G2LA 2BGTA 4FZRA 3RT1A 4EJ2A 2VSNA 3Q3HA 1IIRA 3MT9A 4YI3A 4Z5XA 4AY5A 3WC4A 2SKEA 2GT1A 1KTIA 3E3OA 5HXAA 2PQ6A 3E3NA 1LWOA 1EM6A 4AMGA 2H1HA 4REMA 2GEKA 4QLBA 2SKCA 2FF5A 3CEJA 1NLMA 3L7DA 1EXVA 4YUAA 3MTBA 3O3CA 1FU7A 2GPAA 1JIUA 3BCUA 4LEIA 1VGVA 2IW1A 1XL1A 4N3AA 4PQGA 1FTYA 1SXQA 1GZ5A 3CX4A 1C8KA 4GZ6A 4FKZA 1C50A 3OY2A 5DXFA 3NP9A 2IV7A 1YGPA 2XA2A 3L79A 2IYFA 5DU2A 2QN7A 4MI3A 3S29A 3DD1A 4X6LA 4CTMA 3G2NA 1IXYA 3D1JA 1JIXA 4M60A 4HWGA 2AMVA 3HBFA 4GPBA 4GZ3A 2ACVA 9GPBA 2AV6A 3MRTA 3MT7A 2F3UA 4W6QA 4L22A 3VDMA 2IYAA 1RZUA 1GPYA 2BFWA 2ASVA 3CEMA 3BD8A 1JEJA 3MS2A 1GFZA 3ZCVA 2XGOA 2XGSA 3BD7A 2G9RA 4RBNA 5LQDA 5BNWA 2VCEA 1NZFA 3OY7A 1F0KA 3UYLA 1FTQA 2R68A 3HBNA 1NOJA 3MSCA 4RIIA 2IUYA 2IEIA 4M83A 3G2IA 2XMPA 3TSAA 2FFRA 3HBJA 3G2KA 1L5WA 4BQIA 4F97A 4KQMA 3SYRA 3EBPA 1C3JA 4KQ1A 1FA9A 1AHPA 4MI6A 3MT8A 2ATIA 3C48A 2C9ZA 4X7MA 1QKJA 3L01A 8GPBA 4CTOA 2JLBA 1HLFA 1WV1A 2AZDA 4WADA 3RSCA 3CUTA 1P2GA 3L7CA 1H5UA 2G9QA 3CUVA 3L7BA 3NPAA 1NOIA 3Q3IA 2QLMA 5GPBA 2ZB2A 3MQFA 2ACWA 4BFCA 2C1ZA 1GGNA 3VDNB 3WADA 1P2DA 2XCIA 1P2BA 2QN1A 4GYWA 1UQUA 3G2HA 1A8IA 2R60A 2PRJA 1GPBA 4HLNA 2PYDA 4CDRA 4M7PA 2R66A 3T3HA 1NOKA 1GG8A 3CEHA 1GPAA 3C4QA 2QLNA 3NCHA 1P4GA 2P6PA 3RSZA 1K06A 1PN3A 2Q6VA 1Z6QA 4G2TA 2ECPA 1UQTA 1FU8A 1WW2A 1K08A 3BDAA 2PYIA 4CTNA 1Y6FA 1E4OA 3S0JA 1RZVA 5D00A 1L5RA 3D0QA 1BX3A 3TOVA 2IEGA 5C1DA 3G2JA 1YA6A 3Q3EA 2QRMA 3BCSA 4MHSA 3HBMA 3CV3A 3CUUA 3PE4A 2KS6A 4N39A 3H4IA 1ABBA 4AY6A 1NVKA 2F3PA 3OTGA 1PNVA 3VUEA 3BEOA 2JZCA 1PSWA 1WV0A 3H4TA 4NEQA 4MRAA 2R4UA 2JJMA 1P29A 4RIGA 3ZCQA 2BISA 2OFFA 1WW3A 2QN2A 3VUFA 2O6LA 4RIHA 3MS7A 4KQ2A 1XKXA 2R4TA 2AW3A 2C4MA 2QRHA 4AN4A 6GPBA 1FTWA 2HY7A 3T3GA 1B4DA 1J39A 1RRVA 4GYYA 4RIEA 5JTUA 1FS4A 2GPBA 3SYMA 2XCUA 3PE3A 1L5VA 1JIVA 2BGUA 3DDSA 2SKDA 4GZ5A 3UYKA 4YI5A 5TMBA 2QRQA 3L7AA 5JTTA 1Y6GA 2VCHA 1L6IA 7GPBA 4XIFA 4BQEA 4XI9A 3COPA 3DZCA 3C4VA 1PYGA 3MS4A 1O6CA 3AMVA 2X0DA 5TVGA 1QM5A 3CUWA 3OKAA 5IKOA 2WTXA 2G9UA 4F96A 3IA7A 1P4HA 4MHOA 2GJ4A 3QHPA 3MBOA 4WHMA 3OTIA 1UZUA 1M5RA 3DDWA 1WUYA 1C8LA 3MRXA 4EKYA 1Z62A 4AMBA 2PRIA 2VG8A 2FETA 4RENA 1XV5A 4NESA 1AXRA 3RHZA 3ZCSA 3NAZA 1JG7A 3MRVA 2C1XA 3S28A 1WUTA 3EBOA 1Z8DA
chains in the Genus database with same CATH superfamily
4KO1S 3RIHA 2FPPB 1C1XA 2XHEA 3PFHA 3KYCB 4LDRA 4K6MA 4I55F 4Q4AB 5KSOA 1B41A 3ZTWA 2VJCA 3OTHA 4B6JA 3UPDA 2QZPA 3BB4A 2UUAB 1UOEA 5TMDA 1MB0A 3GCGA 3RS9A 5FBHA 4LI3X 1QH0A 1H1LA 1Y37A 4PLGA 4M1QA 4TMTA 4F3CA 2CNWD 3WGIA 3PUZA 3U1VA 3K9GA 4R5HA 9ATCA 1MX3A 2WJIA 3W5BA 2UXDB 4B3JA 4ZC8A 4N8DA 4MYCA 1IZZA 1D1PA 2W2LD 4LG1A 4MVXA 4CMEA 2ODAA 3VYSB 2OC9A 4PO3X 4U2BA 1H05A 5HVNA 1QE0A 1POXA 3ADPA 3ET4A 1DUIA 1ZVJA 2WI8A 2EJVA 2R8PA 1O5IA 4G01B 3ZU6A 5ESXA 3T4UA 1YQUA 5TF4A 2I66A 5FDFA 1N6RA 4NYJR 3ICEA 4DLNA 1VIAA 2HDWA 4OB8A 1OTXA 3NNNA 1ZPDA 4HN2A 2BR4A 1NF2A 1TMKA 1Y3CE 2C2YA 4M1WA 3TK1A 3FLAA 5EQDA 4KNWA 3FOCA 4GX0A 3MGAA 4YPVA 5LWQA 4OBXA 3JWIA 2PDAA 4WPGA 2B2NA 5JS2A 1LQTA 4UMDA 4FGKA 1QOQB 2IKSA 821PA 4QGFA 3VR6A 5JAOA 4LSZA 2XUAA 3RS7A 2PXAA 3TTTA 1IZ9A 2GEFA 3KUDA 3PXUA 5IHXA 2I6FA 2VSQA 1QUFA 3KDAA 3KSBC 1L1QA 4J0CA 4NJEB 1UXKA 4KUGA 4U9UA 1VHWA 3IEXA 1OZAA 3EGXA 2HF9A 4R4JA 1QK3A 4O1HA 3MWDA 1G60A 2E21A 2QM0A 4C89A 4AJIA 5J4LA 3ESYA 3HRHA 1SRQA 2A9PA 4LQLA 2H3HA 4XD2A 3JAMA 2XCSB 4JC4A 1RVDA 4MP3A 5LMCA 2JBAA 4NU6A 1O95D 4LE0A 2VHEA 4EO7A 4XPIA 3VH1A 5TMEA 3DBVO 5HR5A 1GRQA 2FU5C 2I2CA 4DEYA 2NYAA 5LL6P 2HO5A 2ZJOA 3Q8MA 2J3KA 3TLGA 1X42A 4S1VA 4DY6A 5JAIA 3ICVA 3CLTD 4FOTA 2OLEA 3BD6A 3GY0A 2FR0A 5DLQC 2XTAA 4H2DA 5T7BA 3QVJA 4NBTA 4DR6B 2QSZA 4LVCA 4NENB 4ZZIA 2W6JD 4YPFA 1JU4A 1W88A 4QGAA 3C14C 3R0JA 4RETA 3ZWOA 1YQDA 5REQA 3ZQUA 3BBPA 3AF3A 1O03A 1EP3B 3FD8A 3HN2A 1RIFA 4OQZA 3UATA 3DMTC 5DASA 2B7BA 1IEVA 4JX8A 5ECDA 2J9ZB 3KTFA 1P6XA 1WUHS 4DSNA 5AUNB 1NA5A 3B82A 1FUKA 5BMVF 5L3SB 1LFAA 3R1IA 3NGXA 1YRLA 3VNVA 1NLZA 2V0NA 1L1EA 2DQKA 4WERA 2ODTX 2C5GA 4F04A 1KWGA 2XMDA 2DETA 2I5PO 4Q3LA 1GTZA 4UD6A 4QJ4A 4P3KA 2HYDA 4CM8A 3ONWA 4L5AA 4ESOA 5K3BA 4FUQA 3CF6R 1RPZA 5JNTA 1KTIA 3LE8A 3QH4A 4B47A 5HXAA 4INZA 1MA3A 2DUNA 2ZYSA 1XEXB 3EZYA 1CC1S 3KSDO 4IEIA 4D0RA 1Y3FE 1PT8A 4GDFA 4KIUA 3RI3A 1UT8A 3QF4B 1U1EA 3NHPA 3T94A 3RK1A 1FPQA 1NUTA 1Q14A 2SKCA 3PFWO 4QDUA 3B7GA 4DQXA 5GJBA 2NO0A 2OV3A 2JIBA 4NZNA 2VT6A 2YS6A 2DKOA 1ZSVA 4P2BA 4WJKB 3A7EA 2HUPA 2GEBA 2E2WA 3PEFA 1NBEA 3LHDA 2VPZA 1R3DA 5EHQA 3WL7A 1Q1QA 4BTLA 1N5RA 1KP3A 3DKKA 3WLIA 3IOBA 4QPDA 5CBKA 1JR3A 4QOFA 5KTKA 1ECBA 1ETHA 3WV5A 4B45A 4BZPA 4UOQA 4V1CB 3D31A 1ZUHA 3GA0A 4JLPA 1U3TA 3CRQA 3ZPXA 3AP1A 4JU9A 2IBTA 3RRYA 5CX4A 4GGPA 1Z5VA 4YMUA 4IM7A 5BNZA 5EIEA 4RH0A 1C5KA 2F8SA 4RZHA 4B46A 2UV8A 1NNEA 5K3FB 1RJWA 1U3GA 4ES6A 1JHDA 3UK1A 5GONF 4BXOB 2VZ0A 2Z4RA 3ILSA 5A03A 3MWEB 2N42A 4FKMA 4JBYA 2C2KA 4OFZA 1C50A 3OY2A 4CV1A 4KRXA 3VKUA 1GSHA 5DXFA 4DNFA 1H2EA 1QQTA 1Z5NA 2RONA 1V8BA 5KTNA 3KVOA 4HNAA 1E2NA 1YGPA 5J2UA 1G7SA 5AW5A 3ICWA 2HZBA 4NABA 1KMNA 2FFQA 2VRCA 3BXGA 4FE3A 1NZJA 2WAXA 4QGGA 5A6VA 1NBME 3LX6A 2O3SA 3IQXA 4KE8A 4G0UA 1SG6A 2C7BA 1INLA 3R9IA 4XJSA 3ZU5A 3ZV6A 3T3OA 2FRDA 1BD4A 2NZ2A 3QWAA 4B80A 4J0EA 1VSUA 3MGGA 2AOUB 2PZEA 3KQQA 3L0IB 4OUDA 1MGPA 3RVPA 2WRZA 1VMAA 3I05A 4Q24A 2ZRDA 4BDTA 5I48A 2BCGY 4N5DA 5B2ZA 3ECCA 1FLAA 2P9YA 4AQDA 1TAUA 3VO1A 4KR7A 1H2WA 3IXLA 4R2LA 1P1HA 3TE7A 1JSLA 1EVLA 3NH9A 4FOLA 4IMJB 1XROA 3OX4A 2JLYA 1XZIA 3WSVA 2A1TS 1KFBB 1ZUD1 1FBTA 1LY1A 3S3TA 3SEQA 1QHIA 1DEAA 2GBGA 4NAVA 3SQNA 1E0SA 2H1CA 2IYTA 1XQXA 1SQ0A 4FU0A 4A8PA 4NY1A 1VKZA 1TADA 2VZ9A 3QOXA 1IY2A 4L9AA 2X0NA 4QRIA 3P0IA 4XQCA 1XCPA 3N9IA 3L2OB 3JQFA 1L7NA 1QGUB 2NU8A 1EFTA 1EVYA 2ZE8A 2IHYA 4YXWA 3A3KA 2ZBPA 3CFYA 2GZMA 4K6FA 3T52A 2VCEA 3QU5A 1HY3A 2VP5A 1KMHA 3ESAA 3HV2A 1UZAA 3OY7A 4L9WA 5EGSA 3TR0A 4EH1A 1IU9A 3KRTA 3MWJA 4G41A 4Q9JA 4ZOQI 3JQAD 4GGOA 4RD4A 3TW8A 1DKNA 2WT9A 5CFPA 2GETA 2XBLA 1HFEL 1ZSNA 5DT9A 3S8EA 1XRQA 2MSDB 2BR5A 4KACA 1OU0A 3RV3A 5B7QA 2Z1MA 2DHEA 3GNQA 3PX2A 3PSAA 3ROPA 3RU7A 1MZVA 2WUWE 4B2PA 2Y68A 1VYTA 5K2MA 1K8XB 1SVMA 2M2IA 3D6UA 3DMGA 4MW5A 2OL4A 5I8WA 1ADGA 1ECLA 1P3DA 5LC1A 1CUFA 1XJQA 3AKCA 3BS4A 3FW1A 3VTKA 1K7FB 1L5WA 4BQIA 1VIYA 2I2WA 2PRYA 3VR3A 4EZEA 1XMSA 3G0BA 2NTVA 4EEKA 1PZMA 2XQIA 1RQGA 5A4IS 4RKYA 4EECA 1FA9A 4QOIA 1IAVA 1MV8A 4V0MA 2BKEA 3NHMA 3PHBE 4XYGA 4MI6A 5DTEA 4MYHA 2OYRA 4BQRA 4ENTA 3LXMA 4OLFA 5K3SA 3WIBA 4NIMA 4J43A 3CO5A 3RH0A 4AI6A 2YS7A 2CNKA 2EJCA 2WHPA 3TZ6A 2YFHA 4FTWA 5BN1A 1G63A 3NWJA 1H3FA 3KUKA 4HWSA 3B3JA 4CRWB 1XA4A 3II6X 1QQBA 2OORC 4IJUA 1TYCA 4K9PA 2Q7OE 4CLRB 1IH8A 1U0SY 3D6FA 3RYTC 2B8JA 2G9QA 5KMGB 3A9RA 3CZQA 1AKTA 2JAPA 3HDTA 3JAKB 1GNSA 3AIMA 3TAUA 2QLMA 5FI0B 5JXWA 1J1ZA 3G9TA 5LQSA 5A0VA 1E2JA 2XQGA 3TL6A 1P44A 4OM8A 5SY9A 3UA4A 3OCVA 3WOVA 2GD0A 3X1WA 5CNMA 1ZFNA 1IFXA 5D3KA 5B64A 5FWXA 4OK3A 2K5UA 2ZGVA 3MPOA 2OZEA 4MMZB 1CRLA 2WIKA 4PNHA 4L95C 2HA0A 3GVPA 1SIUA 5K1ZA 1KE2A 4AN0A 5JBNA 1QAOA 4DWOA 2OBNA 1ZN7A 2F4NA 3M1YA 3OJEA 5B3LA 2JK1A 1ORVA 1P1KA 1JKJA 3NDRA 1FB5A 2IEDA 4IVRA 4J9UE 4JEHA 1EGVB 4Y9RA 2OFPA 4AMYA 3LO8A 4FYIA 1V8ZA 4A5OA 2Z83A 1HK7A 2DP4E 1X87A 4HCJA 4RF2A 4X1IA 2O8EA 2R1VA 4RCVA 1KEPA 3EGWA 3BFKA 4WZBB 1MAHA 1KGDA 4LS3A 2BLLA 1CK4A 1ZONA 4ZYWA 3BGIA 3BICA 2FX2A 4DCUA 2HDHA 3TQFA 3TXYA 1TFRA 2H4HA 3AHEA 3LWNA 2D5AA 4KQHA 2UVQA 5CA0A 1IONA 3CZAA 4N6GA 1V1JA 5JJIA 1ONBA 3ND8A 4GNKA 3TZBA 3UZUA 2LPMA 3K4HA 4IIFA 3IVRA 4R1UA 4A92A 1S0UA 3D3NA 2X4GA 5I4KA 1DUVG 4OMDA 5JEDA 4HAXA 1SCKA 2PTGA 3HS3A 3VR2D 3FZYA 3V00A 2VBGA 3BK2A 1Z0IA 1GGEA 1Y9DA 2FVXA 3B1JA 4FT4A 2QW8A 3N07A 4Y6GB 3D4PA 2AC7A 4E31A 2JBWA 1CDDA 1E4EB 1SC9A 1RZVA 1WMSA 2F1JA 2NSDA 2Y71A 4KG7A 4PHFA 2JASA 2WSSD 1I0LA 4X41A 3VSCA 3WLHA 4BB9A 1VKJA 5KDOA 3WAJA 2XDAA 2P5YA 2CCKA 3FXAA 3KYBA 3Q2OA 3N2KA 4LQ4A 5JD4A 1ESZA 2OUIA 3THYB 3CB2A 2QMHA 5ALKA 3GFBA 4F71A 3STTA 5AJXA 3IESA 5BXQC 2ALJA 2JFZA 1EESA 3ASYA 2ZLBA 1Z6ZA 2Y67A 3PRHA 4TTSA 3H13A 4ZVNA 3SOZA 3CO0S 4P93A 4HN4B 1ESDA 2VZ8A 2XNDA 3ZY5A 2BP7A 2XITA 4NMXB 1FNMA 3BIJA 1BXRA 3PXCX 3HB5X 2JLCA 4Z53A 1UBEA 1NVKA 3BE4A 3HN6A 1EU1A 1Q1ZA 1SVOA 3PRKE 2EKPA 2ZI4A 1I14A 4JVLA 3L1VA 3OHMA 3SEZA 2B5WA 4G89A 4KXXA 3UAXA 4BJ3A 3TLXA 4BBPA 4URVR 4DCOA 1GKIA 4D9KA 3AF5A 3CJQA 3KJXA 3S5JA 5AM3A 2OFWA 3ZZ1A 3LXXA 3MGCA 2VJLA 1PSWA 1FJHA 4JYPA 1RYMA 1C9NA 1UINA 1SKYB 4MRAA 5DGIA 5ALQA 4HGOA 4NBSA 4ITRC 5C18A 4BFUA 4CEJB 4IMIB 4KQCA 2WOOA 3FCSB 2ZIAA 4OH7A 3PSHA 3KDPA 1MAUA 3D8NA 3PWKA 3WLPA 3UPUA 4HFNA 1HTTA 2TS1A 2GD2A 3H9EO 4DOMA 2Y9PB 4KWCA 5IVHA 3BRWD 1OWMA 1NQXA 1Z5WA 2CLFB 1PTJC 3P45A 5H3HA 3Q12A 4AJEA 3I42A 1SQ5A 1S8OA 3MS7A 5EIBD 1N2IA 2WE7A 1JTFA 4H0FA 2B83A 2QMZA 3WOHA 3COSA 3VYTB 2I8LA 5LZ4A 1S6YA 1CLUA 1LKZA 1V45E 2ZEJA 4ZVMA 3U6BA 1NP6A 3DFMA 1QIIA 4G97A 1FFSA 5EIWA 3LXUX 2O0HA 3D9QX 4B87A 1B8OA 4U7JA 5ESRA 4B6PA 1Z6TA 1PT9A 4DV6B 1NWCA 3F6EX 3EGCA 2E5FA 3I9KA 1NP3A 4L0DA 3U4DA 4RS3A 4BO3A 4K7JA 4YLYA 1XEAA 1Y5LA 3IFSA 4LSWA 1K66A 4DV2B 1GGKA 2BMDA 3AUJB 4XYLA 4MIKA 5CVJA 2VS1A 4ZVUA 2LW7A 1ENOA 1A2QA 1G5HA 4E0BA 1FRZA 4HDSA 5T8KA 3F4KA 1NYRA 4JYCA 1KRWA 1EGMB 2HL6A 3GD5A 1T3TA 3DBLB 1E9CA 1D0IA 2CV1A 1T5BA 2PUJA 4PZPA 3FX2A 1MNQA 1P45A 3N8GA 5AQEA 3A1VA 1OBFO 3GYBA 1M5UA 2KM1A 1Q83A 3EG5A 4RD3A 5CLQA 3ILVA 4C01A 5L4LA 3R44A 4TSFA 4PZAA 3W6PA 3AF0A 5KHOC 1W9MA 4M76B 3PC2A 4K9NA 3MN1A 1K2WA 3I76A 2HSDA 2YCLA 3ANLA 1VYVA 3STXA 5FOQA 5LZ5A 1G3IA 4NCAA 5DI9A 3LT4A 4DNQA 3ESCA 3U7IA 1P4HA 4NYIQ 2PD4A 2ZJ7A 3NBQA 4YQFA 4PZUA 3HCDA 1NXPA 4YBRA 4RHYA 1IB6A 1Z0JA 3KEMA 3JQRA 3PUJA 4L8VA 1LK0A 1ZGZA 4NMLA 2VSXA 1V8FA 1OI7A 2XDWA 3R3YA 1XSEA 1CJTC 1AXEA 5CYPA 3VDQA 1V39A 3PFFA 1W30A 4ZARA 1DHTA 2OT3B 1M5RA 4V03A 3M3PA 2JGDB 1I30A 1E2HA 4TQ9A 2NMVA 1US8A 2WV7A 5KAPA 4DJJA 3GV0A 4C4PA 1TT7A 2QM7A 4ATNA 1QPZA 3SLKA 2PZAA 5JMTA 2AL7A 4PBSA 3RLIA 4FQ5A 5GM2A 3E7XA 2VG8A 5AJHA 2AXPA 2CCJA 3QV1A 1B6RA 1VBFA 5E1BA 3FDXA 5BURA 5KJEA 1WBJB 1QYXA 2WPDD 4UM9B 4B1FA 3N1UA 3IAXA 4B3DA 2VAVA 4HQNA 4MRSA 4P80A 4C87A 1S96A 3TWOA 3PCRB 2AK3A 1N3BA 3AOEA 4AZ3A 1KPIA 4YCSA 3W1EA 1RLUA 4XASA 4AT1A 2PKQP 2PFGA 4BB6A 4DPMA 1PAUA 2DRIA 1KDYA 3CHYA 2VF2A 3IS3A 3TQHA 3LK6A 2FYTA 3I9MA 4LVNA 4DCSA 1IN5A 4ENPA 5GOTA 5KVCA 5LB2A 4ZYYA 4XD7D 1U80A 2H1IA 4F9FA 3ZCUA 4MV9A 2JLZA 2QPLA 2G4LA 4DN6A 3DE7X 1RJFA 1JN0A 2CF5A 2ZIFA 4EFDA 4HNUA 1E5DA 1C3VA 1J0CA 1HL3A 1JLLB 1QWSA 1ULBA 4G37A 3WGJA 5LYJB 1DAGA 4P0QB 2IK8A 3EXHA 2QXUA 2Z5GA 2AE1A 1RVV1 3AVPA 3DB2A 3DKVA 5DX0A 4ZXPA 2FEOA 2W6NA 4P35A 5IHPA 3I9FA 3BHIA 3GLFE 2JVKA 4Z4HA 3FGOA 1W29A 3IPXA 4KO4S 4Q9LA 5AW1A 4AKGA 4DA9A 2JLWA 2JKYA 1U2SA 5C1PA 2M32A 4BV8A 5ICCA 2QN8A 1CERA 2F1IA 2BH2A 4ERXA 3I58A 1XQ9A 2WJWA 2HIMA 3D0RA 2RI1A 3F5QA 2D1TA 4K9OA 1KDRA 1FFHA 1ISSA 2PVSA 3E1KA 3GVIA 3CG4A 1S1CA 3MBIA 3NDIA 1ZN9A 4L6AA 2GAJA 3A1DA 3DULA 1T3SA 3OQ1A 4TKUB 4TL6A 4UTXA 4IHQA 1YACA 2AYZA 1J33A 1RXUA 3HO6A 4JJZA 4J0DA 1A2BA 1EUCB 5CURA 1LTKA 4DR1B 2WSYB 1NZDA 2BWJA 4FT2A 1SA0A 2VSYA 3I6YA 3OKCA 3F8TA 2EWMA 2XD9A 5ALPA 5JG7A 2PL3A 2FZVA 1CIPA 1FFWA 2JA2A 3G68A 3R0XA 4FMBB 4CIVA 5JT1A 5BSMA 1N77A 1TJ4A 1I2MA 1ZN2A 1QF9A 4LPKA 3T6KA 1QO9A 4EUEA 3KALA 3NETA 2XKKA 1W0JD 3GUZA 5T3UA 5J5VA 2GLTA 1H0RA 3BE5A 5FULA 2HRBA 5FCDA 3L8MA 3HB7A 2XKAA 5LPNA 4J7CA 4NV1A 1NBMD 3OQJA 3EVCA 5D5PA 1C14A 1L6RA 7ADHA 1PHPA 3EARA 4H6VA 5DYGA 3SJ7A 2LDBA 2H4ZA 4BN5A 4B2LA 3MJTA 1RM3A 5FOTA 3GFFA 3JQ9A 1V4BA 1GLNA 4H7KA 4JX9A 3UGKA 2J4FA 3J80A 4IZ6A 1Y33E 5JFTA 1QIJA 4DSTA 2X0KA 1LBTA 1USIA 3C3CA 4MIEA 2UYOA 3TLAA 3Q3GE 3AR9A 4LV5B 2HQOA 3UBTA 1FYXA 1QFYA 2BKUA 4XFJA 5DGDA 2CMHA 3ADOA 5FPQA 3GEIA 5EPOA 1DZ3A 2KJQA 5SYNA 1G6Q1 2RIRA 2QRPA 2WLTA 2WIBA 4Q3DA 4F4HA 4AQ7A 3K70C 1ZA2A 4XCXA 4AO6A 4P6VF 5F3DA 3SX0A 3SYNA 4DQKA 4E5UA 1FP1D 1SHZA 1SXIA 1XE3A 3IV9A 3U13A 1CZOA 2VYVD 2WD9A 3ET5A 1F6DA 4GNRA 3A6HA 4PIVA 6ADHA 2XE4A 3ZBPA 5IPFA 1CUUA 2AF3C 3TZLA 3WWPA 5J4VA 3LQFA 2ZFUA 4HKTA 4RD1A 8ADHA 1PV1A 2PZFA 3HCAA 4TVOA 2ONKA 2XR1A 4ND4A 1N9GA 3FOEC 4O4LF 1CCWA 1FDWA 1J8QA 1NM5C 3TOZA 1W2GA 3WXBA 5I4BA 3HXLA 3MAJA 1JDNA 2BEUB 2I6XA 1I7QB 3Q7TA 4NV0A 2G8LA 2PX2A 1IIRA 4DJ5X 1CP3A 2D5IA 1NVXQ 4R05A 4F6RB 4BC0A 2H9IA 4W6ZA 3EXEA 4RDCA 4IBOA 5ICSA 4BO0A 2DM6A 1PFUA 1K63A 3DD5A 4FYXA 4UE2A 1KYYA 4TMZA 3SHFA 4HNHA 2UXBB 4C4AA 1C0KA 4Y2JA 1H4VB 3QLUC 4KQGA 2XUKA 5DOZA 3SXUB 3ZZNA 2VXYA 4P0PB 3FJOA 4A23A 1JHOA 1YRHA 1RJ9B 2YVUA 3HCOA 5FLXA 4CQLA 1G20B 1J0EA 1ZH8A 1MA0A 4G9BA 5BVGA 4ILEA 3DTVA 3EPHA 3MTBA 1PJCA 4I9UA 4RF3A 3UB3A 3CBGA 4DADA 3GRRA 3OLYA 4CV3A 2YIJA 2SECE 3M1IA 4RA6B 1XU9A 3UT5A 4R9NA 4R81A 1X2BA 3FBWA 5AD1A 3I9LA 1BW9B 1UIMA 2QTFA 3JYOA 4ZEVA 1EE1A 2EZ4A 3GEHA 4A0QA 2EJTA 2BSXA 2OENG 2UKDA 3LY8A 4YJHA 2J09A 2GCNA 4GE0A 5G3ZA 4F2PA 3ZGOA 2JVIA 3OWOA 2VQSA 4PPQA 5AM0A 1UBGA 2RI6A 2QPTA 1KZ7B 1AZSC 3ITNA 3MJCA 3HO1A 4RQBA 4E4TA 4EKDA 4CKWB 4JVMA 5DTJA 1R2QA 4FI3C 4ALKA 1PG0A 4D7AA 1JS1X 3ZKWB 4LOLA 4YV7A 5F2OA 1LVGA 1SCUB 2I55A 1B8NA 2Q1XA 3KOYA 4IIVA 3AXTA 1RQNA 4QOJA 2X9VA 4CG2A 3EOZA 3RK4A 4AX4A 1YJ5A 1UZLA 2YZ2A 3A4NA 4FSDA 4RMNA 2XLCA 1U0BB 4MS3A 1T3HA 3N3BC 4ZOCA 3ZG6A 4BO6A 3S29A 2A7QA 2C9YA 2ZRFA 3H9GA 5EZ5A 1SQSA 5GV7A 5C7IO 3G2NA 3VNUA 4B81A 5JS7A 2NVWA 3D1JA 1ZM9A 1QIDA 3PFBA 4AECA 3UT0A 4ARZA 4URXR 4HWGA 1AS2A 1PUXA 1ST2A 3NATA 5MHTA 1SB9A 4TXMA 3KZNA 1ECCA 3PI6A 4QC2A 2A9JA 4RJLA 2G5CA 4KL8S 2IPXA 4Z2AA 1JWAB 4LRSB 5HFAA 2I8AA 1MN6A 2GI4A 2X9NA 3OE7D 4LXQA 3VKFA 2VA8A 4BB5A 1KY4A 1OX4B 1N3YA 2H7CA 2V59A 3P2MA 4IOMA 4H3SA 1DRUA 2RSLA 3N58A 2BFDB 2IOFK 1XTPA 4LYAA 4N01A 4W6QA 4W1QA 4DM4A 3I2FA 1XVTA 3GCZA 2VQFB 3RPEA 2C58A 2IU6A 4M36A 2DTDA 2ZS9A 3IL2A 3RC7A 3RC8A 2Q5QA 1XB2A 4Q03A 3I2YX 3WSWA 1XXHB 2YYZA 1O2DA 1XNJA 3ACDA 2R8OA 4BVFA 2F55A 1EFCA 2W48A 4PCVA 4B7AA 4DIMA 5LQDA 1SHLA 3OM0A 1M9NA 4RO0A 1KC3A 4M55A 3BL8A 5FP0A 3L06A 1PJQA 4KN5A 3I9OA 4X20B 5AJTA 3UUWA 2CXOA 1TF5A 3KXLA 4HLUA 3V8NA 3LI2A 4MR8B 2VUIB 2ZBDA 5HQ3A 2B4YA 4BAZA 3FTFA 1UBUS 1B74A 2J08A 2N47A 2ZJ1A 3YASA 1QLJA 1YR8A 4WBXC 3KVRA 2AWOA 2QBYB 2YY7A 1W59A 4KVGA 3VMFA 3K9CA 1NI4A 4X1YA 3PUYA 2TRSB 3N87A 4KAXA 1QDUA 3SQWA 3EIWA 4TTIA 4BY9E 2XNKA 4KQMA 3B78A 1AQUA 1I2AA 1YUNA 1ZJJA 3FSEA 3FVTA 3HUDA 4MDYA 1V3VA 1EFUA 2WM8A 4L8YA 2XECA 2D4HA 4RTJA 3Q41A 4U7PB 3ZHZA 1VIDA 4B31A 4TRMA 1E0AA 3C3DA 3KZMA 2NTNA 2FZ4A 4JP8A 4C6TB 3ABIA 3OBIA 1R7RA 3OIDA 1Y3BE 3ESQA 3OCXA 4P84A 2FDCA 3QBTA 1M7HA 2OB2A 3NKFA 4KC0A 2J33A 1F2TA 1VC2A 2O48X 1EQ2A 1Q91A 1F2VA 2OCIA 1O0BA 1RYEA 4XQGA 2PIAA 4HOYA 4K6GA 1QYCA 4TKVA 5EKTA 2QMEA 3QKIA 1Z4LA 3X1MA 1OH8A 1NW9B 5KYNA 1Z0UA 2GZRA 1P0CA 4Z3OA 1G2IA 3D3WB 4NK4A 2QTWB 3H5WA 2QTLA 4EKIA 1FYWA 2QYSA 5FD8A 4WAUA 3T9DA 4IHJF 2A5YB 4OHRA 5DNDA 1BXZA 3WL6A 4DLBA 2W22A 1JR3E 1B6TA 4Z6KA 4XSVA 2DR3A 1D2RA 2C3PA 4LZPA 4KOEC 3UUGA 3FPEA 4NMMA 2QUHA 4NU5A 3NYQA 4HSGA 1OXKB 2OV8A 3DQPA 1Q7BA 3W6OA 1JMVA 1L5KA 1D7OA 3V7YA 1YZUA 3EZNA 5G0WA 3TM4A 5FI1B 3NPMA 3H2HA 3CVOA 3H8SA 1U7UA 2FI1A 3RRBA 3DO5A 2GKOA 4FHCA 2GBCA 3C3MA 4AW9A 1BKDR 2A0WA 3JWJA 2LVBA 3L0PA 2XXAB 1JFFB 1GV0A 3FTPA 1JFLA 1SD5A 1NOKA 2BFAA 3IT0A 5B53A 3L0SA 2WJ4A 4Q4HA 3IB3A 3W5DA 1LI7A 1RCFA 4GDMA 3WLLA 1UJ6A 1NKVA 2GJKA 1MVLA 3NHFA 3QE4A 2R5NA 3MEQA 4G4SO 4NRDA 4URHA 4W99A 4ZU3A 1YS6A 2ZQZA 3I5AA 4QYIA 1K06A 2VDUE 2JHCA 3ILHA 1PN3A 1VRVA 4ZAWA 1LPNA 1LUAA 2CJFA 2IPNA 3DL7A 1JLRA 5BWNA 4IJMA 4N03A 5TPZD 3QXHA 5E38A 3CT6A 3TLKA 5HZHA 5EFZA 1VL0A 1DG9A 2GKGA 2WQZA 2WB2A 1USUA 3MC1A 1TRKA 1V41E 2R97A 4S1WA 5L4NA 1ZZEA 3AWIA 4CLXA 5AUOB 3K70B 1RI2A 3L82B 2PUFA 1NONA 1EVEA 1E4OA 3FKSA 3KPYA 3M81A 4OKSA 1W0CA 4G26A 4ZEXA 1VJ5A 2GUWA 3OAAA 4D8VA 2O0JA 1A7UA 3K16A 2VZEA 4O02B 3WA7A 1AKUA 2HWKA 2X7JA 4XDZA 2DFPA 1E2UA 3N8KA 1TYDE 1WZUA 2FG7C 1TQDA 4KFUA 4MWEA 5GV8A 5HBRA 5HUHA 1H5QA 1G9SA 2PFKA 1WU8A 1M2KA 4R54A 4C43A 5MGNA 4FMCF 5GJWC 4KIWA 2VBCA 4WBNA 5BY2A 2F90A 3PWTA 2E0IA 2P2GA 3A70A 1LV7A 3CY6A 1GVNB 2ERCA 2EARA 3BRQA 3LGXA 1L4KA 3PTAA 4TPKA 2H08A 3PJGA 4N39A 2G83A 4PXSA 2QPOA 4DMCA 1PFKA 3HJRA 3NVDA 3BOSA 4HDNB 5MDHA 4B85A 1BO6A 4TGLA 5G0VA 1NQWA 5AVTA 2QW1A 1F9AA 1X7ZB 3DE5X 3JARB 3QJGA 3UFXA 4CDMA 3IUNA 1AO0A 4HNQA 4MYTA 1Y9AA 2DG2A 3BMQA 3QGMA 1VG9B 4RK7A 4IDDA 1BX0A 1V26A 1TUBA 2IUEA 3GRCA 3H11A 5TT1A 4LIPD 4DKJA 4OAPA 4O4JF 5LQRA 1AQ6A 3K0KA 4JT8A 1GCUA 3WNQA 1NNUA 2GHIA 4ZT5A 2NIPA 4MULA 4NCNA 1A4IA 1XFAA 1T43A 2O3TA 2R62A 2OV1A 2WHXA 3AETB 4HVTA 1KAEA 2HD4A 3TVTA 3ZS8A 1MIHA 2GLXA 4L3WA 3VPFA 1GFIA 1OZ0A 1NR5A 2R7MA 4IO1A 3TBFA 1LPOA 4M0KA 1YMQA 2FUG1 1P77A 3W2IA 1PVOA 2XMGA 5IJXA 2V4UA 3VPDA 3FF1A 1YONA 1H4SA 1ZIYA 1TYEB 2Q1TA 2WF8A 4Z86A 5KTRA 4H27A 4M1OA 1A9XB 1Z35A 3GJ0A 2OCXA 2Y1KA 4UQOA 4DDMA 1FDOA 3BRCA 5AVRA 5MFPA 3BK7A 5LR6A 1YDWA 1THGA 4GZLA 2REXB 4KN9S 1LLFA 1TD9A 3IQDB 3SE0A 5LNK1 1CW2B 1A76A 4ZVVA 1P9LA 3ADDA 1J39A 1PJBA 2B4KA 2BVNA 1GARA 2W6ZA 4XPZA 3T0IA 5K0SA 5GWXA 1LPBB 3D7KA 3K0CA 3OEYA 2P1ZA 3L93A 1BFDA 3B60A 2AC4A 3TIVA 4B3CA 4CM9D 4ADSG 4Q00A 4Y0AA 5LXTF 4A6DA 1U99A 3VRHA 1WXQA 3EPRA 3UQZA 1IVYA 1L5VA 5JSUA 3CZRA 1OBCA 2V6FA 4KLAA 1Z4MA 4URYR 3C43A 1JVSA 1BG6A 3THXA 1CLEA 1JKMA 4DTIA 3VR5A 1XQWA 1TVKB 2OP0A 3JW8A 4IIHA 2XMQA 3SHTA 1QRSA 1O1YA 1FZQA 1XZHA 4J2OA 1GQRA 5FTJA 1UFVA 3P2OA 3W3AD 3DZCA 4KRYA 3C6YA 4LVOA 4NH4A 3STYA 3AMVA 3EEBA 3BMCA 1OIVA 1HYBA 1U1FA 2P8SA 2Z8YM 1R37A 3CPEA 3LLCA 3NUZA 5A71A 3T1OA 5K05A 1LSSA 4ENUA 4RTKA 1TKAA 2WTXA 1IM8A 3AWDA 3CE9A 4EVIA 5KBYA 4NYMR 1PTKA 2WF9A 4FBLA 4ARCA 2PMDA 4RZIA 1BNCA 4J3JA 2Z04A 2YZGA 4LWQA 3I2IA 2BD0A 1XAJA 1W44A 1E9EA 2CKDA 2VF5X 3AVOA 3IDFA 3LRXA 1OBVA 5AK3A 4U39A 3NAMA 3DEKA 1QX3A 3LOUA 4J16A 1O87A 1THZA 1UBJS 3EH1A 3GUVA 4KIGA 4NDAA 3V1KA 3MRXA 3HY6A 4JMPA 2UXCB 4EF6A 3UHPA 1I10A 2G6BA 4RVCA 4D3ZA 2M6KA 1J23A 3FHJA 1E1MA 1LLCA 4WK0B 4ZOLA 2VNAA 3PDJA 2QR3A 3FFWA 1AKWA 4OATA 2IY7A 5EKSA 2PMEA 1J49A 2QUIA 4NJMB 1ZD1A 1JBEA 3NAZA 3S2FA 2HLPA 4MDHA 3EDOA 1GN9A 4XWAA 3IKTA 1B76A 1CWUA 1TPYA 1SXJC 1UK9A 2Z30A 3LFUA 3LUDA 1L4GA 2ZPUA 5I51A 4ZIRA 3I9V1 5LA6B 2I3AA 1U02A 4C2UA 3R41A 3FPSA 1WSWA 3HA3A 5M3BA 4BKRA 1G41A 5J43A 1NQVA 3JD4A 2W42A 4ZVPA 4MDFA 1I01A 2R751 3F97A 1NYLA 4DLWA 3WAGA 4WD3A 4WFKA 2QP3A 2ID4A 4F21A 4RSHA 4R01A 5KNBA 2FOIA 4WZ6A 4QQKA 5H82A 4U00A 1ZGAA 3PL5A 3BHMA 2JIPA 1LLQA 2C5SA 3Q2IA 2F3QA 1FDSA 2AEFA 2OMEA 4IYJA 4EELA 4EWLA 2ZRGA 4J7XA 4JI6B 4FGJA 4EPVA 4FHEA 1UPAA 1BYIA 4M22A 2A9RA 3KT6A 1QNLA 2PGIA 1EVKA 1XNHA 4KQ9A 2PX0A 2BOVA 2B25A 5GGXA 1LPSA 3PF9A 4RXMA 3Q85A 1E94E 2CXRA 2C8LA 1U8YA 2VTVA 3E3LA 4EFMA 1V11A 3TNJA 5EMLA 3VGPA 3GLIE 1E66A 3G9QA 3IMCA 3SN6A 5JS1A 2E37A 3BJMA 5E9QA 2Y27A 1N2XA 1YZ3A 1BQ4A 3HJCA 4RA9B 5LVAA 3E7WA 4R6WA 4XUGB 2AJ8A 2OQRA 3WNDA 1QR6A 3BB3A 4E94A 2VTKA 1ADJA 4YRNA 5FX2A 2VT3A 1GTJ1 2IOQA 4DIEA 1A4UA 1MJ5A 3ZW7A 2ZB8A 3QP9A 4IH4A 1SWVA 4V0OA 5K8CA 1R4ZA 2YRFA 4LY9A 3PITA 1UBKS 1E61A 2UZ0A 2ZRJA 4OY3A 3VR6D 1H8EA 1CJBA 3V8MA 1NQUA 1I3MA 1M6VB 5DYTA 5JECA 3PD0A 3OZEA 3C6ZA 1AA9A 4MKXA 4WGFA 4UHBA 4YLEA 3S2UA 1O4WA 4HAVA 1E96A 1BIFA 5BRJA 3GPBA 2FPMA 2VQ6A 2B82A 2RHMA 5D7BA 4L15A 1Y1QA 4YONB 1NFQA 1H2AS 3T7DA 3O2JA 2XZPA 2CDNA 4ZC1A 3LDGA 3DJYA 1RXYA 4UZEA 3H9BA 1E3JA 2ATXA 3PNSA 2C42A 3TTSA 1Z7WA 3S40A 4P7BA 2NT3A 4JFAA 1W0KA 4CKEA 4B43A 2QIPA 1U65A 2G63A 2JJQA 3TQTA 4DKXA 2LKCA 3DCIA 5LOVF 3J7AC 2VDLB 3PRYA 4WX2B 2C57A 1VE1A 2JAUA 4RFSA 4Q93A 5JY6A 5BVHA 1OYWA 5C2JB 4YJ2B 2WC1A 5EQJB 3L41A 4IY1A 3V1TC 4EHKA 1ND5A 5A9SA 1M3SA 1P7ZA 4X6UA 2XYHA 5C1BA 3FG9A 3OOEA 4NATA 2P9FA 5I7FA 4X90A 2DQSA 2BRUC 1GITA 3QITA 1UPTA 5KJ1A 1R74A 3O8RA 2HF7A 1ULTA 1RAEA 2AS0A 2EP5A 2Y1DA 3B6EA 1YZFA 2H31A 3HO8A 2GT1A 2C20A 3R23A 4QUBA 4TN5A 2Q3FA 2JLVA 2H5LA 3EK2A 2VHWA 4M0EA 1P9WA 1PWEA 1PK8A 4G0OA 4MINA 3L6OO 1Z82A 2YYAA 2MOKA 2NZ8A 4XR9A 4A1FA 4UKDA 4D6YA 2I7XA 1UK7A 1ZD5A 4Y9DA 1XCMA 4G5SA 4MB2A 1XZQA 3QLEA 4Q3CA 4RD6A 5JAZA 1N78A 4JMLA 3EN0A 2D0IA 3DV0B 2VDWB 4LX0A 4WLNA 1OSNA 3VOAA 2WDPA 5JARA 5IBCA 1CEXA 1UK6A 2XEXA 3RSLA 1OYOA 3MCUA 2XOEA 2HMSA 4QDZA 4YDSA 2H17A 4KRGA 5AI6A 3VR4D 1TJ3A 5B6IA 4QUJA 1P72A 2V3VA 1CDEA 2GEUA 1N6IA 3GQBA 4RKEA 4UCXA 2IW1A 5D6NA 1MBZA 5DXJA 1YI0A 3R7WA 1UR5A 4M7OA 1NW5A 2LCFA 3ZDEA 1KYXA 1XKQA 3MD9A 4HZIA 2AKAB 5IM5A 3I1YA 5BN4B 2FQQA 5H3CA 2JK0A 4OHBA 4V2IA 5F1KA 3U4HA 2C54A 3MNFA 5AMXA 1NQOA 1VXRA 2C7GA 5EKUA 5JAMA 3CGGA 4X6XA 4PZCA 1KR2A 1X1AA 3ZWPA 1JR3D 1HQKA 1GO2A 1QQ6A 2BV3A 5DVZA 1Z8FA 3ZNPA 2PKWA 1PJ2A 3TZQA 5ABPA 4UUQA 3OBBA 1A8HA 2RFLA 1BH2A 1K4YA 5B3JA 4LNUA 4F3YA 1WBDA 2QN7A 4LA4A 4A03A 1WETA 3LIPA 4Q4JB 1A5BB 4JBLA 3AEUA 1JMYA 5AVSA 1MXFA 2X3UA 2A86A 1WNFA 2NUBA 4FSHA 1NW4A 4RVNA 5CU7A 1RQXA 1LDGA 5ARCA 4BQSA 2RGDA 3UIEA 1IXYA 2FX5A 3D6NB 1V3UA 3T1TA 1NT2A 1W25A 1K86A 4RLQA 4CKZA 5JSFA 2XWJI 3JU3A 2ZVDA 3PYLA 4GIBA 2YFQA 1KFJB 3UXEA 1V9SA 4C05A 5ILOA 2NSHA 4MVCA 1S4QA 3FNRA 3DHWC 1FY2A 1F1BA 1KEKA 4KAJA 3OOHA 4HVCA 3TINA 1FQOA 2B9EA 1HORA 3I52A 3INNA 9GPBA 2PKYX 3WMEA 3B6IA 2H48A 2X0JA 5A3SA 1Z2EA 2GAFA 3R3JA 4MRNA 3P19A 4A0SA 5F9FA 4AJ9A 1E9SA 2HDNB 1R50A 1W34A 1ACMA 3JQ8B 3OEEA 3W6ZA 5IYZB 3SFTA 2GYWA 4DB2A 3U3KA 1USKA 1I5OA 5EE9A 5BN5A 3QVGA 3NU1A 4C88A 5C5EA 4IF4A 1GIAA 4HZUB 3RT7A 3OLWA 3HPQA 4FD3A 3C1AA 3NBFA 4FYJA 2R7NA 2WM2A 3JQAB 2BFOA 2F8MA 4FR2A 4RBNA 4ZVSA 4BFVA 2RIPA 2JCYA 4EPYA 3BN3A 2DUJA 1EFVB 3HKBA 1M2JA 1Z34A 3K6KA 1F7VA 5BORA 1TF2A 2X7XA 2ZJZA 4MCAA 4XVHA 2G76A 3R7FA 3PLRA 1UMCA 1OE0A 5AK5A 5CDFE 3FRHA 3ST7A 1XAHA 4ZTZB 2FCAA 1IZ0A 3F5MA 1A82A 2G06A 3ZBUA 2JGNA 1CE8B 4IEFB 4TTVA 3TQQA 1G18A 3NS7A 1ID8A 1S2DA 4FDLA 4F4CA 2LE0A 3DT9A 2QAGA 2DUUA 4GAEA 5EKXA 5TIIA 2OXEA 4YP7A 5G3YA 2CL6X 2YHUA 3IT2A 1U0FA 2Q5JA 5DGXA 4WV3A 3J81k 2XDQA 1OASA 3AXSA 4IOJA 4HRXA 3USES 1QFJA 3O4RA 4XWKA 2IIPA 1SXJB 2C4KA 4B3GA 3SZMA 4KMMA 3DZHA 1DKPA 3VGJA 2IE0A 2REQA 4F60A 1R4AA 4MRPA 1LPPA 2HOQA 1WCXA 4PVDA 4G1CA 1H2HA 1TCUA 2ZATA 4DIUA 3LP8A 4AXXA 4HUTA 5E3IA 1GCAA 2O8BB 2MR6A 3PDHA 4OXXA 1KOLA 4NICA 2R3SA 2OZKA 3VZDA 3SHWA 1VSVA 3L6EA 9MHTA 2NYVA 5BUSA 4KR9A 2IPMA 3X3HA 4DSZA 1GCGA 3CZMA 4GP9A 5KNDA 1XZLA 3QEAZ 3O1LA 4TS1A 5DMXA 2VTEA 1N4DA 3IJEB 3QUSA 4Q1BA 3L07A 3U3OA 3WTBA 3A2MA 4F6RA 1PQWA 1FDTA 3MTEA 1DQYA 1Q0SA 3Q3IA 2KI5A 5DN9A 2CEKA 5IH3A 4BKQA 1F20A 1T1SA 1C3LA 3AF2A 2DH5A 1GPLA 4K8OA 4K9KA 4XJVA 1E5VA 2G71A 2J5KA 3AR6A 1D4ZA 2OGSA 1QHHA 4FVTA 4P4SA 1IJKA 5FPYA 3ZDYB 3Q3JB 4IMPA 3DL2A 5HTOA 2BGIA 3I5UA 4RZXA 4UM7A 3ZU4A 4FIDA 5ERGB 2ZWAA 1QH8A 1GKYA 4JT2A 3FDZA 2P0AA 2OK8A 2WW8A 3BHNA 1Q1NA 2EC5A 3OA0A 2CLOB 3CKLA 3AEQB 3DW1X 3P9SA 3ZK7A 3QFTA 1EGHA 5F2EA 3FPCA 5KKAA 2PYDA 4M9RA 2E4AA 1WR8A 1S5PA 1M6HA 3OFVA 5KNCH 1LSUA 1ZW6A 4B82A 5EJIA 3T3HA 3IBFA 5ALSA 4D9EA 5FL3A 4MRRA 2OBLA 3DKPA 4Z7NB 4FONA 3WLFA 2IP4A 2VDMB 3E0QA 1KDOA 4GO1A 3SDZA 4C4YA 5AJYA 2WFLA 1UPCA 4RJKA 5K2OA 1HZZA 1Y81A 1ZUNA 1VCNA 1KH2A 1HE1C 2FJ0A 2FKAA 5HZGA 1ZRSA 4WK2B 3V3TA 5IC6A 1SUCA 4GECA 3AVTA 4KXVA 4J76A 4CEHB 1NMZA 1WJGA 3DBRA 2Q6VA 3AESB 3NC0C 3TI9A 3H2JA 3OMLA 5KEIA 3NEPX 3THSA 3PFGA 1FDUA 4MGZR 1PLLA 2CBXA 4UHDA 1ZCJA 2MDTA 3AEZA 3RS5A 3VC2A 4BMOB 3UWPA 2PUDA 1GQQA 4JB0A 5EMJA 4C0WA 4FYHA 5BV0A 1YHNA 4XUEA 5ICGA 2ABWA 1G66A 4JB3A 4N0EA 4W5JA 3GJTA 2J9XB 4KE7A 1UBFA 3HGQA 1GG5A 2VHQA 3FPLA 3R5FA 3WL3A 3FFTA 4RDIA 3D0QA 3T95A 1BH6A 1PVDA 3AFGA 3M9LA 2JG3A 3JWEA 3QVWA 5JCXA 3AVVA 2JI8A 2JIQA 1MAWA 2PCLA 3NOVA 4JIGA 3ZIAA 2GASA 1R6AA 4YXWD 4NWIA 2FPXA 5CB4B 2IUFA 1QAMA 4H1HA 2EP7A 2Q4DA 1C9KA 1EM8A 3E9DA 4C30A 4DUGD 2QT0A 3H17A 4WT7A 2O19A 1U6KA 5A5GA 4R69A 4TRJA 3O91A 1M2VA 4XX0B 2IZ1A 3Q8LA 3R20A 4FOOA 3ZD6A 4BNXA 3RYCA 3ZWCA 2F3PA 2WUVA 5C0OE 1YU6A 4JUIA 2R8EA 3QLVC 3IKJA 4H08A 1YH3A 2RB5A 5FB3A 2C1EA 4L85A 4YACA 3GMSA 4UJ3A 2QTBA 1CUZA 4BFYA 5K8LA 3QBVA 3QK7A 1B0AA 5DNUA 3S68A 4EY6A 3NM5A 2DHRA 1XQ1A 3QPBA 5D5QA 4YK7A 4RHEA 2RHWA 3FTCA 3AUYA 1P8AA 1KDPA 1Z2CA 3LRPA 4ENSA 5JASA 5INTA 2GAIA 2VHYA 1G4UR 1NGSA 5TR9A 4TL9A 4ZCRA 3I4LA 4L1KA 3FHTA 4CE6A 2XE6A 2XNDD 1U28C 3CNBA 4QU0A 1ORDA 3A31A 3OPNA 1OPXA 3KD2A 4PYQA 3DOCA 1P60A 1K3UB 1U8FO 1SNYA 4HLDA 3GPCA 3KXPA 4IHAA 4PC1A 5DO9A 2J9GA 1NUUA 4ZMBA 3GOQA 1SQ6A 1P1IA 1L4NA 2J7PA 2R1ZA 2P4HX 5HKLA 2JDIA 1WWKA 3WLMA 3WWCA 4M8KA 4HK4A 3TBHA 6ABPA 1Y5NA 1RMYA 3U7EB 3H7AA 2OO7A 4RQUA 2R2AA 3QMVA 1NTRA 3QVMA 2C4MA 4ITVA 2AMLA 4IP0A 3FZQA 3P1JA 1AN9A 3GROA 4KXUA 1BS2A 4CF3A 4LJSA 1C9EA 1HGXA 3QXJA 4OJYA 4YCBA 2HIGA 2NZWA 1KAOA 4LOAA 4OI1A 3V7FA 2VFAA 3HJBA 4PCAA 2RJNA 4OU5A 1EK2A 1HMPA 1YR3A 1KS9A 3KO8A 1A3CA 1TOAA 2CLHB 3G9UA 3NG1A 2FHPA 1FS4A 2B69A 1ETUA 1PJZA 1E3LA 3DPSA 3TLMA 2DPHA 2E4YA 3NKLA 3FWHA 3F7OA 4MMXB 1KL7A 2XI4A 2G77B 4FN4A 2PMKA 1I13A 3ESBA 3DDSA 3WWYA 3HSKA 4F1KA 4E5VA 2SCUA 1NJSA 1UBTS 1M8PA 2OBMA 1OF1A 4RSMA 4ZCPA 5JWHA 1XBTA 2WM9B 1T36A 1TZBA 3UGTA 1QU3A 2BCJQ 1ML3A 2ZW9A 4HGZA 3UMYA 1WHSA 3FCEA 4GXRA 5K09A 3VSBA 1G8KA 1M83A 5JH7F 1NY6A 3RVMA 5I7AA 1Z28A 2GS9A 2H5EA 3QEKA 3CUWA 3KQSA 4UTZA 5DDIP 4EG3A 2D1QA 2LGJA 3EB9A 1LI5A 4FDMA 5FOXA 5FH9A 2B78A 2G9UA 3BBLA 4N5HX 1WCYA 3K6SB 2I4MA 1R0ZA 2FR8C 3ABOB 2GJ4A 3A9WA 1W87A 2EGUA 2XE7A 5LMUB 1CB7A 1PP4A 3DLIA 3BZWA 3QKRB 3E2IA 4IJVA 1VG8A 3LHSA 1E9BA 5T4BA 2FPUA 3L92A 1QK5A 1SU4A 3WIDA 2NYUA 2PX8A 2OYSA 1TZJA 4IG9A 3RYFA 3U19A 4GR5A 3GLHB 4P3NA 5CLHA 4FFNA 1G8YA 3B1KA 5EWJA 4E51A 4I1IA 3V7NA 4TSFD 4CUKA 2Z1NA 3HA7A 4MVWA 2GRJA 2BMVA 4YUYA 1L5HB 4LGVA 1JJBA 1EUQA 4JZYA 1CJSA 3PX3A 4NESA 3UJBA 1VRWA 4HDKA 4MQFB 1IL0A 1L7VC 4BNFA 2FSSA 3GLGB 2VJQA 4HS4A 2C5AA 4WLEA 4AQYB 1XD9A 1KXZA 2RI0A 5DN6A 4UTPA 1QK4A 3IP1A 4M0PA 2GPTA 1FCJA 2PFSA 4G86A 2B9VA 4J0IA 1FVXA 2C2BA 1E3WB 2Q0XA 4WNYA 1VYUA 1D6JA 2KBEA 3D6VA 1IN7A 4ZOAA 5D01A 4S04A 4JR2A 4Z9XA 1N2ZA 5K45A 4PSAA 3BGOS 4AU1A 3RVDA 3BL6A 1EH5A 3S5UA 1CUBA 1U9IA 3USZA 1GCIA 4NOJA 1F5NA 3RO7A 1RKUA 1EX1A 1N75A 1FX0B 1GYPA 3CH7A 5A3JA 1JU3A 4IDCA 1T0BA 3NIWA 1P5ZB 2X0IA 2RAUA 4FHDA 5K0BA 1L5SA 2NUAA 3EOBI 4NJOA 3FTDA 1X7GA 4CEIA 2PT5A 2MINA 3B13B 3BXXA 4MVJM 7YASA 4DEXA 1TM3E 4XW2A 1R5JA 2VJBA 1YQWA 5CVVA 4WFJA 2BKLA 3ZE6A 4QDOA 4X1KA 4ZQEA 2E48A 1ZM4A 3HVRA 4DLPA 5AVXA 1N0UA 2HXGA 1FYVA 2CJXA 2NWQA 3DE4X 2PKRA 3OCYA 3OT4A 2FW0A 4TVBA 3WZ2A 5A4DA 1E0JA 3HXMA 2B1JA 2QE7D 3QOWA 1YJBA 4C0BA 1HT1E 2V7BA 3FROA 2FEXA 3EC2A 1TLTA 1KI6A 1SU7A 3KWLA 4ND1A 1QGOA 1M34A 3G3EA 1GR1A 4POAA 2PX4A 2LD4A 1UEXC 4HUQA 2XWBF 1YQEA 5BXYA 3LY5A 2YZ7A 3K20A 3CX3A 4RABA 2A9VA 4PR0A 1HDRA 3ANTA 1O9GA 5ENDA 4CR8A 3AW8A 2APJA 2QSJA 2GF2A 3QTBA 4KEAA 4DTCA 1UMDB 1KI1A 2IDJA 3IDSA 3PX7A 2YW2A 1S2IA 1T91A 3BE6A 3TSZA 5I3ZA 1P7WA 4O08A 4WA7A 4TWZA 1DWPA 3G23A 4XM1A 2GSWA 1XEFA 4IZIA 8ABPA 4ZALA 2HK7A 5FHQA 4Q7MB 1ISRA 4LJ4A 1QHXA 2ZUFA 2HCJB 3M6IA 4EYOA 3GVCA 4MYUA 4WBSA 3ZCPA 3TRHA 1ZUWA 2G1KA 4OAOA 2W9XA 5H9WA 4RCYA 1N2GA 3SE7A 1BU8A 3UXHA 3VR1A 1G3UA 1D2EA 1AIPA 3OQIA 3UMGA 2R85A 3V4RA 5IJ9B 4D4IA 4KJZA 4WOPA 4D4GA 1I7NA 2X6RA 4EB8A 1C7JA 1LW6E 2A0YA 2JFUA 4WE3A 4I6GA 4A6EA 1X6VA 5LJIA 2DXIA 2QQ5A 1CTQA 1GNQA 1YMVA 2ZIVB 3DGFC 1RW4A 2Q62A 4P33A 3G8DA 3KYDA 3KJNA 5LDGA 2H1FA 3RVOA 1WXGA 4XIJA 1GGJA 3UF0A 5A6SB 2VLBA 3OFSA 3SFVA 2O4CA 4TLAA 1TCAA 3KAPA 2XA1A 3BTSA 3DMYA 5H02A 3HFRA 1NHGA 1C9MA 1LF5A 2CFSA 4XIYA 4BNVA 4HXGA 3L7JA 3RQSA 4NONA 2XMCA 4OX9B 5F73A 1STOA 4MLPA 4TQAA 4K3UA 2R8YA 1YKSA 4H6XA 4FE7A 4IIUA 5DT2A 4BE7B 2Y8EA 4P82A 3ZGLA 5JUWA 2DERA 1DCFA 1GZ4A 3RYIB 2LDXA 4Z0TA 3USCS 4UXJA 1GWNA 2CLDX 3SEFA 3THWA 1XQVA 4XSHA 2BW0A 2PQ6A 3E18A 3AY3A 2HMWA 1OD6A 1Q3TA 3CUKA 3N53A 4N54A 4E5DA 2ZULA 1R6XA 1LC3A 5HE9A 3PJRA 2GEKA 3HFGA 2G5TA 1SBNE 4H7EA 4UU1A 1YBAA 1MEJA 3ROEA 3VYWA 4ZDKA 1NP7A 1XN4A 4Q3AA 4MYRA 1XTSA 2DZDA 3Q1LA 4ZK6A 5IC4A 4NBWA 3SR4A 1WTAA 2GJ9A 5K01A 3SFZA 3AHCA 2XZLA 1LBHA 1I4LD 2JIZD 3KTDA 2P2CA 3O3CA 1YZNA 2GPAA 2NZJA 3BCUA 3DVSX 1DMRA 1ZBQA 4AKSA 4R2IA 1EMDA 2VUHB 3EY4A 3QWBA 2ZB7A 3B7WA 4RAOA 2X4LA 4YJ3B 3RFXA 1MABB 2P2ZA 1I6KA 2PAAA 2JL1A 2IXGA 1WPQA 2NO4A 4B4DA 4EI8A 4RGQA 3KOZA 2HJVA 3P7MA 2AFIB 3N28A 4L8FA 4DNPA 1YVEI 2H1LA 4FJ2A 4MPPA 4J1TA 3LVFO 3T7KA 1V5FA 2WU8A 2YNMA 4L02A 3E03A 1HG1A 3EYAA 2AFHA 1R9MA 2FSFA 2F43A 5KCMA 1CUCA 2AA3A 2I7TA 1D2HA 2O8CA 1RXEA 1IE3A 3JV7A 3I6MA 2NQ8A 4AG3A 1EJ0A 1ZICA 3C24A 3ETLA 3NOQA 3ROFA 5FI5A 1YD7A 2V6BA 4D9JA 4YRAA 4C1NA 3QVOA 5DXAA 4J91A 5COAA 4UPEA 3IIIA 2H63A 4TWIA 5COQA 1JZTA 4HYTA 3HPRA 1VPWA 1I2ZA 3DAPA 3DHNA 1HH4A 4J8PA 2PQMA 4Y8VA 1BE1A 4CKCB 3OJFA 1UBOS 1SQGA 4DEVA 3BGDA 1N25A 4AUEA 1HOTA 1Q1GA 3S8MA 3EGDB 1L5MA 1E2KA 2HLDD 5FHRA 4YRIA 4YRDA 3SQDA 1EA5A 2FWPA 4KB5A 4MGHA 2QMQA 3MRTA 2VOEA 5TS3A 3WY9A 3N7UA 2CB0A 4EGAA 5ITZB 5L4SA 4MARA 3SAJA 4RK5A 4RK6A 5JNRA 1H9AA 2MT9A 1REQA 1ZOPA 3D2LA 4R2JA 1YRAA 4PS1A 3WLEA 4JEMA 1XDWA 1R0WA 1G5QA 2WWHA 3LBNA 1NRIA 5ALIA 4EX7A 2PLNA 1ODLA 2XGOA 1E6MA 3HBLA 4RZ3A 1Z4OA 1R15A 1TCVA 4QYTA 4AKHA 3LUBA 3OC6A 4LTMA 4BO8A 5HM8A 1UDBA 1QGZA 3TUJC 1NN5A 2IZZA 4RY8A 2VYCA 3I6QA 3T61A 1Y48E 1KO4A 3P26A 1VLHA 3TKYA 4ZOBA 1GRCA 3EXIA 3M82A 3ETGA 2IYRA 3EYWA 3I1JA 3O8QA 2ZU6A 3T7IA 4EG5A 4MLZA 1MU0A 1EINA 1DKLA 2HXYA 2IGBA 1UWLA 2SBTA 2WILA 1UF9A 3K1AB 4UZSA 3UN1A 3OJXA 3JAWA 4M8NE 4BQOA 3LVRE 4O4HA 1SD2A 2VUUA 2Q3JA 4LXGA 2IEIA 3SVLA 2W8BB 3ZH9B 3V4SA 1OW3B 3K71B 3S2ZA 1NJ8A 5C81A 1JG4A 4YIHA 5AI0A 5B58C 3TLEA 2ZE6A 2BGMA 2AOTB 1TTHA 3QENA 4EF4A 3HA2A 3OZXA 5DISB 5DB4A 3A1FA 5LP6F 1TTQB 1BE8A 2O06A 1XJ5A 3D43A 1MOSA 1ORWA 1RBZA 3P9XA 4E1VA 1D6MA 2GPYA 2IZ7A 2QD5A 4IIEA 1JG1A 3SIXA 3IODA 2MWMA 2POCA 2EG5A 2OTCA 1KZ1A 1M0WA 3NDJA 5BYJA 1VFNA 2BFBA 4HDMB 4TV8B 3FMGA 1E8MA 3SF8A 5B4VA 2AZDA 1OYVA 2JLRA 2QPAA 1Z7BA 2WK1A 3WDLA 1RRFA 1I7DA 2ZBVA 1T2AA 3RW9A 2WVHA 3DO6A 3U7HB 4H3VA 3KQMA 1DAMA 4CIXA 3NUQA 2ASEA 2ZU0C 1NOIA 5BNTA 1JLHA 4E1BA 1NXXA 1HKHA 4CMEC 3STVA 1JPJA 4L8LA 1OYYA 4F8YA 5C8YA 1FFYA 3IRVA 3N76A 1OFIA 1KI3A 1WDLA 3FPBA 2FCRA 1XO1A 1JB1A 2YXEA 3MXTA 1QU2A 2YC2C 1OJ7A 4OQYA 1AUPA 1LS6A 1R6UA 3ROZA 5I7WA 4P38A 1NXSA 5IK2A 421PA 4FE4A 4OHVA 3CBQA 4O4LB 3I01M 4K86A 5J1SB 1XZPA 4ZI7F 3ICOA 2PR2A 2WQ7A 2UYCA 2HCBA 2JRLA 4JDPA 4RAQA 2HWUA 4B0PA 4COOA 5BSFA 4K81B 2JAWA 1N2SA 4CDRA 1B6SA 5DJ5A 3H9CA 1KQGA 3ED1A 1BCSB 3WXMA 2QRKA 5J3JA 1AQYA 4ZOLF 4PPFA 3T99A 3IUJA 5L3QB 4A82A 1AUXA 1JT2A 1L7BA 1RPAA 3TTVA 2I8CA 1CKEA 2OVFA 4J1NA 4D02A 4OGGA 4WLFA 4RKWA 5C52B 5CFQA 2E9SA 2IP2A 1RXCA 2IYVA 4XYBA 3V32A 2XLBA 4FCWA 3PGJA 4MTCA 4HQ0A 2WWFA 5AVOA 1UQTA 4CQMD 2UZAA 3EA0A 2QRVA 4EO4A 1XDBA 2FMUA 1PJLA 1Q1EA 1QGAA 3O4JA 4EGFA 1CY1A 1H2XA 2ZM5A 1YMUA 1BGXT 3A7DA 2JPDA 4KTVE 1K08A 1T4DA 2KB0A 3ACBA 4MRVA 1DO8A 4LV6A 1YK0A 1ZR4A 1C4OA 1SIWA 4CMIB 4OXNA 3BULA 2WYWA 3CZPA 4ND5A 4YAEA 1EQAA 1K89A 4AYXA 1M10A 4RPLA 5CT6A 2YRWA 3M9XA 3TMAA 4J6EA 1YC2A 2Z2ZA 1VE6A 4PQRA 3AFMA 2QGFA 3OZ7A 4CV0A 2EBHX 5T3YA 1K92A 5J63A 1MEOA 1ZUIA 1VI6A 1MO2A 1HZJA 2YWFA 4CPDA 4CM6A 4EHLA 3PGA1 2IFTA 3HRKA 1MCZA 3JXEA 1A7AA 4NECA 3CE6A 5DYNA 5TSDA 3FCUB 1M7BA 3T9CA 1F8GA 3HRIA 1YS1X 1RTTA 1KEEB 2LCIA 3CUUA 4S12A 2G72A 3LKBA 1UDAA 4OKIA 4JEUA 1T3GA 1ZMBA 4LHWA 5AKJA 1Q2XA 4GI3A 1TGYA 4ENWA 4IQFA 5JXHA 1ZJZA 2DR2A 2GM4A 3DZIA 1CNEA 3UK2A 3BA6A 2XSZD 3W2EA 2JZCA 3INGA 9LDTA 13PKA 3LC0A 3PNQA 3C8DA 5IDYA 1WEKA 3PE6A 4DRXB 1VRCA 3RBXA 6NULA 2ZSBA 5E6RB 1P29A 1ZM7A 1KJJA 1VFPA 4PFJA 3HHPA 3PPVA 3I37X 4XM0A 3GLFB 521PA 5U4XA 3ZCQA 4LRTB 1OZGA 4K9MA 2R7LA 4N8EA 1EWKA 4YAOA 2OFFA 3GYGA 3U4AA 2P6RA 4LRQA 2YHBA 2ZDGA 3M5WA 5DX8A 3VZQA 2ORVA 4KQIA 1PKXA 4EBFA 4FXPA 4HYQA 4KQ2A 2TMGA 2VK2A 4D97A 4YP1A 5K7SA 1TZMA 3LMKA 1PR4A 4G0MA 2WBLC 1X1QA 1FLNA 1MH9A 1WUJS 3B12A 1G21E 4Q6WA 3IAS6 4IEEA 1PDOA 2QRHA 4JHLA 4AD8A 3KX2A 2PY6A 1PD0A 3AY7A 5H4GA 1GQSA 4D92A 5A7GA 3E9ZA 3CN7A 3ZQJA 1LNZA 1RYFA 1MORA 4KVAA 3JR7A 3IXMA 1B4DA 4GMGA 4DCVA 1L0BA 1CY0A 4G24A 2GESA 4FFOA 4KQFA 2OD7A 4KQ6A 3ZE0B 5KYWA 3GZ4A 5G1NA 3M5CA 4WIAA 5AW3A 3H0EA 3PFNA 4ZZ0A 3S99A 3GEGA 1USGA 4JT9A 2V45A 3AL0C 4ZCTA 2BFFB 2OMKA 2XCUA 3PE3A 4S24A 5HS6A 1FF9A 3FI0A 5M34A 4PYKA 4HWRA 2XGGA 3NCTA 2AJBA 1CZUA 1PJRA 3DEAA 3FN4A 3H87A 4GZ5A 4RPJA 4DF3A 5KZMB 1JLMA 3KBOA 4I1VA 1ZCFA 4RVHA 1HUQA 3L7AA 4Y2HA 4WUTA 1RHRA 4G84A 1D1SA 1O9HA 3O2NA 1AVTA 1FL9A 2PBFA 3A9UA 2ZYVX 1P17A 4EY7A 2VYNA 2Y1XA 4M21A 4MPTA 4N12A 1KFKB 4D41A 1R4MB 5L9AA 3QVLA 2UYQA 4QEKA 2FRDC 3PQFA 2Y1CA 2VNIA 4U3JB 1HFJA 1CUWA 2AVNA 2P6NA 2XTZA 3P9RA 3R5JA 3V1LA 4QBKA 1WVMA 4N5NA 4NPHA 1NVAA 1X80B 1U0EA 3DKIA 1HM5A 4KQEA 4MHOA 4AS1A 2ID9A 4EA6A 1NBAA 4UDYX 4DIFA 1W1WA 1KU6A 2C2HA 4YJFB 1LDYA 1UWVA 2I2FA 5HGJA 3TI7A 4C20A 2EAUA 4PO1A 5I8ZA 1KDVA 3OOJA 3GLTA 3QUBA 1T15A 3LX4A 1BRTA 1KJWA 2IYLD 3CRMA 4FZ5A 4CLOA 4ARUA 4NBVA 5D8DA 1X92A 5IEBA 4JI3B 3O7WA 2OLJA 2QEQA 4A15A 3W8FA 3MCZA 2P65A 3LJKA 1PKEA 3D64A 1TJNA 4BNIA 1G7TA 4Z4IA 1JHMA 4EEXA 3JQFC 4OEHA 2P9GA 7REQA 4R2XA 2WP0A 1FFGA 1CEYA 4R5MA 4M9QA 3HYNA 2DPXA 4P7KA 2FZGA 4ETMA 3SICE 1PZHA 4BUJA 1COWD 1GNVA 3HNPA 5KSYA 1GV1A 2FPGB 3CSSA 4G67A 3EW7A 3RHSA 5BR8B 3BEDA 3KZOA 1DLJA 1RHMA 3JRNA 4UARA 1R18A 3P5BA 4YJGB 4XM2A 3QBDA 4KX5A 3A11A 2NAPA 2BMAA 4KKVA 1HF3A 4CKBA 5BN3A 3MOGA 4FYPA 3Q0EA 1MJGM 2DHDA 1P2SA 5EXEA 5HFNA 3RK0A 1T6BY 5K3CA 4KMRA 4TTAA 4H18A 4W5HA 1YC5A 3FIJA 1UQRA 1P7VA 2OGUA 3E3AA 3NYIA 4L16A 4B3XA 4HX9A 5B36A 2DH6A 5IZ4A 5JALA 4MQ6A 2EVWX 1JUDA 1KRHA 1C1XB 1OR8A 1ODKA 3TM5A 1HPLA 1PX2A 1P80A 3ND5A 4HNGA 5AXAA 1I1NA 1SVKA 2YX1A 3TD6A 1UANA 3O9MA 2GDZA 4YH1A 3O38A 4DCNA 1H1LB 5KYYA 2CE2X 3L0CA 5TGTA 1HOXA 1U2QA 2HF8A 1XP8A 2I3BA 3KAQA 3PTLA 4QQ8A 4KSYA 3RCBA 3RVNA 2NXJA 4EGCB 5I45A 1EK6A 1I1OA 1DCTA 4WOBA 3ZV4A 1DO2A 3CCBA 5HOQA 2BM8A 2XBUA 3TIFA 2L0XA 2XUIA 3D3JA 1WXEA 1KERA 3H5OA 1AOXA 3N7AA 4P5EA 3WIVA 4MGEA 3K9QO 4ZODA 4X64B 2V7VA 3OJCA 3ON5A 3SKVA 3ICQB 4I5EA 3MJRA 4RZ2A 4ARIA 2P3OA 4J0QA 4J9VA 1YE3A 1TK9A 1ZNYA 4NC9A 2DFNA 2WA2A 5TC4A 3TRKA 2I6UA 3E2MA 3GJ8A 1M1YA 1GZVA 3AQ4A 1T3LA 4FMCB 3QELA 4F11A 1L4HA 3KEFA 5CAEA 5KVSA 4CGZA 5FFNA 4Z1MD 2OCDA 1GUDA 2GB4A 3X1DA 2VK1A 1LQUA 4NBNA 4QT0A 2WWIA 3QG5A 1MB2A 4PQEA 1RE1A 1U4NA 1CY6A 1KJYA 1XDGA 4Q5IA 3Q40A 3KE9A 3V4ZA 1SEPA 1CVRA 4YMGA 3BB1A 1J2EA 3T0GA 5BV7A 2B3DA 4TOIA 1J7JA 1LBEA 2X6QA 4FFPA 3H4MA 4GPEA 3C1TA 4PQYA 1OXTA 3L9XA 4DGSA 2DSTA 3QY0A 3NC4A 4M8LA 1HSOA 4UHCA 4KDFA 3ZZ0A 1U0TA 4C2AA 3EGXB 3PJEA 4E7OA 2ZZNA 2IT1A 3MMNA 3QNUA 2IU0A 3VTFA 5AIBA 3MWDB 2Q5OA 5EEHA 5FUVA 1JEAA 1Y7HA 1Z15A 3LZDA 4J49A 3O3OB 3OWHA 4UMFA 5CT5A 5IARA 2I6QA 1X14A 4AG5A 4QUHA 4L6IA 2IYYA 1N0HA 3TGPA 1XCOA 2JBAB 1B6GA 2CXQA 3VPXA 1CZKA 2JFVA 4IFBA 4XPIB 2PS9A 1C4XA 5TGZA 4PSVA 1YJAA 2PSDA 4OD0A 5KVAA 2C7PA 1ZDMA 2FEWB 2NVUA 3TLGB 2ZYGA 2D74A 3CKYA 3EZLA 1MO5A 2PZMA 2Q9AA 3DTNA 3HDVA 1A71A 4MKRA 4M1MA 3GOHA 4RVOA 4WASA 4MA4A 4EZBA 2NAFA 1R5NA 4JJ8A 1TO1E 2B8WA 2JFGA 4IAOA 4IGIA 4LRXA 1BS9A 5A7HA 4JASB 3O8OA 1W88B 1T0UA 1QMPA 2QTTA 4JI8B 5REQB 1EWYA 1NDUA 3FOAA 1ZIOA 3M7IA 3H8VA 3VR5H 1DAPA 4DMHA 2ZIWB 3U6KA 3IBCA 1IULA 1UPXA 5AO9A 1IATA 1UMKA 2QMUA 3ORQA 3T5TA 3G88A 3KJZA 1J22A 1Y34E 2E1RA 1SOVA 4XB2A 2C07A 1SOMA 2O14A 2ZYHA 1ZSYA 3O3MB 5JISA 3EFEA 1ZMRA 2Z9DA 4FMPA 1DADA 2D4AA 4WKCA 1DC7A 1J8DA 3OEHA 2FTKE 1JGTA 3DVAA 4EKGA 5KSPA 5GMOA 2ZUWA 3CLRC 2E18A 4NZZA 1ZOIA 4LPSA 3WHKA 4CM8B 1E2IA 3U26A 4BFSA 5DLEA 1I32A 2D2IA 3KVNA 5E2IA 1B00A 3OESA 3PC8A 2WAOA 3OCCA 5BQPA 2OFXA 3IHLA 4QGBA 3ASVA 2QJTA 4PPGA 1EEHA 4OMFG 1DUSA 2HJ9A 1U1CA 2JJ2D 2WWGA 4UBIA 3UMFA 3WMWA 3WQBA 3FM9A 3KLMX 2JCSA 2CNOA 4NCBA 2YUTA 3BTUA 4B7CA 3TJZA 4F5YA 2WUFA 1LGYA 2O0LA 1T9GS 2PRZA 1KWKA 3ZY6A 4YRPA 3T41A 3C97A 4WW0A 3AK4A 4POOA 2QHXA 1N8NA 1NDQA 4BLPA 4PRLA 4KHZA 1KETA 4R9RA 1MC8A 4JQCA 2CLEB 5JJBA 2H2WA 3K32A 2B1GA 4P2GA 5MN5A 2XB4A 2YJZA 2RGCA 2ZBUA 5DIFA 3EZGA 3AG6A 1R10A 3ZK8A 4DLVA 3L0YA 1C3EA 1M8GA 2OUKA 5I6DA 3HE3A 1BVHA 2Y05A 4QNNA 1E9AA 5K6TA 2NW6A 1Y6ZA 1QCZA 2VEDA 2PGOA 4FP9A 2XB2A 2VHVA 2CL0X 2HF2A 1M34E 1VSBA 3CPSA 3ZC3A 2AN9A 4WXRA 1GNRA 1VL2A 3IR6A 4MB0A 1JIXA 2TMYA 1FVFA 5KNBH 1BWQA 4HNAB 3KKNA 3MK31 3PVSA 4MIYA 1Z4JA 4PG4A 5J2UB 2HHLA 3GN2A 2OCPA 1M1ZA 2AG5A 4ND6A 2J5BA 4ABYA 4I1PA 4MEAA 2VBIA 2IOHA 3BJRA 1ZOSA 3BQ9A 1L2TA 3JQQA 1NKSA 1V25A 1XR3A 3CTPA 3PUIA 4WOJA 4Z54A 3WRXA 1SMKA 2X1LA 2NO5A 4MV8A 3DFKA 1X19A 3ESRA 1JILA 3LY7A 4P1ZA 4R16A 1P4RA 1F60A 4KBYA 3OQHA 3MT7A 5FNZA 4NQZA 5T8KC 4OUDB 4P98A 5AKGA 1GQFA 4U5QA 2M6LA 4DMFA 1NVVR 2FFHA 5F7OA 4D42A 2CVOA 2I6GA 1OXMA 3M6VA 3TNFA 4ZCIA 1DRJA 1J1UA 4QUAA 4DMLA 4K3VA 1CJUC 1NBOA 4XJTA 5AHWA 1D07A 3F3MA 2IU3A 5AVWA 3OCWA 1BKYA 4ZQHA 4W5QA 3N2NA 1IHUA 1K7SN 3QE0A 1HKUA 2ONCA 1Y3AA 1LZKA 2QDXA 3OQPA 2D0PB 3UYLA 1LEHA 1YR6A 3SZGA 5IX8A 4D6PA 3BD9A 5JYCA 1NOJA 4R9SA 1H2FA 3IP6A 5AKEA 4BAUA 1CRWG 2RGAA 3FYSA 5C1OA 1ZWLA 4GMXA 5EXSA 4LECA 3IO3A 1XZFA 3F7MA 3JS5A 2IUYA 3OM9A 4JZKA 3OEED 3WGKA 1SAYA 1H9BA 2C31A 3EXG2 2B6NA 4UEQA 4DS3A 4GPZA 4JVSB 1FW6A 2IPAB 4FJ1A 2FVYA 3DDCA 1U5AA 2YMLA 2NU8B 4E7PA 3D02A 3PIRA 3KWMA 1KMHB 1II0A 1LRKA 1RRMA 2FFRA 4V0QA 2YOFA 1E3DA 1PIWA 4WCFA 1GZHB 1IOVA 4DZRA 3ONEA 2BFPA 3UC5A 2IXEA 2H00A 1E9DA 2HJRA 2ISQA 3TW8B 2GHRA 1M2EA 3FNHA 3KR2A 3LF1A 4TKLA 4F5WA 2WF5A 3N8DA 3SBEA 4HF7A 1AHPA 1D5WA 1OFTA 4NPCA 1A1SA 4XIGS 4BEWA 2W2NA 1JA0A 1K5DA 1TE2A 1HXHA 1O58A 2GKSA 3AOEC 3ER6A 3PGXA 4TX1A 4US1R 4W63A 4X65B 1W48A 2YL2A 3KSMA 1HLFA 5LQAA 3PI7A 1GQYA 4YHHB 2IU4A 5HKKA 1X7XA 3DFZA 3R6GA 3JVUA 3RIXA 2NG1A 5CA1A 3I8SA 3CUTA 1JEOA 3JQGA 3PQEA 1K1EA 3JQ6A 4I1SA 4Q7EA 1BVRA 2VJMA 5FTMA 5AESA 4GE3A 3TMYA 1U1GA 1IAQA 3V2IA 3R3HA 3EXHC 4JBHA 2GTIA 4OAQA 3DR3A 4MKFA 1JHYA 1ZA1A 4DLTA 1DCMA 1JEDA 3FH0A 5FUWA 4DC9A 2YQ5A 2WR8A 2HMUA 3SHVA 2WHPB 3P96A 1DTWA 2VYFA 3UJHA 5JCOA 3ECSA 4IZHA 3V8EA 1AKQA 1JECA 1PK7A 1PFWA 2I87A 5D3ZA 4ESVA 2W4QA 4MP8A 2P4SA 3WIEA 4P81A 1WW8A 4S0XA 4AMVA 1ZEJA 4GOND 3WNCA 5ARBA 5KOYA 2VBFA 2PANA 4IG4A 1TU4A 1XDDA 2NOAA 2R60A 3OO0A 5GZ6A 1GEEA 3HZOA 3VISA 2IS6A 1QRUA 1PSDA 4MQEA 4EYQA 5BWLA 2BUAA 1U81A 3COZA 4P7GA 2PKEA 4AJLA 3PYMA 3V7UA 3L1JA 3O1JC 3H1TA 5FWXB 2O1SA 1FXWF 3I0NA 2AFHE 3P9YA 4AJKA 1M72A 2C5BA 3BIFA 3X2FA 1DEXA 4PGMA 1I3CA 1WAMA 1ZOOA 2ZWPA 3ZBQA 2XIJA 1VMDA 4BFXA 1K6EA 1I8TA 1JKJB 5IZCA 3VPGA 1J00A 1T8RA 2CVHA 3OZRA 3P0RA 4I14A 1T5OA 4UU0A 4JLBA 2AMJA 4IFTA 4OLBA 1NXQA 3LO5A 1RC8A 2O8EB 4E4YA 2R1VB 4YAGA 2FOLA 2B5OA 5G4LA 4AY2A 3WE7A 3WGUA 4TLEA 4RQAA 5F4BA 4CYMA 1JFTA 1YRBA 2R9VA 1V43A 3BJIC 2GHQA 2IE8A 4QYXA 3UQYS 1YHZA 2DBZA 1Z0FA 3HWSA 2ZCVA 4INPA 1DS6A 3RAJA 4YAUA 3LP6A 3GVXA 5TDHA 3VNBA 5D00A 5CA0B 4LTNA 4D2IA 4ZU1X 1Z29A 3EGIA 4GOJA 2CDCA 3IHWA 3WGQA 4MMYB 1Z88A 2O8VA 2WTAA 4HDCA 4ZEWA 3V8BA 1SKYE 3G9ZA 1TEVA 1ZITA 3QF7A 2WD8A 3MILA 1EX7A 4Y2TA 5EJ5A 5F2KA 4BNYA 1P6QA 1K8YB 1WSDA 2WKSA 3PDIA 4ML3A 3WGMA 2IXAA 5IBRA 3I72A 3PXGA 1CFJA 1FXSA 4R83A 4QYMA 1W36C 1HMYA 1OREA 2GARA 4K1LA 3RTAA 2AK2A 4Q4CA 3H4IA 1DAHA 3L8ZA 3AZQA 2RH8A 4FEGA 4GF5A 5SZIA 1HE4A 1U9ZA 3N2KB 3I92A 1Y8QA 4KNYA 1ODSA 1CUVA 4Q21A 2VUSA 1YA8A 5EIHA 1B0ZA 1V95A 5ITVA 3K0BA 1VHDA 1BKSB 3NEAA 3RBZA 1KOGA 5EZYA 4NVRA 1F5SA 2VYQA 4LNHA 4BLTA 4JXKA 4ZTBA 1MG5A 3L6RA 2HT6A 1JEEA 1J9EA 2BP7B 2O20A 4B3FX 4NE2A 1WXDA 1ZHFA 1BXRB 3LBHA 4F1WA 5KX5A 2OXRA 2X42A 3AI1A 1A50B 1I51A 2BEJA 3SR0A 4KIFA 2YBEA 4NDNE 4DA8A 1WW3A 2CMGA 1CUEA 3LGSA 5LMZA 4XGQA 3THOA 3A6DA 4IIJA 2HA5A 4DMUB 5DEOA 1AF4A 1XKXA 2AZMA 1KU0A 3WB1A 4KDCA 1WNTA 3LUFA 5E9WA 4AAYA 2YDXA 4II7A 4PTLA 1JIKA 1H4QA 3AUAA 4AN4A 4B35A 4C4RA 3QIAA 1R8QA 3ZWMA 5DM2A 3C3PA 3GJ3A 1EWRA 4MPJA 3ZZTA 5KOJA 4J0JA 1SIBE 4KX3A 3R3SA 4ND2A 4US0R 4JJIA 1W5BA 4O5OA 3JPWA 4GYYA 1A5TA 1A77A 3GLIB 4FGWA 3L8HA 2ZCJA 2O2GA 2P91A 3F96A 3O4IA 1SUIA 2INGX 4EW2A 5ALRA 1MW9X 2VF8A 3IC5A 2GPBA 2O8DB 5FPKA 3SU8A 5A4MS 1ZD2P 2FN4A 2JDID 2EYUA 2C2WA 2YWCA 3KQUA 2NO6A 1OKKD 3K15A 2FQXA 1RWOA 4ACBA </