2CA5A

Mxih needle protein of shigella flexneri (monomeric form, residues 1- 78)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
DDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MXIH
publication title Molecular Model of a Type III Secretion System Needle: Implications for Host-Cell Sensing
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Transport protein
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ca5A00
1ZKEA 3N5LA 2XTLA 1Z0PA 2C5IT 3L3PA 3S4UA 4CQIA 2X9WA 2IC9A 2CA5A 2KWIB 3FXDB 2C5KT 2MBGA 3FXEB 4DNDA 4FI5A 1QSDA 4L0RA 2X9XA 2IC6A 2G0UA 3TKLB 4EYYR 2X9YA 3QK6A 1LVFA 2K48A 1IJ6A 2C5JA 3P7IA 3MXZA 3CVRA 4B6XA 1H7CA 1LRZA 3QUJA 1IJ5A 2KWHA 4J2CA 3CKDA
chains in the Genus database with same CATH superfamily
5JDFA 3S4UA 2VVNA 2JQHA 3NRYA 4DNDA 2ZM0A 3UUBA 2G0UA 3R6NA 3B5MA 4WBOA 1XZYA 1DU2A 2WP9A 2X67A 3NBXX 3AEDA 1HTJF 3KBTA 4PJJA 2W67A 3W15B 1D1CA 4OK0A 3P50A 2Q9QB 1HG5A 2UUCT 3KFWX 5AQGB 4ZI2D 3QNUA 3MACA 2WDRA 4YTMA 3P4QA 2JQQA 4BA9A 5H6QB 3RQWA 3JC6D 2XZEA 2A9UA 2JIWA 1WR6A 4B3MT 5LOVE 2H7VC 4U7IA 3AE9A 4IT4A 3HKCE 4B6XA 3ZT7A 5FY1A 2DCFA 3EI0A 2Q9QD 2BG9B 2WZIA 4A97A 1VOMA 1T8BA 2ZMAA 5HXCA 3LDQB 5L4EA 2J4GA 2E5VA 2XAQB 2SPCA 3P4RA 2NP9A 5LJNA 4Q25A 3N2GE 2L3LA 3D0TA 1AJ3A 2YOEA 3E0ZA 4DV3T 4UELA 4JLEA 3AE2A 4ISTA 4H9NC 1MMDA 4IE0A 4PJNA 2XJ7A 2WM9A 4AKHA 3NKZA 4U7YA 4X5TA 3OJAA 2JMHA 3Q5DA 1UX5A 1UX4A 5JREA 5AQNB 2LSYA 1Z0PA 2RPAA 2WWVA 4DUYT 4EGWA 2WSSV 1FMWA 1T72A 4YHJA 3NWIA 3IA3A 3RYIE 2FJBA 4JBWF 1HCIA 1WLXA 3CVRA 4QH4A 2VKJA 3ZSSA 2KWHA 4A56A 3K8PC 5AQIB 4PFOA 3LFMA 2I59A 4HEAA 1X79A 4H9PC 5KX5E 5FYMA 2RP4A 3UUNA 3CX8B 2D0TA 4H63H 5AQFB 2LEHA 4PNIA 4OFZA 3AA7B 4I43B 5LHGB 2UXDT 3ZKRA 4PW8A 4MFRA 2XQYA 2NTXA 3EDVA 5LHHB 4IDNA 3AE4A 2WS3A 1R8IA 4QX8B 2V7JA 2ODUA 2FJDA 4YY3T 4TV9E 1ZOYA 2W61A 2X68A 3ZEFB 2WZHA 3C4WA 2WMNA 3HI2A 5JDLA 4CI3B 1XMOT 4ZI2C 4EEBA 1QLBA 3PJAA 4IREA 4YTPA 3AVSA 4DR1T 1OEDB 3ABVA 5JVDE 1HNWT 3JC6C 2LHNA 3FZKB 5FVLA 2OA5A 3PV0F 3F31A 3ZT6A 3JCFA 2IAKA 1HNZT 4O4LE 3A7MA 3ZMZB 5HEUA 4NUVA 3MXZA 2Q9QC 2X51A 5DABA 1NENA 3SRZA 1XDOA 3L3PA 4N78D 4X20E 5CJ5A 2CHOA 2CCQA 3A5XA 2LKGA 5JR9B 2UUBT 2BBHA 4U3CA 5LA6E 4GKKT 4U2ZA 2D2SA 1JNRA 3ZSTA 4IDZA 2XTLA 4GOUA 3TLWA 5HEOA 3UU4A 1MMAA 2CBJA 5L3DB 3SFDA 3I0QA 5EK4A 3PURA 2XHEB 2Q9QA 2BG9C 1MMNA 1WRDA 2ZM8A 1FJGT 4JI3T 4ILBA 3Q5WA 1CHUA 3ZN1B 3AB3B 3P8CD 2D0UA 4JI0T 1YD8G 5C2TA 1HNXT 5AQKB 4K0KT 3IBPA 5AQHB 1ZEEA 5FXWA 5ETWA 4AKRB 2XQ9A 1N32T 3BQKA 2BG9A 2VKDA 4KHPT 2BKPA 3I1AA 3KV6A 2VB6A 2YEVC 5AQOB 4IE4A 4AKLA 3MK7C 1KK7A 3AECA 3RC8A 4IDQA 4AQYT 5FKYA 1UCUA 4UIGA 2NW8A 4AIUA 4X1KE 4EZHA 2DI4A 2NW7A 3PU3A 2VWAA 3C50A 4MHCA 2N2NA 1XNQT 1LKXA 4QXBB 1MNEA 2CWOA 5L4HA 5LG4A 3RGLA 4ILAA 2V6YB 1BR0A 2KT9A 2VKOA 4KHZF 3RC3A 3NZQA 2WAUA 4PK5A 4HWCA 3H37A 2B76A 4UXNB 4UVCB 5AQLB 2X66A 2VK9A 2BZBA 3F57A 3EABA 2NOXA 2JQKA 2KLQA 4P0BA 4PJMA 1IAPA 4C90A 1W09A 4HN9A 2H89A 4UEMA 2HN1A 2WDQA 3IEEA 2KSRA 5IHYA 3RYFE 3SWHA 3FXEB 1W0BA 2ODVA 4H9SE 3TLUA 3GA8A 3UU8A 3MZKB 4GIWA 2WWUA 3RQUA 5KDMC 3N9OA 1S35A 5BMVE 1US7B 4WYVA 4L0RA 1OEDC 3ETVA 2WMOA 4HWHA 2XQ3A 5L3BB 1U4QA 1B7TA 4U72A 2W4XA 2RA1A 3GMIA 4NXMT 1I94T 3OVUA 5AQPB 3ZN0B 3ZJ2A 2NR4A 4TV8E 5JQGE 4L9IA 3ZMSB 5LYJE 2BS3A 2LSJA 3CX7B 1VCSA 3RYCE 3ZMTB 4PAGA 3FZFB 4BJMA 5JR9C 1OEDA 5L2LA 4U74A 1SA0E 2CEAA 5LMNT 4WW0A 4EV6A 4JV5T 3KV9A 1G8XA 5ABHA 1WYBA 1SE7A 2LM2A 3RRWA 1GQEA 1U5PA 2VQFT 3PUSA 2V6XA 4YFSA 2V7IA 2DWKA 2E5LT 3AAAB 2DNXA 5JR9A 3B13A 4PFPA 3UQ4A 2VURA 4CN6A 4DV1T 4G2AA 1N34T 3GN5B 2PJQA 2KNDA 5FVKA 3AEFA 4COFA 1KF6A 4DV5T 4ILCA 3EVYA 3N9LA 4YHHT 3U3IA 2ES0A 2FBWA 4U2YA 1V9DA 4YSYA 5H6RB 3ETUA 3KVAA 1WCRA 1XDPA 1FIOA 2IMLA 5HCMA 4IL9A 4JUYA 4AQGA 1SHZC 2C5IT 2X9HA 3WAJA 4OYJA 2WCAA 3UU3A 4AXPA 5F3JA 1EZ3A 2XAGB 2I6HA 3RHWA 5IUXA 2CPTA 3VRBA 2BDEA 3PUVF 5HCJA 2D5UA 2X0YA 1ZV4X 5JDMA 2XASB 4DR3T 3L39A 3Q5EA 5LHIB 3TLVA 2V7KA 2H3RA 4I55E 2BVMA 3AEEA 4MALA 2HPJA 2XAFB 3FZLB 4DMWA 4HTEA 2M6BA 1YKHB 3P4SA 2VL8A 4GK5E 4ISSA 4IE6A 4PK6A 4O4HE 3P4PA 5E0OA 4QWNB 2IC6A 5FMNA 2VVSA 4EYYR 2CBIA 3ZMVB 2V6YA 4X62T 1BR2A 2XQ4A 3M3ZB 5J1GA 3AAIA 4IDPA 3OKQA 4X1IE 2AXDS 1I6ZA 5LNKA 2DWGA 1LRZA 5LCYA 3LJCA 2W63A 2V26A 4ASKA 3BK9A 3ANWA 2IC9A 3FXDB 2Y8DA 2MBGA 5F8PA 4ZS2A 4LFBT 4HWFA 2YDSA 4GYRA 3ZCIA 2UXNB 4MLKA 4OHFA 5AQVB 2VQET 5JDHA 4ZOLE 2QGSA 4A98A 2WY2A 1VRBA 5HEGA 3MJXA 1MIVA 1Z8UA 3OYXA 5FP3A 4JEHB 3FZHB 3EUHA 3UTKA 4HWIB 5AQQB 1O3XA 4QXHB 3AE6A 3T1YT 4AKGA 3RRCA 3AE3A 2X9YA 5LP6E 3HKEE 3LBXB 2YDQA 4IE7A 1HF8A 2XSAA 2YN6A 3LG7A 2JQ9A 2XQ7A 3RLFF 3KBUA 1T7SA 5C3JA 3NVOA 3UT5E 5LXTE 2H88A 5AQRB 4EOZB 5AQSB 3CX6B 1H7CA 1IJ5A 2LRLA 1IBMT 3CPZA 3RYHE 1FEWA 3UULA 5ABEA 2I0MA 5JTGA 5JRCB 4TWHA 4CQIA 3OBVE 3OYZA 2QA7A 5ABFB 2CHNA 2YDRA 3RKOA 1IJ6A 2J62A 5HYAA 4E7ZA 5HXSA 2AE9A 4UV9B 1WR0A 2ACXA 4QKNA 4TNWA 4GKJT 1NWMX 3MKDA 4I0UA 4E7SA 4LMKA 3VHLA 3WI3A 3UU6A 5HXHA 3O1JA 5DJQC 2XM1A 2V8SV 1YXRA 2UXBT 4X66T 4QX7B 3EDUA 4KMCA 3O4XE 5LBQB 4HGAA 1JNZA 1NAFA 4TX5A 4DUZT 3N9NA 1HX8A 1MIYA 2WU5A 2BG9E 2CXLA 4JI5T 4X64T 3OTOT 4Z8XA 4J2CA 4UV8B 2LE8A 2PTFA 5CGMA 3ONLC 3Q5XA 5AQMB 2LM9A 1D1BA 2XUEA 3CMLA 2IHR1 1BR4A 4QXCB 2MAWA 3I9YA 4ILUA 2QYWA 2XAHB 1N33T 1QUUA 3UUXB 2XQAA 4PK4A 1KNRA 4M1PA 3Q9DA 2BBJA 2L8KA 2ACZA 4TN7B 4TZ4C 5F5WA 4WNKA 4JI2T 2L9QA 1N36T 2VKHA 2LSIA 2JMKA 3T1HT 2CA5A 2XAJB 5LGUB 1E1HB 3TKLB 4P0AA 4LF6T 3P7IA 4G63A 2XQ6A 3QUJA 5LGNB 3AEAA 3KDSE 1VCTA 5CFBA 4CN1A 2K24A 4MBQA 4DR6T 3H3MA 4ZEYA 2D9DA 4UF0B 4LF5T 1WYCA 4YLHA 2MPKA 2IW5B 5LG3A 4CXWA 3ZPOA 4EYUA 4JI7T 1UK5A 3TLSA 1M7KA 4DR7T 4O8SA 4BJNA 5FY7A 3ONJA 1ZP0A 3KVBA 3K1SA 2PG8A 4WBNE 3QK6A 4LMJA 2QVAA 3PDYA 4JYAT 3DP7A 3AVRA 2Y6XA 3C64A 1W9RA 4UR9A 2HPLA 5CA1E 1E7PA 5A1LA 3QOFA 2OLTA 5LBMA 4DIDB 4YJ2E 2X9XA 3O1IA 3AA6B 1X9BA 1OEDE 3Q2MA 2E9XB 3EHZA 1D0ZA 4ZXLA 4ADZA 3BQIA 2CM0A 4O2BE 4F6RC 5GONE 5CA0E 2UUAT 2LOPA 2XY8B 4LMLA 2KWIB 4LFCT 2XQ5A 5FL0A 5M4YA 3BQLA 4EB6E 1XMQT 2K9AA 5EK3A 2EHOB 1XWMA 1M62A 5JRCA 4NUUA 2PFVA 1J1JA 5ABFA 3RX6A 4B3ST 3NZPA 4EXTA 2UXXB 2E9XD 4ERRA 4CI1B 2LHRA 3HKBE 5EK2A 2DHRA 5FY0A 4ZI3D 5HWYA 4YXDA 2MOZA 3DJBA 3FZMB 2EHOD 3U78A 5JDQA 3N9MA 2K5BB 2Y48B 3LSVA 4JI6T 2K48A 2LSKA 4DVDA 2YINA 2NTYA 2LSGA 4B3TT 3JAFA 5L3GB 3C98B 3ZC1A 1J5ET 3CQXC 3SFEA 3PU8A 1Y01A 1FMVA 1HX1B 4EAHA 4HKAA 5JDNA 3PUAA 4GK0E 4QH1A 4ZHQE 4HFHA 2UU9T 1YW0A 4TNVA 1OXZA 2FJAA 3QB5A 3M65A 2CXDA 3AE5A 5AQTB 4BAYB 5FL1A 3FBZA 5FXVA 3UUMA 2V7MA 2CWYA 4B3RT 2H7OA 2C0SA 5ADXL 2NWBA 1IBKT 3LK42 2C5KT 1UUSA 3PTRB 4IDOA 3N9QA 4DR2T 4CXYA 2XPKA 4WZXA 3FHNA 4U33A 2W66A 1SUMB 1ZKEA 3RI5A 3ZCJA 4DBQA 2HH7A 4Z90A 3O1HA 4HFIA 3N9PA 3ZYKA 3UQ7A 2JJ9A 1J5WA 4AISA 5KMGP 3L8RA 2M6IA 5J2UE 2W00A 2CMRA 3PE0A 3PUWF 5HXRA 5J0ZA 2YU1A 3E08A 2A72A 4I4TE 1MMGA 3OPCA 4LFAT 3PJAJ 1G73A 1QSDA 4UF0A 4YSZA 2LT3A 1MIWA 3VKHA 2JPFA 4TWFA 4JI8T 2W0GA 4CXXA 2X0HA 3CIRA 3PUZF 2MTQA 4OX9T 5EZYE 4XAXB 5KXJA 1D1AA 1T98A 4HFBA 4EZ4A 4YT0A 3VR9A 2E9XC 4HFVA 4V1Av 1Y64B 4GYSA 4ZS3A 5IWAT 4O4JE 3PUYF 1UGOA 4ZI3C 3WAKA 4P09A 2E2AA 3AXJB 4P1NA 3VU7H 3MA9A 2KINB 3LK2B 4HWDA 2EHOC 4KP3C 1MNDA 1KNPA 4TWDA 3ZT5A 3G06A 3RIAA 3UFGA 3PUQA 2E9XA 3CQGB 3C4XA 2KZ7B 4CZZB 4AI6A 4O4IE 4QHOA 4AKIA 3LK3B 3RIUC 3AEBA 3GWHA 2EHOA 4KUMB 4U31A 4DV7T 1LVKA 2HN2A 4UVBB 3F2EA 2FUPA 3J9X1 4TUYE 4O2AE 4NPPA 1KEYA 4FI5A 2XQ8A 2BVLA 5CB4E 3RIFA 1HR0T 5FNVE 3RIUA 2Z6EA 5L3FB 2VASA 3IHRA 4LF7T 2QRXA 4IGUA 5AQUB 3CQCB 3GN5A 5LGTB 2BKOA 2CLYB 2J47A 2GK9A 2LOSA 3H3AA 2C5JA 1YQ4A 4DV4T 2J1DG 3VR8A 3A8YC 2WU2A 3HKDE 4JEUB 1HS7A 4UVAB 2PBIA 4IL4A 3N5LA 3VRAA 4X1YE 4XZCA 5FXXA 3JAEA 4F8HA 3AA0B 2WQYA 1L0VA 3X1DA 2ZM6T 3CK6A 4DV6T 3HL6A 3AE1A 3O9XA 3QB5K 5HAXA 2A3DA 4H9OC 5JDGA 4PJLA 1KFYA 2W62A 4C91A 5LJMA 4EIWA 4DBRA 5JH7E 3KV4A 4A5XA 1YQ3A 2HHHT 2FJEA 4ZZCA 1D0XA 4QH5A 2CXFA 3FBLA 3PUGA 2E8IA 4KX6A 3C4ZA 2KMFA 1LVFA 3AAEB 3PUXF 1UURA 3L09A 5L3EB 4XBFB 4DV0T 4AQFC 3CWZB 3QC9A 5BR8T 4CI2B 4K0UA 3ZYMA 1D0YA 3EAMA 4KI0F 3B57A 2IIUA 3UFEA 2WBLA 4ZZBA 2F4VT 4IIJE 3R84B 1HG2A 2V5CA 4ANJA 5LB7B 2LLYA 4EEDA 5DQVA 4AQFA 4IE5A 2V7LA 3I9WA 2R6GF 4DV2T 5IYZE 3JADA 3IF8B 4H9RC 3V5SA 2DL1A 3RF1A 3K3NA 4OYKA 2UXCT 2N1GA 2WDVA 3KINB 5C8YE 2YU2A 4LF8T 2X9WA 5AQJB 2W2UA 1W0AA 2IUBA 2P9BA 2XM2A 1NEKA 3N2OA 3RH3A 3C51A 3AXJA 3AE7A 2V5DA 1S94A 3K3OA 1BR1A 3RPUA 3V5UA 2IDOB 2XSBA 4LF4T 4YTNA 4HE8A 5L3CB 3ZC0A 2LKHA 4KBMB 2LRKA 3HR0A 4NXNT 1IZNB 3P4WA 5TAOA 1HFAA 3ZYLA 4CN4A 3ANWB 1XNRT 5L47A 1CUNA 4Z91A 1ZHCA 5HEHA 4HFEA 2A2FX 2K3WA 3ESLA 2B1EA 2BKNA 4IHJE 3LBXA 2NW9A 2YKSA 2JRKA 4X65T 4DMVA 3K3QC 2CLYC 4H63V 1KNZA 3ZMUB 5HXEA 3ZJ1A 4NIQA 2V1DB 4YJ3E 2YK0A 3E22E 3DTOA 2M67A 3HA4A 1WFDA 4I50E 3SS1A 2ZLYA 3AE8A 3NRXA 2DLRA 3AA1B 4HFDA 1YKEB 3UU5A 3T8OA 4LF9T 5HEJA 3AEGA 3SOLA 5J2TE 3VKGA 3ZLIA 4JI4T 1IBLT 5AFUL 2CRBA 4YSXA 2KXPB 4HFCA 4L5GA 4FJOA 2BS4A 3ONXA 5FXZA 3KV5A 3I0OA 2BS2A 1E2AA 5LMUT 2OV9A 4JI1T 4DO0A 3N2KE 3RKGA 2VL0A 5ABGA 4H9QC 2CE7A 3CKDA 5HWXA 2X0LB 5DQWA 3J7Yq 3FB2A 4ZI7E 2ZM2A 4DR5T 1OWAA 2LJLA 2N9DA 2MYSA 4DR4T 2WB5A 3TLTA
chains in the Genus database with same CATH topology
3MA9A 3EDUA 4HN9A 4QX7B 2KINB 5JDFA 4KMCA 4UEMA 3S4UA 3LK2B 3IEEA 3O4XE 2EHOC 5LBQB 4HGAA 1NAFA 4TX5A 5IHYA 3RYFE 3SWHA 3FXEB 3NRYA 4DNDA 4KP3C 1MNDA 2ZM0A 2G0UA 3R6NA 3N9NA 1HX8A 1MIYA 4WBOA 2CXLA 2ODVA 4H9SE 3PUQA 2E9XA 3CQGB 2X67A 3GA8A 3NBXX 3C4XA 1HTJF 3KBTA 4PJJA 2KZ7B 3MZKB 4Z8XA 4GIWA 2WWUA 4J2CA 4UV8B 4CZZB 2LE8A 4AI6A 5KDMC 4O4IE 3N9OA 1S35A 3W15B 4QHOA 1D1CA 5BMVE 4AKIA 1US7B 3LK3B 3Q5XA 4OK0A 3GWHA 4L0RA 3ETVA 2LM9A 1D1BA 2WMOA 2Q9QB 2XUEA 3CMLA 5L3BB 1HG5A 1U4QA 2EHOA 3KFWX 4KUMB 1B7TA 4U72A 1BR4A 2RA1A 4QXCB 1LVKA 3GMIA 3I9YA 3MACA 4ZI2D 4UVBB 4ILUA 2JQQA 3ZN0B 3F2EA 4BA9A 3J9X1 2XAHB 5H6QB 3ZJ2A 4TUYE 4O2AE 3JC6D 1QUUA 3UUXB 4PK4A 1WR6A 5LOVE 4TV8E 5JQGE 2H7VC 4FI5A 3Q9DA 4L9IA 4M1PA 3ZMSB 5LYJE 2L8KA 2LSJA 2BVLA 4TN7B 4TZ4C 3CX7B 5CB4E 3RYCE 3ZMTB 4PAGA 3HKCE 4BJMA 5FNVE 2Z6EA 4B6XA 5L3FB 5JR9C 5FY1A 2VASA 2DCFA 4WNKA 2Q9QD 3IHRA 5L2LA 1VOMA 2L9QA 2VKHA 2ZMAA 5HXCA 4IGUA 4U74A 2LSIA 2JMKA 2XAQB 1SA0E 2CEAA 2SPCA 2CA5A 2XAJB 4WW0A 2NP9A 3CQCB 3GN5A 5LGUB 5LGTB 5LJNA 2CLYB 1E1HB 2GK9A 3TKLB 3N2GE 2L3LA 3D0TA 2LOSA 3H3AA 3KV9A 1AJ3A 4P0AA 1G8XA 3E0ZA 2C5JA 3P7IA 4G63A 1WYBA 2J1DG 3RRWA 4UELA 3QUJA 3HKDE 4JEUB 5LGNB 1U5PA 4JLEA 1HS7A 4UVAB 3PUSA 4ISTA 2PBIA 4YFSA 2V7IA 3KDSE 2DWKA 1MMDA 3N5LA 4H9NC 3AAAB 2DNXA 4X1YE 4XZCA 5FXXA 4IE0A 4PJNA 5JR9A 3B13A 4PFPA 2K24A 4MBQA 4G2AA 3GN5B 2WM9A 2PJQA 4AKHA 2KNDA 3AA0B 4UF0B 1WYCA 4YLHA 3EVYA 3N9LA 3OJAA 2IW5B 2JMHA 1UX5A 1UX4A 3U3IA 5JREA 2LSYA 3HL6A 2ES0A 3O9XA 4CXWA 3ZPOA 1Z0PA 4EYUA 5HAXA 2WSSV 4O8SA 4BJNA 1V9DA 2A3DA 4H9OC 1FMWA 5FY7A 4YHJA 3KVBA 3RYIE 2PG8A 5H6RB 4WBNE 1HCIA 3QK6A 3ETUA 1WLXA 5JDGA 3KVAA 4PJLA 2W62A 3CVRA 3PDYA 4C91A 5LJMA 3DP7A 4EIWA 3AVRA 2Y6XA 3C64A 2VKJA 4DBRA 5JH7E 3KV4A 1FIOA 2KWHA 4A56A 2HPLA 1D0XA 5CA1E 4JUYA 4AQGA 1SHZC 2C5IT 2X9HA 2CXFA 3FBLA 3K8PC 3WAJA 4OYJA 3PUGA 5A1LA 4PFOA 2E8IA 5LBMA 4AXPA 3C4ZA 2KMFA 3LFMA 4YJ2E 5F3JA 2X9XA 3O1IA 3AA6B 2I59A 1EZ3A 2XAGB 1LVFA 3AAEB 4HEAA 3L09A 3Q2MA 2BDEA 1X79A 5L3EB 4H9PC 5KX5E 5FYMA 4XBFB 2RP4A 3UUNA 3CX8B 2E9XB 2D0TA 1D0ZA 4AQFC 2D5UA 3CWZB 1ZV4X 3BQIA 4ADZA 4H63H 5JDMA 2XASB 2CM0A 3QC9A 4O2BE 2LEHA 4PNIA 5GONE 4F6RC 5CA0E 2LOPA 4CI2B 4K0UA 4OFZA 3ZYMA 1D0YA 3AA7B 5LHIB 2KWIB 2V7KA 2H3RA 4I55E 4I43B 2BVMA 5LHGB 5M4YA 3BQLA 3B57A 3UFEA 2WBLA 4EB6E 4MALA 4PW8A 2HPJA 4MFRA 2XQYA 2K9AA 2NTXA 2XAFB 4DMWA 4HTEA 5EK3A 3EDVA 5LHHB 2EHOB 4IIJE 1YKHB 3R84B 4QX8B 5JRCA 1HG2A 2V7JA 2VL8A 4GK5E 4ISSA 2ODUA 4NUUA 4IE6A 4PK6A 4ANJA 2PFVA 4O4HE 3RX6A 3NZPA 4EXTA 2UXXB 5E0OA 2E9XD 5DQVA 4ERRA 4AQFA 4TV9E 2W61A 4CI1B 2X68A 4QWNB 3ZEFB 4IE5A 2IC6A 5FMNA 3C4WA 2WMNA 2LHRA 4EYYR 3HKBE 3HI2A 5JDLA 4CI3B 3ZMVB 5EK2A 2DHRA 5FY0A 2V7LA 3I9WA 4ZI3D 4ZI2C 5IYZE 1BR2A 3IF8B 4H9RC 3AVSA 5JVDE 3V5SA 3K3NA 4OYKA 5HWYA 2N1GA 2MOZA 3KINB 3DJBA 3JC6C 5C8YE 2LHNA 2YU2A 2EHOD 2X9WA 3U78A 5J1GA 2OA5A 3AAIA 3F31A 5JDQA 3N9MA 2K5BB 2Y48B 2IAKA 3OKQA 4O4LE 2K48A 3ZMZB 4X1IE 2LSKA 2P9BA 4NUVA 3MXZA 2YINA 3N2OA 3RH3A 4DVDA 3C51A 5LNKA 2DWGA 1LRZA 1S94A 5LCYA 2NTYA 3LJCA 2W63A 2Q9QC 2V26A 2X51A 5DABA 4ASKA 3K3OA 2LSGA 3ANWA 3BK9A 3SRZA 3L3PA 4N78D 4X20E 2CCQA 1BR1A 3RPUA 5L3GB 3A5XA 2IC9A 3C98B 3V5UA 3FXDB 2Y8DA 2MBGA 3ZC1A 5JR9B 3CQXC 5F8PA 4ZS2A 3PU8A 4GYRA 5LA6E 1FMVA 3ZCIA 4HE8A 5L3CB 2UXNB 4MLKA 4OHFA 3ZC0A 4EAHA 4KBMB 4HKAA 5JDNA 3HR0A 3PUAA 4GK0E 1IZNB 2D2SA 5TAOA 5JDHA 1HFAA 4ZOLE 2QGSA 4IDZA 3ZYLA 2XTLA 4GOUA 1MMAA 1VRBA 5L3DB 3ANWB 4ZHQE 3I0QA 1MIVA 1CUNA 3MJXA 3OYXA 5EK4A 3PURA 5FP3A 2XHEB 2Q9QA 4JEHB 1YW0A 1ZHCA 1MMNA 2A2FX 1WRDA 2ZM8A 3ESLA 2B1EA 4IHJE 3LBXA 3EUHA 2NW9A 1OXZA 3UTKA 3M65A 2CXDA 3Q5WA 2JRKA 3ZN1B 4DMVA 3K3QC 2CLYC 3AB3B 3P8CD 2D0UA 4H63V 4BAYB 1O3XA 3FBZA 5FXVA 1YD8G 3UUMA 1KNZA 2V7MA 4QXHB 3ZMUB 2CWYA 2H7OA 5HXEA 2C0SA 3ZJ1A 5ADXL 2NWBA 3LK42 2C5KT 3PTRB 3IBPA 4AKGA 3N9QA 3RRCA 1ZEEA 2V1DB 5FXWA 2X9YA 4YJ3E 2YK0A 3E22E 5ETWA 5LP6E 3DTOA 4AKRB 3HKEE 3LBXB 2M67A 3HA4A 4IE7A 4CXYA 3BQKA 4I50E 1HF8A 2VKDA 3FHNA 3SS1A 3LG7A 2ZLYA 3NRXA 3KBUA 3I1AA 1ZKEA 3KV6A 2VB6A 2YEVC 3ZCJA 4DBQA 2DLRA 4IE4A 3UT5E 2HH7A 4AKLA 3AA1B 1YKEB 3MK7C 1KK7A 3O1HA 5LXTE 3RC8A 3T8OA 3ZYKA 3N9PA 2JJ9A 1UCUA 4UIGA 4EOZB 5KMGP 5J2UE 2W00A 2CMRA 2NW8A 3PE0A 3SOLA 5J2TE 3VKGA 3CX6B 3ZLIA 1H7CA 1IJ5A 4X1KE 3CPZA 5AFUL 3RYHE 5HXRA 1FEWA 2KXPB 3UULA 4EZHA 4L5GA 2DI4A 2NW7A 3PU3A 4FJOA 2VWAA 5JRCB 2YU1A 3C50A 3E08A 2A72A 4I4TE 3ONXA 4MHCA 1MMGA 4CQIA 2N2NA 5FXZA 3OBVE 3OYZA 3KV5A 3I0OA 1LKXA 2QA7A 1G73A 1QSDA 4QXBB 4UF0A 1MNEA 2LT3A 2CWOA 1MIWA 3RKOA 3VKHA 1IJ6A 4DO0A 5LG4A 3N2KE 2JPFA 5HYAA 4H9QC 1BR0A 2CE7A 2KT9A 2W0GA 2VKOA 4CXXA 4E7ZA 3RC3A 2MTQA 3NZQA 2WAUA 5EZYE 3CKDA 4XAXB 4PK5A 5HWXA 1T98A 1D1AA 2X0LB 4EZ4A 5HXSA 5DQWA 4UV9B 2ACXA 3J7Yq 4QKNA 3H37A 3FB2A 2E9XC 4UVCB 1NWMX 4UXNB 4ZI7E 4HFVA 4V1Av 1Y64B 3MKDA 2X66A 4GYSA 4ZS3A 2VK9A 4E7SA 2BZBA 3F57A 2NOXA 3VHLA 2ZM2A 4O4JE 3WI3A 2KLQA 5HXHA 4P0BA 4PJMA 1OWAA 3O1JA 4ZI3C 1IAPA 2LJLA 4P09A 3WAKA 2N9DA 2MYSA 4C90A 5DJQC 3VU7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKE A;  3N5L A;  2XTL A;  1Z0P A;  2C5I T;  3L3P A;  3S4U A;  4CQI A;  2X9W A;  2IC9 A;  2CA5 A;  2KWI B;  3FXD B;  2C5K T;  2MBG A;  3FXE B;  4DND A;  4FI5 A;  1QSD A;  4L0R A;  2X9X A;  2IC6 A;  2G0U A;  3TKL B;  4EYY R;  2X9Y A;  3QK6 A;  1LVF A;  2K48 A;  1IJ6 A;  2C5J A;  3P7I A;  3MXZ A;  3CVR A;  4B6X A;  1H7C A;  1LRZ A;  3QUJ A;  1IJ5 A;  2KWH A;  4J2C A;  3CKD A; 
#chains in the Genus database with same CATH topology
 5JDF A;  3S4U A;  2VVN A;  2JQH A;  3NRY A;  4DND A;  2ZM0 A;  3UUB A;  2G0U A;  3R6N A;  3B5M A;  4WBO A;  1XZY A;  1DU2 A;  2WP9 A;  2X67 A;  3NBX X;  3AED A;  1HTJ F;  3KBT A;  4PJJ A;  2W67 A;  3W15 B;  1D1C A;  4OK0 A;  3P50 A;  2Q9Q B;  1HG5 A;  2UUC T;  3KFW X;  5AQG B;  4ZI2 D;  3QNU A;  3MAC A;  2WDR A;  4YTM A;  3P4Q A;  2JQQ A;  4BA9 A;  5H6Q B;  3RQW A;  3JC6 D;  2XZE A;  2A9U A;  2JIW A;  1WR6 A;  4B3M T;  5LOV E;  2H7V C;  4U7I A;  3AE9 A;  4IT4 A;  3HKC E;  4B6X A;  3ZT7 A;  5FY1 A;  2DCF A;  3EI0 A;  2Q9Q D;  2BG9 B;  2WZI A;  4A97 A;  1VOM A;  1T8B A;  2ZMA A;  5HXC A;  3LDQ B;  5L4E A;  2J4G A;  2E5V A;  2XAQ B;  2SPC A;  3P4R A;  2NP9 A;  5LJN A;  4Q25 A;  3N2G E;  2L3L A;  3D0T A;  1AJ3 A;  2YOE A;  3E0Z A;  4DV3 T;  4UEL A;  4JLE A;  3AE2 A;  4IST A;  4H9N C;  1MMD A;  4IE0 A;  4PJN A;  2XJ7 A;  2WM9 A;  4AKH A;  3NKZ A;  4U7Y A;  4X5T A;  3OJA A;  2JMH A;  3Q5D A;  1UX5 A;  1UX4 A;  5JRE A;  5AQN B;  2LSY A;  1Z0P A;  2RPA A;  2WWV A;  4DUY T;  4EGW A;  2WSS V;  1FMW A;  1T72 A;  4YHJ A;  3NWI A;  3IA3 A;  3RYI E;  2FJB A;  4JBW F;  1HCI A;  1WLX A;  3CVR A;  4QH4 A;  2VKJ A;  3ZSS A;  2KWH A;  4A56 A;  3K8P C;  5AQI B;  4PFO A;  3LFM A;  2I59 A;  4HEA A;  1X79 A;  4H9P C;  5KX5 E;  5FYM A;  2RP4 A;  3UUN A;  3CX8 B;  2D0T A;  4H63 H;  5AQF B;  2LEH A;  4PNI A;  4OFZ A;  3AA7 B;  4I43 B;  5LHG B;  2UXD T;  3ZKR A;  4PW8 A;  4MFR A;  2XQY A;  2NTX A;  3EDV A;  5LHH B;  4IDN A;  3AE4 A;  2WS3 A;  1R8I A;  4QX8 B;  2V7J A;  2ODU A;  2FJD A;  4YY3 T;  4TV9 E;  1ZOY A;  2W61 A;  2X68 A;  3ZEF B;  2WZH A;  3C4W A;  2WMN A;  3HI2 A;  5JDL A;  4CI3 B;  1XMO T;  4ZI2 C;  4EEB A;  1QLB A;  3PJA A;  4IRE A;  4YTP A;  3AVS A;  4DR1 T;  1OED B;  3ABV A;  5JVD E;  1HNW T;  3JC6 C;  2LHN A;  3FZK B;  5FVL A;  2OA5 A;  3PV0 F;  3F31 A;  3ZT6 A;  3JCF A;  2IAK A;  1HNZ T;  4O4L E;  3A7M A;  3ZMZ B;  5HEU A;  4NUV A;  3MXZ A;  2Q9Q C;  2X51 A;  5DAB A;  1NEN A;  3SRZ A;  1XDO A;  3L3P A;  4N78 D;  4X20 E;  5CJ5 A;  2CHO A;  2CCQ A;  3A5X A;  2LKG A;  5JR9 B;  2UUB T;  2BBH A;  4U3C A;  5LA6 E;  4GKK T;  4U2Z A;  2D2S A;  1JNR A;  3ZST A;  4IDZ A;  2XTL A;  4GOU A;  3TLW A;  5HEO A;  3UU4 A;  1MMA A;  2CBJ A;  5L3D B;  3SFD A;  3I0Q A;  5EK4 A;  3PUR A;  2XHE B;  2Q9Q A;  2BG9 C;  1MMN A;  1WRD A;  2ZM8 A;  1FJG T;  4JI3 T;  4ILB A;  3Q5W A;  1CHU A;  3ZN1 B;  3AB3 B;  3P8C D;  2D0U A;  4JI0 T;  1YD8 G;  5C2T A;  1HNX T;  5AQK B;  4K0K T;  3IBP A;  5AQH B;  1ZEE A;  5FXW A;  5ETW A;  4AKR B;  2XQ9 A;  1N32 T;  3BQK A;  2BG9 A;  2VKD A;  4KHP T;  2BKP A;  3I1A A;  3KV6 A;  2VB6 A;  2YEV C;  5AQO B;  4IE4 A;  4AKL A;  3MK7 C;  1KK7 A;  3AEC A;  3RC8 A;  4IDQ A;  4AQY T;  5FKY A;  1UCU A;  4UIG A;  2NW8 A;  4AIU A;  4X1K E;  4EZH A;  2DI4 A;  2NW7 A;  3PU3 A;  2VWA A;  3C50 A;  4MHC A;  2N2N A;  1XNQ T;  1LKX A;  4QXB B;  1MNE A;  2CWO A;  5L4H A;  5LG4 A;  3RGL A;  4ILA A;  2V6Y B;  1BR0 A;  2KT9 A;  2VKO A;  4KHZ F;  3RC3 A;  3NZQ A;  2WAU A;  4PK5 A;  4HWC A;  3H37 A;  2B76 A;  4UXN B;  4UVC B;  5AQL B;  2X66 A;  2VK9 A;  2BZB A;  3F57 A;  3EAB A;  2NOX A;  2JQK A;  2KLQ A;  4P0B A;  4PJM A;  1IAP A;  4C90 A;  1W09 A;  4HN9 A;  2H89 A;  4UEM A;  2HN1 A;  2WDQ A;  3IEE A;  2KSR A;  5IHY A;  3RYF E;  3SWH A;  3FXE B;  1W0B A;  2ODV A;  4H9S E;  3TLU A;  3GA8 A;  3UU8 A;  3MZK B;  4GIW A;  2WWU A;  3RQU A;  5KDM C;  3N9O A;  1S35 A;  5BMV E;  1US7 B;  4WYV A;  4L0R A;  1OED C;  3ETV A;  2WMO A;  4HWH A;  2XQ3 A;  5L3B B;  1U4Q A;  1B7T A;  4U72 A;  2W4X A;  2RA1 A;  3GMI A;  4NXM T;  1I94 T;  3OVU A;  5AQP B;  3ZN0 B;  3ZJ2 A;  2NR4 A;  4TV8 E;  5JQG E;  4L9I A;  3ZMS B;  5LYJ E;  2BS3 A;  2LSJ A;  3CX7 B;  1VCS A;  3RYC E;  3ZMT B;  4PAG A;  3FZF B;  4BJM A;  5JR9 C;  1OED A;  5L2L A;  4U74 A;  1SA0 E;  2CEA A;  5LMN T;  4WW0 A;  4EV6 A;  4JV5 T;  3KV9 A;  1G8X A;  5ABH A;  1WYB A;  1SE7 A;  2LM2 A;  3RRW A;  1GQE A;  1U5P A;  2VQF T;  3PUS A;  2V6X A;  4YFS A;  2V7I A;  2DWK A;  2E5L T;  3AAA B;  2DNX A;  5JR9 A;  3B13 A;  4PFP A;  3UQ4 A;  2VUR A;  4CN6 A;  4DV1 T;  4G2A A;  1N34 T;  3GN5 B;  2PJQ A;  2KND A;  5FVK A;  3AEF A;  4COF A;  1KF6 A;  4DV5 T;  4ILC A;  3EVY A;  3N9L A;  4YHH T;  3U3I A;  2ES0 A;  2FBW A;  4U2Y A;  1V9D A;  4YSY A;  5H6R B;  3ETU A;  3KVA A;  1WCR A;  1XDP A;  1FIO A;  2IML A;  5HCM A;  4IL9 A;  4JUY A;  4AQG A;  1SHZ C;  2C5I T;  2X9H A;  3WAJ A;  4OYJ A;  2WCA A;  3UU3 A;  4AXP A;  5F3J A;  1EZ3 A;  2XAG B;  2I6H A;  3RHW A;  5IUX A;  2CPT A;  3VRB A;  2BDE A;  3PUV F;  5HCJ A;  2D5U A;  2X0Y A;  1ZV4 X;  5JDM A;  2XAS B;  4DR3 T;  3L39 A;  3Q5E A;  5LHI B;  3TLV A;  2V7K A;  2H3R A;  4I55 E;  2BVM A;  3AEE A;  4MAL A;  2HPJ A;  2XAF B;  3FZL B;  4DMW A;  4HTE A;  2M6B A;  1YKH B;  3P4S A;  2VL8 A;  4GK5 E;  4ISS A;  4IE6 A;  4PK6 A;  4O4H E;  3P4P A;  5E0O A;  4QWN B;  2IC6 A;  5FMN A;  2VVS A;  4EYY R;  2CBI A;  3ZMV B;  2V6Y A;  4X62 T;  1BR2 A;  2XQ4 A;  3M3Z B;  5J1G A;  3AAI A;  4IDP A;  3OKQ A;  4X1I E;  2AXD S;  1I6Z A;  5LNK A;  2DWG A;  1LRZ A;  5LCY A;  3LJC A;  2W63 A;  2V26 A;  4ASK A;  3BK9 A;  3ANW A;  2IC9 A;  3FXD B;  2Y8D A;  2MBG A;  5F8P A;  4ZS2 A;  4LFB T;  4HWF A;  2YDS A;  4GYR A;  3ZCI A;  2UXN B;  4MLK A;  4OHF A;  5AQV B;  2VQE T;  5JDH A;  4ZOL E;  2QGS A;  4A98 A;  2WY2 A;  1VRB A;  5HEG A;  3MJX A;  1MIV A;  1Z8U A;  3OYX A;  5FP3 A;  4JEH B;  3FZH B;  3EUH A;  3UTK A;  4HWI B;  5AQQ B;  1O3X A;  4QXH B;  3AE6 A;  3T1Y T;  4AKG A;  3RRC A;  3AE3 A;  2X9Y A;  5LP6 E;  3HKE E;  3LBX B;  2YDQ A;  4IE7 A;  1HF8 A;  2XSA A;  2YN6 A;  3LG7 A;  2JQ9 A;  2XQ7 A;  3RLF F;  3KBU A;  1T7S A;  5C3J A;  3NVO A;  3UT5 E;  5LXT E;  2H88 A;  5AQR B;  4EOZ B;  5AQS B;  3CX6 B;  1H7C A;  1IJ5 A;  2LRL A;  1IBM T;  3CPZ A;  3RYH E;  1FEW A;  3UUL A;  5ABE A;  2I0M A;  5JTG A;  5JRC B;  4TWH A;  4CQI A;  3OBV E;  3OYZ A;  2QA7 A;  5ABF B;  2CHN A;  2YDR A;  3RKO A;  1IJ6 A;  2J62 A;  5HYA A;  4E7Z A;  5HXS A;  2AE9 A;  4UV9 B;  1WR0 A;  2ACX A;  4QKN A;  4TNW A;  4GKJ T;  1NWM X;  3MKD A;  4I0U A;  4E7S A;  4LMK A;  3VHL A;  3WI3 A;  3UU6 A;  5HXH A;  3O1J A;  5DJQ C;  2XM1 A;  2V8S V;  1YXR A;  2UXB T;  4X66 T;  4QX7 B;  3EDU A;  4KMC A;  3O4X E;  5LBQ B;  4HGA A;  1JNZ A;  1NAF A;  4TX5 A;  4DUZ T;  3N9N A;  1HX8 A;  1MIY A;  2WU5 A;  2BG9 E;  2CXL A;  4JI5 T;  4X64 T;  3OTO T;  4Z8X A;  4J2C A;  4UV8 B;  2LE8 A;  2PTF A;  5CGM A;  3ONL C;  3Q5X A;  5AQM B;  2LM9 A;  1D1B A;  2XUE A;  3CML A;  2IHR 1;  1BR4 A;  4QXC B;  2MAW A;  3I9Y A;  4ILU A;  2QYW A;  2XAH B;  1N33 T;  1QUU A;  3UUX B;  2XQA A;  4PK4 A;  1KNR A;  4M1P A;  3Q9D A;  2BBJ A;  2L8K A;  2ACZ A;  4TN7 B;  4TZ4 C;  5F5W A;  4WNK A;  4JI2 T;  2L9Q A;  1N36 T;  2VKH A;  2LSI A;  2JMK A;  3T1H T;  2CA5 A;  2XAJ B;  5LGU B;  1E1H B;  3TKL B;  4P0A A;  4LF6 T;  3P7I A;  4G63 A;  2XQ6 A;  3QUJ A;  5LGN B;  3AEA A;  3KDS E;  1VCT A;  5CFB A;  4CN1 A;  2K24 A;  4MBQ A;  4DR6 T;  3H3M A;  4ZEY A;  2D9D A;  4UF0 B;  4LF5 T;  1WYC A;  4YLH A;  2MPK A;  2IW5 B;  5LG3 A;  4CXW A;  3ZPO A;  4EYU A;  4JI7 T;  1UK5 A;  3TLS A;  1M7K A;  4DR7 T;  4O8S A;  4BJN A;  5FY7 A;  3ONJ A;  1ZP0 A;  3KVB A;  3K1S A;  2PG8 A;  4WBN E;  3QK6 A;  4LMJ A;  2QVA A;  3PDY A;  4JYA T;  3DP7 A;  3AVR A;  2Y6X A;  3C64 A;  1W9R A;  4UR9 A;  2HPL A;  5CA1 E;  1E7P A;  5A1L A;  3QOF A;  2OLT A;  5LBM A;  4DID B;  4YJ2 E;  2X9X A;  3O1I A;  3AA6 B;  1X9B A;  1OED E;  3Q2M A;  2E9X B;  3EHZ A;  1D0Z A;  4ZXL A;  4ADZ A;  3BQI A;  2CM0 A;  4O2B E;  4F6R C;  5GON E;  5CA0 E;  2UUA T;  2LOP A;  2XY8 B;  4LML A;  2KWI B;  4LFC T;  2XQ5 A;  5FL0 A;  5M4Y A;  3BQL A;  4EB6 E;  1XMQ T;  2K9A A;  5EK3 A;  2EHO B;  1XWM A;  1M62 A;  5JRC A;  4NUU A;  2PFV A;  1J1J A;  5ABF A;  3RX6 A;  4B3S T;  3NZP A;  4EXT A;  2UXX B;  2E9X D;  4ERR A;  4CI1 B;  2LHR A;  3HKB E;  5EK2 A;  2DHR A;  5FY0 A;  4ZI3 D;  5HWY A;  4YXD A;  2MOZ A;  3DJB A;  3FZM B;  2EHO D;  3U78 A;  5JDQ A;  3N9M A;  2K5B B;  2Y48 B;  3LSV A;  4JI6 T;  2K48 A;  2LSK A;  4DVD A;  2YIN A;  2NTY A;  2LSG A;  4B3T T;  3JAF A;  5L3G B;  3C98 B;  3ZC1 A;  1J5E T;  3CQX C;  3SFE A;  3PU8 A;  1Y01 A;  1FMV A;  1HX1 B;  4EAH A;  4HKA A;  5JDN A;  3PUA A;  4GK0 E;  4QH1 A;  4ZHQ E;  4HFH A;  2UU9 T;  1YW0 A;  4TNV A;  1OXZ A;  2FJA A;  3QB5 A;  3M65 A;  2CXD A;  3AE5 A;  5AQT B;  4BAY B;  5FL1 A;  3FBZ A;  5FXV A;  3UUM A;  2V7M A;  2CWY A;  4B3R T;  2H7O A;  2C0S A;  5ADX L;  2NWB A;  1IBK T;  3LK4 2;  2C5K T;  1UUS A;  3PTR B;  4IDO A;  3N9Q A;  4DR2 T;  4CXY A;  2XPK A;  4WZX A;  3FHN A;  4U33 A;  2W66 A;  1SUM B;  1ZKE A;  3RI5 A;  3ZCJ A;  4DBQ A;  2HH7 A;  4Z90 A;  3O1H A;  4HFI A;  3N9P A;  3ZYK A;  3UQ7 A;  2JJ9 A;  1J5W A;  4AIS A;  5KMG P;  3L8R A;  2M6I A;  5J2U E;  2W00 A;  2CMR A;  3PE0 A;  3PUW F;  5HXR A;  5J0Z A;  2YU1 A;  3E08 A;  2A72 A;  4I4T E;  1MMG A;  3OPC A;  4LFA T;  3PJA J;  1G73 A;  1QSD A;  4UF0 A;  4YSZ A;  2LT3 A;  1MIW A;  3VKH A;  2JPF A;  4TWF A;  4JI8 T;  2W0G A;  4CXX A;  2X0H A;  3CIR A;  3PUZ F;  2MTQ A;  4OX9 T;  5EZY E;  4XAX B;  5KXJ A;  1D1A A;  1T98 A;  4HFB A;  4EZ4 A;  4YT0 A;  3VR9 A;  2E9X C;  4HFV A;  4V1A v;  1Y64 B;  4GYS A;  4ZS3 A;  5IWA T;  4O4J E;  3PUY F;  1UGO A;  4ZI3 C;  3WAK A;  4P09 A;  2E2A A;  3AXJ B;  4P1N A;  3VU7 H;  3MA9 A;  2KIN B;  3LK2 B;  4HWD A;  2EHO C;  4KP3 C;  1MND A;  1KNP A;  4TWD A;  3ZT5 A;  3G06 A;  3RIA A;  3UFG A;  3PUQ A;  2E9X A;  3CQG B;  3C4X A;  2KZ7 B;  4CZZ B;  4AI6 A;  4O4I E;  4QHO A;  4AKI A;  3LK3 B;  3RIU C;  3AEB A;  3GWH A;  2EHO A;  4KUM B;  4U31 A;  4DV7 T;  1LVK A;  2HN2 A;  4UVB B;  3F2E A;  2FUP A;  3J9X 1;  4TUY E;  4O2A E;  4NPP A;  1KEY A;  4FI5 A;  2XQ8 A;  2BVL A;  5CB4 E;  3RIF A;  1HR0 T;  5FNV E;  3RIU A;  2Z6E A;  5L3F B;  2VAS A;  3IHR A;  4LF7 T;  2QRX A;  4IGU A;  5AQU B;  3CQC B;  3GN5 A;  5LGT B;  2BKO A;  2CLY B;  2J47 A;  2GK9 A;  2LOS A;  3H3A A;  2C5J A;  1YQ4 A;  4DV4 T;  2J1D G;  3VR8 A;  3A8Y C;  2WU2 A;  3HKD E;  4JEU B;  1HS7 A;  4UVA B;  2PBI A;  4IL4 A;  3N5L A;  3VRA A;  4X1Y E;  4XZC A;  5FXX A;  3JAE A;  4F8H A;  3AA0 B;  2WQY A;  1L0V A;  3X1D A;  2ZM6 T;  3CK6 A;  4DV6 T;  3HL6 A;  3AE1 A;  3O9X A;  3QB5 K;  5HAX A;  2A3D A;  4H9O C;  5JDG A;  4PJL A;  1KFY A;  2W62 A;  4C91 A;  5LJM A;  4EIW A;  4DBR A;  5JH7 E;  3KV4 A;  4A5X A;  1YQ3 A;  2HHH T;  2FJE A;  4ZZC A;  1D0X A;  4QH5 A;  2CXF A;  3FBL A;  3PUG A;  2E8I A;  4KX6 A;  3C4Z A;  2KMF A;  1LVF A;  3AAE B;  3PUX F;  1UUR A;  3L09 A;  5L3E B;  4XBF B;  4DV0 T;  4AQF C;  3CWZ B;  3QC9 A;  5BR8 T;  4CI2 B;  4K0U A;  3ZYM A;  1D0Y A;  3EAM A;  4KI0 F;  3B57 A;  2IIU A;  3UFE A;  2WBL A;  4ZZB A;  2F4V T;  4IIJ E;  3R84 B;  1HG2 A;  2V5C A;  4ANJ A;  5LB7 B;  2LLY A;  4EED A;  5DQV A;  4AQF A;  4IE5 A;  2V7L A;  3I9W A;  2R6G F;  4DV2 T;  5IYZ E;  3JAD A;  3IF8 B;  4H9R C;  3V5S A;  2DL1 A;  3RF1 A;  3K3N A;  4OYK A;  2UXC T;  2N1G A;  2WDV A;  3KIN B;  5C8Y E;  2YU2 A;  4LF8 T;  2X9W A;  5AQJ B;  2W2U A;  1W0A A;  2IUB A;  2P9B A;  2XM2 A;  1NEK A;  3N2O A;  3RH3 A;  3C51 A;  3AXJ A;  3AE7 A;  2V5D A;  1S94 A;  3K3O A;  1BR1 A;  3RPU A;  3V5U A;  2IDO B;  2XSB A;  4LF4 T;  4YTN A;  4HE8 A;  5L3C B;  3ZC0 A;  2LKH A;  4KBM B;  2LRK A;  3HR0 A;  4NXN T;  1IZN B;  3P4W A;  5TAO A;  1HFA A;  3ZYL A;  4CN4 A;  3ANW B;  1XNR T;  5L47 A;  1CUN A;  4Z91 A;  1ZHC A;  5HEH A;  4HFE A;  2A2F X;  2K3W A;  3ESL A;  2B1E A;  2BKN A;  4IHJ E;  3LBX A;  2NW9 A;  2YKS A;  2JRK A;  4X65 T;  4DMV A;  3K3Q C;  2CLY C;  4H63 V;  1KNZ A;  3ZMU B;  5HXE A;  3ZJ1 A;  4NIQ A;  2V1D B;  4YJ3 E;  2YK0 A;  3E22 E;  3DTO A;  2M67 A;  3HA4 A;  1WFD A;  4I50 E;  3SS1 A;  2ZLY A;  3AE8 A;  3NRX A;  2DLR A;  3AA1 B;  4HFD A;  1YKE B;  3UU5 A;  3T8O A;  4LF9 T;  5HEJ A;  3AEG A;  3SOL A;  5J2T E;  3VKG A;  3ZLI A;  4JI4 T;  1IBL T;  5AFU L;  2CRB A;  4YSX A;  2KXP B;  4HFC A;  4L5G A;  4FJO A;  2BS4 A;  3ONX A;  5FXZ A;  3KV5 A;  3I0O A;  2BS2 A;  1E2A A;  5LMU T;  2OV9 A;  4JI1 T;  4DO0 A;  3N2K E;  3RKG A;  2VL0 A;  5ABG A;  4H9Q C;  2CE7 A;  3CKD A;  5HWX A;  2X0L B;  5DQW A;  3J7Y q;  3FB2 A;  4ZI7 E;  2ZM2 A;  4DR5 T;  1OWA A;  2LJL A;  2N9D A;  2MYS A;  4DR4 T;  2WB5 A;  3TLT A; 
#chains in the Genus database with same CATH homology
 3MA9 A;  3EDU A;  4HN9 A;  4QX7 B;  2KIN B;  5JDF A;  4KMC A;  4UEM A;  3S4U A;  3LK2 B;  3IEE A;  3O4X E;  2EHO C;  5LBQ B;  4HGA A;  1NAF A;  4TX5 A;  5IHY A;  3RYF E;  3SWH A;  3FXE B;  3NRY A;  4DND A;  4KP3 C;  1MND A;  2ZM0 A;  2G0U A;  3R6N A;  3N9N A;  1HX8 A;  1MIY A;  4WBO A;  2CXL A;  2ODV A;  4H9S E;  3PUQ A;  2E9X A;  3CQG B;  2X67 A;  3GA8 A;  3NBX X;  3C4X A;  1HTJ F;  3KBT A;  4PJJ A;  2KZ7 B;  3MZK B;  4Z8X A;  4GIW A;  2WWU A;  4J2C A;  4UV8 B;  4CZZ B;  2LE8 A;  4AI6 A;  5KDM C;  4O4I E;  3N9O A;  1S35 A;  3W15 B;  4QHO A;  1D1C A;  5BMV E;  4AKI A;  1US7 B;  3LK3 B;  3Q5X A;  4OK0 A;  3GWH A;  4L0R A;  3ETV A;  2LM9 A;  1D1B A;  2WMO A;  2Q9Q B;  2XUE A;  3CML A;  5L3B B;  1HG5 A;  1U4Q A;  2EHO A;  3KFW X;  4KUM B;  1B7T A;  4U72 A;  1BR4 A;  2RA1 A;  4QXC B;  1LVK A;  3GMI A;  3I9Y A;  3MAC A;  4ZI2 D;  4UVB B;  4ILU A;  2JQQ A;  3ZN0 B;  3F2E A;  4BA9 A;  3J9X 1;  2XAH B;  5H6Q B;  3ZJ2 A;  4TUY E;  4O2A E;  3JC6 D;  1QUU A;  3UUX B;  4PK4 A;  1WR6 A;  5LOV E;  4TV8 E;  5JQG E;  2H7V C;  4FI5 A;  3Q9D A;  4L9I A;  4M1P A;  3ZMS B;  5LYJ E;  2L8K A;  2LSJ A;  2BVL A;  4TN7 B;  4TZ4 C;  3CX7 B;  5CB4 E;  3RYC E;  3ZMT B;  4PAG A;  3HKC E;  4BJM A;  5FNV E;  2Z6E A;  4B6X A;  5L3F B;  5JR9 C;  5FY1 A;  2VAS A;  2DCF A;  4WNK A;  2Q9Q D;  3IHR A;  5L2L A;  1VOM A;  2L9Q A;  2VKH A;  2ZMA A;  5HXC A;  4IGU A;  4U74 A;  2LSI A;  2JMK A;  2XAQ B;  1SA0 E;  2CEA A;  2SPC A;  2CA5 A;  2XAJ B;  4WW0 A;  2NP9 A;  3CQC B;  3GN5 A;  5LGU B;  5LGT B;  5LJN A;  2CLY B;  1E1H B;  2GK9 A;  3TKL B;  3N2G E;  2L3L A;  3D0T A;  2LOS A;  3H3A A;  3KV9 A;  1AJ3 A;  4P0A A;  1G8X A;  3E0Z A;  2C5J A;  3P7I A;  4G63 A;  1WYB A;  2J1D G;  3RRW A;  4UEL A;  3QUJ A;  3HKD E;  4JEU B;  5LGN B;  1U5P A;  4JLE A;  1HS7 A;  4UVA B;  3PUS A;  4IST A;  2PBI A;  4YFS A;  2V7I A;  3KDS E;  2DWK A;  1MMD A;  3N5L A;  4H9N C;  3AAA B;  2DNX A;  4X1Y E;  4XZC A;  5FXX A;  4IE0 A;  4PJN A;  5JR9 A;  3B13 A;  4PFP A;  2K24 A;  4MBQ A;  4G2A A;  3GN5 B;  2WM9 A;  2PJQ A;  4AKH A;  2KND A;  3AA0 B;  4UF0 B;  1WYC A;  4YLH A;  3EVY A;  3N9L A;  3OJA A;  2IW5 B;  2JMH A;  1UX5 A;  1UX4 A;  3U3I A;  5JRE A;  2LSY A;  3HL6 A;  2ES0 A;  3O9X A;  4CXW A;  3ZPO A;  1Z0P A;  4EYU A;  5HAX A;  2WSS V;  4O8S A;  4BJN A;  1V9D A;  2A3D A;  4H9O C;  1FMW A;  5FY7 A;  4YHJ A;  3KVB A;  3RYI E;  2PG8 A;  5H6R B;  4WBN E;  1HCI A;  3QK6 A;  3ETU A;  1WLX A;  5JDG A;  3KVA A;  4PJL A;  2W62 A;  3CVR A;  3PDY A;  4C91 A;  5LJM A;  3DP7 A;  4EIW A;  3AVR A;  2Y6X A;  3C64 A;  2VKJ A;  4DBR A;  5JH7 E;  3KV4 A;  1FIO A;  2KWH A;  4A56 A;  2HPL A;  1D0X A;  5CA1 E;  4JUY A;  4AQG A;  1SHZ C;  2C5I T;  2X9H A;  2CXF A;  3FBL A;  3K8P C;  3WAJ A;  4OYJ A;  3PUG A;  5A1L A;  4PFO A;  2E8I A;  5LBM A;  4AXP A;  3C4Z A;  2KMF A;  3LFM A;  4YJ2 E;  5F3J A;  2X9X A;  3O1I A;  3AA6 B;  2I59 A;  1EZ3 A;  2XAG B;  1LVF A;  3AAE B;  4HEA A;  3L09 A;  3Q2M A;  2BDE A;  1X79 A;  5L3E B;  4H9P C;  5KX5 E;  5FYM A;  4XBF B;  2RP4 A;  3UUN A;  3CX8 B;  2E9X B;  2D0T A;  1D0Z A;  4AQF C;  2D5U A;  3CWZ B;  1ZV4 X;  3BQI A;  4ADZ A;  4H63 H;  5JDM A;  2XAS B;  2CM0 A;  3QC9 A;  4O2B E;  2LEH A;  4PNI A;  5GON E;  4F6R C;  5CA0 E;  2LOP A;  4CI2 B;  4K0U A;  4OFZ A;  3ZYM A;  1D0Y A;  3AA7 B;  5LHI B;  2KWI B;  2V7K A;  2H3R A;  4I55 E;  4I43 B;  2BVM A;  5LHG B;  5M4Y A;  3BQL A;  3B57 A;  3UFE A;  2WBL A;  4EB6 E;  4MAL A;  4PW8 A;  2HPJ A;  4MFR A;  2XQY A;  2K9A A;  2NTX A;  2XAF B;  4DMW A;  4HTE A;  5EK3 A;  3EDV A;  5LHH B;  2EHO B;  4IIJ E;  1YKH B;  3R84 B;  4QX8 B;  5JRC A;  1HG2 A;  2V7J A;  2VL8 A;  4GK5 E;  4ISS A;  2ODU A;  4NUU A;  4IE6 A;  4PK6 A;  4ANJ A;  2PFV A;  4O4H E;  3RX6 A;  3NZP A;  4EXT A;  2UXX B;  5E0O A;  2E9X D;  5DQV A;  4ERR A;  4AQF A;  4TV9 E;  2W61 A;  4CI1 B;  2X68 A;  4QWN B;  3ZEF B;  4IE5 A;  2IC6 A;  5FMN A;  3C4W A;  2WMN A;  2LHR A;  4EYY R;  3HKB E;  3HI2 A;  5JDL A;  4CI3 B;  3ZMV B;  5EK2 A;  2DHR A;  5FY0 A;  2V7L A;  3I9W A;  4ZI3 D;  4ZI2 C;  5IYZ E;  1BR2 A;  3IF8 B;  4H9R C;  3AVS A;  5JVD E;  3V5S A;  3K3N A;  4OYK A;  5HWY A;  2N1G A;  2MOZ A;  3KIN B;  3DJB A;  3JC6 C;  5C8Y E;  2LHN A;  2YU2 A;  2EHO D;  2X9W A;  3U78 A;  5J1G A;  2OA5 A;  3AAI A;  3F31 A;  5JDQ A;  3N9M A;  2K5B B;  2Y48 B;  2IAK A;  3OKQ A;  4O4L E;  2K48 A;  3ZMZ B;  4X1I E;  2LSK A;  2P9B A;  4NUV A;  3MXZ A;  2YIN A;  3N2O A;  3RH3 A;  4DVD A;  3C51 A;  5LNK A;  2DWG A;  1LRZ A;  1S94 A;  5LCY A;  2NTY A;  3LJC A;  2W63 A;  2Q9Q C;  2V26 A;  2X51 A;  5DAB A;  4ASK A;  3K3O A;  2LSG A;  3ANW A;  3BK9 A;  3SRZ A;  3L3P A;  4N78 D;  4X20 E;  2CCQ A;  1BR1 A;  3RPU A;  5L3G B;  3A5X A;  2IC9 A;  3C98 B;  3V5U A;  3FXD B;  2Y8D A;  2MBG A;  3ZC1 A;  5JR9 B;  3CQX C;  5F8P A;  4ZS2 A;  3PU8 A;  4GYR A;  5LA6 E;  1FMV A;  3ZCI A;  4HE8 A;  5L3C B;  2UXN B;  4MLK A;  4OHF A;  3ZC0 A;  4EAH A;  4KBM B;  4HKA A;  5JDN A;  3HR0 A;  3PUA A;  4GK0 E;  1IZN B;  2D2S A;  5TAO A;  5JDH A;  1HFA A;  4ZOL E;  2QGS A;  4IDZ A;  3ZYL A;  2XTL A;  4GOU A;  1MMA A;  1VRB A;  5L3D B;  3ANW B;  4ZHQ E;  3I0Q A;  1MIV A;  1CUN A;  3MJX A;  3OYX A;  5EK4 A;  3PUR A;  5FP3 A;  2XHE B;  2Q9Q A;  4JEH B;  1YW0 A;  1ZHC A;  1MMN A;  2A2F X;  1WRD A;  2ZM8 A;  3ESL A;  2B1E A;  4IHJ E;  3LBX A;  3EUH A;  2NW9 A;  1OXZ A;  3UTK A;  3M65 A;  2CXD A;  3Q5W A;  2JRK A;  3ZN1 B;  4DMV A;  3K3Q C;  2CLY C;  3AB3 B;  3P8C D;  2D0U A;  4H63 V;  4BAY B;  1O3X A;  3FBZ A;  5FXV A;  1YD8 G;  3UUM A;  1KNZ A;  2V7M A;  4QXH B;  3ZMU B;  2CWY A;  2H7O A;  5HXE A;  2C0S A;  3ZJ1 A;  5ADX L;  2NWB A;  3LK4 2;  2C5K T;  3PTR B;  3IBP A;  4AKG A;  3N9Q A;  3RRC A;  1ZEE A;  2V1D B;  5FXW A;  2X9Y A;  4YJ3 E;  2YK0 A;  3E22 E;  5ETW A;  5LP6 E;  3DTO A;  4AKR B;  3HKE E;  3LBX B;  2M67 A;  3HA4 A;  4IE7 A;  4CXY A;  3BQK A;  4I50 E;  1HF8 A;  2VKD A;  3FHN A;  3SS1 A;  3LG7 A;  2ZLY A;  3NRX A;  3KBU A;  3I1A A;  1ZKE A;  3KV6 A;  2VB6 A;  2YEV C;  3ZCJ A;  4DBQ A;  2DLR A;  4IE4 A;  3UT5 E;  2HH7 A;  4AKL A;  3AA1 B;  1YKE B;  3MK7 C;  1KK7 A;  3O1H A;  5LXT E;  3RC8 A;  3T8O A;  3ZYK A;  3N9P A;  2JJ9 A;  1UCU A;  4UIG A;  4EOZ B;  5KMG P;  5J2U E;  2W00 A;  2CMR A;  2NW8 A;  3PE0 A;  3SOL A;  5J2T E;  3VKG A;  3CX6 B;  3ZLI A;  1H7C A;  1IJ5 A;  4X1K E;  3CPZ A;  5AFU L;  3RYH E;  5HXR A;  1FEW A;  2KXP B;  3UUL A;  4EZH A;  4L5G A;  2DI4 A;  2NW7 A;  3PU3 A;  4FJO A;  2VWA A;  5JRC B;  2YU1 A;  3C50 A;  3E08 A;  2A72 A;  4I4T E;  3ONX A;  4MHC A;  1MMG A;  4CQI A;  2N2N A;  5FXZ A;  3OBV E;  3OYZ A;  3KV5 A;  3I0O A;  1LKX A;  2QA7 A;  1G73 A;  1QSD A;  4QXB B;  4UF0 A;  1MNE A;  2LT3 A;  2CWO A;  1MIW A;  3RKO A;  3VKH A;  1IJ6 A;  4DO0 A;  5LG4 A;  3N2K E;  2JPF A;  5HYA A;  4H9Q C;  1BR0 A;  2CE7 A;  2KT9 A;  2W0G A;  2VKO A;  4CXX A;  4E7Z A;  3RC3 A;  2MTQ A;  3NZQ A;  2WAU A;  5EZY E;  3CKD A;  4XAX B;  4PK5 A;  5HWX A;  1T98 A;  1D1A A;  2X0L B;  4EZ4 A;  5HXS A;  5DQW A;  4UV9 B;  2ACX A;  3J7Y q;  4QKN A;  3H37 A;  3FB2 A;  2E9X C;  4UVC B;  1NWM X;  4UXN B;  4ZI7 E;  4HFV A;  4V1A v;  1Y64 B;  3MKD A;  2X66 A;  4GYS A;  4ZS3 A;  2VK9 A;  4E7S A;  2BZB A;  3F57 A;  2NOX A;  3VHL A;  2ZM2 A;  4O4J E;  3WI3 A;  2KLQ A;  5HXH A;  4P0B A;  4PJM A;  1OWA A;  3O1J A;  4ZI3 C;  1IAP A;  2LJL A;  4P09 A;  3WAK A;  2N9D A;  2MYS A;  4C90 A;  5DJQ C;  3VU7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...