2C9ZA

Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
451
structure length
438
Chain Sequence
TNPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHTMQCNIKSYDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Transferase
molecule keywords UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
total genus 154
structure length 438
sequence length 451
ec nomenclature ec 2.4.1.115: Anthocyanidin 3-O-glucosyltransferase.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2c9zA02
2GM9A 3NP7A 5TMEA 4KQMA 1HLFA 2QRPA 3MT9A 3E3OA 2GPBA 1FS4A 3TSAA 1SXPA 1L5RA 2WTXA 1QM5A 2XGSA 4X7RA 2F3QA 2IYFA 2G9VA 5TMBA 1GFZA 2GEJA 3MS7A 1IIRA 1LWNA 1WUTA 5DLDA 3OKAA 2GEKA 2XCIA 3S27A 4HLNA 2G9RA 4X7MA 3CUYA 4LDPA 2VCEA 2F3UA 5JTUA 4PQGA 4RIGA 2H1FA 1JG7A 4WHMA 3D1JA 3BCSA 2FETA 5HXAA 2BISA 4W6QA 2H1HA 2QN7A 1FTQA 2X0DA 4CTMA 4N3AA 3L7BA 4AY6A 1P2GA 4YI5A 3O3CA 1GGNA 5D01A 2R66A 2XA2A 3NB0A 4L22A 3OKCA 1SXQA 3PE3A 1PN3A 3L7CA 1F0KA 3MS2A 1M5RA 2R60A 3AMVA 2AMVA 5IKPA 3NAZA 1H5UA 3NPAA 2ECPA 2QLLA 2XCUA 1Z6QA 3BD6A 1L5QA 3CV3A 4GPBA 2QRHA 3T7DA 4MI6A 1KTIA 6GPBA 3T3EA 3OY2A 3NCHA 1XC7A 1EXVA 3SYRA 1JIUA 1NLMA 2XGMA 3ZCUA 3CEMA 3S2UA 2QN1A 4RIIA 1WV1A 2F3PA 1NZDA 1FC0A 2R68A 1RRVA 1UQUA 4YUAA 1ABBA 4N3CA 1IXYA 1PSWA 4NC9A 2ZB2A 3ZCVA 4RBNA 3T3GA 2HY7A 3BD8A 3CX4A 3MRXA 3PE4A 2XMPA 3L7DA 4GZ5A 2IV7A 3BEOA 5TVGA 1JIXA 3EBOA 1NVKA 2IYAA 1K06A 1XKXA 2BGTA 3DDWA 4MI3A 1GG8A 1EM6A 3L79A 3RSZA 1P29A 1XV5A 4REMA 7GPBA 2JZCA 3E3NA 4F9FA 4CTNA 1LWOA 3CUWA 2SKEA 3DD1A 1P4HA 1NOIA 2X6QA 3MBOA 4XIFA 2VSNA 4AMBA 4BQFA 4X6LA 4CDRA 2C4MA 2QZSA 3CEJA 2FF5A 3MS4A 3UYKA 1FU4A 3MQFA 3NC4A 1E4OA 3DDSA 5BNWA 2XA1A 2QN9A 3CEHA 2PQ6A 3TOVA 2IEGA 4LEIA 2ACWA 3BCRA 4WACA 3T5TA 1XOIA 4MI9A 4N9WA 3S0JA 3E3LA 1FU8A 3CUTA 2X6RA 3MT7A 1B4DA 4M60A 2PYDA 3MT8A 3COPA 1JIVA 1AHPA 4NESA 2IV3A 2QLMA 3H4TA 2AV6A 3HBMA 4NEQA 4G2TA 2PRIA 2YJNA 4EL0A 1C3JA 2FFRA 3G2KA 4RIFA 3IA7A 1WV0A 1L7XA 1NOKA 1NZFA 4GYWA 1WUYA 1L5VA 2QRMA 2VSYA 1FA9A 1VGVA 2GT1A 4FKZA 3QHPA 4AY5A 2QLNA 3TAXA 4CTOA 3WC4A 2PRJA 2R4TA 2QN2A 4FZRA 4XI9A 3HBJA 4AMGA 3MRTA 2GJ4A 3MTDA 2SKDA 1UQTA 8GPBA 1JG6A 4EL5A 3NP9A 1C8LA 1C8KA 5C1DA 3C4QA 2C1ZA 3T3IA 4QLBA 2R4UA 1WW2A 3G2HA 3D0QA 1Y8ZA 2G9UA 2O6LA 1P2DA 2XA9A 3VUFA 2GPNA 3HBNA 1Z62A 2P6PA 4GYYA 3RHZA 3SYMA 1P4GA 3GUHA 3S29A 2AZDA 1RZUA 4BQEA 1GPBA 1RZVA 1L5WA 1UZUA 2Q6VA 3DZCA 1GZ5A 3G2JA 1C50A 3UYLA 3OTGA 2VCHA 3ZCSA 5ENZA 3HBFA 1WW3A 1L5SA 2F3SA 4X7PA 2F9FA 1GPYA 2ACVA 4F96A 4M7PA 2ASVA 3OT5A 5LQDA 2PYIA 4MHOA 4YI3A 3MRVA 3MTAA 3CUUA 5IKOA 3WAGA 2JLBA 3EBPA 3Q3HA 4BQIA 2IUYA 4F97A 4MICA 2XGOA 4RIHA 2C9ZA 3D0RA 4HWGA 3VDMA 5GPBA 4MHSA 1Y6FA 2QN8A 2AW3A 3G2LA 3MSCA 1YGPA 3Q3EA 3S28A 1GPAA 3ZCRA 5I45A 1FTYA 5DXFA 3H4IA 2KS6A 1F6DA 4EKEA 5TMDA 1E1YA 3OTIA 3VDNB 3RSCA 1L6IA 1NOJA 5D00A 1V4VA 1BX3A 3L7AA 1P2BA 1P4JA 3ZCQA 4GZ6A 3BD7A 3G2IA 2QRGA 3FROA 2OFFA 2VG8A 3GPBA 4M83A 2IW1A 3VUEA 1PYGA 3OTHA 1XL0A 3MTBA 2C1XA 1Y6GA 1O6CA 1QKJA 1FU7A 1XL1A 2IEIA 3Q3IA 2ATIA 2QN3A 3G2NA 1Z6PA 1K08A 4WADA 1PNVA 2BFWA 4N39A 3CUVA 4BFCA 5DU2A 3C48A 2QNBA 2X0EA 3T3DA 4EJ2A 4Z5XA 2G9QA 1J39A 2X0FA 3QKWA 3C4VA 4KQ1A 3IAAA 3T3HA 3L01A 4KQ2A 4N3BA 2GPAA 3WADA 4RENA 1AXRA 2SKCA 4EKYA 1JEJA 1A8IA 3OKPA 3OY7A 1FTWA 1Z8DA 2BGUA 4MRAA 9GPBA 1YA6A 3RT1A 3ZCPA 2JJMA 4GZ3A 2QRQA 3BCUA 5JTTA 4AN4A 3ZCTA 4RIEA 3BDAA 4RELA
chains in the Genus database with same CATH superfamily
5H9VA 2EZ4A 1G5QA 1SQSA 2GBIA 2VDPB 2R44A 1ZUWA 3FOZA 2RB4A 4UM8B 2VATA 3BH0A 1FNCA 4Z0NA 1H6DA 4KMOA 3SKVA 5L4SA 4LV6A 2FUG6 3QWIA 1IG0A 5EJIA 4MTCA 1TF5A 1ISFA 3NEPX 1AU9A 3OQOA 1Q0TA 1IM5A 2DTEA 1E79D 3DAOA 1WBJB 1T2UA 4UDNA 4ETIA 5B1IA 1W2HA 2IYFA 1HTTA 3S6JA 3SEZA 4AJ1A 2RB5A 3FYUC 4A2CA 3LAWA 3AESA 3V00A 1IQ0A 2OZLB 5EC8A 3MUOA 3BDVA 2F8SA 1C7IA 2A9FA 2AF3C 1ONNA 3AZOA 2ANCA 3VX3A 2H4HA 5A6SB 2H1WA 4WFQA 2BR4A 5BNIA 4M8LA 2GEKA 2XCIA 1VE3A 2UZ1B 1LGYA 4D8TA 3PUKA 5K45A 3N2KB 4ZWNA 1VIAA 2VT7A 2IH5A 4R1LA 4JI7B 5DGDA 3MCVA 3B9QA 3TBKA 3PG5A 1UT6A 1E6CA 4L1KA 1CIPA 621PA 4QZVA 1ORTA 1RWNA 2OP0A 4XM1A 5BVHA 1R50A 2CFOA 5I01A 3RC3A 1HEUA 5FOTA 5HRCA 1G1MA 3FSJX 2ILVA 4Q12A 3SFZA 4R2JA 2X0DA 5CDFE 2QXTA 3PX3A 4KP7A 5SYAA 5BV0A 1ZXLA 2HCBA 2HXGA 2IF0A 3O90A 5FB3A 3NFRA 4X8MA 3M5CA 1KDTA 3R5HA 1NW8A 5J5CA 1WXHA 2OPBA 3G5AA 3NFYA 1LLDA 3QG5A 4X85A 3VJRA 1HLDA 1WMEA 4OHFA 3RYHA 3WRYA 4P5PA 2J07A 1J56A 1SBIA 3T4XA 4KVAA 2KM1A 3FBTA 4HYQA 1IY0A 1VP9A 3NGLA 3OM1A 3ETLA 3QPVA 3TMAA 1O8BA 2C0QA 2F1OA 2FPMA 4HC4A 3H83A 4M99A 4JROA 1F0KA 1RJ9A 1T3ZA 1W75A 1XJ5A 1FB5A 2HC9A 2O1SA 1Q0SA 3NOXA 3GJ7A 4O2BA 2OP1A 3K6KA 2VTVA 3W9UA 3PTAA 1JSRA 2E49A 2WIDA 2LUOA 3HZOA 4YVFA 4KYVA 1ORDA 1RQNA 2C9OA 4P82A 5GZ3A 1P0MA 3OE4A 1S3IA 3QU4A 1KE2A 3PUWA 2XSZD 5DI9A 1MXFA 5EUBA 5T8KC 1QE5A 2CXOA 1MW9X 1Z6QA 3GVIA 4JVNA 4Q39A 2GZMA 3LBYA 3A1FA 3LXRA 1L5QA 4TWJA 1M2KA 1S7CA 3AUAA 1YQGA 1X38A 2B4KA 3A4MA 4V1CI 3OD5A 3IT0A 4ER6A 3RVKA 1WVMA 4X64B 5E4TA 5ESDA 4OUDA 4AFNA 3ICEA 2BI8A 2O2EA 1TE2A 1U65A 5DGHA 2ZJFA 3VDRA 5DF1A 2WM8A 1KJYA 5DI3B 1V8OA 4L75A 4LFAB 3F96A 1RT9A 3K53A 4JXJA 4DUGA 3D3QA 3EDOA 4UBLA 1F17A 3VISA 1KU0A 4NTZA 1M0TA 5HIKA 5CNJA 3JSAA 3IMEA 1PDWA 3UGQA 2Z2IA 1D0VA 2XE7A 1H65A 2JA1A 4F4DA 1SIUA 1I3KA 2QQFA 3M9WA 3PC6A 2A84A 4M54A 5AJYA 1JWBB 3RVOA 3TDKA 2V3CC 1RJDA 3D8BA 3R4CA 1DC6A 1L5OA 1XCPA 4DV6B 2AX3A 4ZO8A 4KBGA 2ZE8A 5K2OA 1KTVA 1XXHB 2X9LA 1SC3A 3MWEA 4TYNA 4J8PA 1QKIA 1K2WA 3WDLA 3PFGA 3BWDD 2FPPA 3EGWA 2EFCB 4NHEA 1S6YA 3O6VA 3Q8MA 3BD9A 4FMBB 4FZJA 4IQGA 1VLVA 4KN8A 1W94A 1X7GA 3ELWA 4V1CB 3ENKA 5DLYA 3Q6MA 1YRWA 2DSNA 1TVKA 3A6HA 3RKRA 5IANA 1FMLA 2W2LD 2QTLA 5AJTA 1EK5A 1HYQA 3UJDA 1FCJA 1TKCA 2G0TA 4HAZA 1KAOA 3BXPA 2M6KA 2N0SA 1BXGB 1UKYA 1GQYA 2QPLA 2VBCA 3V32A 3T1YB 1N6HA 5EJAA 1QTNA 1RAFA 3DTNA 4FXOA 2HDWA 3T7IA 2E9SA 3KG2A 1KYTA 3CUKA 3DH0A 4EJMA 1D6NA 3QLVC 4DQXA 5JNUA 4OJKA 1F2UB 1I4WA 1XXLA 3CIOA 3IT2A 5H83A 4E2XA 1Y6JA 2O07A 4RDIA 1R88A 3NR2A 4UPVA 4EO9A 2DETA 5FL7D 4OBWA 3OZTA 3C45A 1QAMA 1P9OA 2IZ1A 2H06A 3QI7A 3BHMA 2B69A 1W85B 2BLLA 4FFBA 4WFIA 4X41A 4EHHA 3IHWA 3R3HA 4OQNA 1T0BA 3OE1A 3AM5A 4IZHA 2CB0A 3E9DA 1NDQA 2AR7A 5JY6A 1LZLA 3ELYA 3TXYA 4B7UA 4LC1A 1Z4NA 2H5IA 3EWIA 4IJ5A 2EARA 1PRYA 2JLVA 4R1QA 5BW5A 1QH0A 5IU6A 1NOIA 3LFHA 4R5MA 4LHEA 2YV4A 4M3NA 1XZQA 1C2YA 1JEQB 1O1YA 2JAXA 4GI1A 2UXCB 2X2OA 3IALA 4RMIA 2GKOA 2CFSA 4C88A 1JQBA 1JF8A 4BJHB 4MVJE 3U31A 5LLTA 2BIFA 1M0EA 1XRMA 2IDJA 3QEKA 1TJYA 3DHVA 4D46A 1RHRA 1WOYA 2DP4E 2GKGA 1VG9B 2C8JA 4NSNA 1JTFA 4AM8A 3T6KA 4BGUA 1L7QA 3BXGA 5GZ1A 5HKKA 4PM4A 3K4QA 1EX9A 4CM3A 1HPLA 4B4VA 1M8KA 1RYHA 1NJ1A 4HRVA 2NSHA 1ZRSA 5TQ2B 1S0UA 4XIGS 1C3LA 5DT2A 2NP7A 4J75A 1MAUA 1P7WA 2VDMB 3DT8A 3ETCA 2BE9A 1XOIA 2NACA 4FEYA 1OZGA 2V6FA 4JYMA 1W25A 4ND3A 4FEEA 3D7RA 5EUMA 2V9PA 3S0JA 2W8BA 1XTQA 2V97A 2JAOA 1K7FB 4XTRA 1TYEB 4JKOA 1T0JB 4FFMA 1PJ2A 2WWXA 5HKKD 4NAVA 3DF7A 1WUHS 1XCLA 1Z35A 4PHFA 4IMRA 4UPEA 2PYDA 1CK4A 1KYXA 1SBZA 4MSUA 5EKDA 3QLUC 3FXAA 3RS4A 5LYJF 1R9NA 4L5YA 1J2UA 5EGNA 2DERA 1NHGA 1XNGA 2RHMA 3F5SA 1BX0A 3TLCA 1YMVA 4Q9JA 5E38A 4AQ7A 5K3EA 1Z06A 3IKVA 4LYJA 3CLSC 1PX0A 4UAGA 1I1NA 1FOEB 4KXVA 1V7PC 2WIJA 3RIXA 1QG6A 1R0XA 1MOPA 1SQ0A 4WECA 4YTEA 1A76A 3DR5A 4GBED 2OL4A 1E9BA 2QN6A 4KZPA 3RS8A 3ZV4A 5BWOA 2PWPA 1FYDA 4C6HA 2FQYA 3GFGA 4UW9A 2PAAA 4QODA 4NPHA 4QVGA 2C9CA 3WYGA 1NC3A 1Q20A 2BBSA 2BSXA 2OQRA 2Y1GA 4B3XA 3IMFA 3FFBA 4UOEA 4Q7JB 3W06A 1J70A 3Q10A 4YA6A 2GPWA 1KMHA 2PJDA 3QEJA 3RJZA 3TPZA 1FA9A 3ZI4A 4PIPA 3WL7A 4KDCA 1JJIA 1GR1A 3KQYA 1P44A 1U3CA 1HRDA 1VKJA 4EHDA 3GXBA 3FX2A 4K1XA 2JI4A 4QOJA 1XTUA 2ZTLA 2XCSB 2NVOA 5FUYA 5DLEA 1FDOA 3WK4A 4LBVA 3GWZA 3DDOA 3JQBA 2FA9A 1RW4A 2W58A 2XW6A 1RS0A 2Q4BA 4PYQA 5F73A 2CZGA 3V1MA 3ZIAA 4DHWA 1OOEA 1QLHA 3C43A 1VPLA 1V2GA 4FFRA 2XX3A 5IAAA 3TIFA 2VUUA 4UEWA 1IEWA 3E82A 3Q0IA 4FGZA 3M1IA 4BWVA 4WZBA 1J8MF 4DJAA 3K71B 5F76A 2V7UA 3TKAA 3GLIA 3IBGA 3WNVA 3DONA 4PX5A 4XI9A 4GC9A 1V1JA 5AKGA 1E1RA 2CNWA 4HWTA 3WYCA 2NOAA 1X7XB 4M7OA 2ZRKA 3BCHA 5I7VA 4G26A 2BDEA 4QRDA 1G5HA 4UXJA 2XZOA 1VXRA 1PK8A 5J3JA 2AUNA 3OOJA 1VG1A 2NUAB 4FDUA 2ZXFA 4H27A 3TI7A 3BQMB 3F8SA 4BMSA 4N3NA 1RLMA 1EZZA 3WKAA 4NE2A 5A3VA 2C3MA 2WB2A 1SG0A 1SB9A 1KS9A 2WDPA 2XCQA 1E79A 1WW2A 3DT6A 1CR1A 1J2RA 2V98A 3IAXA 4LF8B 4RHFA 4DDUA 4BS9A 4URVR 3SKYA 2XQFA 4L8YA 1QYRA 1CJVC 3HO1A 3NTXA 3PDWA 3L0ZA 3R5XA 5B58C 4JLMA 1AZLA 2FOIA 1ZGHA 1P1RA 2I80A 1JEYB 1ENPA 1F2VA 2KBEA 121PA 4HWPA 2EERA 1BIFA 1D9ZA 4GMFA 1W49A 2LDXA 4M86A 5HQJA 2JH3A 4NPAA 4CLXA 3OZGA 3WKBA 1USWA 5B2FA 1H2RS 1Z7GA 2OLKA 3SJBA 3EWNA 3OZSA 2DZDA 4ECAA 3TX6A 1WB9A 4KAFA 1RR6A 2G63A 3FGPA 1CKEA 4IXDA 5EVCA 1KJNA 3DZ8A 1DLJA 1RYBA 2A14A 3D3WA 5GJWC 4D26A 5IVPA 4M9CA 1Z8HA 5COQA 3A6ZA 1B0PA 1CQZA 1DG3A 1E6MA 1I6LA 1RVDA 1PJCA 2O2GA 3E6AA 3EASA 4YP1A 2BT4A 4LDZA 3QLTA 3Q87B 2F3SA 4GMGA 2A9JA 1JP7A 2IPLA 3C8DA 3SXUB 1VYVA 2YS7A 3BMNB 1JFVA 3JQ9A 1R15A 2ZW9A 1VE7A 2FGKA 3NDPA 4YP5A 1CJBA 5GTDA 4ZP1A 3DE2X 5EJ4A 1V6CA 1B2RA 1A97A 2MYPA 1MHTA 1DIGA 3WK9A 4RZXA 3NYQA 4N0EA 2VYNA 3GVXA 1LI4A 4PW0A 2HQSA 1CEEA 3K9NA 4FHFA 1T2VA 3B1YA 1PHPA 1EFHA 3R9XB 1DDOA 2IK8A 5IC5A 3DMYA 2I2CA 5LKAA 1S3SA 2PAFA 4QYWA 3L7YA 2M6RA 5ED0A 5LQSA 3I52A 3ZTYA 4DJEC 4G1VA 2DOKA 1K6XA 1N2GA 2XCLA 1NR1A 2ESRA 1NUPA 2IUYA 3LOPA 1UBFA 1SU8A 3NBKA 1QPGA 1EI9A 2WF6A 2Y99A 4HWGA 3VDMA 1YR9A 5HKLA 4KKVA 3SFTA 4RS3A 3FPSA 3GF4A 2I5PO 1PFVA 4ZVMA 1T9BA 2C9MA 3LUJA 4YJ2B 1FYFA 2V3WA 3Q9NA 4KO8A 4TROA 1JI0A 3AVXA 1YB2A 1LF0A 4U7WA 4JD5A 4URYR 4CXMA 3MSCA 4YLYA 4G8CA 1YZTA 2QJTA 3K16A 4JB2A 4OL0A 2XYGA 4JU8A 4P93A 4QC2A 4DMUB 4BMNA 5CDTA 1L8AA 4BC0A 4YHHB 2H3HA 3OHPA 3KZNA 2CE2X 4YJ3A 1MOSA 4MK4A 4O63O 3OT4A 1YWGO 1YULA 2JD2A 2XNKA 3FFXA 4XA8A 4ZPJA 4BO2A 2OHFA 3DO5A 3UHAA 4B45A 1NOJA 2RGBA 2C3UA 3AK4A 1GTRA 4CQLA 4B3RB 5K0GA 5ER6A 2P4SA 2NP6A 1Y4SA 1V8PA 2OCDA 3L0CA 4RPIA 2RGAA 2VYFA 1WM1A 2I67A 1AUQA 1T4BA 4ZAGA 2C84A 3P9XA 1FFCA 4J29A 4LJ4A 1XZBA 2J4CA 3BWXA 3GJ8A 1YKFA 4ZDJA 4DV4B 3JAKA 1G21B 3FMFA 4YC7A 3T9CA 4U2BA 3FFTA 3R7WA 4BN4A 1O5TA 4Z7OB 1KKLA 2WJWA 2DR3A 3QOWA 4LG1A 2Q7OE 2LTAA 4GKBA 4OJTA 1F3OA 1F2TB 1OF1A 4EJSC 3F6EX 1SOWA 4LF5B 1FNBA 1PW7A 1QHIA 3C41J 2VWQA 1GT91 1QV9A 2PCJA 4IJKA 1MJHA 3E58A 3MAJA 2REXB 4NEHB 4Z3DA 4MUHA 3RAGA 3K96A 2A9OA 3CKLA 2LPMA 2H92A 2QR3A 1LQ2A 3IXQA 5K8JB 2JGEA 1FJXA 2BF4A 3WQSB 4X7BA 2J67A 1P75A 2A5LA 2DULA 4TMYA 1KDPA 2I76A 4ITVA 4WADA 4K2HA 1P39A 2W6PA 3QVKA 4FCTA 5LIPA 1E2NA 1OXBB 1PFUA 4GX1A 3TBHA 3DCYA 3P19A 4GNKA 3EXAA 5K0CA 5KX5B 2PS9A 4YN3A 2PUGA 1XN1A 5JEEA 3NAGA 1QRDA 3NBXX 4QUBA 2PBRA 3PQ8A 3BMOA 4C0QC 2V96A 2WE8A 1B6GA 5IFLA 3ER6A 4XCXA 1EFRA 1Z4LA 2XY4A 3PQ3A 2Q1YA 4E3WA 1F48A 3EN0A 2FSVC 1TYBE 2QRNA 3GEEA 1DBRA 1SUDA 1XK7A 1QJCA 1BOOA 2I7CA 3BIFA 3EZLA 4U63A 3T3HA 3N76A 4MWEA 5ALIA 5FI0B 4X3PA 4N3BA 2XYRA 4NENA 4DRXA 4YCJA 2ZWIA 1M54A 2DH6A 1KVSA 5HFJA 1CJKC 4WLOA 2FZGA 1V7CA 4LX0A 2Y1LA 4GM1A 1Z8DA 9GPBA 3KIPA 5FDFA 1D4ZA 1K9VF 2WAYA 4F0JA 3VPSA 1YA6A 4I1PA 4RTQA 1PJTA 1IZYA 5ENDA 3MB5A 4W1SA 4ZMBA 1X1SA 3OQVA 3SICE 1OCEA 1GAJA 1RRMA 3BCUA 3JWGA 5AHXA 4BVKA 3ZXSA 4R9NA 4HT3B 4GPTA 4F3NA 2MSDB 1G20B 1AO3A 3OIWA 5F2KA 3ZCTA 3ET4A 3FD8A 1KDOA 4GUAA 4J0CA 4CV1A 1PUJA 4JR1A 5AD1A 2WV9A 4BNZA 1KQPA 1QE0A 2ZIZA 3OOEA 4M8NE 2CDRA 4TKMA 1WZIA 4QWMA 2WY2D 4KQMA 2G1UA 2VH5R 4X97A 4CIVA 3WV5A 1E32A 4N8SA 2BELA 4D4HA 3ZDCA 3E48A 3Q8KA 1JUDA 1NUUA 3LCCA 2PXHA 3E9CA 1N5DA 4OQXA 5EPOA 3GGOA 5EQJB 1JX6A 3AVUA 2HZBA 1PK9A 4L7QA 1DQRA 4D5GA 4DLVA 5J63A 3TSAA 4G09A 1GQQA 4RY8A 3T1OA 4C6TA 2JEYA 5EWJA 1R12A 2BI7A 2P0EA 1SEVA 2VSFA 2NO4A 2PUHA 3ACDA 4A6PA 1OB5A 4HAYA 3ETHA 1CUXA 2GEJA 2VF7A 3MA0A 2CD9A 4RULA 2Q1XA 2FB9A 4JH0A 4KC0A 1JKFA 1FX0B 3I2HA 3R20A 5BPHA 3V8NA 2EU8A 2XJ9A 2O2IA 5K09A 1NW3A 1XHEA 3TFOA 4L8LA 4O3MA 3AT1A 3KC2A 5LOVF 1QMGA 3PNMA 4RJJA 1S8AA 3MWJA 3A4LA 4LDPA 2CWWA 1J8FA 2AIRA 2J7PD 4G5GA 2VCEA 3B1FA 1S96A 3JATA 1XMXA 1XQ1A 3OFSA 2OGWA 1KMQA 3ZZMA 5JTUA 4E0BA 1KBOA 3O26A 4LN1A 2QQGA 1Y7IA 3DMFA 3ZWNA 1CRZA 4HX9A 4FB5A 1PTKA 1ADCA 5CJ2A 5EPEA 2H1HA 3IFSA 5AOAA 5AICA 5EI5A 4BO3A 3II6X 1J9EA 4KXYA 2OA0A 3SDSA 1XP8A 2Q8PA 3SK0A 5DYNA 2MIIA 4ROSA 1ZRHA 3V80A 3ZCXA 4HADA 3LWBA 4BMDA 3LLUA 1EUCA 2XUIA 3H2IA 2BEWB 3P5SA 2OZEA 4YI5A 4NXMB 1J0BA 4PXAA 1TK2A 3WLAA 4QU5A 5BUQA 1JJFA 1CB7A 1TA4A 4RHYA 2PLRA 2ZJOA 4FMCF 1AH2A 5DNUA 1LRLA 1FJHA 3OCUA 2FFHA 5KWIA 4C3UA 2XMCA 4C06A 5C8YB 2OVBA 3FJYA 5DNEA 1R74A 5BORA 3RBAA 4ON9A 1M5RA 2IBMA 3ZTWA 3MBKA 5FBQB 4S1PA 2WAAA 2NVUB 3GJZA 2I0FA 5C1OA 2O8CA 1W88B 4KXMA 4JBLA 1OGJA 2XNCA 3PT5A 3R7BA 4CYMA 5K0SA 1ADBA 1JE1A 1OTXA 5BMVA 1R18A 1GAQA 2FDCA 2ZROA 4B6JA 2PZFA 2DFPA 1KPGA 1Z07A 3NATA 4IS2A 4L5BA 2DFVA 5JOQA 2EKBA 3KHSA 1JKJA 4YCLA 1R6DA 3VFDA 4AF6A 2HJSA 4YAWA 5TVKA 4EB6A 4N01A 4HVTA 4RWZA 1Z63A 3B3JA 4NU5A 1SVKA 2YVKA 2FMTA 1IN7A 1GG9A 3AIIA 1NVXQ 3C6MA 3MFYA 2D54A 4M89A 4ZT2A 4AX8A 4DBVO 4HR7A 4F72A 3EDMA 4ZCPA 1I32A 3CEMA 3W5BA 3ONNA 4ZC1A 4PIMA 5BRAA 2WKSA 4RVOA 2RG7A 3TPFA 4WXEA 1J7JA 2MCFA 4C01A 2Z4TA 1FC0A 1OZAA 2QL9A 2X5KO 2G80A 3KUUA 1PWHA 4HFMA 4K9KA 1EFPB 3INGA 5EKXA 5H1YA 4KR7A 4DSNA 4FC6A 4KXUA 3E9YA 1XDWA 5DV9A 3FYHA 5DK6A 4YRGA 1JVSA 2FLKA 2QW0X 5J4HA 1J99A 2CVFA 2J1LA 3DOFA 5IAGA 1M34B 1MC4A 1P0PA 2Q5QA 4IICA 2W8ZA 1JAHA 4DQUA 3M3DA 2YRXA 2CBGA 4EGCB 1RAAA 3FCCA 4EHFA 3RRJA 3ZCVA 4DHEA 3NKFA 1SR8A 1WSAA 2IEDA 2X7HA 3NM4A 4E4TA 2I1LA 3FMPB 4XWTA 1VJTA 3OFJA 3U7JA 4C7XA 4ZCLA 3U17A 2X4IA 4C30A 2JLAA 1ZUHA 4QU0A 1V5GA 3DEKA 5GM2A 1TAGA 3DSRA 4P4UA 1E3SA 3TL3A 1KMNA 3FOWA 4F2WA 5LYJB 3SS9X 3RU2A 5ECYA 3IDZA 2ICAA 4WZZA 5CA1B 5H4HA 3BREA 3ZHXA 2BKLA 2LIVA 2BHLA 1A95A 4XB1A 2O8FB 1M8GA 2C03A 1SU6A 1N6NA 1DP4A 1B0ZA 1NMXA 1D2AA 1NDUA 2IZ7A 3PQFA 1M3SA 3S99A 1MH1A 5AT1A 1KHTA 2RHHA 2W8BB 3T3MB 3IJPA 3DNMA 4K86A 2BZSA 1MBZA 1CF4A 4REMA 3PCXA 3E18A 3NYIA 2NUPA 4GI7A 4YRZA 3RTBA 1BEUB 4WFKA 2IEAA 3EEYA 4F2GA 2RC6A 3PQCA 4Q7LA 4MW1A 3SXPA 3AKCA 4QJBA 4L2IA 1UC4B 3UT5B 1Z13A 4D80A 2OHGA 4OMDA 3AF1A 1N2CB 3GRKA 3TJZA 3TTTA 2O8EB 5C34B 5KZMB 1XRSB 3DE5X 1EK1A 5JD3A 3M4ZA 3U49A 1NXSA 1Z7WA 3FUVA 3QMPA 4AMBA 3QU2A 4M7WA 4FR0A 1GPWB 2OUKA 5YASA 2PZGA 3UCFA 3UYKA 3LXMA 4EEKA 4AECA 1NJ5A 1USUA 5CU7A 5JZSA 4TYPA 3OIYA 2IPOA 1ULUA 2X9GA 2IX3A 1OBVA 1YAJA 1JHDA 2HBYA 1M2WA 1H1TA 2VDUE 4TS4A 3WOHA 2H2FA 1CNFA 1ZMTA 4O4JB 1F7UA 3KT8A 1PV1A 4LRYA 3Q1LA 4CQLB 3OAAA 2ZBVA 3B6IA 3P2MA 3UWPA 1N6RA 3K1ZA 3QPUA 4MI9A 2QR2A 2WSMA 3AYXB 3FMIA 2ZKIA 3I09A 3VKHA 2MTBA 3BKXA 4P34A 4OQ4A 4NY1A 3U44B 4CEJA 4OL9A 3IJRA 2JFPA 1CR6A 3G13A 4QDJA 5BYBA 2GZRA 3BSSA 3EAQA 3M70A 4NYIR 3MJDA 4CKBB 3R5SA 3QVLA 5AQ1A 5FBVB 3N28A 3BRQA 3LPCA 3T7SA 4OP3A 2WAOA 2O14A 3P5BA 1QVRA 3A6KA 3CF4A 1XMOB 3BJZA 1QZUA 4MPRA 1G8JA 4NV1A 1ZUIA 2BFOA 2TRSB 3AF5A 3DMTA 3ZU3A 1DEAA 2X6TA 2ET6A 2AN1A 3B5EA 3QEMA 4RV9A 4E2YA 4YQZA 3E03A 4E3ZA 4B3GA 3NUQA 5AYVA 1X7WA 2EJWA 4MOWA 4UE2A 5HE9A 3VZQA 4AUNA 2MDTA 4HDSB 3VU3A 1J90A 2HIMA 2RARA 4AZ0A 5JMPA 2I6GA 1JB1A 4GGPA 5TS3A 3THWA 3QWFA 4UFNA 2GD1O 1D8AA 4O4LB 5E7IA 2VVTA 4YRDA 4Q3KA 1Q1BA 3OQIB 1PL6A 3RTAA 1D3AA 4YMTA 4M1OA 1ZBQA 2Z9CA 1II0A 4FW9A 4PEVA 1X9IA 5KYYB 1HRKA 2D2EA 1O0BA 3BB4A 4BGDA 3MJCA 3LIPA 3ZDEA 4UHFA 1R16A 5KQGA 1YRBA 3SLKA 2PH5A 4GW3A 3J7TA 4MYSA 4ZVNA 1RBMA 5BURA 4CG3A 4A4DA 4A8HA 1TMYA 3NHFA 2PBLA 1DXHA 1Z68A 4M0LA 5FFMA 1SKAA 4ETWA 5JNLA 3Q5EA 1PJBA 5CH5A 1I80A 3B5IA 2QF7A 2WJ6A 4K6HA 3NOVA 2BGMA 2WYUA 3OJFA 2V45A 3H86A 3VXKA 4HL6A 4GC5A 4ABYA 1QFMA 1U3DA 1LK5A 3P0RA 4PF1A 2IZ6A 1EX6A 2JGDB 3FPFA 4C5CA 4GRAA 3KO8A 4AC9A 5AK5A 1Q92A 2FLWA 1I33A 1V3TA 1C0LA 2WWRA 3BC1A 3TL2A 3ESYA 4PYNA 4JI3B 2XT9A 4DIKA 2X8AA 5FL7A 4Z7JA 4LFBB 3I0NA 3K70D 1CVLA 1SPXA 2HX1A 4KQKA 2X4LA 2G28A 2BFCB 2PKWA 1FTSA 3EUAA 4IXTA 2PEYA 4WASA 1DPFA 3HI4A 2Q2NA 1E2MA 4ECEA 3AR8A 3H1FA 3H1AA 4KPUB 2GNOA 1M2JA 3HCPA 4EW6A 1ECBA 4JXXA 2B6HA 1T2CA 1OI3A 3H6HA 5THXA 2QORA 1E4VA 2ZI6A 1P5ZB 3HEAA 3HYNA 3LHIA 4QL3A 3MD0A 5IZ4A 1MZVA 2R7MA 2V54A 1DVRA 2VTEA 3B48A 3GT3A 4EOGA 1WNFA 1ECCA 4B5KA 1HMPA 5E2IA 1KDZA 5JW6A 1WRBA 1ZK4A 1DAOA 2DSTA 2DX7A 4V3CA 4OXIA 3ODGA 9LDTA 2XF8A 1T9KA 1ZSVA 2X1MA 3I6MA 4XZ3A 5D1HA 4BFUA 5HBGA 4EGQA 1PO7A 2KPOA 3EARA 2GYYA 4X62B 2WOOA 3SE7A 3L8ZA 3ZIUA 4QTUB 1T4DA 3KKZA 3P9IA 3S40A 4LKOA 3CKYA 2CYCA 4LRWA 5GADl 1OBFO 3A05A 4RQUA 4YRMA 3ZWYA 1GPUA 1V9LA 3AU8A 1X2BA 1LX6A 2C4UA 1KO4A 2C2XA 2A86A 2JC3A 2ZXEA 3L04A 4MVJF 3PC4A 4I9FA 5HFNA 2OQVA 4KE9A 1V48A 1RWVA 3F98A 1LUAA 1Z5PA 4YROA 4F3KA 3ERCA 1C50A 4ML3A 1DUIA 5LA6B 2OTCA 2HMTA 4WOJA 5J1TB 3I8SA 2R48A 3VHXA 2E89A 2IS4A 3SOPA 3UYLA 2OCIA 2VCHA 4II2A 4RFSA 1XZHA 3NLLA 4UHCA 5L3RA 3IILA 5BQFA 4EB6B 5C4GB 1CZRA 4MDHA 4BLOA 3K70C 3ZZTA 5DHUA 2VT3A 3PX2A 4DVGA 2OGUA 3CPHA 4FFVA 1MDBA 3IHKA 5LZ2A 2YINC 3KJQA 3UFXB 1BMQA 1O9HA 1G8YA 3FY4A 1ECFA 3DZFA 4MROA 1EM8A 1L1QA 3BZUA 2UYHA 2IYLD 1WTAA 1M5UA 2WJIA 3SHVA 3KKLA 3FYTA 3K8YA 4PTLA 1VDMA 1ZD5A 4AL4A 1R8XA 4JVLA 1K7YA 1QOQB 2V7TA 2X2FA 4KV7A 3TZBA 2JLSA 5ALSA 1UDAA 1YOBA 3ZPXA 4P7FA 2ZVPX 3WAKA 1GVHA 4NCHA 5D6NA 3BFVA 1OASA 5FUWA 3TEJA 4JJZA 3O4FA 2JHFA 5K6TA 1IMOA 5IJZA 4RJIA 1V96A 5IVDA 3N1UA 4Y6LA 5HF9A 1D1QA 4M55A 2HZ7A 3GLIE 1GFIA 4UNQA 1R6XA 4R1SA 2ORIA 1CS0A 4D44A 1QVAA 3PHBE 4DLBA 2QN8A 2XEXA 3JZMA 4XFDA 6ABPA 3E5NA 3NWEA 2F4VB 4JJ7A 4RUKA 1ESNA 3SR4A 1YHZA 1ST3A 2VQDA 1I5RA 3B5JA 3ODPA 4C0JA 1QG0A 3A1DA 2RGWA 4R54A 2BYTA 3E9RA 4K1LA 5KYXA 2XCTB 1RXVA 2CLKB 3GDGA 4PFQA 1KBQA 2CMGA 2X3UA 5K8TA 1BXGA 1Y3BE 3ANNA 3DE6X 3CY6A 4BV8A 3PF9A 1KY2A 1B8PA 1U2DA 2QL5A 3BE8A 1DFGA 1GSIA 4YJGA 4E51A 3FNFA 3CF4G 2WA1A 1R9GA 1XKLA 4MB0A 2QJFA 3EUEA 1P9NA 3HMKA 5AUQA 2IXAA 1ECJA 4Y2HA 4X66B 3AUUA 3U3KA 3X0DA 3NYWA 5F9FA 4Z7QB 3O91A 4DQ0A 1LV7A 4BV3A 5JCZA 1TMGE 1YGYA 3GZJA 2IIQA 3K1AA 4RPJA 4EY3A 1Q3HA 1GZ4A 1TQ8A 2QOEA 3L1IA 3NH9A 3OTHA 1AK1A 1E58A 3BJMA 4L4XA 4QAQA 3AV0B 2WU0A 3ENWA 4LJ8A 2YVUA 4BNLA 5A2GA 4NCXA 1QTQA 1JR6A 2BEUA 1CZNA 2H2WA 5DBIA 1G66A 5HM8A 2VSQA 2C58A 5CFLA 2GS9A 1K0UA 5H02A 3ZWQA 1CUEA 1Z4IA 3CVYA 5C31A 1Z39A 1GVNB 1X19A 3H2YA 4H18A 5LNK1 2ID8A 4I36A 4RD4A 4Z2YA 1YF3A 1KQ3A 2AC7A 3IDSA 3BYZA 1XZFA 4QX6A 3HUFA 2LWIA 1NF8A 1US8A 1D4FA 1IY8A 2BFWA 3AFGA 4CMBA 3V4RA 4P84A 3HL0A 5JCOA 2P1ZA 3UXYA 4QYXA 1X1DA 2VNAA 5E1BA 1ZMBA 4OAOA 4LY9A 5CW1A 3LCMA 4TKZA 4ZU6X 5B3JC 5E6UA 1ZD1A 3R8CA 1EUZA 4LE2A 5A4FS 1O8CA 4XR4A 5REQB 4YRSA 5TT1A 5I5EA 5GVRA 1MAAA 2ADOA 3ABSB 2C0PA 3EF3A 2E1PA 3TW8A 3O8QA 5K3AA 3A4VA 3A3KA 1N6OA 4EG5A 3LUHA 4CIWA 1BDHA 3VR6A 3H4VA 1CQIA 2IDMA 4DBLE 2JFYA 5JLAA 1T29A 4MR7A 5JYCA 1GUAA 4BV2A 2WWTA 2UVDA 1UC9A 1K8YB 2M2IA 4CGYA 4IR7A 1IHDA 2OLJA 1WMDA 4H7PA 2G83A 3FDFA 1DELA 4NLLA 4PLPA 4Y1GA 4IHQA 3A6EA 4FN4A 3FHCB 1EH5A 3ID6C 2PKEA 1PSDA 2ZJAA 5BOSA 3MGBA 4IYJA 4FKMA 2I7TA 4N1AA 1N2CA 4IZ6A 4QYIB 4FZ3A 4WV3A 4LSGA 1AQJA 4C4ZA 4G5FA 4EEZA 2RH5A 2V7WA 2WMYA 3WA7A 4QEZA 1UBJS 4J2HA 1ENOA 4AWXA 2YWFA 1M2NA 1PG2A 4HDOB 4UTOA 1JTVA 2IY7A 2VYND 2YHUA 2NXCA 5K3CA 4XGNA 4OLFA 4X61A 2OAGA 3NKVA 4H6VA 4RAQA 1JKJB 2VF8A 2Z5VA 1BE1A 1VL0A 1I4EB 2QM3A 2J08A 3IR7A 1QH8B 4IJVA 1K0FA 4RIEA 3SZGA 5KUTA 1SUFA 1GGJA 2NZUG 2NAFA 4U7DA 4JI2B 1KDYA 4M6WB 4L78A 3O7MA 2Z95A 3QRWA 1OX5A 5JMTA 1U2PA 1KY5A 2QRPA 5KYTA 1WD7A 4QELA 2ZAMA 4R2HA 4BNJA 4NECA 3PDUA 4P4GA 2OQIA 1B6TA 1O5OA 4U7GA 2QW8A 2VYCA 5ANRB 3EAFA 3LWNA 2DECA 3KLOA 1WHTA 10MHA 2BFBB 5IAJA 2WF7A 2FPUA 3GNSA 4PZDA 3LU1A 4PN7A 5CEJA 1E69A 3QG1A 2VLIA 1NMSA 2ZR0A 2OAP1 2IELA 2SBTA 3A04A 3CG0A 3P96A 1KI6B 4GMHA 1M34A 5CVJA 3GG9A 4XSVA 1H4SA 2GF9A 3SHFA 3KOOA 1U6JA 3NNDA 2QPOA 4QSMA 1J8DA 5IN5A 4D9CA 3F6RA 5IFKA 2HK7A 3P0IA 1EQUA 2H4XA 3QF4A 2YUTA 2CEKA 3TCXB 5LP6C 2BFFB 1A4IA 1ABFA 3WIUA 3S2GA 4JB3A 4L57A 3DXFA 1C8VB 2E85A 4KR2A 4HEJA 5TARA 1CUWA 3ZWDA 4HDKB 2H5LA 1FFXB 1HT1E 3HADA 4Y6RA 5KKAA 3UXEA 1NVBA 3DE7X 4IDAA 4JEIA 2W6OA 4I3GA 4HZUB 2B92A 1CT9A 2IHZA 3SSMA 2QBYB 3AEZA 1UK8A 4M8SA 3DS8A 3O3CA 3V4FA 4FJ2A 1JHOA 4PZUA 2ZSJA 4AK9A 4QQKA 4C2TA 4BNUA 4AKEA 4BVFA 1VLHA 1U8FO 3UUFA 5KNLA 1DKLA 1T26A 1SXQA 4MV9A 4KUEA 3K1YA 1Z18A 3CFYA 3HGMA 2BI4A 3HPQA 4JKYA 1E2UA 2TMKA 5EXEA 4A1FA 1CZLA 3UK1A 3OETA 1DFHA 3SJUA 2Z6QA 1KZ7B 5CXQA 1WCXA 1YUBA 4GE3A 1V16A 1LSJA 3BGWA 1OLXA 3OEEA 5T4EA 6LDHA 4ZVSA 2ENWA 2J7KA 1GUBA 4G0QA 3AMVA 2A5DA 4KAXA 2GFIA 4BLRA 1U9YA 1ML4A 5DYTA 1RHMA 2XXBA 2QJRA 4X91A 1CUYA 4UVIA 2CB9A 5AVJA 3VZPA 2NZWA 3ORRA 2CMHA 4LMAA 1YRQA 3GJQA 2BKAA 1LK7A 2H51A 2OHHA 4D57A 4MWCA 5FI3A 2KX7A 4KIWA 3TE6A 3FUUA 3FI9A 1I2AA 4IBOA 1BRMA 1PR2A 2NV0A 2YMPA 2OCAA 3AEUB 5KTNA 2CJPA 3K5HA 3OLVA 4MV5A 3D6VA 4IX9A 1T2DA 1QCYA 2ASEA 4DEYA 4UMFA 3ESRA 2C4TA 3SYRA 1X77A 2OV3A 1QU3A 4YUXA 4GQBA 4A0HA 2AG1A 2FAXA 4ZQBA 4P35A 1LU9A 3KFVA 3TQOA 1MF7A 2Z58A 4JCCA 3QPWA 5D85A 3SBDA 1WV1A 1NM5A 3W6NA 4IGEA 4EG7A 3GZ4A 1H2HA 2QTNA 3B1JA 4FGJA 4YRAA 1D2MA 3JV7A 2HOQA 1KIFA 5JJ5A 5H9WA 3I2FA 1PT8A 2HL6A 4F5ZA 2QTVA 2VJQA 3TYXA 4TWRA 3D5QA 2B8EA 4DSOA 2PGJA 2AE2A 2P78A 3EVTA 4NFLA 3ZX5A 5C1PA 1GHTA 4CM8A 3PI6A 2JIZA 4ZTBA 2WUFA 3U39A 5CP8A 5DISB 1OT3A 2C20A 3N8GA 2F62A 1VHWA 2QL7A 5D7NA 1YR1A 4HB4A 3AHDA 3ZWKA 2Q3EA 3QUCA 1ZVQA 4C89A 1FK8A 2GZ3A 2IV7A 3WICA 3OEHD 2X86A 4YJ2A 2QJOA 2C3OA 4MWOA 1N9KA 3D6TB 1L4EA 1Q95A 1ZH4A 4GX5A 4BCBA 2C8LA 2JI8A 1VKZA 1LY1A 1G42A 2C88A 2HDOA 3FNQA 3GPIA 3K35A 3RYCB 4MRNA 2V7XA 2EIXA 4QPZA 5F52A 3E53A 1K06A 5BWBA 1JFFB 1XALA 4N5LA 2B83A 3VOSA 3GJ6A 5I7OA 2YMLA 1VIDA 2Z8YM 3VGJA 3DFUA 2YYZA 2ZYGA 3IBYA 4H60A 3R3WA 4CN9A 1C9KA 4S3MA 1Z75A 5BSTA 4YO8A 2ON6A 3RSZA 3P0JA 2ZE7A 1ISMA 1OXVA 3VC3A 5C2JB 3KB6A 1ZKDA 2O8NA 3IPAA 4G0NA 2R1VB 1RTKA 1AKYA 1EFUA 5CXSA 1V3VA 1OFUA 3MEQA 1QHFA 1XUOA 1C9NA 4WLFA 4MW9A 4NL4H 3WKDA 1YSCA 1KDRA 1ULTA 1WCIA 5BQ3A 4RHXA 5GINE 4UBJA 1U6KA 4A26A 2RGEA 1BU8A 3WHKA 2XMQA 3A2KA 4BFZA 1XVUA 1ZZGA 2E2WA 2EJTA 4NJEB 1CV2A 1QTIA 2QUKA 1IXYA 1JIKA 2B34A 3WJ7A 4U2CA 3GN1A 1QO9A 1JDVA 4PYMA 4QPPA 2FUEA 4R1OA 4DR5B 3Q85A 2OLEA 2D1SA 2EEZA 1NSTA 1ZC3A 2P4QA 2PH3A 4ZTUB 1CZKA 5H59A 1N2HA 4GLBA 4YJKA 4J3FA 4LOJA 4ALKA 4EX6A 1NVDA 3K9FC 3JD1A 1FRVA 5D1NA 3A1EA 3K1TA 2JIDA 3KOXA 4Q9KA 1FRQA 4L74A 5H3LA 3U09A 3MAAC 4WNCA 1G3IA 3FPAA 4EGFA 2AZXA 4I1IA 1TAUA 3S70A 4EZBA 5KYYA 3UHFA 4EBBA 5JWOA 2H8KA 1CQIB 1YUNA 3GRCA 1A8UA 2VHYA 4ZFNA 2QRVB 4OSPA 4N0QA 3OHSX 1H22A 2PX3A 3I5MA 1PG0A 3AETA 1ZIYA 8MHTA 1FU8A 5KJFA 1C4XA 5DZSA 4X00A 4R2MA 2EJCA 5G1OA 1J23A 4J9UE 4QOSA 2PMCA 4UUPA 3O4RA 4RM2A 1N5OX 3HRIA 3RANA 4ZKEA 2OXRA 1ODFA 1UBKS 1VJCA 2PD3A 3DW3X 5G3YA 5DIZA 3LXXA 2P27A 4YX9A 1P45A 3IVXA 4J0IA 3FF1A 1PQ4A 2XVYA 4LYYA 5KTOA 3SFVA 5FTWA 4ZVLA 4DDVA 5LP1A 2HKIA 1P7YA 3AM1A 4HDMB 1XTJA 1JLKA 4QGAA 4XGQA 5EG5A 4QQ8A 2EW1A 1IN8A 2C5GA 5LNK6 5DKFA 1XTSA 1ADGA 4TL7A 4DNOA 3ZVKA 1DX6A 4KQWA 3OBIA 1KWGA 1VIMA 2PEZA 2BBWA 2YUIA 4F4CA 4NAUA 1YQQA 3GFPA 2B4AA 3IA7A 4EF4A 4JBWA 3K0AA 2WJAA 3VR2A 3SY8A 5C3UA 4ND2A 1W85A 2NN3C 2VQSA 5BR8B 4YECA 5JHHB 4Y18A 1HNXB 1V95A 2FHSA 1T9AA 3HZZA 3VAAA 5L7TA 2XSZA 4HGOA 5HIAA 4O0MA 3GP5A 5JBQA 3VPBA 4P32A 1SGWA 2BFBA 5B36A 1G38A 4HCJA 4J1TA 5JXHA 2NYVA 4NYJQ 2A92A 1AGRA 4KE8A 4TTIA 4UBIA 4G4GA 4OSEA 2GEUA 2IC5A 2JGRA 4RY2A 2XITA 2VZEA 1JZSA 2IE0A 3RRNA 3V2HA 2BP7B 3SF8B 4GI5A 3DBOB 4WTOA 3A14A 4OIFA 4EB0A 1C7JA 3ETEA 4UBMA 4WW0A 2M6SA 2Y6VA 4DXDA 1PHRA 2X5OA 3MHTA 3PCRB 2OO5A 4OXNA 5FR1A 4YCMA 1W44A 2PRJA 1XMVA 2RC5A 3KAJA 3V3KA 4YCSA 2NIPA 5EZYB 2CJWB 1NNUA 2C9DA 3ON5A 1KI1A 4C4XA 4TX1A 2FMXA 2XE8A 3ZJVA 1E2JA 4O4LA 3OPQA 4BB5A 1UK9A 2PGOA 1SZDA 1Z5NA 4XGIA 1AIPA 2JB9A 4IRMA 1AUOA 3ZLBA 3EC2A 1SUSA 2OZVA 3IULA 4D82A 4QA9A 4HDKA 3JATB 5L95A 4HAIA 1C1XA 1T1SA 2NGRA 5AVOA 2HA0A 1VSQA 2XTJA 2JF0A 4AXBA 5JFOA 3FMGA 5D7BA 4YJHA 3NP9A 1NMZA 1Q12A 1WX1A 4ZXPA 4IRXA 1UFOA 3HBLA 3QW2A 1NW9B 3A27A 2GYUA 3R6WA 4S1VA 5IVKA 1JU9A 1ZESA 5IUJC 4WGGA 3SSAA 4R05A 3M83A 4YRIA 2AN9A 4O4IF 4U0JA 1YQDA 1EDEA 3N7TA 4JJ6A 3RIMA 3UTDA 2O7QA 4X60A 1VDZA 2G36A 4ZO6A 5HF8A 2EP7A 2QWXA 4RYLA 1XDZA 1G1AA 1BH6A 1U11A 3HBNA 1MO5A 4WN9B 2O7VA 1J0CA 3FVWA 3LKZA 5LD2B 5T7BA 2FWJA 4UNNA 1D7OA 1P6QA 2ZULA 2W2TA 1ZM4A 4IIGA 1HYGA 4XDYA 1XLTC 2NM0A 3B82A 2G07A 3KM0A 5DHAA 3ZJYA 3RRYA 3CF0A 4DMCA 1U7DA 1D9XA 1T25A 2HSJA 2QLFA 2WJGA 4Z49A 4DM7A 1CUGA 1F0NA 1RCUA 2GO7A 1ELOA 2G1JA 3GEIA 3T54A 1AUVA 1Y3DE 2R9VA 2MINB 2YOFA 2NU8B 1K75A 5AI8A 4KCGA 5ENZA 3WL6A 1ESMA 2RHJA 1W2WB 2HRZA 3AEUA 4RFVA 4ZOQI 1EDDA 1I1HA 2OESA 4V39A 4WNAA 4Y6QA 5EE1A 3RO7A 4BO6A 4F96A 2FPLA 3OLWA 3IL2A 4A5OA 4B48A 4YT5A 5LJIA 5AW0A 1K7SN 4C76A 2VAVA 3INYA 9LDBA 3DMRA 3K05A 2BHNA 4ZQGA 3JQ9C 3UIEA 5F7XA 5LQDA 2NXNA 2VT2A 4Z99A 2V7PA 2CLMB 4R1NA 2XDQA 3BICA 3PFKA 3IQEA 3RUAA 3TSOA 5DHTA 4DQLA 5K9ZA 4PE5B 2QVCA 4NFYA 2JJYA 3KDAA 5KQSA 4BNIA 3FE2A 4P3KA 1Z28A 2BE7A 1E0KA 1JJVA 2OCYC 3NX4A 4R98A 3KK0A 5F1KA 1VPEA 1UJNA 2XGOA 1R0SA 3MB8A 4FGKA 4DBLC 5G1PA 1KMMA 1LBIA 3GX1A 1EKXA 3ACBA 3HU3A 3L0IB 3NHSA 4Q1CA 5BQXA 5KWSA 1BMDA 4U8HA 4RZQA 4G0XA 4XVCA 2GVDC 4D8XA 4JL8A 4E5YA 2C7GA 1YAHA 3RS7A 1DAFA 4DDMA 3KAQA 1MJNA 4XD7A 1PJ8A 3H5TA 4B6RA 1DTWA 3ENNA 1UJ4A 1NW5A 4YAUA 4ZZ0A 3CVUA 5EHGA 1Z88A 2PWAA 4PHCA 4Q7EA 2GGSA 3DCJA 4MRVA 2GCNA 3NHZA 5HA5A 1XD2B 2B8TA 2GHTA 2ONYA 2PY6A 1AN9A 2XTMA 4MUJA 4KODA 4M9SA 4DNPA 4UTVA 3HK2A 5HK9A 3KQQA 5AVZA 2PSHA 2VUIB 3L7AA 5FEUA 4BUJA 3VC7A 1KQGA 3GIDA 1GXSB 1II9A 3EHDA 3FJOA 4QOHA 2ORED 3QM1A 2BR5A 4XWYA 3N2LA 1YBFA 4FI3C 3UMRA 4BJ3A 5JXGA 2X2EA 2ZTUA 3CVJA 4DG9A 4ESVA 4BATA 5DCYA 3WGZA 3FPCA 2VG8A 2OGSA 2W83A 4ZHQA 1GV1A 4CE6A 2AL7A 1E5QA 3N8DA 1FSFA 2GZ2A 1HGXA 1HEYA 5ALYA 2ECKA 3LTEA 4IMPA 2XGJA 4GH5A 2QMYA 4X44A 2CCGA 4TQGA 3OA2A 2FFJA 4GICA 2ZYUX 5EVJA 1ILWA 5C35A 2CFRA 4XJSA 3AU9A 4B3TB 3T3NA 1QMPA 5BOSB 4WCFC 4H7FA 5AKZA 1W5SA 1E9SA 4JUIA 2WM3A 3E7XA 5DHPA 3ZBTA 4CKCA 1FU7A 3FTFA 4Q21A 3WKEA 5IX8A 1CQJA 3FPBA 4DWJA 2POCA 3K8QA 1SBCA 1INLA 3LC1O 3NALA 6Q21A 3VPGA 4JLOA 1AY0A 2RIPA 2IYOA 4GX2A 4W1RA 4C1BA 3DAPA 4XLLA 1LLUA 3HDTA 3MTGA 1X8JA 1XHFA 2I3BA 1J2TA 1QZZA 1QH8A 3JQPA 3W9SA 2C92A 3SJAA 2ODTX 2GB4A 1P80A 1H8HD 1JYFA 2DWQA 2C2KA 3BRSA 1QS0A 3JYNA 4I6EA 3UCXA 3WL3A 4BLQA 1S2LA 4TZKA 5AK0A 4AYTA 4WUTA 3LUBA 1GLGA 1PF7E 1CDZA 1LPAB 1YC2A 3CH5A 3E22A 4CKEA 3U1TA 1OPRA 3F2VA 1ZA2A 2NQ8A 3IAAA 3NEYA 1KEUA 1U9ZA 2WE7A 4GS5A 1M1NB 1QGED 2VZ0A 3GFRA 4HNAB 3VR2D 3QKTA 1ZGAA 4DLLA 5LOVA 3EXIA 2ACEA 1V16B 1AXRA 5ELXA 5E9JA 2EFHB 5EZQA 4B6EA 1A8IA 2FMKA 4BY9E 3EZ7A 2ROQA 4B83A 3DF9A 2RGRA 3L82B 1GZ3A 4MWGA 1XAHA 2ZR9A 4PYKA 1ICEA 3FVVA 3I4FA 2PMBA 4MLPA 3SS7X 3AQIA 3K9QO 4EFMA 1ECPA 3NJRA 4UTZA 2XMDA 4KZKA 4PLCA 4BNMA 4MW6A 2HSEA 4YRBA 4NCIA 2UZ1A 3DKPA 3OC0A 1WQ3A 2IODA 4LPSA 1XZKA 2OM6A 3UGKA 4O4IA 4AN4A 2B3TA 4JWTA 2HBZA 4JNKA 3IQWA 1WMSA 3KJIA 4PLGA 4E5SA 3ZDAA 2ZSHA 1LFAA 4IXNA 4ZVKA 2B1JA 3GFOA 5KYVA 4CBVA 5TMEA 4UBOA 1PI3A 4IZOA 4RXUA 2H29A 4D9KA 5HTOA 2OMEA 4IP0A 4MR9A 1TA9A 2FEAA 2R2AA 3IYLW 3QVSA 5K6AA 1J0XO 1DJNA 2NO0A 3T4UA 3KT0A 5LP6B 5DWVA 1GZHB 5JCPA 1TQDA 3CT6A 3QX9A 4C7JA 2BWJA 3KTFA 1OSNA 3L46A 4US2R 3IXLA 2YN0A 2WTXA 2AX4A 2DKOA 3IAFA 3ROQA 4X7RA 3JQFC 2H3EA 2BCGY 4L5JA 5I7SA 3NDIA 3L0BA 3TOXA 4W5OA 1JWLA 4N8EA 2R5NA 4JAVC 2HQBA 3ABZA 3OMXA 3HLKA 5CEEA 1IHOA 3UT5A 3KBOA 2J3IA 4KJZA 1SA0B 1OFHA 4AZVA 1GTSA 2NU9B 2Y0CA 3DXZA 4FDLA 1PSZA 1QC5A 3FA2A 4HQNA 3S27A 4RLFA 3HH8A 4PVCA 2F7SA 3G0CA 3QXHA 3ZHTA 3DKVA 3GLTA 3CUYA 4INJA 4B8YA 4PLYA 1EYZA 1KY4A 2WT4A 4I9UA 2QD3A 2GZHA 3ONVA 2AQIA 5A62A 3R77A 4Q6WA 3BRWA 3D1JA 1GKYA 1KNQA 3BXEA 2P6RA 2REQB 3ZD8A 1QHNA 2F00A 1H6CA 2J3EA 1TD9A 3UBMA 1IE3A 5L51A 3HTXA 3KXIA 1NXOA 4L7VA 1L3BA 1SVMA 2D7JA 1NU8A 1UADA 2BFCA 1VIYA 3EVCA 1B16A 1GPLA 3HMQA 1WLYA 4MCIA 4JBGA 1AKRA 3GLQA 4DLRA 4QGGA 2FRDA 5HZMA 2NZ2A 3QE4A 2XKJE 2C07A 4L0QA 3VTAA 1UFKA 3PTLA 2P9ZA 2IWRA 4WA8A 3OECA 1Q3TA 5SYNA 2FX3A 3NV9A 1JR2A 4MUNA 3WB2A 5E6RB 2FPGB 1T35A 1KFCB 2BPOA 4RVSA 2OV4A 2IEYA 3CNEA 2P67A 1LLFA 3QWAA 3S68A 3QVTA 4FWIB 1R1DA 2UVPA 5AM3A 3CWCA 2P90A 1TKAA 3NJ4A 2W2VA 3HFRA 5CK4A 2OZLA 2V1XA 3N74A 4YCAA 2Q7DA 5JQGF 2DJ5A 5C0OE 3LI2A 1QRSA 2F8TA 1SXJD 3ZGVA 1II8A 2X14A 5J2TA 3RRBA 1PLKA 5JQWA 3THYB 4URZR 3DWGA 3VH2A 4I1OA 1Y80A 1XU4A 2UYOA 4TM8A 3L77A 2OBXA 4BQOA 4JHLA 5E9QA 3HJAA 2PHZA 2XUOA 3V4SA 4YH1A 3CU5A 2XUDA 4UULA 4TPKA 5JCJA 4LZLA 4MB6A 5MHTA 1C81A 4FVTA 2YCBA 3IP9A 5UKDA 3A9CA 1OWMA 4JEUA 2KW5A 4C05A 1N0WA 1PV2A 2VWHA 1RZRA 2Z08A 2OD9A 5D6OA 5THKA 4ZTZB 2ORWA 2XEDA 3EZFA 4JUAA 3WTCA 5CLJA 3KB2A 4N0MA 3WFIA 4BVGA 2E82A 5FA6A 1O3YA 1QDUA 3E15A 4IYRA 4MUGA 3E4CA 1JN0A 1H5QA 3AYZB 2FVXA 1WXWA 1EJ2A 5A5VA 2IHNA 3ZCUA 3QPCA 5KMGA 3B13B 4PANA 4OI0A 2DCMA 1FQKA 1F8UA 4YYEA 4LZOA 3U6KA 3NVKI 1G20E 4ZAFA 1H69A 5BVGB 5CDSA 3O2SB 4X63A 5KJ6A 2WSYB 1TECE 1L5YA 3RF7A 3EA0A 2I8LA 2EVWX 4DZRA 1CUCA 4PBRA 2LCQA 3RVSA 4B6FA 1QGOA 3KWFA 1QHSA 4ID9A 4NZOA 1CYEA 1NYTA 2PGXA 4AMVA 4EDHA 3FPLA 3L6UA 5A6SA 3RYIB 1Z4KA 2PX4A 2H1OA 3T3GA 5E8JA 5HKOA 2A9KA 1YFKA 3KDPA 4I3HA 4W9MC 3QUTA 3V1UA 2KMLA 1PR4A 2W98A 3H8SA 3KEQA 4IIFA 1G6OA 2RH9B 3QHAA 3RUCA 3QKUA 4QGFA 4B6OA 5A3JA 3CG4A 4BO5A 2W9XA 3N5CA 4KGZA 4RACA 1IVNA 5B58T 4MVXA 5HPYB 1DKPA 1JDBC 3PNQA 1F5NA 2AXPA 3FN4A 4KPUA 3VU9B 3KPVA 5KAPA 1MOZA 2NO5A 2XT6A 3U3RA 1VG0B 2REOA 3LQ1A 3MLAA 2K2WA 1GG8A 1O03A 1EM6A 1W4ZA 1G8PA 1Z74A 3QFRA 4LZWA 1AK9A 4K0KB 2CF6A 2DU8A 3D7SA 1ZFNA 2Q0SA 5CLQA 3AUTA 1QYVA 2NMVA 4FDTA 2A5JA 5AFSA 4UOZA 1HUQA 5ECDA 5JMOA 4CTNA 2D2XA 5GV8A 2ZUUA 1K5GA 2OXCA 4BFLA 1P1HA 4O25A 3P97A 1DUVG 5IK2D 2UZ3A 4O2AB 1Y33E 2HRDA 5L3QA 3TZCA 4G1BA 4WN3A 1MT3A 1SZJG 4R8SA 5LA6F 3UH1A 1OYVA 4E11A 4FFDA 5BV1A 1SCUA 4AJIA 3R40A 4J49A 3V4PB 1HYBA 1Y4ZA 1DT3A 1O57A 4HNSA 1LDGA 5M7EA 4WH0A 1ZOPA 3OIVA 2ZJ1A 4LZNA 3IUJA 2RHTA 1DMRA 3H9GA 4Y6OA 4YAKA 5EWLB 1Q7TA 1ZXXA 3WYBA 1RKBA 3F67A 3RTEA 1T43A 5KWVA 2NSYA 4J4BA 2BFNA 4OK6A 3BCRA 2AI3A 5DW0A 2FPRA 4EX7A 2Q2QA 5JBNA 3FUXA 4PSKA 1I3CA 1MFZA 3SZ3A 4JASB 1SKBA 1UC5B 1CVRA 2OHJA 2V5AA 4MUYA 2ZWPA 1D6JA 3WB0A 4AO8A 5EJ9A 4PBTA 1A5TA 3NVAA 1WF3A 1N3YA 4AJLA 4YIHA 3F71A 5ALGA 2EW2A 3E3LA 2BKUA 1YZHA 3H6KA 3HU1A 3WMEA 4H17A 1Z2PX 1P5FA 2X4GA 3FVQA 3W8DA 3GP3A 1WW8A 3N0VA 3IP5A 3N75A 2P7IA 2EBHX 3SAJA 3G49A 3ZEAA 4Z7NB 3WYFA 3H2BA 1YKSA 4AAYA 1G8SA 5BYJA 3HYSA 3M3HA 2RCYA 4M1ZA 5A0FA 5GGXA 1R4MB 3FWNA 2XD4A 3M3PA 4KX5A 1XMSA 4MV1A 3CZQA 1SUIA 4Q15A 2VHCA 2PYZA 5ALWA 4PHHA 1EDZA 1E3DA 2WSSA 2DBYA 3MOIA 2AJCA 1QVWA 5IK2A 4D3YA 1Y9ZA 4O2AF 2QKYA 4BC1A 4BKOA 4GKVA 3I32A 1RMYA 2EHDA 2HPAA 3E5MA 3SDBA 3UVEA 1MAWA 4DYVA 3HE3A 2AV6A 2C5EA 4MIOA 1UAAA 4RTLA 1ODKA 2H2GA 5MGNA 3GLGA 3OF2A 3NANA 4HV4A 1GYQA 1D0SA 2PT9A 2FFRA 3O95A 1W0KA 3RS2A 3EPLA 1FFWA 1ZSYA 2GXAA 5KYWA 2LIPA 4JUDX 5F7JA 2G40A 2QRMA 1XVIA 4RFLA 3TLZA 1VE5A 1R4NA 1SBQA 3B38A 1NI4A 3I6YA 1U1CA 3X1YA 2FH5B 1NLUA 2A58A 5JRZA 2IYNA 4I9GA 3SLRA 2GRAA 2CXXA 1G8MA 2W22A 3OUUA 4UDYX 3RC9A 1RP7A 4HDNA 5HILA 1QK3A 3H5OA 2Y92A 5HQ3B 3DBLB 1AA6A 1BDIA 4UQPA 4M1MA 2RI0A 2OFOA 4O59O 1BKYA 1TVCA 1KI9A 4D43A 1D5CA 4CT0A 3OX2A 4Q1BA 1QR6A 3QLEA 2WU1A 3L1HA 2R751 4CL3A 3R3VA 3A6PC 2Q5EA 4HZGA 4KMRA 1RP1A 1E9RA 1SKYB 4AUMA 5KJCA 4P36A 1WDMA 2B98A 1CZHA 3ROKA 1UM9A 3PUXA 3M1LA 4FB4A 1DDIA 3VTZA 1FP6A 1U0LA 2BN4A 4O3FA 5BN3B 2G1KA 3IXMA 3IEIA 2RBEA 3U5ZB 2PUDA 1HDZA 5LD2C 1T1RA 3IODA 3EDRA 4F7DA 4JXZA 3TDMA 3P94A 2GAJA 3H18A 3DDZX 3P27A 4OUDB 3RS9A 4F5EA 4F6LA 2ZIXB 3ANLA 2YJZA 3GJ3A 1AGXA 4X1YB 3HKBB 3M6IA 3OQMA 1EGHA 1E1CA 3P9YA 2C1ZA 4PVDA 4AJ4A 2H1SA 4BE4A 4U39A 3T1HB 3L06A 3HKDB 1FFXA 3CZ5A 1A72A 2Q4DA 1IRXA 1W48A 1KMHB 2X7JA 4N48A 4CEIB 1T2AA 1Q0UA 1DQNA 5AM5A 1XZEA 2HLHA 3SVTA 2VYQA 2JFOA 2O0MA 2W4IA 4LVUA 4PX2A 5BNZA 4B1FA 3HLYA 3OCCA 3REGA 2QSYA 3O8RA 5A4IS 2E4WA 5HK8A 3V8EA 2XB2A 3EZXA 1LF5A 1SVUA 2ONKA 3ASUA 3CWZA 2HEGA 2JI7A 1JDUA 3QITA 1ZN8A 4QJIA 2A5GA 5K0LA 5B53A 1L9XA 2H1VA 4CKCB 4C2UA 4D4MA 3DPIA 4RNCA 1XEFA 3KQMA 5FRDA 3ZLJA 5DTJA 3V8MA 5ALTA 2RHBA 3I01A 1MABA 3Q7PA 1GZ5A 1P0QA 4X1IA 1Z3IX 4QYMA 4LJYA 2J3DA 1P0CA 2FW7A 3X2FA 3FKJA 3I8XA 3E5HA 5LZ7A 2IXDA 3MMXA 1GY8A 3MUFA 1I3MA 3AR3A 2DLDA 2NVWA 5SY9A 2GJAA 3NIBA 2ACVA 3A2MA 5BRNA 3S2EA 1JFSA 1TA0A 3QP9A 2WWYA 3HJCA 3PHGA 4KYTA 3E05A 2MMGA 4FDMA 5CT4A 1RABA 1NKVA 2ZAIA 3P2JA 3QHQA 4ZI7B 4BRSA 4BEVA 1UXKA 4MHOA 1LDYA 3K8ZA 1MX5A 3DEZA 4DVJA 2JZNA 4O08A 3LBAA 4B9AA 2V55B 1CP2A 4LNUA 3MG9A 3URKA 1SKMA 2QTMA 1LB1B 4F6RB 3SF0A 1C0KA 1RHQA 1RZ3A 4MVJH 2F1HA 1T5IA 1ESCA 1XLWA 3QTBA 3GNQA 2A33A 1Y63A 5JXIA 2JVKA 3DV0A 1R0BA 2AEEA 2ZE6A 5I9NA 1ZRNA 2I6UA 1PFYA 3RRZA 1O94C 4WOCA 1ZH2A 3G17A 2QE7A 2CXRA 1C1DA 2RHCA 1RAEA 4M9XA 1YGPA 3EA5A 3QKIA 2EOAA 3HP4A 3CLRD 1CX9B 1R0KA 2GN9A 3PENA 1I4OA 5FPQA 2X1VA 3A6FA 3CISA 4GUDA 5AVYA 2OVFA 2P11A 1SKQA 4MS1A 3OLZA 4ZOEA 3HCEA 2AYYA 4YCDA 4OKIA 1FUIA 4KE7A 3VKGA 1BKDR 1Q1NA 1HDIA 1R3DA 3JYPA 4KQEA 2EGUA 2Q4RA 3LX5A 2JCXA 2A6PA 4RVCA 4YRNA 2C7QA 4H0NA 5CX4A 1AD2A 3DV2A 1ZAYA 1J9GA 1EQ2A 3A7EA 1FQJA 1WDWB 5JPCA 2IDZA 1CXZA 3FOEC 4G0OA 1QNLA 4RE6A 1RXSA 5TPWB 1MHPA 1V9CA 2CUKA 5DBOA 2D3WA 5IF9A 1BA3A 5GVSA 4A15A 1K4MA 4DRZA 4LXQA 1ZINA 3REOA 1FQOA 2FJUA 2VDWA 3E84A 2JLWA 3AOEA 4L27A 1CUZA 1QUFA 1TLLA 3PXGA 4NI5A 1OLSB 4FIDA 3CE6A 2RJNA 5LXTF 1G9XA 5TPZD 1W59A 2LV8A 3C3YA 2GAFA 3L6CA 4FZVA 1XZJA 4AS3A 2GNAA 4PG8A 4YUYA 2YZ2A 3GGJA 4W8OA 3TW4A 1JRLA 1LDNA 1XL1A 3RRFA 2XWPA 2UAGA 1PS0A 9ABPA 3G2NA 2IIBA 4HZIA 2JVIA 5ICEA 4HPJB 3K32A 1GTMA 3HNPA 3LLVA 2RK6A 3MD9A 5ICCA 3JZIA 2QUZA 4TUYB 4PRLA 3F6PA 2NAPA 1CJCA 4UEJA 5DU2A 3PGKA 1PYOA 1CW2B 4KHPB 4MP3A 4Q9LA 2ZKLA 1GZVA 1W6UA 3PQ4A 1U4SA 1DTSA 1USKA 1T6NA 4RLHA 1O6FA 4UVGA 3DTVA 1E96A 3M6AA 3PXCX 1H8HA 1QX3A 4ZYVA 4Z4QA 3VZRA 2QBYA 4AY2A 1O95C 1Z47A 3NS7A 2IY9A 2GPTA 5KDLA 4ZCTA 4FFPA 4MWDA 3UV7A 1A88A 2OZPA 1UWCA 3DC7A 1IZ8A 1DB3A 1K3FA 3D43A 1L1EA 3DDCA 4J0GA 4MQBA 5LKRA 3OCWA 2F67A 2SKCA 2GEFA 1AQIA 4DFDA 2O5EA 1GAXA 5ENVA 2HD4A 4BN5A 2GJKA 1S01A 2WTNA 4EKDA 2NU9A 3QA3E 3LK6A 3M6VA 4IFIA 1C4WA 4PAMA 1EZ1A 1ZCBA 4PONA 3EXFB 4HFRA 4OHXA 3PUHA 1SU7A 5LXTB 1O0SA 2CDCA 1ZITA 3ITEA 4MGIR 2HEIA 4O29A 5JTTA 2HJRA 4EHLA 4Q9HA 3UPDA 1OXXK 3DMGA 4BVJA 3COJA 3RBVA 4R1UA 2W6MA 4IHJB 3WG9A 5L53A 4FBGA 5HQTA 1VZ3A 1TO1E 1ISGA 2FZLA 4L4SA 4LOLA 4O8CA 4UCQA 1BKSB 4DNQA 1G63A 5B57C 4ITUA 3GCXA 5DOZA 3BULA 1M34E 3CVWA 1I3NA 4ZO7A 2MHCA 4NMMA 2OXEA 2HMVA 2VT6A 4M0PA 2OORA 1R9JA 4M49A 4BNDA 1Q1QA 1JPUA 1F4PA 5AIBA 1OFIA 5JCXA 5JNVA 1MNQA 3W5CA 4NENB 2VP5A 3IVGA 1V39A 5HUHA 1QM5A 1V3QE 3VBEA 1SWVA 3KFLA 4MKGA 1UBSB 5EMKA 5EKSA 2DFNA 2OYSA 4DDHA 5B6JA 2JLCA 1IB6A 2IYEA 4OXYA 3KLBA 2VDKB 2E4AA 3KJNA 4PFJA 5SY6A 4AULA 2Q28A 2CSXA 2J9FA 2YV3A 3NC0C 1KHHA 5KO2A 3R7FA 4JC4A 4ZT6A 2LP4Y 2QVZX 3HJUA 4A8JB 3THYA 2WIBA 3C7DB 3HVJA 3OKAA 2AOUA 4LCBA 1WXGA 3D3WB 3ONEA 3M4NA 2WP0A 4OPMA 4LPKA 1OA0A 1TJ3A 1JQJC 1Q6ZA 1V43A 4BLUA 4UTXA 3WMFA 2VAMA 1M2HA 3L1UA 4AG6A 3MLEA 5EZYF 1WBBA 3UG6A 1DPGA 1JHMA 2HLPA 2ZJ3A 1JAXA 1OGYA 3WLOA 1X86B 3I9LA 3I64A 3CRMA 3T1VA 4DBZA 1E2PA 3AJDA 3ANTA 3HR7A 4JJFA 3LBNA 1KS2A 1QGUA 5G0SA 2GDJA 2JFZA 2QG4A 1DMSA 2UZ0A 3I73A 1WZNA 1RI1A 2AFHA 1QQTA 1S8OA 2W2XA 2ZJ6A 3CCFA 3MINB 4GZMA 5A5DA 1Z12A 2QRLA 1NV9A 3REQB 1EGAA 1ETUA 1ZKMA 1XZIA 2BFAA 2ZT8A 3BOSA 3EWAA 3PUIA 3QKSB 4R2XA 5FFNA 1QFZA 4C6TB 1ESEA 2EWWA 1BU5A 4LZPA 4DV2B 2C2BA 3GLRA 5IJ9B 4J0HA 3PGXA 5E95A 1COWA 4R1PA 5HKAA 1PAUA 1NC1A 1U9CA 2HDHA 3BF7A 2ZYDA 1TF2A 4IJMA 4DLWA 3TLGA 3N3BC 2HUPA 4WWHA 1KJJA 4CQMD 5F9MA 5KAMA 1SVLA 5JVDB 1K8RA 3AOEC 4Q82A 3NAZA 5AWFC 4BKUA 3KJXA 5KJEA 5D3MB 2N9UA 1GCIA 2FEPA 2XCUA 3V55A 4YRJA 2PO5A 5HZKA 1NVFA 2NZXA 4CCAA 4R51A 2EP8A 4PLFA 2H4FA 1X8LA 5I7RA 2Q99A 1UK7A 4YGYA 4RY9A 5EEGA 2PFKA 2YW2A 1YRYE 4JVMA 1Q6YA 4MQ6A 4Q37A 4UEOA 1E2IA 1E1DA 3E9MA 6GPBA 4J7AA 4DMLA 4JC5A 1C14A 3KKQA 4GMDA 3RIEA 4RMHA 4HX2A 1RPJA 1FZQA 3DMTC 3A37A 3U60B 4JLKA 1NLMA 5DBFA 3T7RA 4QTXA 1CEQA 2DPYA 2V0CA 3Q11A 3OZRA 1HL3A 3OEHA 3IQFA 1Y9DA 1NV8A 1BE6A 3FWHA 1JDBB 3KE8A 3PXUA 4KWEA 3RUEA 4RIIA 4A2PA 5JDIC 2VJLA 4XCVA 4EY7A 2D2FA 1FLDA 2D1TA 2X8BA 3IT1A 5CJPA 5KOIA 1OMOA 3PUJA 1IWPB 2OZKA 5AO9A 2WD9A 5C8ZA 2VZ9A 4MZDA 2C2GA 3C15C 1PE0A 3D3KA 5SYMA 4D3DA 4L76A 3AXSA 4MWBA 1NM5C 1V8FA 4MV6A 5EP4A 3WWPA 4B32A 5E4YA 4DR6B 1RYDA 1FX0A 3EUFA 1IEVA 2NO1A 4LYHA 3RRXA 3W78A 1K6IA 4Z3OA 1I3OA 1PSWA 5IW8A 3O4IA 1ZHFA 2A1TS 3QVGB 5CB4B 1JU4A 2V59A 5U4XA 5BR7A 2RONA 1RTTA 3PE4A 4CHGA 4V1CA 1NPYA 4EI7A 4FBMA 1EE9A 2F6RA 4KLCA 5E6SA 3G5UA 3I61A 4WBNA 3VR1A 3EGOA 5IXJA 4JP8A 1J6UA 3C5EA 2VWPA 5JSFA 1KSJA 3EFBA 1ZVJA 1LPNA 1NIJA 5DJ5A 5BUCA 1P3DA 4V0OA 2XAUA 3W79A 4E5VA 5JNWA 3T12A 1SOUA 1XPJA 4WY2A 1Q77A 2BGTA 2WK1A 4LSZA 4RTPA 1TDJA 1H2YA 4N7MA 3O8LA 2UZAA 4MCAA 1V8BA 4WJKB 2C99A 4YBRA 4QXOA 5BVGA 1XJQA 4EARA 1GL6A 2GEDA 3LLMA 3QH4A 4K3UA 1K4YA 1YFJA 4D4GA 2ATEA 6NULA 1Q0QA 2AUTA 1UXGA 4FFBB 2FI1A 1UAYA 1YDWA 4XUEA 3ZW9A 4R71A 1T5TA 3GYBA 2JFWA 2WFMA 3U3OA 3EYWA 4IFBA 5J4KA 2BMVA 4UXHA 3ANYB 3U7GA 1UKCA 3MBOA 4PGHA 4C3ZA 4ZQIA 3GLHE 4P81A 3W90A 5HRAA 1KH1A 4D4KA 2FQ1A 1YASA 4XIFA 1W46A 4TLMB 3LD9A 3E81A 4NH0A 3BERA 3WGOA 5IYZA 2DPLA 1P77A 2CJWA 1RQGA 4LGVA 1KAMA 3KAPA 2NU8A 5C37A 2JH8A 2VJCA 3QPAA 3ADKA 3W2HA 5ECGC 3DAGA 3VHLB 2FEOA 1GCUA 2BMJA 4LJLA 4I4CA 2YIVX 3GLVA 4DA7A 4YMWA 3RUFA 3C24A 1CRQA 4RO0A 4U7JA 4Y6PA 2OAQ1 2BHTA 3GA0A 3KJZA 4NICA 4Q03A 4ZPXA 3K6SB 3GLHA 3G23A 3JQRA 1XX6A 2CXHA 3BXHA 5BXYA 1A9YA 3FGOA 1EK2A 2I29A 1SCIA 3NETA 3NHWA 2JL1A 4NF2A 3RBXA 5KTKA 2CK3D 4M53A 1XVAA 1VBNA 4KRXA 5L9AA 3EDQA 3MT7A 2O7NA 3A2NA 3TNDA 4R84A 3EUWA 1B4DA 1DO2A 1XR3A 2VHZA 4OAPA 5ALKA 5ICMA 5KBYA 3WWCA 3UAVA 4C7MA 1MKYA 2B99A 2P5SA 4AWBA 4ZYZA 4G1MB 4A91A 3NHAA 4IDQA 4CM7A 5F78A 4HDMA 2D0PB 2VA9A 5HJ7A 2YWDA 1JAYA 1U5BB 1Z3CA 2GK4A 1IXKA 2AB0A 2ILTA 4GEGA 1VYTA 1D1TA 2IX9A 5JRJA 1X7ZB 4CKYA 1SUCA 1EFDN 2CLCX 4WK2B 1KI2A 5L6LB 3E7FA 2YASA 1P1CA 3SCZA 3PZBA 3UJCA 1Z17A 1GZ7A 1WVIA 5JDCA 1XD2A 1POXA 5EIEA 3ZDQA 1E5VA 4GP7A 5ARDA 5HE8A 3TZHA 4DR3B 1WV0A 1YS6A 3BG5A 5AJVB 4IH1A 2VSOA 13PKA 1G7RA 2AXQA 2XUGA 3BSYA 5EE0A 3UMVA 4D8VA 3G68A 4LVOA 3KU1A 3CGWA 4TTQA 5CLGA 1A9OA 1DJOA 5FLYA 2C4VA 1L5MA 5TXGA 3SZMA 4Q93A 2P2YA 1UWKA 3DTVB 2ZS7A 2QM7A 4RF4A 5BSGA 3I3OA 5AW9A 4DV1B 1XTBA 4F4JA 1G8AA 4DLAA 3PZRA 4G84A 1AQNA 5LC1A 1DZIA 3PFBA 2CUZA 4DLSA 2DY1A 1BJTA 2J9FB 1P33A 2J8ZA 4H4DA 3B20A 3DYBA 3D9QX 4X92A 5AJWA 4YDQA 1YJ8A 1YOVA 3FBGA 2VTKA 1TCBA 3EPKA 4JYZA 1N3LA 2HCTA 4JLPA 1V41E 1DOHA 2H7CA 3A1TA 3W77A 4BV9A 1N2EA 4DLZA 4ENWA 5BYKA 5F2EA 1RBYA 1OH7A 1ECLA 2QN2A 2ZIUB 5TMPA 1TVEA 5IJ0B 4FZRA 1Q83A 4F1KA 3ZHVA 1CQJB 3HBJA 3OPMA 2VIIA 3FOFC 2BMAA 4A7PA 2QVYX 4TTVA 4H9GA 3O2NA 1BX1A 3EZ2A 4KVFA 3U1VA 1M9NA 1E61A 5KNCD 4W6ZA 1MIHA 1L8QA 3H13A 4QPNA 4EY4A 2X5XA 1NU6A 5U1PA 2KBFA 3N8HA 1MFPA 1P3Y1 1UQTA 2DUUA 3HWSA 2FG6C 3LNTA 3ELBA 3P4YA 3IUSA 1LTQA 4LV5B 2TMDA 2WSSD 3M33A 2AA3A 5HDQA 5CD9A 1QORA 3N07A 2ONCA 1W36C 3PEYA 4MAMA 1NN5A 2GSWA 4W5WA 1IAVA 4KGVA 4CR7A 4MCHA 1QR2A 3EMDA 4RDHA 1SD1A 3IKTA 1Z7EA 4KREA 2Q46A 2HQOA 2WPDD 2Z30A 5G3ZA 1CS4C 3C97A 1JR3D 5K0TA 1A4UA 3RE1A 4Y9DA 3PFFA 4EPRA 3QXXA 3ZLVA 5H81A 4INOA 3QENA 3WIEA 3OUZA 1EK0A 1SOVA 1DIOB 4WBNF 2QZZA 3D8UA 1DBIA 1OZ0A 4TYWA 1WF6A 2JGKA 1DIAA 1Z73A 2OM2A 1VLJA 1NJ6A 4MGKR 1GRQA 3P45A 3JASA 4COOA 5I7HA 1UIRA 4IWYA 3UJ3X 4DR2B 1FW8A 4OAQA 3F7MA 3G2JA 5CVUA 2QMUA 2PUFA 4YXFA 2W6JD 5E0OA 3E0QA 2Q7XA 4IO0A 3SIXA 1T3SA 4B7ZA 1DBWA 1GNLA 3T52A 1E6EA 3H9EO 5AVXA 2VJBA 4X1YA 3PPWA 2XLBA 3KX2A 1XZGA 4BIMA 2YKGA 3HKDA 3ET5A 3CJRA 2BUAA 1TYZA 2YXEA 2I1WA 4BEJA 2VQFB 4I5EA 3U4AA 4RD1A 1Q15A 1QQAA 1IULA 2OE2A 4U2DA 1N2SA 3BJIC 2FJPA 5JE8A 3U4QA 3HSKA 2AYXA 2XB9A 4Q5IA 5HYVA 4DMHA 5IC4A 2FFBA 2I55A 2JLBA 2JLUA 3ZVNA 1DJMA 4Y1FA 5CW2A 1Q19A 1TUBA 3I01M 3GFFA 5TX7A 1N78A 5C5IA 1W7AA 1QGZA 2BTQB 1VYHA 3NTVA 1SCDA 3CVOA 1OWOA 1KDVA 3WRXA 1CSEE 3VH4A 4OQMA 3PHCA 3PI7A 4HH4A 2GEVA 3B1XA 1Z6ZA 3LRTA 3RLIA 1VOTA 2B5OA 1FBNA 3RWOA 3ZU6A 2D13A 1KL7A 1BWQA 1IK4A 3EIUA 2AW3A 1Q91A 5FAXA 4B75A 1G55A 1OJ7A 3AB7A 3RYFA 4V0KA 1JMKC 4ZQEA 1V8DA 1UCFA 3VHXB 1E20A 4UD2A 4IG9A 4R31A 1BN6A 1MX1A 3OZEA 4TKLA 2JFQA 3L05A 2UYCA 1H2EA 1UL1X 2HV9A 4ZQFA 1LSOA 2E4UA 4FOPA 2YHBA 4JWKA 4KMSA 3I0ZA 1KETA 2Z0MA 2Z9DA 1GXSA 1JKIA 3LZDA 3DE1X 3IQGX 4MUKA 3DLHA 5AVTA 3SEFA 1MMFB 4RKYA 4TXJA 5AVUA 3B7PA 5TLSA 2R4QA 1FDRA 3GVCA 4BRWA 4QOFA 4QUGA 1XRLA 3OQBA 2QUJA 3FF4A 2OFFA 3GDHA 1GUFA 4K6KA 3EXG1 2YV2A 5T57A 2IXFA 1D2HA 3LBFA 1RU3A 3QGMA 8OHMA 4IH4A 5J47A 3L43A 1GRVA 4UMEA 4EPVA 3AEQA 1AV7A 2NADA 3QSGA 2R85A 4H6PA 3WLFA 2WUVA 1BO6A 1F5SA 2DFTA 5ADHA 5KPJA 3FUTA 2FCAA 1S2IA 2IYWA 3GEBA 3HVUA 1SAYA 3QZUA 4Y0AA 4ZOLF 3E0XA 4PSDA 1JHRA 4HLUC 5HF5A 5P8WA 4DUPA 1N2JA 5B12A 5IPFA 5IM5A 5BT8A 1ZIDA 4KR0A 5CM9C 4HEQA 3NTUA 3GZNB 3NRBA 1DO8A 1N1GA 4D9JA 3KT6A 1JWAB 1KI8A 3LVFO 3OESA 4CPDA 4V2UA 3GLFA 4KQIA 4H0FA 4B71A 1DRWA