2C9ZA

Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
451
structure length
438
Chain Sequence
b'TNPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHTMQCNIKSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
publication title Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Transferase
total genus 154
structure length 438
sequence length 451
ec nomenclature ec 2.4.1.115: Anthocyanidin 3-O-glucosyltransferase.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA02
3OT5A 2VSNA 1IIRA 2YJNA 3CUWA 2R68A 9GPBA 2SKDA 4FKZA 3DZCA 2XCIA 2GPBA 3OTHA 2R4TA 1C8KA 1PYGA 5GPBA 4N39A 2P6PA 3OKAA 3T7DA 3G2HA 4CTOA 3ZCSA 3QKWA 3CEJA 3D1JA 4X6LA 2QRPA 4BQFA 1L6IA 1V4VA 1P4HA 5ENZA 1L5QA 2JLBA 3E3NA 3OTGA 1FTQA 1L7XA 5TMEA 4RENA 2BGTA 3T3IA 1QKJA 1HLFA 2QRQA 4MI3A 2AV6A 2AW3A 2QN1A 2X0FA 1EXVA 4CTMA 1K08A 2X0DA 2FF5A 4XIFA 1GFZA 2XCUA 3BCSA 2QLLA 4N9WA 3T5TA 2G9RA 2GEJA 3VUFA 2XGSA 5IKOA 4PQGA 2X6RA 1WUYA 3PE4A 4F97A 1PN3A 2VSYA 1Y6FA 8GPBA 3T3EA 4AMBA 3L01A 4KQ1A 3GUHA 1P29A 2BGUA 3IAAA 2IYAA 1Y8ZA 3QHPA 4NEQA 2H1FA 2GJ4A 4MHOA 5JTUA 2QN8A 4Z5XA 1SXQA 2KS6A 4MI9A 1GPYA 1GG8A 2G9UA 2BFWA 1XL1A 3GPBA 4MRAA 4AMGA 2XA2A 3T3HA 3MTAA 2C4MA 1C50A 4AY5A 1FU8A 1YA6A 1P2GA 4RIGA 1P4GA 4KQMA 3SYMA 4X7MA 1L5VA 4M7PA 1VGVA 1C8LA 5DLDA 4MI6A 4N3CA 3OY7A 4GZ5A 3MRVA 3HBMA 2R4UA 4EL0A 2ECPA 3NCHA 4NESA 4GZ6A 2IUYA 3NB0A 4W6QA 4HLNA 3Q3EA 1M5RA 2QRHA 2PYIA 3ZCTA 3BDAA 2QLMA 1Z62A 3DD1A 3CEHA 2F3PA 4EKEA 3G2IA 3RT1A 3S28A 2ZB2A 3HBFA 2XMPA 3C48A 1JIVA 1GZ5A 4MICA 3NP7A 1RRVA 3T3DA 6GPBA 5BNWA 4CTNA 1ABBA 3WAGA 4EL5A 5LQDA 3L79A 3MT7A 3BD8A 1JG7A 3CX4A 3L7BA 2Q6VA 3Q3IA 4FZRA 1L5RA 3G2JA 2SKCA 3TSAA 4WHMA 1NOKA 3CUUA 2QRGA 4AY6A 1A8IA 5HXAA 3BCUA 4F9FA 2H1HA 3O3CA 1P2DA 3NC4A 1FU4A 4EKYA 1E4OA 2GPNA 3S27A 2X6QA 1C3JA 4M83A 3EBPA 3IA7A 3OTIA 2XGOA 4QLBA 3WC4A 1LWOA 3UYLA 2R66A 1H5UA 2ACVA 3G2NA 2C1XA 3ZCPA 2XA1A 5TMBA 3MTDA 1RZVA 5JTTA 3ZCQA 2F9FA 1NOJA 1FA9A 2F3SA 1PSWA 2GT1A 2VG8A 4GYYA 2JJMA 2GM9A 4F96A 4BQEA 4NC9A 2GPAA 1Y6GA 2SKEA 3DDWA 3T3GA 3OY2A 3MTBA 3Q3HA 1GGNA 2ASVA 3EBOA 3NPAA 3MS2A 3RSZA 2QRMA 4KQ2A 4BQIA 2PQ6A 3UYKA 1KTIA 1L5WA 1WW3A 3RSCA 1FTWA 4X7RA 1FTYA 2QN7A 3MRTA 5DXFA 7GPBA 2QN3A 4RELA 4GPBA 4YI3A 1FS4A 1NZFA 3C4QA 3NAZA 1F6DA 1J39A 2PYDA 2QLNA 1XOIA 1JIXA 3VUEA 3CV3A 3OKCA 2X0EA 1AHPA 4N3BA 1JEJA 3MQFA 1XC7A 3MRXA 3S0JA 1NOIA 4RBNA 2IV3A 4LEIA 1WV0A 2AZDA 3BD7A 5C1DA 2PRIA 1YGPA 3AMVA 3S2UA 3NP9A 2IYFA 5I45A 2IEIA 1WW2A 3D0RA 4BFCA 2C9ZA 2G9QA 4YUAA 4RIHA 4AN4A 3ZCRA 2R60A 3FROA 3OKPA 3L7AA 4YI5A 3VDNB 3H4IA 1NLMA 4HWGA 2XGMA 1JIUA 3CUVA 3S29A 5D00A 4GYWA 2GEKA 2QZSA 2IW1A 1GPBA 1F0KA 1E1YA 4MHSA 4XI9A 3TAXA 2QNBA 1Z6PA 2BISA 1EM6A 1UQUA 3PE3A 3BEOA 1B4DA 3BD6A 3ZCUA 1XV5A 1RZUA 3HBNA 4WADA 3MT8A 1P4JA 4RIEA 3CEMA 2FFRA 1JG6A 2FETA 2PRJA 4LDPA 4G2TA 4RIFA 1IXYA 3G2KA 2QN9A 2VCEA 2ATIA 5TVGA 3BCRA 1AXRA 1SXPA 1Z6QA 2G9VA 3H4TA 3MT9A 2HY7A 4M60A 4GZ3A 1XL0A 1WV1A 1O6CA 2AMVA 2O6LA 3RHZA 4X7PA 3G2LA 3HBJA 1UZUA 1FC0A 1K06A 3SYRA 2F3UA 5DU2A 2WTXA 4EJ2A 2XA9A 3E3LA 5IKPA 3MS4A 1QM5A 4CDRA 3DDSA 5TMDA 2JZCA 1NZDA 1PNVA 2C1ZA 1L5SA 4N3AA 3MS7A 2ACWA 1NVKA 1XKXA 4L22A 3TOVA 1P2BA 2IV7A 4REMA 3CUTA 5D01A 4WACA 1FU7A 3WADA 3L7DA 1UQTA 1BX3A 1GPAA 3MBOA 1LWNA 1WUTA 3VDMA 3COPA 3E3OA 4RIIA 3CUYA 3MSCA 2OFFA 3C4VA 3D0QA 3ZCVA 2QN2A 2F3QA 3L7CA 2IEGA 2VCHA 1Z8DA
chains in the Genus database with same CATH superfamily
2XYGA 1R88A 1SOAA 2VSQA 1B93A 3EPLA 1KRWA 1H0RA 1J8QA 1PLKA 1FBTA 4KVGA 4DQDA 5KX5A 2O8EB 3KJNA 2HQSA 1JFLA 2Y76A 1ODKA 2A5LA 2JFQA 1AC5A 4PHHA 3V1MA 2QTVA 4X66B 2EX4A 5KQSA 4KR0A 2A14A 3ZW7A 3ISTA 3I42A 3VTKA 4FFBA 4QOEA 3J7AC 2IEDA 2DQSA 4B43A 3HMQA 4EPRA 5LP6C 1BZYA 1MRZA 5JPIA 3WY9A 5HS6A 1PGJA 2ZT6A 3IA2A 1JB1A 4IIFA 3TW0A 3ZD8A 4PX2A 4CTOA 3DFZA 3LKBA 3AP1A 3UQZA 1ZIDA 2H85A 2PX5A 1V7QA 4FYMA 4RKEA 2I3ZA 4MA5A 1DO2A 2NN3C 1G16A 4ZGWA 5U9CA 1RADA 1JS1X 1E7YA 3HDVA 1BCSB 4GT1A 4LY9A 5TRTA 1L7QA 3WICA 1A04A 2QG9A 3NVDA 5FPTA 4KU4A 1OXMA 2YHIB 4G5RA 5LYJF 1JHDA 1H93A 2UUOA 5DPMA 3BIWA 4NQRA 5HCUA 1OBCA 4G0QA 1AKRA 1AKWA 3EQ7A 3BTSA 5EE1A 3P20A 3IVAA 3GXOA 1K6XA 1RM4A 3IYLW 2A7QA 1OH7A 2QI9F 1K7FB 5FI1B 4BMSA 2ZAMA 4LE2A 1YF3A 3E15A 4LHSA 2P2DA 5ICGA 2PH1A 3F49S 4YMIA 3U44B 4TKVA 2X2FA 1S9DA 3R6DA 2EWVA 1JEEA 3AUUA 1T9ZA 3EZ9A 3EYAA 4YGYA 1D1SA 1MNQA 1T1EA 1IN5A 2H06A 2F00A 2O0MA 4CETA 5E9QA 4JL8A 1DKPA 2O23A 4EHJA 3B36A 2XUFA 2WIAA 4RETA 3CTMA 3DLCA 5AHWA 4B8ZA 4EB8A 3PJRA 1W29A 2PZ8A 3LA6A 1VLJA 2O0JA 5K05A 1QTIA 1XTIA 2PQ2A 5AI0A 4E4TA 3LFTA 4IJVA 2VPXA 2JCBA 1R5JA 1RWOA 2IYPA 2JI7A 3WZMA 2R65A 3LRXA 3G5LA 3DC7A 3HYSA 3B8HA 3PGXA 3LU1A 3E8SA 4L5CA 1DC4A 1GITA 4F97A 2QE6A 2W4QA 5EA2A 3QIAA 4JV5B 4ZP1A 2NTVA 4OKNA 1NP6A 1QMGA 4OHOA 2FOXA 2NU8B 1K27A 3G89A 2PUDA 1NKTA 1ZISA 2DSNA 2JGFA 4U2GA 3ZD6A 1CR0A 2RK4A 3NONA 2PNJA 3ZBQA 4FI3C 4CNBA 4EMBA 1GUYA 1Z36A 3GUHA 1KJNA 2WPDA 4BFXA 4KIJA 4FHDA 4KGXA 2YWGA 3PICA 4V39A 5HEKA 3DDUA 1EDDA 1B2RA 3F0TA 3GMSA 4DUYB 1W4CA 2CYAA 1BXGA 4P0TA 3ROQA 3B82A 1DIAA 2W2VA 2QL5A 1Z18A 4D3XA 5T57A 4KB5A 1BW9B 2R86A 2QSJA 3BQNB 5JALA 1SU4A 3MGGA 3EEOA 1EYZA 1KNQA 3UA4A 2VDRB 2II6A 4QOGA 3HDQA 2ZYHA 3ZI0A 1T4CA 4K8RB 1L5FA 1DV1A 4B4DA 3TLBA 3DO6A 1HYBA 2HK7A 1PUIA 3RYHB 3THRA 2BFMA 2OHFA 2W4MA 3T3HA 1CIVA 1XPJA 2YFKA 5D5QA 3GA7A 2DPXA 2F62A 4URWR 4V02A 1MJNA 1XCJA 3HA5A 4ZREA 2JFXA 2C92A 3GPIA 3LQYA 2VJKA 4TMFA 2VYFA 3CYFA 4QUEA 1YL5A 4PONA 5E6SA 5EWJB 4GU5A 4EHKA 3ADPA 4E2FA 3P8ZA 2E18A 4EEXA 2PMCA 4RZXA 4B8YA 1YZQA 1E0SA 1H3NA 5BUCA 1OC4A 3IMFA 4OHXA 1H0HA 4PICA 2WWIA 3SSNA 3OJCA 4CLRA 1FFHA 1PDVA 1V16B 2G8LA 4E2XA 2Z30A 3K0CC 3WLFA 4XQ0A 1B6RA 4UNPA 2Q5FA 1J8DA 3ZHBA 3A3YA 3VYWA 4ENPA 5K9ZA 5CT6A 2B8EA 3FM9A 4PO1A 2FMKA 3GXBA 1V8PA 3CVOA 3WIBA 2D0OB 3ABZA 2J7PA 2QAJA 4WNAB 4AUEA 4NARA 4YYEA 5INTA 4QDXA 4FFRA 3WB1A 1ZYUA 3HJBA 1WBBA 1DRKA 3D6FA 4MQLA 5H83A 3ENKA 3MMZA 4PRKA 3TECE 1EQ2A 2GB4A 2JFUA 4YRQA 1TU4A 3H04A 3H5VA 3KPYA 2DGDA 3Q3EA 2CEAA 3QENA 4M98A 4ZARA 4EQZA 4OUKX 2J5RA 1JHXA 3DBHB 3SFTA 1Q3KA 3KOZA 2O9JA 2C2HA 3RT9A 5DI3B 1X19A 4J7AA 1KXZA 3NIFB 4E2YA 1EXDA 2B9VA 4ZCQA 3G5TA 3V7WA 3OH8A 4WK4B 1KDVA 1EM8A 1J2YA 3OIVA 3RT1A 1IBMB 5JD3A 2EG5A 5TPZA 1MPTA 4R8RA 1HE8B 3WIVA 4PIPA 4J0FA 4OAOA 2QZ4A 2ONJA 1ZBDA 2SBTA 4R7ZA 3KXKA 2XADA 2H0QA 3B2NA 2DHQA 1HDEA 1PEYA 3H83A 3OP4A 3PD0A 3ZWOA 2FWBA 4YUYA 2VJOA 1ABBA 2PUBA 4CN9A 3L4KA 1FFCA 1FFEA 2XCOA 3PPVA 4ME6A 5JARA 1WVMA 3AG5A 3B52X 3LT0A 3M5CA 4DBVO 1T35A 3NJRA 3UJ3X 5D5HA 3AF6A 3U7RA 4ZK6A 2RC6A 4ARIA 2PA0A 2Y71A 3OA2A 1EG2A 3A11A 5J47A 1JFFA 4LJ9A 4PW0A 3I28A 1DXHA 3AETA 4CN8A 3AJDA 3U2QA 1I13A 2V7BA 1JKMA 2X7HA 4FILA 4LF5B 2ILVA 2ISQA 5K01A 3DHEA 1XE3A 2H2IA 3B9QA 3NJ4A 4AD8A 4AKIA 4WXHA 4PZUA 3OCVA 2NYVA 1VTKA 3L02A 3CEPB 5KNCH 5JAMA 4JLDA 1NSFA 1MQSA 4R1MA 4NJOA 2COUA 3DEHA 1L0BA 3MIIA 1YBAA 4H7HA 2APJA 2VDKB 5BNFA 1I30A 1N2OA 1J0EA 1UC8A 3LXUX 3QA3E 4G97A 3EBPA 4WQMA 3HXMA 1AUPA 5K99A 4GKJB 5I7FA 4CPDA 3UKDA 1FP7A 3FE2A 1QVAA 3K1JA 2OFWA 1DKOA 3VNSA 2I3DA 2ILTA 5DN6A 1KI9A 2RAFA 2ZUWA 3E3AA 5IJXA 2CJWB 4AZ3B 1E1CA 3TJMA 1IN4A 3HBLA 4QJIA 1NFRA 3JQFC 3KOUA 1UODA 4ED9A 1KP2A 1GM5A 3IR6A 1DAFA 3KWJA 3KYCA 1KDTA 4GRDA 1VJDA 1T5DX 3HUUA 3E82A 4RV5A 2XA1A 4XTCS 5DYYA 4Y6RA 4FFMA 5TMBA 2BJHA 1IOZA 4FSDA 2HJRA 2XBLA 5I7VA 3EIWA 4C3ZA 1K8YB 1VPTA 4E5DA 3LZDA 3PNOA 1PGOA 3J81A 1ICEA 3I92A 2HCRA 3UCEA 4OSPA 3FN4A 1PSWA 1C1DA 3SPXA 1SBYA 2PPVA 2A0UA 3WV4A 1JLKA 2K4MA 4GSLA 4CIXA 3FPKA 4DKJA 4AP6A 5TQ0A 4Q12A 4BTEA 4I14A 3IAS6 2IHVA 2SKEA 2OK8A 4HWPA 2OG2A 2OSVA 3GT7A 4GLLA 2EAUA 1RLIA 1PGPA 3SBXA 1TEVA 4M1WA 3GMTA 2GXAA 3T0GA 4BBPA 3KETA 2Q6LA 3C7DB 4H4CA 3QFCA 2AYZA 3AIMA 1OJLA 3D7MA 4BQQA 5LZ5A 2WJJA 3OOHA 3BRWD 2OCKA 4IWXA 5T41A 4EITA 3FWPA 2CMHA 4IXNA 5ALJA 4MKHA 3CR8A 4X41A 2A5DA 5CHEA 2OYRA 3EFHA 3UYKA 4HT3B 2EIHA 3F3KA 2IYOA 1UAAA 1TAQA 4G5FA 1WW8A 5IAGA 3SS8A 5AHRA 1N2IA 5AOVA 2PKQO 4UCQA 1ADBA 1KY4A 2EFEB 2R84A 1VYTA 3PQFA 4LNUB 1CF2O 4ZU1X 1GOTA 3IAUA 3V1LA 2PUCA 4PX9A 1Z0AA 3OLXA 4KQXA 2ZBFA 1ZC3A 3TCXB 4KJXA 4CMIA 1GPUA 5KCZA 2WKQA 1M6WA 2OD7A 3VYSB 2C94A 5KU1A 1KAEA 1K5DA 2HPHA 3NG1A 3O1JC 1GNPA 2FPSA 4NR0A 1KMCA 4PFSA 4V3CA 5JS7A 1E96A 5EJ6A 3ZJTA 3MQFA 1LSUA 4B71A 2JLVA 5A5EA 2RH5A 4U0KA 3F9IA 2HA2A 3P32A 5A4KA 1VSTA 4CF6A 5D84A 4C20A 4C04A 5CP8A 2HA7A 5CLIA 1IBKB 3FMFA 4IJ6A 5CNIA 3U4IA 1F2UA 4BCBA 1NR5A 1W4LA 3D8RA 3MPUA 4GWKA 2PSSA 3BWBA 3E9NA 2XOXA 1YGPA 3CIFA 5JLAA 4M9QA 5HK8A 2XNHA 3UKJA 2JJ1A 2IYFA 4DG9A 2YJZA 3GP5A 4L3OA 4LY0A 2ZCUA 2W48A 2H1CA 2NUAB 4EENA 2VRNA 3KM0A 2ID9A 2F2TA 1JDSA 1UPAA 1VKNA 2MYNA 2XWJI 1QORA 3A1CA 4URFA 1ZKMA 3VMMA 4MULA 3KYDA 3W2FA 3M9WA 1N6KA 2NSLA 4BKMA 1NA5A 2ZBUA 4GL4A 3PXGA 3D5EA 4I1SA 2O50A 4IJKA 2WWXA 3R3SA 4PF1A 3SK0A 3WBBA 5HYVA 3A4TA 3ZEIA 2IS4A 1W4BA 4RXUA 2C4NA 4QC2A 3O3OB 3MXOA 3TYXA 2ATXA 4QARA 4B6SA 4GX0A 1Y9AA 2PX3A 1RM0A 4R2LA 3IE0A 1D8TA 4W5JA 2HWYA 3V8QA 1CEQA 3C5WP 4YCAA 3RG2A 3ZI7A 1P60A 2CBZA 4BKQA 1ISPA 1W19A 4PZAA 3A3PA 2WZDA 4ZAVA 1Q14A 1M1NB 3PR1A 1F0KA 2VH1A 4LXGA 1FDTA 2YHSA 1RQNA 1XKLA 2EV9A 1J8MF 3IULA 3VI3B 5CURA 4D8XA 4DY4A 4JITA 3TUZC 3MFQA 2MOKA 3IRVA 2DM6A 3DH0A 2FK8A 4FQ7A 3WA6A 4YCCA 1Y8RB 1P0PA 2XLBA 4TV9B 3MINA 5CBPB 4MRRA 1XZHA 1NBME 2J9FB 2QSUA 3FB4A 4L8WB 4LSWA 1TO6A 2A1TR 1KEKA 1RRFA 1KU0A 4WJKB 1C4XA 3O4FA 1VMAA 2P4UA 1ZD1A 3LK6A 5ALUA 1OX5A 2FPRA 1AQ6A 1VE3A 2B0JA 2QVBA 5BOSA 2ZDQA 4AO8A 4U2EA 4NJEA 4YNBA 2H4HA 3T5GA 3ESRA 2KE5A 4K6FA 3PI7A 3FUCA 4YA6A 1ZOPA 2ZUEA 3A9TA 1C9KA 3DZFA 3MGBA 4O4JB 1JQ5A 1QG4A 1VJGA 3OUTA 1IOLA 4REOA 3TXYA 4AQDA 1AZSC 3DE5X 4JKOA 1PUJA 4D4GA 3CZPA 5EAIA 5GJWC 1MX3A 4ES6A 4BNDA 2L17A 3GL9A 4F9EA 1FX1A 4GRAA 4PSVA 2Q7DA 3ZK9A 5J23A 2VBFA 3QU5A 3VPGA 1DO8A 4AJ2A 5A62A 3K53A 3ZD9A 4D4KA 2CV0A 1PAUA 3K2BA 2PAAA 4W7SA 3MJEA 4TV8F 4NBKA 3H84A 1UH5A 2NVOA 4QVIA 4F06A 3LE8A 2HDHA 1AURA 2O2JA 4DA4A 1IXSB 3E9EA 4P4SB 3C8HA 5B1EA 1Y3BE 2QX9A 3FGPA 3HBJA 4J7UA 5HUQA 1ZHFA 3Q12A 1NWCA 1Y1SA 1XVAA 1NX6A 2Y4OA 3HWSA 3OT1B 3WXMA 4YLGA 1YZKA 6AT1A 4BEVA 3W8DA 2GTPA 4D9FA 1ZOSA 3EEBA 4Q1AA 4A7PA 3HR4A 4C05A 1GDHA 3ORRA 3KYIB 3MK31 3I61A 4WLUA 3B8EA 3F98A 3BE4A 5CDFE 2XCLA 1U2ZA 3A2NA 1Z6AA 4BVFA 4F4IA 2CZGA 5I47A 2A0XA 4OOEA 2OV4A 3P71T 4FZ5A 3V4RA 3CLTC 3ZWMA 4QT4A 4RPGA 1SU8A 1J2EA 1FUUA 3PCXA 2OTCA 1W7AA 2QRVA 3PC8C 4XDGA 1CLUA 3ENZA 4NZOA 4RMJA 2VKQA 3NNDA 4UNIA 4Z0NA 5H0IA 1BWRA 5J1TB 4I3HA 3UUWA 4BVGA 4C78A 4EYKA 1C9DB 4B3GA 4RY9A 2Z9BA 2VT6A 1U4OA 3AJAA 2F90A 3GF4A 3N2ZB 4MQ5A 1JU4A 1ODJA 4DDUA 3WADA 2BSQA 2NLOA 2DPHA 2OCXA 5AJWA 2EGGA 2H2HA 1E4VA 2BKLA 5HOEA 1T8SA 3OZSA 1QIGA 1UBJS 1CBUA 4AU1A 3WAJA 2XE6A 3AOEC 5E9AA 4L6IA 4QYTA 3H7AA 4P31A 1DKUA 2AXPA 4KTTE 4PC3A 5CG2A 2R0QC 4MVJM 2JLUA 2QPOA 2VDWA 4KP7A 1E2BA 3GWGA 2IHTA 1G8YA 5LQRA 3P9RA 2B8NA 1GV0A 2J5KA 3BWXA 4RHCA 1EFPB 2OFFA 5CA1F 5DE3A 5DHAA 1YS1X 4KMRA 2QROA 1NVWQ 4P38A 3AHGA 3T1NA 2FDCA 1DQRA 1G20B 1HV8A 2GMWA 4K40A 5ICFA 3SJZA 1C7QA 2IEGA 1QC5A 5EC8A 2J9ZB 3PA8A 1DWQA 1TADA 4UOZA 4FDAA 1CRQA 5LOVA 3VV3A 1P91A 1QFJA 3CCCA 2H5LA 5I7UA 2HD4A 2CNWD 3LY9A 4P5DA 1QQBA 2E6KA 2ZVJA 1E1QD 2R4TA 4XGQA 3GFRA 3KR1A 3L4BA 1S96A 3Q3GE 4I55F 2A0FA 2WTNA 3PV0A 1ZUD1 5JCJD 5DHFA 2R00C 2ZRFA 3GGDA 5DW0A 2VTEA 4HDAA 2Q3MA 3I04A 4YECA 2Q2WA 4DNOA 3IDSA 1BS2A 4UFPA 1DZIA 1KO1A 2VZEA 2XB4A 4G5OA 1ISIA 2XXBA 3DXYA 3KSUA 3PUHA 2FFBA 5JZ9A 1V1MA 4S12A 4P7JA 4ZA2A 5IAEA 2MYTA 2E4UA 2VYNA 3WV5A 3SSOA 2XUZA 2EW2A 5JSZB 3AXSA 2AI3A 5EHGA 1P4HA 2HZ7A 3GZNA 1Q0RA 1E6EA 3DMHA 4HZIA 1XQYA 4Q7EA 4MUMA 2AEMA 5FNVF 4F04A 3LO8A 1GEGA 4LNAA 4OHFA 3BJIC 3RTGA 1XZNA 1VG8A 2EP8A 2JFYA 2V3CC 3FR7A 5BRAA 1W76A 1U3VA 1TIBA 1M8GA 2G3YA 4MMXB 3G0OA 1E1RD 3BMXA 2QENA 4RAOA 4Z2YA 1GV1A 3WLKX 5J2UB 5LA6F 2R6JA 2YWDA 2R8ZA 4RXTA 4DCTA 1LLCA 1RXYA 2CCGA 3PKJA 3ISJA 4CI0B 1JDUA 2L0XA 5DBOA 4B7AA 5A0VA 1NBMA 1QAMA 4G1CA 3EVNA 1ESDA 1LZKA 2LNDA 4IDFA 4IMPA 1DLJA 4X45A 5ICMA 4CEIA 3MTEA 3OUZA 3VSBA 1PRYA 4NE2A 2PZJA 4DLVA 10MHA 1SIUA 1DZ3A 1QUEA 4W6ZA 5K0FA 1OWLA 1HBJA 3ELUA 1DWUA 4JENA 3Q0EA 2JAXA 2Q2VA 3K7EA 4RHEA 2IH2A 1O5TA 3DBRA 1Z35A 3PPIA 2HMAA 3X1MA 1ZAKA 2CVOA 5B1HA 4ARVA 3HXLA 4EKDA 3FYSA 1HSZA 2R44A 2H07A 2OZEA 4LK2A 2HYDA 2BGRA 4EFDA 3MT0A 1R7RA 2CBGA 2WG1A 3RR2A 3E9CA 4CG0A 2IXBA 1N3IA 2AYYA 4TS1A 5I48A 3PNKA 1O2DA 2HV9A 3MWEB 1PX2A 4L4RA 4HVLA 1H6AA 4NBWA 3F6EX 4MRNA 2CNDA 2IXFA 4JLJA 3GLGA 1T0JB 2O3JA 3RUEA 5K0TA 3PGJA 2ZETA 1KI6A 4KODA 4OIFA 1Y6ZA 3OFJA 2NIPA 3QHPA 1BJRE 1RQLA 4RD4A 4MHTA 2HHLA 2D2VA 2JLQA 2O5RA 4YMUA 5C1PA 4RTOA 2H4ZA 2ZJZA 4WBNF 3A9WA 1X0VA 4PRYA 3UB3A 3DD5A 5TGZA 1KPHA 2VJYA 1RWXA 1JFRA 1GVNB 3B12A 1KQNA 3PQEA 1N5KA 1VBFA 4XJSA 5EWLB 1CUUA 1ZQ1A 4ALNA 1N2BA 2BGLA 2ZJAA 5TS2A 5EJ4A 3RK1A 3LPLA 1GPYA 2BGMA 2DX7A 4WLVA 3PD1A 2OVBA 4UNNA 3DQPA 5JSUA 4BUJA 2G4LA 1N36B 2BFWA 2F64A 3HYRA 3SS7X 1DC8A 3I30X 3BN3A 2YN2A 3N6RA 1M6YA 3DJYA 3ORFA 4HATA 4ID3A 4IIEA 3EVDA 5CDFA 5EIWA 1QVVA 4W5TA 5I9IA 4U02A 1ZD8A 1PFYA 1U5BB 3DULA 4G65A 3ZWPA 4LAFA 3U49A 1KQPA 1YB1A 4HNTA 2ZJ0A 2WP8J 1V37A 3KKKA 3LY7A 1G38A 1V5WA 3T7IA 1BVYF 2P30A 2QRJA 2RMKA 1SC4A 3H05A 4KE6A 1JTFA 4F71A 2R85A 3BJZA 1VIMA 3EZ2A 1ORTA 3M4XA 2IS6A 4S1VA 1HG1A 5JXGA 1TRHA 2Z2XA 3F5QA 1G2QA 4C0JA 4LJSA 3B6MA 1LVGA 4HAOA 1L5VA 1L8XA 3PCRB 4WIAA 1C8LA 2P75A 1Z08A 2AI2A 4WZBB 4CLOB 2G6TA 1NVFA 1RXWA 4P36A 5JRDS 1U28A 4ISCA 1NM5A 1XQ1A 5KIAA 2FSFA 1IHUA 1XJCA 4IIJB 4KQFA 3B60A 4HNRA 2PUJA 4UEQA 2X9QA 1UUFA 3LOUA 1MC1A 1O6ZA 4HBGA 1Z4LA 3AVVA 3LX8A 3F5SA 1SD5A 4IILA 4FFOA 4FOTA 3QLUC 4FHZA 1J2TA 4JEUA 5I7EA 4M22A 4Q3KA 4U63A 3WWOA 2IUYA 4DLBA 4P7GA 4AMYA 5CPFA 1GKYA 3DTVD 1P0MA 3LHIA 3NKFA 4BV9A 3QE9Y 3UMGA 2V7TA 2XB9A 4PS0A 5EZ5A 1SZPA 3UBMA 1COWA 2G5GX 5GQSA 4X1OA 3CEHA 3K4HA 2IKSA 3DA8A 4JQSA 2GVZC 1ZH6A 3HCCA 5D3ZA 1KY2A 3ZW8A 1MDFA 5LWQA 3Q15C 4B32A 3ZXUB 1F51E 3VO9A 2YL2A 1KVTA 2OKCA 4KIGA 3OJXA 2OBMA 1OTXA 2IH4A 1OBOA 4KR6A 3NP7A 4UKDA 1GPJA 3NHJA 2HO4A 2C4KA 4AWAA 2XD4A 1EJBA 4RTNA 4EK9A 2HM7A 2NZJA 4JBXA 4PX3A 1HPLA 3ZVKA 4JC4A 1Z0KA 3S3TA 2RGXA 1X1BA 4YV7A 1KKMA 1CUIA 1GG2A 2A9KA 3AM5A 2H7XA 3OEHA 4JELA 3LX4A 2EFJA 5TR9A 3R2JA 3WGOA 4AG3A 3JQAB 3RVLA 2ORED 2DERA 2HC9A 1QGYA 2N1BA 2GK6A 4UBIA 3WL5A 3IE2A 2BJVA 2CNNA 3OM8A 4J0HA 1A8IA 5CVJA 2PUTA 1O4VA 4HGYA 1ODIA 3ADKA 4P7KA 4YCDA 3K0AB 1QIKA 4Y2TA 3ZKAA 5JNRA 3AR3A 3HJHA 3COZA 3DDOA 3MWFA 4PS1A 1EDZA 4Q1CA 4BBAA 1XZIA 4WVLA 1E79D 4PG6A 4ZO6A 3RVDA 3LPCA 1E4OA 4JJ4A 4FB5A 2ZAYA 3R0ZA 1RFGE 1RWKA 1JYEA 3DTNA 1R4ZA 3IBTA 4UPVA 1FNMA 4FDMA 4C0LA 4F72A 3IA7A 4P3PA 5E6RB 4PZCA 3R9KA 5HIJA 1E18A 3VKUA 1H2BA 1HTTA 1W5TA 1W85A 1BE0A 1BCSA 3DR3A 3HXTA 3IIJA 2QGNA 4P93A 3KUXA 3M6WA 2JLZA 1EE1A 2TMKA 3CLTD 1UJ5A 1IQRA 1HETA 1QIDA 3H5WA 2JLRA 3PRKE 3VR2A 5IAOA 5JVDA 4JB0A 4EMTA 1BKSB 1JG3A 2JDIA 5AW1A 4S3MA 2Z09A 3QOWA 2YNMC 2HA0A 3EVFA 3E05A 1DJOA 1PWEA 1Z47A 1KEEA 2PUHA 4KQEA 4BFWA 1IM2A 1CZKA 3D81A 3H1TA 5HHTA 2XGGA 1FRNA 1W36B 2DKOA 3HA7A 3L7MA 5BXYA 1X7XB 1GL3A 3QYPA 1SXJA 2M32A 1B0UA 1YZNA 2JVIA 2YS6A 4E32A 5AVSA 3BSSA 3R0VA 2G25A 1ULHA 2JJMA 1HDCA 3H6KA 3QMVA 4B80A 4FNOA 2WDZA 3A14A 1ZMOA 2G28A 2WB4A 3ZDZB 1FQJA 1E2PA 2BMWA 1IHDA 3RC7A 3SDZA 1YQUA 4QLAA 4Q3OA 4NJMB 2HEIA 3FTPA 3NAMA 2LDXA 3LM8A 3FTEA 3P26A 3PJEA 4RDIA 5JJKA 1JPUA 2EEZA 4CLEA 6REQB 3RUIA 4RW0A 5ALLA 3VYVA 5B7PA 1M1UA 5HS4A 1NIPA 4MVJD 1W73A 4FHCA 2C7QA 1CD5A 2IOQA 5CFPA 1QRSA 2FW6A 4ETMA 2NQTA 3ZWAA 5G40A 2QTFA 3H97A 4AJJA 4AXXA 3NI2A 3FNBA 2V3WA 1OZHA 5BRJA 4ESVA 2NU8A 3EIUA 4IRUB 1PFVA 2CNLA 4X7RA 2JHPA 3V1NA 3HABA 2BBWA 2WJHA 2BCEA 3DNMA 5KDLA 2WC1A 3ZQ4A 1GTJ1 1ZL0A 1Y5NA 3VO2A 2D7JA 3UH0A 4RLFA 1JQDA 1CRWG 1LH0A 1CY2A 3PQ2A 4UVIA 1MRSA 1G6HA 3EDOA 2AHRA 2EJTA 1QWOA 1TAUA 1Y8CA 3HV0A 3G8AA 4D92A 3IALA 1ODCA 4Q3NA 1AU9A 5CITA 1WD5A 3ISVA 4PHCA 1HM5A 4NH4A 4W82A 3GVXA 2OQIA 3M1LA 4MTCA 4EELA 2O4CA 4BZPA 5CCBA 1G5PA 1NVAA 1U3UA 2R7AA 4G86A 5ICCA 4YS6A 5T6MA 4Q7JB 3DE6X 1EVYA 1NOIA 4MUNA 5ALSA 1MABA 3ABIA 2MSKA 3MJ4A 2EZ9A 3NYWA 3QPWA 4LEIA 1U98A 1SIWA 4R7TA 1Z07A 3VZRA 3VZPA 3K70B 3FKJA 2RHBA 4J7XA 3D0KA 4QOJA 1NYTA 3JQGB 2ZLBA 4RNCA 3NTRA 3RYCB 2PQ0A 4QSHA 2WHXA 4AZWA 1D2RA 1J22A 1LBQA 4BFCA 2GTHA 4G0WA 2YN0A 4I4TA 1C7FA 2LIPA 2NOAA 1O9HA 4KLRA 3SZUA 4EEZA 4YUAA 2DFNA 1HLPA 1DIRA 3NANA 4L8LA 3PC4A 3SC3A 3ZCRA 3CBGA 3NCTA 4MXDA 3WO0A 4UJ5A 4GKKB 3PK0A 5E7JA 1PVOA 5D3MB 4PPNA 1CQJA 1IZ9A 2IHNA 2XF2A 1H1DA 2DJIA 1MG5A 1P61B 3I9MA 5CW2A 5FULA 3INNA 2HCTA 3CUVA 3IP1A 2QTTA 2I65A 4OK6A 4BJ6A 1JP7A 2XUOA 4ZAXA 5HF8A 1E0JA 1CY6A 2NT4A 4BO3A 1EBUA 1KEUA 1OAOC 1V8FA 3DUFB 3NHSA 3O91A 1RI2A 3ROGA 2RBKA 4Q4AB 2QTLA 5SYAA 1TW2A 2CYBA 1Y1TA 3EXHB 3EUFA 4MHSA 3EUEA 3NBKA 4DM4A 4YRNA 4IBOA 4F3NA 2H1IA 3DBHA 1PG2A 4M37A 3A3OA 4H0FA 4KQCA 5BV0A 4P98A 2UUBB 1YI8A 1UKAA 4EB6B 3WHKA 1I8TA 2X40A 5IYZB 2XQJA 5B55A 2BM1A 1G1MA 1CKEA 2ZFUA 3CNLA 3QVGA 2FEXA 3I09A 2ZYRA 4MVJF 2FFRA 4AWXA 5GWXA 3SR0A 4Y6GB 1RYDA 3OICA 3SC6A 2FYTA 2VCEA 1KZ9A 2NXEA 4HNVA 2VNAA 3WLEA 2GILA 3A31A 4BPRA 3RHTA 1IHYA 1Z5ZA 1L8AA 2HK6A 2VBGA 4JOQA 1Q0ZA 5C0OE 3WGIA 3L0BA 4BL5A 1E3LA 1NXSA 4YUWA 2CHQA 1Z0IA 4P1ZA 4GNRA 2A88A 4W5HA 1OROA 1NL3A 1PZHA 1FDRA 2X2OA 3FMGA 2W2QA 5FTLA 3O1LA 4Z6KA 5K1ZA 4HXFB 5FRDA 1RLUA 2QX7A 3ETCA 1L8LA 3LG2A 4GOND 5HF6A 2P78A 4Y30A 3VPHA 4ZPJA 4Y1RB 4LOAA 5F9MA 1DXYA 2HJWA 5IDVA 3RGWS 1P9OA 1F5NA 3ZDFA 4E4YA 5JAZA 2YOHA 1W4RA 2HA4A 4G09A 1HURA 1R0RE 4CT4B 1BQ3A 3C97A 3VKVA 1YIOA 1PFWA 1AQIA 1XJQA 3RSOA 4LFCB 4YH1A 5L3QA 1NI3A 1WKCA 1E8DA 1ZL2A 3VTZA 2WWGA 3HY3A 2KLBA 3KT6A 3R41A 1U0JA 2E49A 1IY2A 4GGPA 2ONZA 4TTRA 4X63A 2HNBA 4F3RA 3IEVA 1L4FA 3SJCA 3H5TA 3LCMA 3TR5A 2H00A 2HOQA 1AA9A 1E0DA 2YVAA 3OZWA 2XUQA 3SIXA 4BGIA 2LCQA 2VTBB 1VPWA 2XA9A 1KE1A 4FTWA 3E3LA 1E5VA 3RVBA 5A9SA 4IDBA 4AZ3A 2HXSA 3KO8A 3P2YA 4LVCA 1G9TA 1JJVA 4UD2A 2QVLA 3C3KA 4DLXA 5DSTA 1Q0QA 1QGAA 1GYPA 3AP3A 4X84A 5JLJA 3OI7A 1PO7A 4D80A 2PD6A 1VKRA 2XOKD 4ND8B 3CLRC 3VU8A 1T4GA 2VDLB 4XX0B 2FQWA 1D03A 4MYSA 2ACWA 1TYBE 1Z37A 2A4KA 3TOVA 4M8KA 4U00A 1C4WA 4EJSA 1RR6A 1QQ5A 1KYIA 1QZTA 1ZCAA 3U26A 5CDGA 4QX6A 4DUPA 3M7IA 2CMFA 4BBJA 4DHWA 4YRGA 3JQ9A 1BMTA 1F6BA 1HFEL 2VDUE 3QKRA 4AG5A 4RM2A 3T5PA 2EKZA 2BSXA 1JG4A 2IIPA 1NBWB 5JQGF 4LRSB 2RGUA 1AF4A 1T8PA 3E3OA 2Z57A 1THZA 4FW9A 2OOKA 4DHEA 1K6EA 3FCYA 4BTVA 5ICSA 5LMNB 3IPCA 3W5DA 3OPMA 1RAGA 2L19A 3F74A 3IERA 3ST7A 3ZVMA 1FTNA 2AQIA 3A04A 3AHFA 1OBFO 2PWPA 1HMYA 3IHWA 4QXMA 4S0XA 4Y2PA 3WLNA 3ORSA 4EARA 3KNZA 5EJ8A 1C14A 3BUSA 4LNUA 4LF4B 3B78A 1YD7A 3H75A 5CB4B 5CYOA 3ZX5A 9GPBA 4FKZA 2IPXA 4Y6QA 1TGVA 1CUBA 1IC6A 2OZVA 3BFPA 1QV7A 2OL4A 3TE6A 4D82A 3ETLA 4S1OA 1DKMA 1NVEA 3KWLA 2NMVA 3G82C 2DQZA 4BVHA 3L7NA 1NVMB 5DNAA 1TPYA 5E6UA 3KK0A 4E5UA 2NV6A 5HZGA 1XA4A 1PYGA 1BNCA 1NRWA 1WCIB 4PAMA 1G20E 4B4OA 4JYAB 1K9SA 1XKQA 2GCOA 2VKTA 3CC8A 2GZAA 2XY4A 1TPZA 2OBYA 2IWRA 3P9NA 2ZEJA 5IAAA 4FEYA 4ZOBA 5F1KA 4PGHA 4CQNA 2OO5A 3HTXA 1TUEA 3NVKI 4NTZA 3JWGA 4JMPA 3UICA 3DMNA 3PYXA 1CULC 2NV2B 3CINA 5EJGA 3S55A 2VRBA 4G0YA 4NYJQ 3IVRA 3I9KA 3K0EA 4DZZA 4FWIB 4EB0A 2VNIA 2XQVA 1EFRA 3UG6A 1ST3A 2C5GA 4RL6A 3RODA 1GNTA 1WLSA 2NUAA 1E98A 4LRQA 4A27A 2DJ5A 1R6BX 3VH3A 1CY8A 4LFAB 1Z16A 4PSKA 2PN1A 2YNMD 4KR2A 4BLVA 2B36A 5BR4A 2C9BA 2A7XA 1JU3A 2GAJA 2OENG 4B3JA 2HFJA 3I58A 2OFPA 2BR4A 1I3LA 2WMNB 5CJPA 3CH6A 3QEJA 4Y0AA 2CKMA 2WDPA 3BXOA 4KAXA 2QN1A 5B6PA 5B36A 2ZZMA 4OYLA 1N6HA 4U7HA 1LPPA 4QO7A 1K08A 1V6CA 3GJTA 2WD8A 3D8HA 3AWDA 3IILA 4W5OA 1F7VA 1P75A 3O8LA 1RMQA 1U3CA 2A84A 3H2KA 3O8RA 4DR6B 3UMYA 3TD6A 1P4RA 4D46A 3D2CA 2ZSDA 1T5IA 3LVQE 1RMYA 2ZRBA 3HPRA 4G25A 4WESB 5EHNA 3ZYCA 2P68A 1QZZA 3EQ6A 1DBPA 1FFXB 3BICA 4GP6A 4YRCA 4CE6A 1CDEA 1U2DC 1U2GC 1UDRA 3W2IA 1E2MA 4I4NA 2O8DB 3GAMA 1KAGA 1Y8RA 3MAJA 4EO7A 2OD2A 4PQGA 5CBPA 4ZVUA 1KBQA 2XEXA 2BYTA 2C8JA 1Y7TA 4AW9A 5HJ2A 4RYLA 4M9CA 4UOEA 3NZEA 5IXSA 2AR0A 4BAZA 3T3EA 2V7EA 4YCNA 5A7FA 3L01A 4IF6A 4V3BA 4R9VA 4B6EA 3HNOA 1UMKA 5FOVA 4O4IA 4MVXA 4B4UA 2XXJA 3AEXA 1QVWA 3QG1A 1NJFA 2GBCA 1SJ9A 5B1DA 3U4DA 5LKAA 3GVHA 2MR6A 3Q2OA 2QN8A 3ZGLA 4QJ3A 3L8YA 4Z1OA 1T8UA 1UOQA 2XMBA 2WKWA 4AJKA 3LTNC 1U02A 2N3ZA 4L3VA 4E30A 4EJ0A 2CFRA 2AFIA 4KDRA 1BS9A 4P0QB 2YCBA 4WINA 1NY6A 2XA2A 2VHYA 2W58A 2QMEA 3VHXA 4RDXA 5A3QA 2C4MA 3FNIA 3F7MA 4R40A 4AY5A 4FT2A 3EZGA 1XN4A 2C2MA 2IX9A 3ER9A 4O33A 2WK1A 4P4SA 1QHFA 2ZG6A 3JWJA 3AY3A 3GIDA 4JEHA 5F77A 3ICCA 4D8UA 5J5CA 1LI7A 1KIMA 2FKAA 2PNFA 3DFIA 3PIDA 2R7NA 4GYKA 1GGFA 1S7CA 5BVHB 1M3SA 1PT7A 2NX2A 2R6FA 3SYMA 4AYWA 1N92A 2HSGA 3IOCA 1Y1PA 2J6IA 3KC2A 1W4ZA 5H8WA 2Z9CA 1L4MA 3GJ8A 4L02A 5LP6A 5IP5A 2XJ4A 2GBGA 1S1MA 2FRXA 2VCYA 2GD2A 2YV3A 1OAKA 1NJGA 5GONB 3E22B 3GQBB 3UWDA 1YVDA 2QMHA 1W0KD 1EWYA 5KNLA 4FT4A 1Z39A 3JAWB 3E9YA 4RC9A 5LWHA 4M21A 4C4ZA 1UDAA 3TPZA 4D3ZA 4WPGA 1F17A 2ZDGA 4DF3A 2ECKA 3IFSA 4EBBA 2QRZA 4AZ0B 4JASB 4E5VA 1BE8A 4DR1B 4LBVA 1M8JA 2HJSA 3O3NB 2FUEA 5P21A 5BVGB 5C18A 3GFVA 3PQCA 3LLVA 1EPUA 1GCGA 4NOJA 5C4GB 4OI2A 5U1PA 2ID7A 3LFUA 3OQBA 4I08A 4IHKA 1GIAA 3EGOA 3G0CA 2PZMA 4JVLA 3L6UA 4ZAFA 2H6EA 2W2KB 5BN1A 2VP6A 4ZOAA 3QXCA 4WZBE 1F4PA 3KBBA 3K8OE 1I6MA 4DCVA 5JSFA 5FX2A 5MN4A 3OM9A 5KTNA 1OMOA 3D3KA 3PHCA 2XTNA 2V9CA 3FPLA 3W9UA 2CHEA 3INTA 3SQXA 1NNEA 1YQGA 1TJ3A 3ETDA 3IKJA 3LBYA 3AIIA 3LWNA 4L9WA 3RTDA 1O94C 4F93B 2XTAA 3GMIA 4CYMA 5JBQA 2RE8A 3BF8A 2I4OA 2EGUA 4MNTA 3W1EA 2JI9A 3WGZA 5B4VA 3SBEA 1G20A 2HJ9A 3T3DA 2X5JO 3ROEA 5CEEA 3IBSA 1Q12A 2J9GA 1MGPA 4GLFA 5LQDA 3EA5A 4ZYVA 1QIEA 1TD9A 2OK7A 1WAMA 4MCHA 1BDJA 3FKQA 1L5HA 4K9DA 3FA2A 4N0EA 2YRWA 3PU6A 1DAMA 3BWDD 1JHOA 1HQCA 1NMZA 2SKCA 3KXIA 3R7AA 3SHFA 4Z0HO 3T38A 3VRHA 3GCWA 4Y6PA 4MQBA 4DCSA 1P33A 1TE2A 1XXLA 2OD9A 3ZGVA 4UASA 4CQMA 4FC7A 2DT5A 4ER5A 3OFND 4L85A 3OJ0A 4F9FA 3X2FA 5H4GA 1UMDB 4OATA 2ZIVB 1OZAA 3P2EA 1OVGA 4KQJA 5J59A 5BXQC 3KOWA 2OMKA 4PLZA 4I1VA 3TRJA 1Y81A 1C3LA 4GVLA 3PFCA 4X20B 1UL1X 1RWMA 3HCWA 3KR2A 4BVBA 4TOIA 3CPEA 3ID6C 4CM3A 1RPAA 4LGCA 2NAPA 2DLNA 1W88B 4F8JA 4ENSA 5CLJA 1UBRS 3L0IB 1PR0A 1R4NA 4DMRA 3FPSA 3B6ZA 2NTYC 3ZV6A 3IOEA 2EZUA 1NULA 4IVNA 4KWEA 4DT1B 1YFKA 2VTVA 4HV4A 2VOJA 5JU6A 1PW5A 4PC7A 2G8NA 4BNVA 1QTRA 4EKGA 5IJ0B 2VA8A 1OH5A 2HDOA 4BLTA 3U1TA 1QLWA 1WETA 5LQSA 3QYJA 5I7OA 5KWIA 5DVZA 3OX3A 4D57A 4AJNA 3OOWA 4Q9AA 5I51A 3E3MA 1BMDA 4LXYA 2JHAA 2IXDA 3VYRB 3BWVA 3KTAA 3PX7A 4TUYF 1YHZA 2I1LA 2O1SA 3LP8A 4B3SB 3GQVA 2GT1A 5BSRA 3W3ZB 4EVIA 2MMGA 5DI9A 3HFSA 3MELA 1SUEA 3T7AA 3CUKA 2TMDA 4O1MA 3K0CA 2C9YA 1CIPA 5GOTA 3O2SB 3MTBA 2FPXA 1KK3A 2ZWPA 4LVUA 1OJ7A 3UJ8A 4C6RA 4UHBA 1GGNA 1ZIOA 2ZWIA 1D2GA 1UK9A 2JIDA 3AU8A 3D6NB 3IMGA 4OXIA 4FGJA 1TJYA 3ROFA 1WUIS 1C7EA 2YCLA 3SVTA 3MS2A 4L95C 4ITUA 5DTEA 4C03A 1JZTA 2HCBA 2ZR8A 3KKPA 3DW1X 3Q8WA 5KHOC 3HK2A 2GZHA 1EDOA 2Q3EA 1MORA 2RH8A 3VKWA 2O2GA 3VNRA 5B4TA 3GDGA 3P45A 3FCSB 3ZV5A 4YLYA 1UKBA 4NULA 5BW4A 4GKVA 2I2DA 4LGMA 4LWOA 4MQMA 4KTVE 1IVNA 2XMCA 2G1AA 4QXQA 4AAYA 2ZCVA 2GWRA 2NUTA 5KYUB 3DP7A 1ZK2A 4MVJP 5EWLA 3OEED 4A8TA 3AVTA 4FGZA 2FQQA 1A5ZA 8AT1A 2YZNA 3EJWA 3LAWA 3KZOA 1YQDA 3DHNA 1H2HA 2WV9A 1PQUA 3L8DA 4JH0A 1KAOA 2KB0A 1UJ6A 3CPSA 4IZOA 4MV3A 1C3EA 4RCZA 5LU9A 1FP2A 3M3HA 3RSLA 5B7NA 1A96A 1RP7A 4W7HA 3G8CA 5HZKA 2PRIA 1CY0A 1TM3E 1I4DD 1PD1A 3OZCA 3KAPA 2VDPB 3D0RA 3DFUA 1EA7A 4QYWA 2YIVX 2O19A 3NDBB 4RX1A 4ND3A 3RJ5A 2BUAA 3FPFA 3LHSA 3QBJA 4Q47A 3IEIA 4ZZ2A 4NOMA 4ZOLF 5A5FA 1E8NA 4B3TB 3D2BA 4MUGA 2DUUA 5DN6D 1XDBA 1J00A 4F45A 3R0XA 2QZPA 3U3JA 1YU6A 3QI7A 4WZBA 4CLOA 5LYJB 2RHWA 3ORYA 1FFSA 1KYZA 2Q5OA 4FQ5A 1U0TA 2GUGA 2HU5A 1K89A 2XJ9A 3WBFA 4AF7A 4C7BA 4F4CA 5IAKA 2IC5A 3KE8A 4YJKA 3FNQA 4YPVA 1JIUA 1JE1A 5FTJA 1ZC4A 3O31A 4R1UA 1QPGA 1XTSA 1B26A 2J0UB 5EFOA 1EFTA 2WWRA 1TJPB 1HXHA 1E4EA 2VPYA 4BN5A 1MO6A 1MNAA 1E7SA 1OZFA 1UT8A 4NBVA 4DDKA 4OH1A 1AV6A 1GU0A 4A2WA 4WZ6A 3KB2A 1V45E 3S8YA 5EYPB 2DOKA 3NXSA 1MX5A 4E1BA 2O59A 1IBRA 1SVNA 4RH0A 5J40A 1F9AA 2JLCA 2HBQA 3PE3A 3ZCUA 3H9BA 1NT2A 3ZZNA 3Q3VA 1OXXK 3ZKWB 4YMVA 2RHMA 5IH7A 5GM2A 1K0UA 1E60A 1XZMA 4RULA 2BV3A 1TQDA 1GL6A 3WYDA 4R2XA 4EMSA 2PRYA 3AO0B 4JCOA 5AFSA 5JFGA 1E3EA 4C4PA 4OUDA 2FUG6 2X5NA 3FPCA 5DNCA 4E5PA 4C3OB 1J2RA 4O2LA 4PZYA 1JDJA 2JIQA 1CERA 1Y8AA 2YY6A 3TLZA 4C21A 1N77A 4BPBA 1R8SA 2JFWA 2P27A 4X97A 3MD9A 1PFKA 3TIIA 1ZVVA 2QVYX 1PQWA 3HSKA 1TD1A 1YC2A 3SHQA 1J9EA 4P5EA 2I6SA 1SAYA 5TPWA 4P4NA 1DE0A 4GF5A 2VF5X 4UE6A 1XGKA 2O7VA 4FINA 1P7ZA 1MB4A 1XD9A 4GPIB 1LX7A 2B1IA 1G6KA 4D56A 4D0SA 4URVR 4DA8A 4N6OA 1ZM2A 4AN0A 2X42A 1TYDE 4MVJH 5JDIC 4MVYA 4EA8A 1Y5MA 2Y2UA 1FNSA 3K30A 3UWSA 1CP2A 4ENQA 1FK8A 4LI3X 3RS4A 4HADA 3AZPA 4JC0A 3TGPA 1T5TA 4PX5A 1T3ZA 3O73A 4Y9UA 3B3FA 3K0AA 3P0RA 3QFRA 3SQLA 3WKDA 5JRZA 3BMOB 4S1TA 1IVSA 4HDKA 1NLFA 1X1QA 1Z4OA 4FMCB 5CG1A 3VR4H 4HQLA 4MUJA 3AQ4A 4DLWA 1C3OB 3FPEA 3PF9A 4MPPA 2HPAA 3RFCA 3THXA 4DDMA 3HP1A 2C59A 4BRSA 3RAEC 5EMNA 2WM9B 4N47A 4GWGA 4ON9A 1Y63A 3PB3A 2OZPA 2POQX 3AGPA 1NLUA 4M6WB 1WULS 1XJWA 4CKXA 1OFIA 1C4KA 3LYAA 1RC8A 4MR9A 1ISGA 4IYRA 3VTAA 2ODQA 3I6QA 3LC7O 5T4HA 5KYTA 5JNSA 2O48X 4Z3KA 4X65B 4KK4A 3GJQA 1RBZA 1H6CA 1SB9A 1X1SA 3DDSA 5IK2A 2AK3A 1VE1A 2ZE5A 4X1KA 1AMUA 1VM6A 4DIFA 4DBLE 1MAHA 3M70A 1RYNA 4RS4A 4YJGB 3UAOA 3HDTA 3R44A 2O2EA 2VYVD 4Z9XA 1XVVA 4BN4A 4RZ2A 3WQBA 4IMRA 4R84A 3ADBA 3K96A 1EUDA 3GARA 5I4CA 2J3EA 4XSGA 3GN2A 2YUIA 5FWYB 1Q7RA 3N70A 4HGRA 3WE7A 3ZE0B 2FRDA 2GJSA 1IY1A 1E9BA 1FPMA 1KU6A 3CUTA 4K28A 1BFDA 3IXMA 4HQRA 3OIYA 4M0FA 4XPZA 1JEYB 3NBFA 4L5BA 5IX8A 5DHTA 4URUR 1XP5A 4FFWA 5AUPB 4G1FA 1TDJA 2AXNA 3M49A 1KE2A 2PH3A 5C81A 5IC4A 1CIJA 3U17A 1QV9A 1Z2OX 2VTKA 4L1KA 3CUEF 5T7BA 2GEFA 3O4JA 2V5UA 5ALVA 4ZJPA 3KJIA 5F1YA 5EUQB 4NJMA 4B1FA 1DIOB 4I46A 4B79A 1M6VB 1QGUB 4R1OA 1AZWA 5F7ZA 1H42A 1O94D 5TF4A 3QBDA 4B83A 1QPBA 6REQA 1ACMA 1FY2A 2WOJA 1PTJC 2P0EA 3MAGA 3VSCA 3U7EB 2IYEA 5JJ5A 1YE5A 2VNSA 3ENVA 1OFGA 4YRSA 4OB8A 3ELDA 3NAQA 4ZO4A 3MJTA 3WLTA 4UTVA 3LWBA 2P2NA 2Q9UA 5FBKA 2G4VA 2R2AA 2GHTA 1T1RA 1UJ4A 5DTJA 4DC9A 5L4NA 5AW2A 3E9QA 1CZHA 4YAOA 4CMEC 3VJKA 3H2YA 1V7CA 4OHYA 3QEMB 1K6IA 2A9QA 2OP1A 2W6IA 1ZQ9A 2XPCA 2Q7XA 3QNMA 4A26A 3Q7IA 4MR8A 1B1AA 1EAMA 2AZ4A 4OLBA 4OQDA 1R9GA 3I39X 3VC7A 1LJUA 1C8KA 3KUUA 4C5CA 4QBKA 2B30A 3TLCA 2C97A 3GJ6A 2FJ0A 1D2NA 4P7BA 2ODPA 4DR3B 1TCAA 2AFHA 3E5RA 4WKCA 2ZSAA 4KL8S 4QRIA 1FF9A 5TQ2B 2C5LA 5KDDA 4N39A 4AO6A 4G56A 3GY0A 4MIEA 4UTRA 5AKXA 4RESA 1NJSA 4WBXC 3H8JA 3BC1A 3K6KA 4RDHA 3ZWNA 3SAJA 2V58A 3UPTA 3U7FB 1KJIA 5FOXA 3EZFA 1PJ3A 1SWWA 3JQGA 4ZRNA 4HDOB 2QRPA 4DRZA 3RYCA 1JALA 5G3ZA 4DE5A 1F60A 3DG9A 3NWPA 2GRJA 4DA6A 2R7KA 2ZBPA 4J3NA 3FETA 1JKJA 4DV0B 5ESDA 1VL6A 1KPIA 1Z4QA 1XA0A 2FTKE 2LCIA 3FYUC 3MAAC 3E1SA 3GW8A 3OC0A 4WKNA 4QLOA 5JBNA 1KOJA 4M9UA 1OH6A 1PQYA 2YQ4A 5BN5B 1MO4A 2EZTA 3WSTA 3K31A 5F21A 2COKA 3EIEA 4QASA 3VDQA 2GHQA 2Z6AA 3E84A 4LJAA 3JATA 3PXCX 5D3MA 3MBKA 3DYIA 5DBEX 2X0FA 4WCFB 3FG9A 1XMJA 2W2LA 3BB3A 5J2TF 5EKSA 3DFFA 3G88A 1O08A 2I7TA 3IJ5A 3RRNA 4NV3A 4FJ2A 3F67A 4A0RA 1XHEA 3QJGA 4IMJB 3UGJA 2J6BA 2JBHA 3AHJA 3I4CA 4YRJA 2H1VA 2PUGA 3EY4A 4DRYA 1MO5A 3IKVA 3PUZA 4KWHA 1MT0A 1SEVA 1SVMA 3LCRA 4Q4AA 4TZTA 1HLGA 5AHXA 5E2BA 4Q00A 5CAEB 4I5GA 2G5CA 3KFVA 4O2BF 2C8KA 2PYZA 4UTZA 1CJVC 3EEYA 5H3HA 4P3XA 4PVDA 1JN0A 3FWYA 5IKOA 4RD1A 3PC8A 2OORC 3DT6A 1BEUB 3UAGA 2X6RA 3VXKA 4B81A 1T25A 1WUYA 5FHQA 4EB6A 2Q50A 4LZWA 4QRHA 2P91A 4EZEA 4OLFA 5CXSA 5K3CA 2O54A 3A3NA 3GHYA 2AYXA 5IEJA 4AJOA 1YA8A 5FL3A 3W3AD 3AR4A 1C0PA 3IVMA 1ZGCA 1A9XA 4OAQA 1I4EB 1VCIA 4I6JA 4M0KA 3DUWA 4AJPA 4C7MA 3HO1A 1PR2A 4RZHA 1XNQB 2G04A 3AOEA 1C7RA 4OH7A 4PNPA 3PHIA 4P2BA 4YMWA 3SF8A 2I4TA 3O83A 5EVJA 2JFNA 1JR3D 1JSCA 3RJMA 4JJ6A 2CBXA 2J59A 4IFBA 3QOXA 5BYAA 4G37A 1UBLS 4PG5A 3L46A 4H6VA 1VCHA 3EVBA 4PYKA 4KPFC 2D8MA 1O1YA 2FJPA 1GA1A 1T3GA 3LUJA 1WQ3A 3RCBA 4AB1A 4BUCA 4HS9A 3UGKA 3ZZTA 5B12A 1XL1A 2VRCA 3TTVA 5AKJA 3DTTA 1ORRA 3WR5A 1R5BA 4MRAA 1AUVA 3MWGA 3WLLA 4DCGA 3V1KA 2GD0A 3EAFA 1PF7E 4IJQA 4ND6A 3GLFB 3QE0A 1OF1A 4H35A 1ONSA 4HDMA 4Y9RA 2WVGA 5M29A 4GPTA 4Y1GA 3T5AA 1O3YA 3AV0B 1E2LA 1SOVA 5TV2A 1M73E 2F3RA 3WWPA 3ZOKA 1YAJA 3ZE1B 3ESDA 1TYEB 4Q21A 2A86A 2W93A 1VHLA 3LNTA 5DXAA 4EF5A 1CUEA 3LYUA 2R00A 1PV2A 1XT6A 1PJ8A 2W43A 2VTBA 4J9VA 2C5EA 4L75A 2VWGA 1JDBC 3SDSA 1P1KA 4MYUA 3IQFA 3KP1A 1SBHA 3K0SA 2FW9A 4LOHA 4N5DA 1ZCBA 1FUYB 2YJTD 4BMVA 5LZ2A 5EMMA 3ZDQA 3U6KA 3P0IA 2H3HA 2WTBA 1AO3A 3QPAA 4MUYA 1JWLA 2J67A 4ER6A 4QT0A 1MTZA 4D9KA 3ZIAA 2QT9A 5K3BA 2ZJ5A 4R83A 1C4OA 5B3AA 3KPJA 4MW0A 1PV4A 2VAWA 4JVMA 2AFVA 5LQAA 1F4VA 2EDCA 4B2YA 4RTSA 3KSMA 4CIBA 2GVNA 3HN7A 3H5OA 5K03A 4BQSA 4F21A 4Z4IA 3ZK8A 2IY8A 1NDUA 4KO4S 1L6RA 3C15C 3QKIA 4ARZB 3HZOA 2ZI9A 2X7XA 1JNYA 4DWVA 1VHQA 3O9MA 3C3YA 2Q1UA 3UUFA 4C5BA 4K9LA 4YT5A 2IHKA 3C45A 4FGSA 5DLPA 2WINI 4ZAYA 2WTAA 5L9AA 1U9YA 2DVMA 4K1XA 3THYB 3A2KA 4OREX 2I1WA 1H5QA 4KFUA 4X3PA 3SZOA 3M6XA 4KZPA 5DYIA 1QLJA 3IV7A 1ZBQA 2VP0A 1UXKA 3B1FA 1U7XA 5F52A 3PWKA 1E1KA 3QG5A 1VCMA 1ZSVA 4PPFA 3WGLA 4TLAA 4C2TA 4LDAA 4CKBB 4JDPA 3ET4A 3JY6A 4O4LA 1Z82A 4MS4B 1EESA 3E8XA 2FSGA 1QDUA 4FGUA 1I36A 1SFRA 4CXMA 3G2JA 1I2BA 6PFKA 4MZXA 2H5EA 2HREA 4DXHA 3TSAA 1CY4A 1ZK4A 2W8ZA 4WW0A 4YJFB 2QTCA 3NUQA 1M76A 2FZLA 3AUJB 2HUNA 1P81A 2G4CA 3DE2X 4LJ8A 3DO8A 5EZ6B 4CKCB 3FWHA 3TZHA 2O57A 4Y6SA 3WLMA 5JAIA 5LQNA 4LYAA 3OU7A 1PUXA 4OG2A 1U0NA 3O95A 3BGSA 4J03A 1IHXA 4AJ1A 4PNEA 2ZANA 4MITA 2HDNB 3TGWA 2A9PA 3H17A 2SHKA 2CFIA 2IP4A 4CKWB 4JBLA 3U4MA 1JKFA 4KREA 1Z0ZA 7MDHA 2ZBVA 4U7TB 4EY6A 5IWAB 2RHGB 4CM7A 1N1DA 1QOQB 5H81A 3STTA 3W5HA 5B58T 1WHTA 1UXJA 3SM9A 1I4WA 1JEAA 3PSAA 5FBZA 3ROZA 3W78A 1QU2A 5HTOA 3OQHA 2D54A 3L92A 5FUBA 3TIVA 4C22A 1N0UA 3IOBA 1TQ6A 4B3DA 1V9LA 1PR1A 4QTXA 1ZONA 1O8BA 3HCDA 3AJEA 3OZIA 1A7KA 3BIOA 3MCUA 4IFEA 2R97A 1GCUA 1E3JA 4MKRA 3BRSA 4YP6A 3T1QA 3RDPA 4F4UA 3RANA 4FX5A 3ZCQA 2F9FA 1T0IA 4TV8B 5E2AA 1JHAA 4WEQA 3SZLA 3U3KA 1FP4B 4TTPA 4F46A 1LI4A 4A8PA 3LUBA 4MR7B 3BM5A 2I99A 4R2IA 4X61A 4YONB 1IFXA 1IUOA 2X9GA 1ML3A 3K4PA 3Q3HA 3QYFA 1JYFA 3U61B 4EG7A 3AGQA 3S2IA 3ZXSA 4ILKA 3Q85A 1GZUA 3QVVA 1WQ4A 4U8HA 1KXJA 2GEDA 3AW9A 4FR5A 5ALRA 1VL0A 1KKUA 5FIUA 3NPAA 2ISSD 5DLYA 2IL1A 3TLYA 3QLUA 4LHVA 4EG0A 4GOKA 2XRZA 2VJPA 3W77A 3NIGB 4LJ5A 1K3FA 1F2TB 1P0QA 1D6NA 3Q0IA 4LHYA 1W2GA 2WNSA 2Q2QA 3H99A 4TWJA 5LB2A 1DBIA 2EG9A 3BWYA 4XA8A 4C9BA 1VIVA 3U13A 4TMYA 3ZDCA 3NAZA 2JAWA 1N0VC 3I32A 4QUGA 1B00A 1VLVA 1D0SA 1GPDG 4NBSA 3T5CA 3UJBA 4CDNA 4CL0A 1U99A 4RZSA 2QORA 5D3KA 1PI3A 4B4WA 5ISMA 4XWWA 2H31A 2ZKIA 4NS4A 4XYGA 1ZU4A 2CVZA 2IHZA 3CV3A 3DGFC 4JKIA 2EKDA 1J24A 2J08A 3ONEA 4NU8X 3PT5A 5E4FA 5F2OA 4AROA 3QU7A 4FE4A 3REFA 5F23A 3UT5A 3PYMA 4QZVA 5EXEA 2OGZA 2E1RA 2C2GA 2V0NA 2Q49A 5KVQA 3UGTA 5F98A 3C1UA 1IEXA 3ASUA 3LUDA 4LOIA 1CYEA 4IJ5A 1I80A 4Q4HB 5CA1B 2QF7A 4UW9A 3GEPA 1UBGA 2IUEA 1MEEA 2IEIA 3QH4A 3ZHUA 3NNSA 4I2VA 5ELMA 4KHPB 2XCQA 3GVIA 3GIWA 3I3OA 5JOQA 3RYFB 1ZHHA 2B1GA 2DBYA 4FZVA 4WZAB 1Q91A 2AD1A 3S2GA 3VR5A 1MLDA 3AUKA 4HFRA 2IEZA 4WLFA 3KVRA 1CP3A 2FOLA 4DCPA 1JL3A 5DGIA 3OZUA 4LRTB 5FBQB 5I9TA 2Q99A 3W90A 4W5WA 1YR9A 4YI5A 5AQ1A 3DVRX 1HOXA 3E22A 3QM1A 2I29A 1N0IA 4M87A 2VSFA 5T3YA 2PWBA 2VT3A 3JAWA 4D3SA 4DMUB 4DQVA 3M81A 2D06A 4PQYA 3CB4A 1NC3A 3WIDA 5KNDD 2QPTA 3M5WA 4BYGA 2FWRA 2I7VA 2OV2A 1BD3A 1Y48E 2FG5A 3CXUA 5FOWA 1WO8A 5G02A 5FT9A 1RNLA 2WM3A 2CJXA 3KOYA 3X1ZA 4DIUA 2ZW9A 3NDPA 4HX2A 2AKEA 2J31A 2H11A 3JRNA 3BJMA 4IG4A 1USWA 3LSYA 2V45A 1O4WA 1FIUA 5ILOA 3R8FA 1YTUA 1FX0A 2W2KA 2W2XA 2W71A 3L6CA 1HE3A 4J0CA 2Z6QA 1EXMA 3PFGA 1Q7GA 1X15A 5KWSA 1EM6A 2DWOA 3NHYA 1SCAA 3N2IA 3TQSA 1XRSB 2Q6IA 4YP7A 4RORA 4A15A 1CVLA 1JHMA 1IWOA 1XRQA 1OLUB 4AZSA 1G7SA 5FNVB 2J09A 4F2GA 2EL7A 1YE3A 2XDAA 2O2HA 1JMKC 3ZWXA 3RFVA 4L50A 2HAEA 2X0IA 4XKJA 1RPZA 1KRXA 3RBVA 4CM9D 5LA6B 1S8AA 5FEUA 3W5JA 1KERA 1DARA 3A6EA 2OBBA 2O0KA 1U2PA 2MYPA 1KJ8A 3F6YA 4H31A 4CHGA 4FNGA 1U7DA 1AVTA 5KMGB 4ND7A 1YS4A 4B33A 4KYTA 1V26A 3PCTA 3K2QA 2DUMA 4ESOA 5A6VA 1XNJA 3QF4A 2I34A 1AHIA 2C9DA 4M0UA 2HY7A 1QDLB 3FUVA 5DCWA 5AVYA 1EK2A 3W9YA 1RACA 1O95C 4M54A 1TEXA 4LQCA 3CO5A 4J8PA 1OLSB 4YROA 5SY9A 2OA0A 2P35A 5E8RA 4MIOA 1LQ2A 2O6LA 1O89A 2P2GA 3GNSA 3H3JA 3H2GA 1OI7A 3O8QB 4KGZA 5KVCA 3ZQKA 3TRFA 4UZSA 4X6XA 1ESMA 1P2UA 4BMNA 3A8TA 2DTDA 3JX9A 2IOYA 4BY9E 1NQVA 4CIWA 1M0SA 1QX4A 4MCAA 1I1HA 4MPRA 4B46A 3EGDB 3ZZUA 4BMCA 4DPKA 2VOEA 3CRMA 1X9IA 4TKUB 1W88A 1KO5A 1XYYA 3AF1A 1L2TA 3EIQA 3I6YA 3KB8A 4GRIA 1K06A 4F6RB 1NFQA 4NNJA 1DADA 2VAPA 3N2KA 4QPDA 2JF0A 1AK2A 1NXWA 3UQYS 3PXAA 4ETNA 4U9HS 2OY0A 4NBTA 4XOUA 2O8FA 4EPVA 4DSUA 3ZU3A 4ENRA 2PD4A 1OSNA 1M1YB 2CFSA 2ZWMA 3GLQA 4FN5A 4EG4A 1J5PA 3KOMA 4JQCA 3URMA 1AMOA 3LQ2A 5KI6A 1JB9A 2G1KA 1P2BA 3A4VA 3ICVA 3UHJA 5AVQA 1KETA 1WX1A 2RGEA 3JYOA 4BLUA 1E2DA 1ZR2A 1QS0A 3UHAA 4YASA 1G3UA 1XNHA 4AZTA 3JRXA 3RFUA 4ZVPA 3BIFA 4GMHA 4IQ4A 4XB2A 4JBHA 2XKBA 2FSIA 3ZXXA 1UKYA 5G41A 1KQ3A 1NMSA 1AKVA 1II0A 3S1AA 1X7YA 4GMFA 4GDMA 3ZE8A 2PLFA 1FDWA 4RFLA 1TZMA 4GM0A 4N40A 3PFBA 1ZGAA 3GVPA 4GI5A 3Q9UA 3HJFA 3IUQA 1Z4IA 3KB6A 4XQGA 3WDLA 3TVYA 1YUMA 5CU7A 1W581 2VDMB 1F2VA 3MSCA 1UJBA 2OAQ1 1M66A 1OAOA 2GR9A 5KYYA 3I5XA 2VJNA 2W90A 1XVIA 2OZLB 3UWOA 2BGJA 2CE7A 5AD1A 4ZDIA 2E2WA 2VIIA 1Q84A 3KTDA 4BVEA 3ZLBA 4JVOA 2Q21A 1Z8DA 4N49A 1DJMA 4UMEA 4LKRA 3SBOA 5KOYA 3PQ5A 3HZZA 4DUGD 2LW7A 2H4WA 4IOLA 13PKA 2YR0A 3ZY5A 5JYBA 2GPBA 4XB6B 1ZJ5A 2QQFA 1ZM3A 2J41A 4GQBA 4AMVA 3TX2A 1T5OA 4HJXA 3VH1A 3O2QB 2ZULA 4JXJA 1LDBA 3RYIB 1NQXA 3B1WA 2G5TA 4ZDJA 1PR3A 2ZKLA 1EAYA 3ITNA 5HA5A 2Q41A 4LDQA 2VQEB 3B9BA 3EGXB 3RKRA 4F38A 4NYMR 1YSCA 4K8OA 2XV1A 2QVCA 5HM6A 1EDEA 3V7UA 1LPBB 1Q7TA 5CGQB 5AJHA 4ASUD 2TSYB 3DHWC 1QE0A 4FOPA 2PX6A 4BU1A 2DP4E 1KDZA 3W06A 3OIUA 4Q1FA 5EWMA 1NXOA 4B3FX 2BZ1A 1ECCA 1PJLA 2I8AA 2QR2A 1G2IA 3MBIA 5AVXA 4UAGA 1E0AA 5CM8B 3SIRA 5HKKD 3U9SA 4D45A 1YVEI 3VR3D 1GN8A 1X3LA 1BDMA 1N8SA 2AV6A 2HWXA 4DCCA 3TL3A 2IP2A 2RJOA 4FNAA 2JKVA 4QFMA 1V11A 1WWKA 4QPCA 3EFBA 1Y3HA 3GPCA 3HMKA 4EI2A 3CONA 1JF8A 5DBHX 4WLNA 4XD7A 3AEQA 3T7KA 3RVPA 1EB8A 1RCUA 3S4YA 2FP4A 4WL0A 2AOTB 1OGJA 3GUYA 3LDUA 2QYOA 2QD3A 4YN3A 4L07A 1Q19A 2BR3A 1LSOA 4MKZA 3LHFA 2GKGA 4EHHA 5K6RA 3SMVA 5CCXA 3N58A 1QFZA 1ZKDA 5AJVB 4R31A 2ZRLA 5DEIA 3SXUB 2G9RA 4G8BA 1ZUNA 2ERCA 4N7JA 4OBXA 4CM4A 2P65A 1BHSA 2JIOA 5EJ9A 5L45A 2R47A 4R0VA 1JWBB 1Q0SA 1P2SA 2WJ3A 2H0RA 3L4SO 5AKIA 3H65A 4MWDA 5LYJA 3RU7A 1QIJA 1SKQA 1UZAA 2AG5A 1TF2A 3AW8A 5KNBD 2ZT8A 4HZUB 1X7WB 3QV2A 4LYHA 3ZLVA 4F2DA 4RHXA 5AESA 2PUEA 2GN4A 1QRAA 2Y1XA 4UU1A 3ES9A 5E0OA 2QTWB 4F4HA 1N7HA 1ZD9A 2OV1A 4INOA 4MP8A 3VR0A 3U5TA 1OA1A 1P5JA 3H1AA 4RKQA 4X1IB 2ZWVA 3IP7A 1Z7BA 2GAAA 3FB1A 4Y0NA 2P4QA 3ICEA 3CZ9A 4Y2SA 2JD1A 4RJTA 4JI7B 3FZQA 1PWHA 2MINB 2YFHA 3JQBC 2QYTA 3OIDA 4YJ2A 1PW7A 4D9EA 3HM9A 1PEAA 1VB5A 4FFVA 4WAUA 3FOCA 3KQHA 3S68A 1VHWA 1KVUA 3VOTA 3EIHA 5ARCA 2VZLA 4WGFA 3GJZA 2AX4A 4LBZA 1SBNE 1XF9A 1LVUA 2CLOB 4J1TA 5CNKA 4Z7QB 4PGGA 1DJPA 4FGKA 4QAQA 2OHVA 1GSHA 2BEKA 2IHBA 3LLUA 5LMUB 2YYYA 2W6OA 1BWPA 4HJRA 3BMOA 2CXUA 4KAAA 1O7JA 3PJGA 3UO8B 3ZHSA 2CKDA 1ZESA 3V5NA 3OQ1A 5JAPA 4FYJA 4J0JA 2WJAA 1FSSA 1T26A 3DE1X 2XZTA 1BE1A 4I5EA 5K4AA 3ODPA 3JD0A 3UM9A 4RVCA 4BYMA 2AOWA 2YIJA 4IIHA 1MX9A 4ND4A 4EO4A 4QUHA 3KPWA 4J43A 4O2AF 4RVSA 1OH8A 1FZTA 1U80A 2ALJA 4EDFA 3VVCA 2H7YA 1QFYA 3RFXA 2EFGA 2BKEA 3AB7A 1SURA 1XKTA 3SYTA 2VF2A 2I6QA 3E0XA 2C04A 1MC5A 2W70A 3GLFE 3I01M 5JYDA 3VOSA 5BMVF 4C6TA 5C1OA 3FOFC 5ELLA 1KFKB 1C9YA 3EK2A 4DAEA 5B30A 2AG0A 2FPLA 4YJGA 4OHZA 4HH0A 3U62A 4FB4A 2V4ZA 3DJFA 1N2EA 1SOUA 2GEUA 2ZAIA 2KJQA 3VZBA 1YB2A 1GL7A 2J4DA 3ZX4A 4AO7A 5FWYA 2GD6A 2HSEA 3K9LA 2ZUFA 3DBOB 4FDUA 4GVPA 1JEYA 2Y0EA 1WUJS 4YP5A 2C4WA 2C84A 5ANRB 3BS4A 4JLNA 3ZY4A 4P22A 4Q6BA 3L1HA 2W83A 4EKEA 5ED4A 1CUGA 2ZE6A 1ETHA 4A6EA 5A06A 3I12A 4M55A 3CMCO 1M6VA 1HKHA 221PA 4UUNA 5AI9A 4YCSA 5G4KA 5KTKA 1GU7A 2MIIA 4BJ5A 1MR3F 3MG9A 1UK8A 2YXLA 2QQEA 3TEFA 2QU7A 1RAAA 3OWXA 4MICA 3SFZA 3NEYA 3AVQA 4O5AA 3SF0A 5A03A 1SHTX 1VZ3A 4RTMA 4HWKA 3ZTTA 6GPBA 5DX0A 4F3CA 1LUAA 1P44A 4G4SO 2OXFA 1U2GA 3QKSB 3UZUA 4E70A 3ILHA 2Y68A 4M1QA 2O5VA 4D74A 3RSFA 1IOVA 3N5CA 5ITZB 3FPAA 2ZJ2A 4E12A 5KVAA 4E08A 4LXTA 4PVCA 3RTAA 3RRYA 5LQKA 1HT0A 1RRMA 1VCNA 2ZUCA 1UMCB 2GO7A 5KWVA 3B6IA 4IQ8A 1Z28A 3KKNA 3T41A 3VHRA 3SQDA 2NU9B 1GFWA 1M34A 2Z8ZA 3PNYA 4RF3A 4XJVA 3WMWA 3PQ4A 4HQKA 3D6HA 3W3AH 5K6AC 3BEDA 3EIFA 4S05A 1QBKC 3IHTA 4L6CA 1S02A 1KJ9A 1XXHB 2PK3A 3BCUA 3C7TA 3EUAA 3HQ4O 3O4VA 1VSVA 4TN5A 4Y2JA 2EZ4A 2WHPA 2IYTA 1USIA 2LR0A 2PKYX 3BWEA 1XZPA 5IVDA 3REGA 1TQ8A 3ZNNA 4CQLB 5C7OO 3DF9A 5B64A 1P7YA 1UP4A 5BNTA 4JR1A 1FBNA 3FHJA 3VR6D 1BVUA 5SZJA 4D6XA 2C54A 2R8YA 2AJDA 4G9EA 4YAWA 3UBTA 3AR5A 1Q7BA 4EW1A 4HDNA 4IQ0A 4C06A 3D4OA 3PNQA 4EY5A 2F8SA 3C1TA 2A0KA 1FL9A 4QL3A 1WMFA 4TT3A 1BRMA 2O06A 2I71A 1Z6ZA 2E87A 1R0YA 5C7IO 3TFOA 1U9IC 1PHRA 3F2VA 1PJCA 1DTEA 2ZI5A 3Q5DA 5F1PA 4C0XA 5BN5A 5IJ9A 2PJZA 4RJ2A 4KRGA 5DN9A 1JR2A 2GA9A 3O92A 1PFUA 1WXGA 4K03A 1PP4A 5IKEA 4II2A 5LLDA 1GFSA 1Z9BA 1ZGJA 3OIGA 2RONA 2YH2A 3BMQB 1RZVA 3KPVA 2UYGA 3P2KA 4WCFA 2V7GA 4ZRDA 3FGOA 2GXQA 5FLEX 3RLFA 4LMAA 3THOA 4N1AA 2P6NA 4F5ZA 4OD0A 4R71A 4J6FA 3WYAA 4CTJA 4AJEA 2Q45A 4CKEA 3A2MA 1U81A 4U2FA 3H0CA 2A6PA 4DQLA 8ADHA 3DNFA 3W6OA 3B2EA 1SELA 4HUQA 3VJMA 3N5KA 5E2IA 5HUHA 1E5XA 1QYIA 3E2IA 2X0JA 2GTIA 4RVNA 3N1UA 4HY3A 2DFLA 2YMMA 3E6AA 4K46A 3SVZA 2O7RA 1IAVA 4KAJA 4LXXA 2HF8A 1UMBA 3E7FA 3HSSA 5AUOB 1AXGA 3ROMA 3WNDA 1QANA 1S2DA 4FOOA 1T4MA 2WZCA 3PVZA 2J3KA 3V2IA 2PQ6A 3WLOA 1L5WA 1OPRA 3QP9A 1WW3A 1VFPA 3OOEA 1I33A 1FTYA 2FX2A 5ECYA 3WNBA 1EWKA 1Q3TA 5LVAA 3A2LA 1TA4A 1NQ5A 1HX7A 4KN6A 3QSYA 1ZRSA 1JQ3A 3SICE 3KVOA 2IHYA 2QG4A 4I36A 5BYBA 3UWMA 5KSZA 4TWIA 2B5VA 1XJ5A 3O8OB 4RFSB 5DSXA 1Z4JA 4EKNB 3R6LA 3GRVA 1Z38A 2YWJA 1XOIA 3DAPA 3V3TA 3GP8A 2X0EA 2AIRA 4D25A 4M9RA 5FORA 4Q5IA 3VISA 1GZ7A 5DNDA 4LI0A 4CCYB 5C8YA 3LXXA 2V1XA 1ESCA 2C31A 2DPGA 3L0OA 3UXHA 3ZWWA 5C8XA 5L7WA 4QNRA 4U1RA 3KQYA 1MF7A 5JQGB 4HUTA 4HK4A 1X8LA 3F6CA 1YH3A 3ORQA 5KOIA 3UGQA 4FMPA 4A0FA 2C2OA 3KJEA 3VPDA 2HWWA 2JFPA 5C46F 5AJZA 3FSJX 2GPYA 1TK3A 3FVTA 1X9HA 1DKQA 3U4QA 5M7EA 2OFXA 1KQFA 4ENTA 2NADA 1R6VA 1U0HC 1JKXA 2XWBF 1CXZA 1I2ZA 1WD7A 3L8GA 1VIDA 4U3JB 3PKZA 3RVKA 4EGSA 3V55A 1O5OA 2CE2X 3FMOB 3TSYA 3DP9A 4N0DA 2VLBA 1G6Q1 5CIQA 4I66A 5F7OA 2Y0PA 4F2HA 1WG8A 2Z08A 3FTDA 3K4QA 4ZT7A 1E3WB 2IOFK 3L93A 3QWBA 1MH9A 2WG2A 3MWDB 4GWLA 1DAPA 3VPAA 2CD7A 3K8ZA 2X8LA 2QZSA 1WMDA 2O8NA 4OBEA 5EUMA 4UBMA 3UK7A 2OGUA 3BGDA 1JH9A 4Z4FA 3L0SA 3I0MA 2NUPB 4YIHA 2WA1A 5J5VA 1RPTA 2B35A 5K0BA 1TKRA 1LEHA 3HKBA 4BV2A 5DHQA 1DT3A 3MC1A 1RIFA 4DCOA 1WF3A 3EDRA 4NHOA 2QNBA 3CO0S 1XTPA 2D74A 3GEGA 5FQOA 1N25A 4WMLA 4LZOA 3UXYA 5ENVA 1S9HA 1V0JA 1ZJ6A 1Q50A 2KBEA 2VSOA 3E4CA 3NBUA 4ARZA 4BIMA 3TI7A 2DBVO 1FVOA 4ZV4A 1OILA 4DR7B 3BKXA 4N7BA 4FDLA 4ZGBA 4HKTA 2RBGA 1W94A 3H2IA 4IRXA 4BFSA 5JUWA 1CZOA 1OHHA 4HN2A 3THYA 3HVJA 1ABEA 1JG6A 3V32A 1IRIA 1J90A 1SC3A 4WK2B 3W0LB 2BZSA 3RVJA 4LJLA 4UBLA 1MH1A 3BFJA 2GH1A 1HWYA 3G2OA 2C95A 3IQZA 2OHXA 3JQ7B 4NL4H 4V0SA 5AW9A 1IG0A 2RARA 1NR7A 4WXPA 4HNQA 4PZDA 5G0WA 3BZBA 4L72A 5HR5A 1Y5IA 2JBAA 2NUBA 1E2GA 4MYRA 1CCWA 3H4TA 4KE8A 4C4RA 2QTAA 2QJOA 4MS4A 4CM1A 3K0FB 1OBVA 3K9BA 4I50B 1N78A 5E1BA 3H3XA 3TQIA 3PXUA 1AK1A 1T1SA 2A1UA 3JR3A 1G8SA 2NU7B 3W8FA 4ZYLA 1UK6A 2OYSA 2BLNA 1XL0A 2QRUA 1K2WA 2XNDA 3ON5A 4MYDA 5G4LA 3VKGA 5AW3A 2VSXA 3B48A 4HGPA 3FTQA 2YZGA 4KQIA 1T2NA 2Y9PB 2YZMA 2XMQA 3AERA 3PJDA 2MMCA 1C7JA 2JI4A 4CKCA 2G08A 3CZAA 2LP4Y 2ZBQA 4MVCA 4PCVA 3D31A 4ZEOA 4BCCA 4UCFA 3NM5A 1GEEA 1I5OA 2RJ3A 2C99A 1MENA 2IK8A 3CKYA 3DCNA 5CJ2A 4JLUA 5EKXA 1FDIA 1NZJA 4CKWA 3MJDA 3B9PA 2XCRB 3RF7A 1U0OC 3ZBUA 1FJ2A 1YL6A 4E22A 4CGYA 1T1GA 3QXSA 4XSHA 5ITWA 4JVNA 3OQMA 1JXQA 1UOEA 4EYGA 1H1LB 3BULA 3M8KA 5GAJA 2CVPA 2CLKB 2ZJ1A 4QE3A 3SKVA 3UJCA 2E4XA 2BBOA 5B7QA 4F4FA 1CZNA 1X1CA 2FQYA 2P77A 1OE0A 1NZDA 1T9CA 2IZ1A 1KWKA 2OXRA 5KPDA 1NVVR 4WFIA 1ORVA 3CVJA 2DPLA 1L5SA 4FE7A 2YWCA 2ETVA 2I5PO 1YONA 1MJFA 1M0WA 1QLHA 1H1TA 2RKOA 3EFEA 4Q9HA 2X13A 4CLHA 3ZGZA 3V1TC 3PYLA 1C5KA 4DCJA 1H22A 1JE0A 1FP4A 3E7PA 3PLRA 4CODB 3IP8A 3AUFA 4TTJA 3HV2A 2FRVA 4I7EA 2UYOA 4OA5A 4KO1S 4IKEA 3LT4A 5DYWA 4C4OA 1Z5PA 1Y9DA 1J0DA 3N7AA 1UWLA 2UZAA 5H59A 1G63A 4WN9A 1QGOA 3RVSA 4KCGA 4RTRA 2MSCB 1YIDA 1Z22A 2OLJA 2UDPA 5DIFA 1M1YE 5C35A 1W30A 1S8FA 2AJCA 1WKVA 2VF7A 5K0JA 1ZM7A 3PQ7A 1WZIA 1YRHA 2FH5B 1GUBA 4JSTA 5SYNA 1LX6A 1C81A 2ADOA 3KEMA 1REQA 1ZXBA 2BMJA 4FNMA 3HDHA 2BVNA 2PG3A 4I3FA 4LRXA 4URZR 4ZO9A 5TS3A 3G1TA 2AVNA 3DDNA 3TJZA 1AS3A 4ZGGA 3T4PA 3C8UA 1L7PA 3A28A 3H9GA 3ZCVA 4G26A 1STOA 4KDFA 2PGOA 5F5XA 2LZ0A 3OSUA 2QBYB 2HU7A 1SIBE 5F3RA 2QE7A 2W6PA 1NN3A 1Y0BA