2CA5A

Mxih needle protein of shigella flexneri (monomeric form, residues 1- 78)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
b'DDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAILEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MXIH
publication title Molecular Model of a Type III Secretion System Needle: Implications for Host-Cell Sensing
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Transport protein
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ca5A00
1ZKEA 2KWHA 3FXDB 2C5KT 1LRZA 4J2CA 2MBGA 3S4UA 4L0RA 2KWIB 4FI5A 2X9YA 1QSDA 3L3PA 2CA5A 2K48A 3CKDA 4CQIA 2X9WA 3QK6A 3MXZA 2IC9A 3CVRA 2C5IT 4B6XA 1Z0PA 2IC6A 3TKLB 3FXEB 4EYYR 3P7IA 2G0UA 1IJ5A 2X9XA 3N5LA 4DNDA 1H7CA 1IJ6A 3QUJA 2XTLA 2C5JA 1LVFA
chains in the Genus database with same CATH superfamily
2KXPB 3C98B 4QXCB 5AQKB 1UURA 4HGAA 2UUBT 2LT3A 1QSDA 2IUBA 3ANWA 4P1NA 4IDNA 1VRBA 3UQ4A 4AKRB 3NZQA 1HFAA 2UXBT 2N9DA 1HG2A 4ZXLA 3N2OA 1NENA 3AEAA 3T8OA 3NRYA 2NOXA 2XPKA 4QHOA 4LMLA 1OEDC 5HYAA 4UF0A 3NKZA 2LSIA 2IC9A 5LP6E 2W67A 2QRXA 4CXXA 3ZMSB 1YXRA 3ONXA 4TWHA 3CQXC 4L5GA 2P9BA 3FXDB 3PUGA 3RHWA 2WDVA 3Q5XA 1DU2A 2XQ5A 4HN9A 4ILUA 2X9WA 1XMOT 2XAQB 3MACA 4K0KT 1ZEEA 2IC6A 3ZJ2A 4UIGA 4DMWA 5HXHA 2V7KA 5L2LA 2PBIA 2IAKA 4QXBB 3FBZA 4L9IA 4GK0E 1XWMA 2E9XC 1S94A 1T72A 2UUCT 1FEWA 1XDPA 4WBNE 4ZS2A 2MYSA 4ISTA 4EOZB 1M7KA 3CK6A 2W00A 3ZMZB 2NP9A 3T1HT 4EEDA 4DV1T 5L4HA 4ILBA 2BBJA 4EV6A 1WLXA 2RPAA 3AXJA 4NPPA 2W4XA 2ES0A 2I6HA 3SWHA 5DABA 5LG4A 2V26A 5AQPB 5J0ZA 4I4TE 2XZEA 2L8KA 1W0BA 1VOMA 1WYBA 2RP4A 2V6XA 2BDEA 4GK5E 5CA1E 2JRKA 2W61A 4G63A 1D0XA 2LE8A 4X5TA 2DI4A 3VR9A 2LOPA 4CI2B 4B3TT 4AKHA 1WR6A 3W15B 3RYFE 3N2KE 4KI0F 1KF6A 3AE4A 3BQLA 3RIUA 2CWYA 3FXEB 4KMCA 1US7B 3PUXF 2OV9A 2N1GA 5JDHA 4UVCB 2CE7A 1NWMX 5LG3A 3K1SA 2W2UA 2D0TA 3KBTA 3RLFF 2B76A 4OFZA 4TNWA 2VKDA 5IUXA 1HR0T 3PE0A 2EHOC 2PFVA 1ZKEA 1OEDB 2Y8DA 5AQGB 4CI1B 3U3IA 3C4XA 4LMKA 1KNRA 2JQ9A 4DV6T 3AA1B 4P0BA 5ABGA 3CWZB 3EHZA 4AQYT 5F3JA 5J1GA 4XAXB 3ZYLA 4JI1T 3EABA 4ZZBA 2WDRA 2WDQA 2YU2A 2H3RA 3AEEA 4Q25A 3M3ZB 4ISSA 5LHIB 2L9QA 2JQKA 4MFRA 5FY0A 5LMUT 5FXZA 4GKJT 3UTKA 4AKLA 2LJLA 3ZYKA 2CM0A 3GN5A 4PK6A 3LFMA 5JR9C 2J62A 5AQQB 1LRZA 4DR1T 3VRAA 2WSSV 4X62T 2V7MA 3K3NA 3KV6A 4EB6E 5KXJA 2HH7A 3BK9A 5EZYE 5HCMA 5FY7A 3RC3A 3NVOA 2C5JA 3NRXA 5JDQA 3HL6A 5JDFA 3I0QA 5FVLA 1EZ3A 2IIUA 1X79A 4ZZCA 4AXPA 4BAYB 4PJLA 5F8PA 1MMDA 3EAMA 1S35A 5EK4A 4GKKT 4CN4A 1SE7A 4UV9B 4ASKA 4YSXA 4H9NC 2W62A 2WP9A 2KWIB 3TLSA 4CQIA 3RKGA 4PK5A 3AAIA 3UUXB 4QH5A 3JAFA 1ZV4X 5J2TE 4GYRA 5L3BB 1G8XA 4PJJA 1X9BA 5AQNB 4YJ2E 1VCTA 3QOFA 4IL4A 4KHZF 3UUMA 1YW0A 4KBMB 1UX5A 4ILCA 3RYIE 3AE3A 3AE7A 2J47A 3EDUA 4EYUA 1OWAA 2ODUA 4TX5A 4TUYE 3V5UA 3TLUA 3N9NA 2BKOA 1WR0A 5LCYA 1LVKA 3CX8B 4JLEA 2CXDA 4YTNA 1W09A 4DR2T 3KDSE 5KDMC 1UK5A 1D1AA 2JQHA 4ZI2C 3KBUA 2EHOB 3LSVA 4HFCA 1T8BA 2LM2A 2HPJA 2W66A 3ZMUB 1WFDA 4LF5T 4O4LE 1HCIA 5AQTB 2ZMAA 3O9XA 3ANWB 2H89A 3BQKA 4TNVA 5AQOB 4QX8B 3KVAA 2AE9A 1CUNA 4U7IA 4AKIA 4DUZT 5L3GB 3ZC1A 5IYZE 3CPZA 3NZPA 3WI3A 3ZN0B 2LHRA 4QH1A 3RYHE 4ZS3A 2HPLA 4TV9E 3OYZA 2AXDS 3AE2A 4LFCT 3ZYMA 5IHYA 5FXXA 5CFBA 2CXFA 3AVRA 5JR9B 3AVSA 4MBQA 4Z91A 4UR9A 4ZI3D 4U72A 1XMQT 1IBKT 2WBLA 3UQ7A 4PJNA 4FJOA 2BG9A 2XQ9A 4PJMA 1WCRA 3A5XA 4LF7T 4O4HE 2IDOB 4O8SA 4CI3B 4OX9T 2V8SV 3ZSTA 5BR8T 1G73A 1NAFA 4P09A 4I50E 5AQLB 2DLRA 3J9X1 4QX7B 3TKLB 3I1AA 2ZM8A 2LRLA 2X67A 2YN6A 2ZM0A 3OTOT 3N9QA 4JI7T 4UEMA 1HNXT 5FP3A 4IE4A 3AXJB 3MXZA 5AFUL 3K3QC 2ACXA 3ZEFB 2WWUA 2FJDA 3AEBA 1D0YA 2CEAA 5C8YE 3AA0B 2VKHA 3WAJA 5HEOA 2CCQA 1BR4A 3VKHA 5FXVA 1B7TA 3RX6A 3G06A 4O4JE 4OYKA 3TLTA 4YJ3E 5AQSB 3MA9A 2NWBA 2UUAT 2E8IA 2XQ8A 1H7CA 3JCFA 1Y01A 5JDLA 2DWKA 3JC6D 4O2BE 3IBPA 4JI4T 2CA5A 2V1DB 2MAWA 4IHJE 3L8RA 4IREA 3AEFA 4JEHB 2C5IT 4MHCA 2H7VC 4DR4T 2WAUA 3IEEA 4H9RC 2BBHA 1HNZT 1I6ZA 3N9MA 1JNZA 4FI5A 3UU8A 4JEUB 4HWFA 5FY1A 4HE8A 4N78D 4YXDA 1XNRT 1HS7A 1MIVA 2OA5A 3RRWA 5FYMA 3N9LA 2YOEA 2H7OA 3ETVA 3ABVA 1CHUA 2BS2A 3PJAA 3FZFB 5H6RB 5LNKA 3C4ZA 3C64A 5JDNA 2KLQA 5LXTE 3VKGA 4LF6T 1LVFA 1LKXA 2R6GF 3VR8A 4COFA 3Q2MA 4DV3T 3B13A 4YSYA 2CHOA 3U78A 5LOVE 4LMJA 4BJMA 2M6IA 3SFEA 1IJ5A 4IE7A 4DR3T 4AIUA 5LMNT 1SUMB 4DR5T 5CGMA 4IDQA 2XJ7A 4HFDA 3LDQB 1FIOA 2YDSA 5HWYA 1V9DA 4KHPT 2QVAA 2Q9QA 5L3DB 3ONLC 2BS4A 3UU3A 4Z8XA 2J1DG 4P0AA 2XSBA 2BKPA 2X51A 4DO0A 5ABEA 3E22E 5HXSA 4H9OC 3AE5A 3CVRA 3RIFA 3UU5A 3D0TA 3PUSA 2X9XA 5J2UE 2CHNA 1E1HB 3H37A 4I0UA 1MIWA 1HNWT 3MK7C 4YY3T 2FJEA 1MNEA 3HKDE 2XQYA 2YINA 3GA8A 4LF8T 2NW9A 3DTOA 4I43B 2HHHT 5LJMA 2WCAA 3L09A 3RKOA 4IIJE 3AE1A 2K9AA 4NUVA 3ZC0A 4JI5T 4JV5T 5ETWA 3EI0A 2M6BA 4X1KE 5ABHA 2XASB 3CX6B 3KV9A 2Q9QD 1W9RA 2DWGA 2ZM6T 2K48A 1R8IA 5LBQB 3GWHA 2GK9A 4UELA 3QUJA 2LSYA 5LYJE 4KP3C 4DMVA 2DCFA 3PU3A 2LOSA 4O4IE 4AKGA 5FKYA 1N33T 2X68A 3A8YC 2I0MA 1MMAA 2YEVC 4C90A 3L39A 5FVKA 2KWHA 3LK2B 4EIWA 2VK9A 3Q9DA 2Y48B 3C51A 1Z8UA 1IBMT 1MMGA 3O4XE 5CB4E 4CN1A 5HXRA 2A9UA 4H9PC 3UFEA 5HXEA 3PURA 3ZSSA 4X20E 4IT4A 2UXCT 3Q5DA 4U7YA 1Y64B 4AQFA 4C91A 2KZ7B 3CKDA 3SFDA 4YSZA 4M1PA 4YFSA 3UUNA 2V6YB 4TZ4C 3RC8A 3X1DA 2YDRA 2WB5A 2X66A 3TLVA 2ZLYA 5BMVE 3LK3B 1HX8A 4WW0A 3IA3A 3UU4A 3PTRB 4A97A 4QH4A 5LGUB 5HEGA 4H9SE 1E2AA 4YHHT 2E5LT 2ZM2A 5JTGA 3KV5A 2CLYC 2KMFA 5L3FB 4X64T 5JRCB 1UUSA 4HEAA 4U3CA 4LFAT 4HWIB 5LGTB 3DP7A 5FMNA 5JH7E 1E7PA 3FZKB 4UVAB 3ONJA 1L0VA 2XQ3A 5AQIB 2M67A 2LKGA 4U31A 3ZJ1A 3RIUC 1UCUA 3ZCIA 4UV8B 1NEKA 2Y6XA 3QB5K 1ZOYA 4GYSA 5FNVE 2NTXA 3MKDA 3AE8A 2X9YA 1D1BA 2JMKA 2KT9A 2XAFB 4V1Av 2A72A 1J5ET 4EZHA 3FZHB 1T98A 3AA7B 4UF0B 5LBMA 2WZHA 3VHLA 4U33A 4LFBT 3RGLA 3KVBA 2A3DA 1N34T 2BVMA 1KNZA 4IGUA 4H63H 3CQGB 2XTLA 5FXWA 1W0AA 3O1HA 3OVUA 4ERRA 4O2AE 1MMNA 2JPFA 2NW8A 2VL8A 3IHRA 3A7MA 4HFHA 5M4YA 3ZMVB 1D0ZA 4IE0A 2E9XA 2XM1A 4EXTA 4ZEYA 5GONE 2CMRA 2LM9A 4GOUA 4L0RA 1D1CA 3L3PA 3P4SA 3V5SA 2CBJA 4H63V 3EUHA 5LHGB 3N2GE 4LF9T 2XAGB 2PTFA 4DNDA 4YLHA 3DJBA 5LB7B 3ZT5A 2BZBA 3J7Yq 3F31A 2VASA 2Q9QB 4HTEA 2BG9E 4BJNA 3P8CD 5CJ5A 3IF8B 2CLYB 3AE9A 3LK42 3F57A 4JI2T 1U4QA 2K24A 3RF1A 3JAEA 2C0SA 2C5KT 3VU7H 2VKOA 2L3LA 2D9DA 4CXYA 4PFOA 4MALA 4ZI7E 1IAPA 2SPCA 4BA9A 3H3MA 5AQUB 5L3CB 3E0ZA 2WMNA 1GQEA 3EVYA 5F5WA 4XZCA 3PDYA 2E9XD 3P4QA 4ZI3C 1IZNB 1ZP0A 1J1JA 3PUAA 2YU1A 4HKAA 4F6RC 4WNKA 3HI2A 4TV8E 5ABFA 3RQWA 3AA6B 4EZ4A 4U2YA 5JVDE 2LHNA 2NTYA 2EHOA 2NR4A 5EK2A 1XDOA 2I59A 3UFGA 2PJQA 1VCSA 3JADA 2FJAA 2WM9A 5H6QB 2G0UA 5L4EA 3RI5A 3PUYF 2DL1A 4E7SA 5AQVB 2XQ4A 4B6XA 2LSJA 4PNIA 2BS3A 5KMGP 5JR9A 3I9YA 2WU5A 3GN5B 3ZMTB 5TAOA 4DBRA 1KK7A 3Q5EA 3FZLB 3HKCE 1XNQT 4K0UA 4U2ZA 2J4GA 3QB5A 4Z90A 2BG9C 4HFVA 4NIQA 3EDVA 4NUUA 4TN7B 2EHOD 5JDMA 3SS1A 2VQFT 3GMIA 5AQJB 3JC6C 1I94T 1SHZC 4AI6A 4HFEA 4IDOA 4JI6T 4AQGA 4HWCA 4UVBB 2D2SA 3QK6A 4NXMT 2VB6A 2X9HA 3RH3A 4DV4T 4DR7T 4F8HA 2D5UA 2CPTA 1BR0A 5A1LA 4ANJA 2VKJA 4OK0A 1SA0E 3RPUA 2WWVA 3LBXA 2HN1A 4JBWF 5AQRB 4OHFA 1YKHB 2XY8B 2W63A 2YDQA 1Z0PA 2WS3A 3P7IA 3AECA 2WU2A 3I9WA 5AQMB 1M62A 3CQCB 1YQ3A 2XAJB 1FMVA 1QUUA 1ZHCA 5AQFB 2V7IA 4G2AA 4QWNB 3AB3B 2X0YA 2CWOA 3RRCA 3OPCA 2VVSA 4A56A 1JNRA 2XAHB 2UXNB 3PV0F 4YT0A 3WAKA 2V5DA 4WZXA 3SOLA 2NW7A 2MBGA 4DV0T 4CXWA 4CN6A 1KEYA 2KINB 4U74A 5C3JA 4IE6A 3ESLA 3N5LA 1IJ6A 4B3RT 3UU6A 3PUZF 4PK4A 4DV2T 3O1IA 3KV4A 2IHR1 1YD8G 2KSRA 4JUYA 2V5CA 2DHRA 2YK0A 2QGSA 4PAGA 2QYWA 4B3MT 4A5XA 4ZOLE 3VRBA 2XUEA 4WYVA 4IDZA 3QNUA 4WBOA 3S4UA 4DUYT 1U5PA 4HWHA 3AEDA 5LJNA 2CRBA 1FMWA 2BG9B 4GIWA 5LA6E 3RYCE 2X0LB 4ZI2D 5HCJA 4NXNT 4EGWA 3I0OA 2X0HA 3R6NA 2KNDA 2XSAA 3F2EA 3BQIA 2V7LA 2V7JA 3UUBA 4J2CA 5AQHB 2E2AA 2FUPA 2UXXB 3LJCA 4JI0T 2E9XB 1MIYA 1AJ3A 3HKEE 2LSGA 4TWFA 2WZIA 4CZZB 3FZMB 3P4PA 4X65T 1WYCA 1HX1B 2XQ7A 3SRZA 4OYJA 5DQWA 3MZKB 3B5MA 5HAXA 2WQYA 3KFWX 3K3OA 3FHNA 1WRDA 2JQQA 2Q9QC 3QC9A 5IWAT 1MNDA 3E08A 4KX6A 5FL1A 2LEHA 3C50A 4A98A 3UULA 4QXHB 5JQGE 4IL9A 4DV7T 2CBIA 4X1IE 4DVDA 3H3AA 2FJBA 1HG5A 4PW8A 3O1JA 1T7SA 1O3XA 2F4VT 2UXDT 3OKQA 2A2FX 5ADXL 2XHEB 3HA4A 4ZHQE 3RIAA 5E0OA 2WMOA 3B57A 2VVNA 3CIRA 4HFBA 4HFIA 1OXZA 2CXLA 3ZT7A 5KX5E 4YTMA 5LHHB 2UU9T 3ZT6A 5ABFB 4EAHA 4PFPA 4YTPA 4XBFB 3OJAA 5HEJA 1UGOA 3K8PC 3AAEB 2LLYA 5L47A 3UT5E 5HXCA 3P50A 1OEDA 3ZKRA 2LSKA 2VQET 3ETUA 4DR6T 3P4WA 2BVLA 1HF8A 3CMLA 2MTQA 2ACZA 4AISA 3FBLA 1IBLT 2IMLA 3T1YT 4IE5A 3P4RA 2K5BB 5EK3A 1KNPA 2JIWA 4DBQA 3PJAJ 1YKEB 3MJXA 4DV5T 3CX7B 5L3EB 4KUMB 2PG8A 3PU8A 4X66T 3N9PA 2YKSA 3ZPOA 4DIDB 3AAAB 2OLTA 2VWAA 4X1YE 3PUWF 2E5VA 4TWDA 1N36T 2VL0A 4I55E 4UXNB 1FJGT 3FB2A 3NBXX 3M65A 2K3WA 1OEDE 2H88A 2FBWA 4H9QC 2RA1A 1QLBA 2B1EA 5HEUA 1KFYA 4QKNA 3OBVE 4IDPA 3R84B 2ODVA 4ILAA 3NWIA 2W0GA 2JMHA 2LRKA 3ZLIA 4JI8T 2JJ9A 4HWDA 2V6YA 2XQ6A 2VURA 4AQFC 3HR0A 2HN2A 2XM2A 3TLWA 4B3ST 3AEGA 4JI3T 5JREA 2DNXA 5FL0A 4LF4T 2QA7A 4E7ZA 2BKNA 2D0UA 3PUVF 5LGNB 1UX4A 3OYXA 4JYAT 3KINB 5JRCA 3LBXB 5DQVA 2MOZA 1XZYA 4MLKA 2IW5B 4EEBA 1BR2A 3ZCJA 3PUQA 4ADZA 5DJQC 3RQUA 5HWXA 1J5WA 1N32T 1YQ4A 3ZN1B 2Z6EA 3C4WA 2WY2A 5JDGA 2LKHA 3HKBE 5HEHA 1BR1A 3LG7A 4EYYR 5CA0E 3N9OA 1HTJF 3AE6A 5C2TA 4YHJA 2N2NA 2XQAA 2MPKA 3Q5WA
chains in the Genus database with same CATH topology
1BR0A 4X20E 5A1LA 2KXPB 4ANJA 3C98B 4QXCB 2VKJA 4HGAA 4OK0A 1SA0E 3ZYMA 3RPUA 3LBXA 2LT3A 5IHYA 1Y64B 4AQFA 1QSDA 4OHFA 5FXXA 2KZ7B 3CKDA 1YKHB 4C91A 2CXFA 3ANWA 3AVRA 5JR9B 3AVSA 4MBQA 2W63A 4ZI3D 1VRBA 4M1PA 4U72A 4YFSA 1Z0PA 3UUNA 4TZ4C 3RC8A 3P7IA 4AKRB 3I9WA 2X66A 2WBLA 3NZQA 1HFAA 4PJNA 3CQCB 2ZLYA 2XAJB 2N9DA 1FMVA 4FJOA 1HG2A 3N2OA 5BMVE 1QUUA 3LK3B 4PJMA 1HX8A 4WW0A 3A5XA 1ZHCA 4O4HE 3T8OA 2V7IA 3NRYA 4G2AA 2NOXA 4QWNB 3PTRB 3AB3B 2CWOA 4QHOA 4O8SA 3RRCA 5HYAA 4UF0A 5LGUB 4H9SE 2LSIA 2IC9A 5LP6E 4CI3B 4A56A 2ZM2A 4CXXA 2XAHB 2UXNB 3KV5A 3ONXA 3ZMSB 3CQXC 2CLYC 3WAKA 4L5GA 2P9BA 3SOLA 3FXDB 2KMFA 2NW7A 3PUGA 5L3FB 1G73A 1NAFA 2MBGA 5JRCB 4P09A 4I50E 4HEAA 3Q5XA 2DLRA 4CXWA 4HN9A 5LGTB 4ILUA 2X9WA 3DP7A 2KINB 4U74A 5FMNA 2XAQB 3MACA 3J9X1 5JH7E 1ZEEA 4IE6A 2IC6A 4QX7B 3TKLB 4UVAB 3ZJ2A 3ESLA 3N5LA 3I1AA 2ZM8A 1IJ6A 2X67A 4UIGA 4DMWA 2ZM0A 3N9QA 5HXHA 4PK4A 2V7KA 4UEMA 3O1IA 5FP3A 2M67A 3KV4A 5L2LA 2PBIA 2IAKA 4IE4A 1YD8G 4QXBB 3FBZA 4JUYA 3ZJ1A 3MXZA 5AFUL 3K3QC 2ACXA 2DHRA 2YK0A 2QGSA 3ZEFB 2WWUA 4L9IA 4GK0E 1UCUA 4PAGA 2E9XC 3ZCIA 1S94A 4UV8B 1D0YA 4ZOLE 2CEAA 2Y6XA 2XUEA 3AA0B 2VKHA 5C8YE 3WAJA 1FEWA 4GYSA 4IDZA 2CCQA 5FNVE 4WBNE 1BR4A 4ZS2A 2NTXA 3VKHA 4WBOA 3MKDA 5FXVA 2MYSA 3S4UA 4ISTA 1B7TA 4EOZB 1U5PA 2W00A 3ZMZB 2X9YA 3RX6A 1D1BA 2NP9A 4O4JE 5LJNA 2JMKA 4OYKA 1FMWA 4GIWA 4YJ3E 2KT9A 2XAFB 5LA6E 3RYCE 4V1Av 3MA9A 2X0LB 2NWBA 2A72A 4ZI2D 2E8IA 4EZHA 1H7CA 3I0OA 1T98A 2KNDA 3R6NA 3AA7B 3F2EA 3BQIA 4UF0B 2V7LA 5LBMA 1WLXA 2V7JA 4J2CA 3VHLA 5JDLA 2DWKA 2UXXB 3JC6D 2ES0A 2A3DA 2E9XB 3KVBA 3LJCA 4O2BE 5DABA 3SWHA 5LG4A 1MIYA 3IBPA 2V26A 2BVMA 2CA5A 2V1DB 4I4TE 1AJ3A 2L8KA 4IHJE 3HKEE 2LSGA 1VOMA 1WYBA 2RP4A 4JEHB 2C5IT 2BDEA 4CZZB 4GK5E 5CA1E 2JRKA 4MHCA 1KNZA 2H7VC 4IGUA 2W61A 4G63A 4H63H 1D0XA 2LE8A 2WAUA 2DI4A 3CQGB 2XTLA 5FXWA 1WYCA 3IEEA 4H9RC 2LOPA 4CI2B 4AKHA 3SRZA 3O1HA 4OYJA 4ERRA 4O2AE 3N9MA 5DQWA 1MMNA 3MZKB 1WR6A 3W15B 2JPFA 4FI5A 5HAXA 3RYFE 3N2KE 3KFWX 2NW8A 2VL8A 3IHRA 4JEUB 3K3OA 3FHNA 5FY1A 1WRDA 3BQLA 4HE8A 2CWYA 2JQQA 2Q9QC 3FXEB 4N78D 3QC9A 4KMCA 1US7B 5M4YA 3ZMVB 1HS7A 1D0ZA 4IE0A 1MNDA 2E9XA 3E08A 4EXTA 1MIVA 2OA5A 3RRWA 2LEHA 2CMRA 5FYMA 5GONE 3N9LA 2N1GA 5JDHA 4UVCB 2H7OA 2LM9A 3C50A 2CE7A 3ETVA 1NWMX 4GOUA 3UULA 4L0RA 4QXHB 5JQGE 1D1CA 5H6RB 5LNKA 3C4ZA 2D0TA 3C64A 3L3PA 5JDNA 3V5SA 4X1IE 4DVDA 4H63V 3KBTA 3H3AA 3EUHA 4OFZA 5LHGB 1HG5A 3N2GE 4PW8A 2KLQA 3O1JA 1O3XA 2VKDA 3OKQA 5LXTE 3VKGA 2XAGB 2A2FX 4DNDA 2XHEB 3HA4A 5ADXL 3PE0A 2EHOC 3Q5WA 4YLHA 1LKXA 4ZHQE 2PFVA 3DJBA 5E0OA 1ZKEA 3Q2MA 2BZBA 2Y8DA 2WMOA 3B13A 3J7Yq 3F31A 2VASA 2Q9QB 4CI1B 3U3IA 3C4XA 3B57A 4HTEA 3AA1B 4BJNA 3U78A 4P0BA 3P8CD 3CWZB 3IF8B 5LOVE 2CLYB 1OXZA 5F3JA 5J1GA 3LK42 4BJMA 4XAXB 2CXLA 3F57A 5KX5E 1U4QA 3ZYLA 1IJ5A 5LHHB 2K24A 4IE7A 4EAHA 2C0SA 2C5KT 2YU2A 3VU7H 2H3RA 2VKOA 4PFPA 2L3LA 4XBFB 3OJAA 3K8PC 4CXYA 3AAEB 4PFOA 4MALA 4ZI7E 1FIOA 4ISSA 5LHIB 5HWYA 2L9QA 4MFRA 1IAPA 5FY0A 3UT5E 1V9DA 5HXCA 2SPCA 5FXZA 4BA9A 3UTKA 2LSKA 3ETUA 4AKLA 2LJLA 3ZYKA 2CM0A 2Q9QA 3E0ZA 5L3CB 3GN5A 5L3DB 2BVLA 2WMNA 4PK6A 3EVYA 3LFMA 5JR9C 4Z8XA 1HF8A 2J1DG 3CMLA 2MTQA 4P0AA 4XZCA 3PDYA 1LRZA 2E9XD 2X51A 4ZI3C 3FBLA 4DO0A 1IZNB 2WSSV 3PUAA 2YU1A 4HKAA 4F6RC 2V7MA 3E22E 3HI2A 3K3NA 4WNKA 5HXSA 3KV6A 4TV8E 4IE5A 2K5BB 4H9OC 4EB6E 2HH7A 3AA6B 3CVRA 5EK3A 3BK9A 4DBQA 3D0TA 4EZ4A 3PUSA 1YKEB 2X9XA 3MJXA 5J2UE 5JVDE 5EZYE 2LHNA 3CX7B 5FY7A 3RC3A 5L3EB 2NTYA 2EHOA 1E1HB 2C5JA 3NRXA 5EK2A 3H37A 5JDQA 2I59A 4KUMB 3HL6A 1MIWA 2PG8A 3PU8A 3N9PA 3ZPOA 5JDFA 3MK7C 3I0QA 3AAAB 2PJQA 1EZ3A 2VWAA 4X1YE 1MNEA 3HKDE 2XQYA 4I55E 4UXNB 1X79A 2YINA 3GA8A 4AXPA 2WM9A 2NW9A 5H6QB 4BAYB 3FB2A 2G0UA 3DTOA 4PJLA 3NBXX 1MMDA 3M65A 5F8PA 4I43B 1S35A 5EK4A 5LJMA 4H9QC 2RA1A 4UV9B 2B1EA 3L09A 4ASKA 3RKOA 4QKNA 4H9NC 2W62A 3OBVE 4IIJE 2KWIB 2K9AA 3R84B 4CQIA 2ODVA 4PK5A 3AAIA 3UUXB 4NUVA 4E7SA 3ZC0A 1ZV4X 2W0GA 2LSJA 4PNIA 4B6XA 4GYRA 5L3BB 5J2TE 2JMHA 1G8XA 5ETWA 5KMGP 3ZLIA 4PJJA 2JJ9A 4X1KE 2XASB 5JR9A 4YJ2E 3CX6B 3I9YA 2Q9QD 3KV9A 3UUMA 1YW0A 4KBMB 1UX5A 3GN5B 3ZMTB 2DWGA 4AQFC 5TAOA 3RYIE 2K48A 3HR0A 3EDUA 5LBQB 4DBRA 4EYUA 1OWAA 2ODUA 4TX5A 1KK7A 2GK9A 3GWHA 4TUYE 3V5UA 3N9NA 5LCYA 5JREA 3HKCE 2DNXA 4K0UA 4UELA 1LVKA 3QUJA 3CX8B 2QA7A 4E7ZA 2LSYA 4HFVA 5LYJE 4JLEA 2CXDA 4KP3C 3EDVA 4DMVA 4NUUA 3KDSE 2D0UA 5KDMC 2DCFA 3PU3A 1D1AA 4TN7B 2EHOD 1UX4A 5LGNB 3OYXA 5JDMA 4ZI2C 2LOSA 3KBUA 3SS1A 2EHOB 4O4IE 2HPJA 3ZMUB 4AKGA 3GMIA 3KINB 5JRCA 3LBXB 5DQVA 2MOZA 2X68A 4MLKA 4O4LE 1HCIA 2IW5B 1MMAA 2ZMAA 2YEVC 4C90A 3O9XA 3JC6C 1BR2A 3ANWB 3ZCJA 3BQKA 3PUQA 4ADZA 5DJQC 5HWXA 2KWHA 3LK2B 1SHZC 4EIWA 2VK9A 4AI6A 4QX8B 3KVAA 3Q9DA 1CUNA 3ZN1B 2Y48B 3C51A 2Z6EA 1MMGA 3C4WA 4AKIA 3O4XE 5L3GB 5CB4E 3ZC1A 4AQGA 5IYZE 3HKBE 5JDGA 4UVBB 3CPZA 3NZPA 5HXRA 2D2SA 3WI3A 3QK6A 1BR1A 3LG7A 4H9PC 2VB6A 3ZN0B 2LHRA 2X9HA 3RYHE 4EYYR 3RH3A 3UFEA 5CA0E 4ZS3A 3N9OA 2HPLA 1HTJF 2D5UA 5HXEA 4TV9E 4YHJA 2N2NA 3OYZA 3PURA 1LVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKE A;  2KWH A;  3FXD B;  2C5K T;  1LRZ A;  4J2C A;  2MBG A;  3S4U A;  4L0R A;  2KWI B;  4FI5 A;  2X9Y A;  1QSD A;  3L3P A;  2CA5 A;  2K48 A;  3CKD A;  4CQI A;  2X9W A;  3QK6 A;  3MXZ A;  2IC9 A;  3CVR A;  2C5I T;  4B6X A;  1Z0P A;  2IC6 A;  3TKL B;  3FXE B;  4EYY R;  3P7I A;  2G0U A;  1IJ5 A;  2X9X A;  3N5L A;  4DND A;  1H7C A;  1IJ6 A;  3QUJ A;  2XTL A;  2C5J A;  1LVF A; 
#chains in the Genus database with same CATH topology
 2KXP B;  3C98 B;  4QXC B;  5AQK B;  1UUR A;  4HGA A;  2UUB T;  2LT3 A;  1QSD A;  2IUB A;  3ANW A;  4P1N A;  4IDN A;  1VRB A;  3UQ4 A;  4AKR B;  3NZQ A;  1HFA A;  2UXB T;  2N9D A;  1HG2 A;  4ZXL A;  3N2O A;  1NEN A;  3AEA A;  3T8O A;  3NRY A;  2NOX A;  2XPK A;  4QHO A;  4LML A;  1OED C;  5HYA A;  4UF0 A;  3NKZ A;  2LSI A;  2IC9 A;  5LP6 E;  2W67 A;  2QRX A;  4CXX A;  3ZMS B;  1YXR A;  3ONX A;  4TWH A;  3CQX C;  4L5G A;  2P9B A;  3FXD B;  3PUG A;  3RHW A;  2WDV A;  3Q5X A;  1DU2 A;  2XQ5 A;  4HN9 A;  4ILU A;  2X9W A;  1XMO T;  2XAQ B;  3MAC A;  4K0K T;  1ZEE A;  2IC6 A;  3ZJ2 A;  4UIG A;  4DMW A;  5HXH A;  2V7K A;  5L2L A;  2PBI A;  2IAK A;  4QXB B;  3FBZ A;  4L9I A;  4GK0 E;  1XWM A;  2E9X C;  1S94 A;  1T72 A;  2UUC T;  1FEW A;  1XDP A;  4WBN E;  4ZS2 A;  2MYS A;  4IST A;  4EOZ B;  1M7K A;  3CK6 A;  2W00 A;  3ZMZ B;  2NP9 A;  3T1H T;  4EED A;  4DV1 T;  5L4H A;  4ILB A;  2BBJ A;  4EV6 A;  1WLX A;  2RPA A;  3AXJ A;  4NPP A;  2W4X A;  2ES0 A;  2I6H A;  3SWH A;  5DAB A;  5LG4 A;  2V26 A;  5AQP B;  5J0Z A;  4I4T E;  2XZE A;  2L8K A;  1W0B A;  1VOM A;  1WYB A;  2RP4 A;  2V6X A;  2BDE A;  4GK5 E;  5CA1 E;  2JRK A;  2W61 A;  4G63 A;  1D0X A;  2LE8 A;  4X5T A;  2DI4 A;  3VR9 A;  2LOP A;  4CI2 B;  4B3T T;  4AKH A;  1WR6 A;  3W15 B;  3RYF E;  3N2K E;  4KI0 F;  1KF6 A;  3AE4 A;  3BQL A;  3RIU A;  2CWY A;  3FXE B;  4KMC A;  1US7 B;  3PUX F;  2OV9 A;  2N1G A;  5JDH A;  4UVC B;  2CE7 A;  1NWM X;  5LG3 A;  3K1S A;  2W2U A;  2D0T A;  3KBT A;  3RLF F;  2B76 A;  4OFZ A;  4TNW A;  2VKD A;  5IUX A;  1HR0 T;  3PE0 A;  2EHO C;  2PFV A;  1ZKE A;  1OED B;  2Y8D A;  5AQG B;  4CI1 B;  3U3I A;  3C4X A;  4LMK A;  1KNR A;  2JQ9 A;  4DV6 T;  3AA1 B;  4P0B A;  5ABG A;  3CWZ B;  3EHZ A;  4AQY T;  5F3J A;  5J1G A;  4XAX B;  3ZYL A;  4JI1 T;  3EAB A;  4ZZB A;  2WDR A;  2WDQ A;  2YU2 A;  2H3R A;  3AEE A;  4Q25 A;  3M3Z B;  4ISS A;  5LHI B;  2L9Q A;  2JQK A;  4MFR A;  5FY0 A;  5LMU T;  5FXZ A;  4GKJ T;  3UTK A;  4AKL A;  2LJL A;  3ZYK A;  2CM0 A;  3GN5 A;  4PK6 A;  3LFM A;  5JR9 C;  2J62 A;  5AQQ B;  1LRZ A;  4DR1 T;  3VRA A;  2WSS V;  4X62 T;  2V7M A;  3K3N A;  3KV6 A;  4EB6 E;  5KXJ A;  2HH7 A;  3BK9 A;  5EZY E;  5HCM A;  5FY7 A;  3RC3 A;  3NVO A;  2C5J A;  3NRX A;  5JDQ A;  3HL6 A;  5JDF A;  3I0Q A;  5FVL A;  1EZ3 A;  2IIU A;  1X79 A;  4ZZC A;  4AXP A;  4BAY B;  4PJL A;  5F8P A;  1MMD A;  3EAM A;  1S35 A;  5EK4 A;  4GKK T;  4CN4 A;  1SE7 A;  4UV9 B;  4ASK A;  4YSX A;  4H9N C;  2W62 A;  2WP9 A;  2KWI B;  3TLS A;  4CQI A;  3RKG A;  4PK5 A;  3AAI A;  3UUX B;  4QH5 A;  3JAF A;  1ZV4 X;  5J2T E;  4GYR A;  5L3B B;  1G8X A;  4PJJ A;  1X9B A;  5AQN B;  4YJ2 E;  1VCT A;  3QOF A;  4IL4 A;  4KHZ F;  3UUM A;  1YW0 A;  4KBM B;  1UX5 A;  4ILC A;  3RYI E;  3AE3 A;  3AE7 A;  2J47 A;  3EDU A;  4EYU A;  1OWA A;  2ODU A;  4TX5 A;  4TUY E;  3V5U A;  3TLU A;  3N9N A;  2BKO A;  1WR0 A;  5LCY A;  1LVK A;  3CX8 B;  4JLE A;  2CXD A;  4YTN A;  1W09 A;  4DR2 T;  3KDS E;  5KDM C;  1UK5 A;  1D1A A;  2JQH A;  4ZI2 C;  3KBU A;  2EHO B;  3LSV A;  4HFC A;  1T8B A;  2LM2 A;  2HPJ A;  2W66 A;  3ZMU B;  1WFD A;  4LF5 T;  4O4L E;  1HCI A;  5AQT B;  2ZMA A;  3O9X A;  3ANW B;  2H89 A;  3BQK A;  4TNV A;  5AQO B;  4QX8 B;  3KVA A;  2AE9 A;  1CUN A;  4U7I A;  4AKI A;  4DUZ T;  5L3G B;  3ZC1 A;  5IYZ E;  3CPZ A;  3NZP A;  3WI3 A;  3ZN0 B;  2LHR A;  4QH1 A;  3RYH E;  4ZS3 A;  2HPL A;  4TV9 E;  3OYZ A;  2AXD S;  3AE2 A;  4LFC T;  3ZYM A;  5IHY A;  5FXX A;  5CFB A;  2CXF A;  3AVR A;  5JR9 B;  3AVS A;  4MBQ A;  4Z91 A;  4UR9 A;  4ZI3 D;  4U72 A;  1XMQ T;  1IBK T;  2WBL A;  3UQ7 A;  4PJN A;  4FJO A;  2BG9 A;  2XQ9 A;  4PJM A;  1WCR A;  3A5X A;  4LF7 T;  4O4H E;  2IDO B;  4O8S A;  4CI3 B;  4OX9 T;  2V8S V;  3ZST A;  5BR8 T;  1G73 A;  1NAF A;  4P09 A;  4I50 E;  5AQL B;  2DLR A;  3J9X 1;  4QX7 B;  3TKL B;  3I1A A;  2ZM8 A;  2LRL A;  2X67 A;  2YN6 A;  2ZM0 A;  3OTO T;  3N9Q A;  4JI7 T;  4UEM A;  1HNX T;  5FP3 A;  4IE4 A;  3AXJ B;  3MXZ A;  5AFU L;  3K3Q C;  2ACX A;  3ZEF B;  2WWU A;  2FJD A;  3AEB A;  1D0Y A;  2CEA A;  5C8Y E;  3AA0 B;  2VKH A;  3WAJ A;  5HEO A;  2CCQ A;  1BR4 A;  3VKH A;  5FXV A;  1B7T A;  3RX6 A;  3G06 A;  4O4J E;  4OYK A;  3TLT A;  4YJ3 E;  5AQS B;  3MA9 A;  2NWB A;  2UUA T;  2E8I A;  2XQ8 A;  1H7C A;  3JCF A;  1Y01 A;  5JDL A;  2DWK A;  3JC6 D;  4O2B E;  3IBP A;  4JI4 T;  2CA5 A;  2V1D B;  2MAW A;  4IHJ E;  3L8R A;  4IRE A;  3AEF A;  4JEH B;  2C5I T;  4MHC A;  2H7V C;  4DR4 T;  2WAU A;  3IEE A;  4H9R C;  2BBH A;  1HNZ T;  1I6Z A;  3N9M A;  1JNZ A;  4FI5 A;  3UU8 A;  4JEU B;  4HWF A;  5FY1 A;  4HE8 A;  4N78 D;  4YXD A;  1XNR T;  1HS7 A;  1MIV A;  2OA5 A;  3RRW A;  5FYM A;  3N9L A;  2YOE A;  2H7O A;  3ETV A;  3ABV A;  1CHU A;  2BS2 A;  3PJA A;  3FZF B;  5H6R B;  5LNK A;  3C4Z A;  3C64 A;  5JDN A;  2KLQ A;  5LXT E;  3VKG A;  4LF6 T;  1LVF A;  1LKX A;  2R6G F;  3VR8 A;  4COF A;  3Q2M A;  4DV3 T;  3B13 A;  4YSY A;  2CHO A;  3U78 A;  5LOV E;  4LMJ A;  4BJM A;  2M6I A;  3SFE A;  1IJ5 A;  4IE7 A;  4DR3 T;  4AIU A;  5LMN T;  1SUM B;  4DR5 T;  5CGM A;  4IDQ A;  2XJ7 A;  4HFD A;  3LDQ B;  1FIO A;  2YDS A;  5HWY A;  1V9D A;  4KHP T;  2QVA A;  2Q9Q A;  5L3D B;  3ONL C;  2BS4 A;  3UU3 A;  4Z8X A;  2J1D G;  4P0A A;  2XSB A;  2BKP A;  2X51 A;  4DO0 A;  5ABE A;  3E22 E;  5HXS A;  4H9O C;  3AE5 A;  3CVR A;  3RIF A;  3UU5 A;  3D0T A;  3PUS A;  2X9X A;  5J2U E;  2CHN A;  1E1H B;  3H37 A;  4I0U A;  1MIW A;  1HNW T;  3MK7 C;  4YY3 T;  2FJE A;  1MNE A;  3HKD E;  2XQY A;  2YIN A;  3GA8 A;  4LF8 T;  2NW9 A;  3DTO A;  4I43 B;  2HHH T;  5LJM A;  2WCA A;  3L09 A;  3RKO A;  4IIJ E;  3AE1 A;  2K9A A;  4NUV A;  3ZC0 A;  4JI5 T;  4JV5 T;  5ETW A;  3EI0 A;  2M6B A;  4X1K E;  5ABH A;  2XAS B;  3CX6 B;  3KV9 A;  2Q9Q D;  1W9R A;  2DWG A;  2ZM6 T;  2K48 A;  1R8I A;  5LBQ B;  3GWH A;  2GK9 A;  4UEL A;  3QUJ A;  2LSY A;  5LYJ E;  4KP3 C;  4DMV A;  2DCF A;  3PU3 A;  2LOS A;  4O4I E;  4AKG A;  5FKY A;  1N33 T;  2X68 A;  3A8Y C;  2I0M A;  1MMA A;  2YEV C;  4C90 A;  3L39 A;  5FVK A;  2KWH A;  3LK2 B;  4EIW A;  2VK9 A;  3Q9D A;  2Y48 B;  3C51 A;  1Z8U A;  1IBM T;  1MMG A;  3O4X E;  5CB4 E;  4CN1 A;  5HXR A;  2A9U A;  4H9P C;  3UFE A;  5HXE A;  3PUR A;  3ZSS A;  4X20 E;  4IT4 A;  2UXC T;  3Q5D A;  4U7Y A;  1Y64 B;  4AQF A;  4C91 A;  2KZ7 B;  3CKD A;  3SFD A;  4YSZ A;  4M1P A;  4YFS A;  3UUN A;  2V6Y B;  4TZ4 C;  3RC8 A;  3X1D A;  2YDR A;  2WB5 A;  2X66 A;  3TLV A;  2ZLY A;  5BMV E;  3LK3 B;  1HX8 A;  4WW0 A;  3IA3 A;  3UU4 A;  3PTR B;  4A97 A;  4QH4 A;  5LGU B;  5HEG A;  4H9S E;  1E2A A;  4YHH T;  2E5L T;  2ZM2 A;  5JTG A;  3KV5 A;  2CLY C;  2KMF A;  5L3F B;  4X64 T;  5JRC B;  1UUS A;  4HEA A;  4U3C A;  4LFA T;  4HWI B;  5LGT B;  3DP7 A;  5FMN A;  5JH7 E;  1E7P A;  3FZK B;  4UVA B;  3ONJ A;  1L0V A;  2XQ3 A;  5AQI B;  2M67 A;  2LKG A;  4U31 A;  3ZJ1 A;  3RIU C;  1UCU A;  3ZCI A;  4UV8 B;  1NEK A;  2Y6X A;  3QB5 K;  1ZOY A;  4GYS A;  5FNV E;  2NTX A;  3MKD A;  3AE8 A;  2X9Y A;  1D1B A;  2JMK A;  2KT9 A;  2XAF B;  4V1A v;  2A72 A;  1J5E T;  4EZH A;  3FZH B;  1T98 A;  3AA7 B;  4UF0 B;  5LBM A;  2WZH A;  3VHL A;  4U33 A;  4LFB T;  3RGL A;  3KVB A;  2A3D A;  1N34 T;  2BVM A;  1KNZ A;  4IGU A;  4H63 H;  3CQG B;  2XTL A;  5FXW A;  1W0A A;  3O1H A;  3OVU A;  4ERR A;  4O2A E;  1MMN A;  2JPF A;  2NW8 A;  2VL8 A;  3IHR A;  3A7M A;  4HFH A;  5M4Y A;  3ZMV B;  1D0Z A;  4IE0 A;  2E9X A;  2XM1 A;  4EXT A;  4ZEY A;  5GON E;  2CMR A;  2LM9 A;  4GOU A;  4L0R A;  1D1C A;  3L3P A;  3P4S A;  3V5S A;  2CBJ A;  4H63 V;  3EUH A;  5LHG B;  3N2G E;  4LF9 T;  2XAG B;  2PTF A;  4DND A;  4YLH A;  3DJB A;  5LB7 B;  3ZT5 A;  2BZB A;  3J7Y q;  3F31 A;  2VAS A;  2Q9Q B;  4HTE A;  2BG9 E;  4BJN A;  3P8C D;  5CJ5 A;  3IF8 B;  2CLY B;  3AE9 A;  3LK4 2;  3F57 A;  4JI2 T;  1U4Q A;  2K24 A;  3RF1 A;  3JAE A;  2C0S A;  2C5K T;  3VU7 H;  2VKO A;  2L3L A;  2D9D A;  4CXY A;  4PFO A;  4MAL A;  4ZI7 E;  1IAP A;  2SPC A;  4BA9 A;  3H3M A;  5AQU B;  5L3C B;  3E0Z A;  2WMN A;  1GQE A;  3EVY A;  5F5W A;  4XZC A;  3PDY A;  2E9X D;  3P4Q A;  4ZI3 C;  1IZN B;  1ZP0 A;  1J1J A;  3PUA A;  2YU1 A;  4HKA A;  4F6R C;  4WNK A;  3HI2 A;  4TV8 E;  5ABF A;  3RQW A;  3AA6 B;  4EZ4 A;  4U2Y A;  5JVD E;  2LHN A;  2NTY A;  2EHO A;  2NR4 A;  5EK2 A;  1XDO A;  2I59 A;  3UFG A;  2PJQ A;  1VCS A;  3JAD A;  2FJA A;  2WM9 A;  5H6Q B;  2G0U A;  5L4E A;  3RI5 A;  3PUY F;  2DL1 A;  4E7S A;  5AQV B;  2XQ4 A;  4B6X A;  2LSJ A;  4PNI A;  2BS3 A;  5KMG P;  5JR9 A;  3I9Y A;  2WU5 A;  3GN5 B;  3ZMT B;  5TAO A;  4DBR A;  1KK7 A;  3Q5E A;  3FZL B;  3HKC E;  1XNQ T;  4K0U A;  4U2Z A;  2J4G A;  3QB5 A;  4Z90 A;  2BG9 C;  4HFV A;  4NIQ A;  3EDV A;  4NUU A;  4TN7 B;  2EHO D;  5JDM A;  3SS1 A;  2VQF T;  3GMI A;  5AQJ B;  3JC6 C;  1I94 T;  1SHZ C;  4AI6 A;  4HFE A;  4IDO A;  4JI6 T;  4AQG A;  4HWC A;  4UVB B;  2D2S A;  3QK6 A;  4NXM T;  2VB6 A;  2X9H A;  3RH3 A;  4DV4 T;  4DR7 T;  4F8H A;  2D5U A;  2CPT A;  1BR0 A;  5A1L A;  4ANJ A;  2VKJ A;  4OK0 A;  1SA0 E;  3RPU A;  2WWV A;  3LBX A;  2HN1 A;  4JBW F;  5AQR B;  4OHF A;  1YKH B;  2XY8 B;  2W63 A;  2YDQ A;  1Z0P A;  2WS3 A;  3P7I A;  3AEC A;  2WU2 A;  3I9W A;  5AQM B;  1M62 A;  3CQC B;  1YQ3 A;  2XAJ B;  1FMV A;  1QUU A;  1ZHC A;  5AQF B;  2V7I A;  4G2A A;  4QWN B;  3AB3 B;  2X0Y A;  2CWO A;  3RRC A;  3OPC A;  2VVS A;  4A56 A;  1JNR A;  2XAH B;  2UXN B;  3PV0 F;  4YT0 A;  3WAK A;  2V5D A;  4WZX A;  3SOL A;  2NW7 A;  2MBG A;  4DV0 T;  4CXW A;  4CN6 A;  1KEY A;  2KIN B;  4U74 A;  5C3J A;  4IE6 A;  3ESL A;  3N5L A;  1IJ6 A;  4B3R T;  3UU6 A;  3PUZ F;  4PK4 A;  4DV2 T;  3O1I A;  3KV4 A;  2IHR 1;  1YD8 G;  2KSR A;  4JUY A;  2V5C A;  2DHR A;  2YK0 A;  2QGS A;  4PAG A;  2QYW A;  4B3M T;  4A5X A;  4ZOL E;  3VRB A;  2XUE A;  4WYV A;  4IDZ A;  3QNU A;  4WBO A;  3S4U A;  4DUY T;  1U5P A;  4HWH A;  3AED A;  5LJN A;  2CRB A;  1FMW A;  2BG9 B;  4GIW A;  5LA6 E;  3RYC E;  2X0L B;  4ZI2 D;  5HCJ A;  4NXN T;  4EGW A;  3I0O A;  2X0H A;  3R6N A;  2KND A;  2XSA A;  3F2E A;  3BQI A;  2V7L A;  2V7J A;  3UUB A;  4J2C A;  5AQH B;  2E2A A;  2FUP A;  2UXX B;  3LJC A;  4JI0 T;  2E9X B;  1MIY A;  1AJ3 A;  3HKE E;  2LSG A;  4TWF A;  2WZI A;  4CZZ B;  3FZM B;  3P4P A;  4X65 T;  1WYC A;  1HX1 B;  2XQ7 A;  3SRZ A;  4OYJ A;  5DQW A;  3MZK B;  3B5M A;  5HAX A;  2WQY A;  3KFW X;  3K3O A;  3FHN A;  1WRD A;  2JQQ A;  2Q9Q C;  3QC9 A;  5IWA T;  1MND A;  3E08 A;  4KX6 A;  5FL1 A;  2LEH A;  3C50 A;  4A98 A;  3UUL A;  4QXH B;  5JQG E;  4IL9 A;  4DV7 T;  2CBI A;  4X1I E;  4DVD A;  3H3A A;  2FJB A;  1HG5 A;  4PW8 A;  3O1J A;  1T7S A;  1O3X A;  2F4V T;  2UXD T;  3OKQ A;  2A2F X;  5ADX L;  2XHE B;  3HA4 A;  4ZHQ E;  3RIA A;  5E0O A;  2WMO A;  3B57 A;  2VVN A;  3CIR A;  4HFB A;  4HFI A;  1OXZ A;  2CXL A;  3ZT7 A;  5KX5 E;  4YTM A;  5LHH B;  2UU9 T;  3ZT6 A;  5ABF B;  4EAH A;  4PFP A;  4YTP A;  4XBF B;  3OJA A;  5HEJ A;  1UGO A;  3K8P C;  3AAE B;  2LLY A;  5L47 A;  3UT5 E;  5HXC A;  3P50 A;  1OED A;  3ZKR A;  2LSK A;  2VQE T;  3ETU A;  4DR6 T;  3P4W A;  2BVL A;  1HF8 A;  3CML A;  2MTQ A;  2ACZ A;  4AIS A;  3FBL A;  1IBL T;  2IML A;  3T1Y T;  4IE5 A;  3P4R A;  2K5B B;  5EK3 A;  1KNP A;  2JIW A;  4DBQ A;  3PJA J;  1YKE B;  3MJX A;  4DV5 T;  3CX7 B;  5L3E B;  4KUM B;  2PG8 A;  3PU8 A;  4X66 T;  3N9P A;  2YKS A;  3ZPO A;  4DID B;  3AAA B;  2OLT A;  2VWA A;  4X1Y E;  3PUW F;  2E5V A;  4TWD A;  1N36 T;  2VL0 A;  4I55 E;  4UXN B;  1FJG T;  3FB2 A;  3NBX X;  3M65 A;  2K3W A;  1OED E;  2H88 A;  2FBW A;  4H9Q C;  2RA1 A;  1QLB A;  2B1E A;  5HEU A;  1KFY A;  4QKN A;  3OBV E;  4IDP A;  3R84 B;  2ODV A;  4ILA A;  3NWI A;  2W0G A;  2JMH A;  2LRK A;  3ZLI A;  4JI8 T;  2JJ9 A;  4HWD A;  2V6Y A;  2XQ6 A;  2VUR A;  4AQF C;  3HR0 A;  2HN2 A;  2XM2 A;  3TLW A;  4B3S T;  3AEG A;  4JI3 T;  5JRE A;  2DNX A;  5FL0 A;  4LF4 T;  2QA7 A;  4E7Z A;  2BKN A;  2D0U A;  3PUV F;  5LGN B;  1UX4 A;  3OYX A;  4JYA T;  3KIN B;  5JRC A;  3LBX B;  5DQV A;  2MOZ A;  1XZY A;  4MLK A;  2IW5 B;  4EEB A;  1BR2 A;  3ZCJ A;  3PUQ A;  4ADZ A;  5DJQ C;  3RQU A;  5HWX A;  1J5W A;  1N32 T;  1YQ4 A;  3ZN1 B;  2Z6E A;  3C4W A;  2WY2 A;  5JDG A;  2LKH A;  3HKB E;  5HEH A;  1BR1 A;  3LG7 A;  4EYY R;  5CA0 E;  3N9O A;  1HTJ F;  3AE6 A;  5C2T A;  4YHJ A;  2N2N A;  2XQA A;  2MPK A;  3Q5W A; 
#chains in the Genus database with same CATH homology
 1BR0 A;  4X20 E;  5A1L A;  2KXP B;  4ANJ A;  3C98 B;  4QXC B;  2VKJ A;  4HGA A;  4OK0 A;  1SA0 E;  3ZYM A;  3RPU A;  3LBX A;  2LT3 A;  5IHY A;  1Y64 B;  4AQF A;  1QSD A;  4OHF A;  5FXX A;  2KZ7 B;  3CKD A;  1YKH B;  4C91 A;  2CXF A;  3ANW A;  3AVR A;  5JR9 B;  3AVS A;  4MBQ A;  2W63 A;  4ZI3 D;  1VRB A;  4M1P A;  4U72 A;  4YFS A;  1Z0P A;  3UUN A;  4TZ4 C;  3RC8 A;  3P7I A;  4AKR B;  3I9W A;  2X66 A;  2WBL A;  3NZQ A;  1HFA A;  4PJN A;  3CQC B;  2ZLY A;  2XAJ B;  2N9D A;  1FMV A;  4FJO A;  1HG2 A;  3N2O A;  5BMV E;  1QUU A;  3LK3 B;  4PJM A;  1HX8 A;  4WW0 A;  3A5X A;  1ZHC A;  4O4H E;  3T8O A;  2V7I A;  3NRY A;  4G2A A;  2NOX A;  4QWN B;  3PTR B;  3AB3 B;  2CWO A;  4QHO A;  4O8S A;  3RRC A;  5HYA A;  4UF0 A;  5LGU B;  4H9S E;  2LSI A;  2IC9 A;  5LP6 E;  4CI3 B;  4A56 A;  2ZM2 A;  4CXX A;  2XAH B;  2UXN B;  3KV5 A;  3ONX A;  3ZMS B;  3CQX C;  2CLY C;  3WAK A;  4L5G A;  2P9B A;  3SOL A;  3FXD B;  2KMF A;  2NW7 A;  3PUG A;  5L3F B;  1G73 A;  1NAF A;  2MBG A;  5JRC B;  4P09 A;  4I50 E;  4HEA A;  3Q5X A;  2DLR A;  4CXW A;  4HN9 A;  5LGT B;  4ILU A;  2X9W A;  3DP7 A;  2KIN B;  4U74 A;  5FMN A;  2XAQ B;  3MAC A;  3J9X 1;  5JH7 E;  1ZEE A;  4IE6 A;  2IC6 A;  4QX7 B;  3TKL B;  4UVA B;  3ZJ2 A;  3ESL A;  3N5L A;  3I1A A;  2ZM8 A;  1IJ6 A;  2X67 A;  4UIG A;  4DMW A;  2ZM0 A;  3N9Q A;  5HXH A;  4PK4 A;  2V7K A;  4UEM A;  3O1I A;  5FP3 A;  2M67 A;  3KV4 A;  5L2L A;  2PBI A;  2IAK A;  4IE4 A;  1YD8 G;  4QXB B;  3FBZ A;  4JUY A;  3ZJ1 A;  3MXZ A;  5AFU L;  3K3Q C;  2ACX A;  2DHR A;  2YK0 A;  2QGS A;  3ZEF B;  2WWU A;  4L9I A;  4GK0 E;  1UCU A;  4PAG A;  2E9X C;  3ZCI A;  1S94 A;  4UV8 B;  1D0Y A;  4ZOL E;  2CEA A;  2Y6X A;  2XUE A;  3AA0 B;  2VKH A;  5C8Y E;  3WAJ A;  1FEW A;  4GYS A;  4IDZ A;  2CCQ A;  5FNV E;  4WBN E;  1BR4 A;  4ZS2 A;  2NTX A;  3VKH A;  4WBO A;  3MKD A;  5FXV A;  2MYS A;  3S4U A;  4IST A;  1B7T A;  4EOZ B;  1U5P A;  2W00 A;  3ZMZ B;  2X9Y A;  3RX6 A;  1D1B A;  2NP9 A;  4O4J E;  5LJN A;  2JMK A;  4OYK A;  1FMW A;  4GIW A;  4YJ3 E;  2KT9 A;  2XAF B;  5LA6 E;  3RYC E;  4V1A v;  3MA9 A;  2X0L B;  2NWB A;  2A72 A;  4ZI2 D;  2E8I A;  4EZH A;  1H7C A;  3I0O A;  1T98 A;  2KND A;  3R6N A;  3AA7 B;  3F2E A;  3BQI A;  4UF0 B;  2V7L A;  5LBM A;  1WLX A;  2V7J A;  4J2C A;  3VHL A;  5JDL A;  2DWK A;  2UXX B;  3JC6 D;  2ES0 A;  2A3D A;  2E9X B;  3KVB A;  3LJC A;  4O2B E;  5DAB A;  3SWH A;  5LG4 A;  1MIY A;  3IBP A;  2V26 A;  2BVM A;  2CA5 A;  2V1D B;  4I4T E;  1AJ3 A;  2L8K A;  4IHJ E;  3HKE E;  2LSG A;  1VOM A;  1WYB A;  2RP4 A;  4JEH B;  2C5I T;  2BDE A;  4CZZ B;  4GK5 E;  5CA1 E;  2JRK A;  4MHC A;  1KNZ A;  2H7V C;  4IGU A;  2W61 A;  4G63 A;  4H63 H;  1D0X A;  2LE8 A;  2WAU A;  2DI4 A;  3CQG B;  2XTL A;  5FXW A;  1WYC A;  3IEE A;  4H9R C;  2LOP A;  4CI2 B;  4AKH A;  3SRZ A;  3O1H A;  4OYJ A;  4ERR A;  4O2A E;  3N9M A;  5DQW A;  1MMN A;  3MZK B;  1WR6 A;  3W15 B;  2JPF A;  4FI5 A;  5HAX A;  3RYF E;  3N2K E;  3KFW X;  2NW8 A;  2VL8 A;  3IHR A;  4JEU B;  3K3O A;  3FHN A;  5FY1 A;  1WRD A;  3BQL A;  4HE8 A;  2CWY A;  2JQQ A;  2Q9Q C;  3FXE B;  4N78 D;  3QC9 A;  4KMC A;  1US7 B;  5M4Y A;  3ZMV B;  1HS7 A;  1D0Z A;  4IE0 A;  1MND A;  2E9X A;  3E08 A;  4EXT A;  1MIV A;  2OA5 A;  3RRW A;  2LEH A;  2CMR A;  5FYM A;  5GON E;  3N9L A;  2N1G A;  5JDH A;  4UVC B;  2H7O A;  2LM9 A;  3C50 A;  2CE7 A;  3ETV A;  1NWM X;  4GOU A;  3UUL A;  4L0R A;  4QXH B;  5JQG E;  1D1C A;  5H6R B;  5LNK A;  3C4Z A;  2D0T A;  3C64 A;  3L3P A;  5JDN A;  3V5S A;  4X1I E;  4DVD A;  4H63 V;  3KBT A;  3H3A A;  3EUH A;  4OFZ A;  5LHG B;  1HG5 A;  3N2G E;  4PW8 A;  2KLQ A;  3O1J A;  1O3X A;  2VKD A;  3OKQ A;  5LXT E;  3VKG A;  2XAG B;  2A2F X;  4DND A;  2XHE B;  3HA4 A;  5ADX L;  3PE0 A;  2EHO C;  3Q5W A;  4YLH A;  1LKX A;  4ZHQ E;  2PFV A;  3DJB A;  5E0O A;  1ZKE A;  3Q2M A;  2BZB A;  2Y8D A;  2WMO A;  3B13 A;  3J7Y q;  3F31 A;  2VAS A;  2Q9Q B;  4CI1 B;  3U3I A;  3C4X A;  3B57 A;  4HTE A;  3AA1 B;  4BJN A;  3U78 A;  4P0B A;  3P8C D;  3CWZ B;  3IF8 B;  5LOV E;  2CLY B;  1OXZ A;  5F3J A;  5J1G A;  3LK4 2;  4BJM A;  4XAX B;  2CXL A;  3F57 A;  5KX5 E;  1U4Q A;  3ZYL A;  1IJ5 A;  5LHH B;  2K24 A;  4IE7 A;  4EAH A;  2C0S A;  2C5K T;  2YU2 A;  3VU7 H;  2H3R A;  2VKO A;  4PFP A;  2L3L A;  4XBF B;  3OJA A;  3K8P C;  4CXY A;  3AAE B;  4PFO A;  4MAL A;  4ZI7 E;  1FIO A;  4ISS A;  5LHI B;  5HWY A;  2L9Q A;  4MFR A;  1IAP A;  5FY0 A;  3UT5 E;  1V9D A;  5HXC A;  2SPC A;  5FXZ A;  4BA9 A;  3UTK A;  2LSK A;  3ETU A;  4AKL A;  2LJL A;  3ZYK A;  2CM0 A;  2Q9Q A;  3E0Z A;  5L3C B;  3GN5 A;  5L3D B;  2BVL A;  2WMN A;  4PK6 A;  3EVY A;  3LFM A;  5JR9 C;  4Z8X A;  1HF8 A;  2J1D G;  3CML A;  2MTQ A;  4P0A A;  4XZC A;  3PDY A;  1LRZ A;  2E9X D;  2X51 A;  4ZI3 C;  3FBL A;  4DO0 A;  1IZN B;  2WSS V;  3PUA A;  2YU1 A;  4HKA A;  4F6R C;  2V7M A;  3E22 E;  3HI2 A;  3K3N A;  4WNK A;  5HXS A;  3KV6 A;  4TV8 E;  4IE5 A;  2K5B B;  4H9O C;  4EB6 E;  2HH7 A;  3AA6 B;  3CVR A;  5EK3 A;  3BK9 A;  4DBQ A;  3D0T A;  4EZ4 A;  3PUS A;  1YKE B;  2X9X A;  3MJX A;  5J2U E;  5JVD E;  5EZY E;  2LHN A;  3CX7 B;  5FY7 A;  3RC3 A;  5L3E B;  2NTY A;  2EHO A;  1E1H B;  2C5J A;  3NRX A;  5EK2 A;  3H37 A;  5JDQ A;  2I59 A;  4KUM B;  3HL6 A;  1MIW A;  2PG8 A;  3PU8 A;  3N9P A;  3ZPO A;  5JDF A;  3MK7 C;  3I0Q A;  3AAA B;  2PJQ A;  1EZ3 A;  2VWA A;  4X1Y E;  1MNE A;  3HKD E;  2XQY A;  4I55 E;  4UXN B;  1X79 A;  2YIN A;  3GA8 A;  4AXP A;  2WM9 A;  2NW9 A;  5H6Q B;  4BAY B;  3FB2 A;  2G0U A;  3DTO A;  4PJL A;  3NBX X;  1MMD A;  3M65 A;  5F8P A;  4I43 B;  1S35 A;  5EK4 A;  5LJM A;  4H9Q C;  2RA1 A;  4UV9 B;  2B1E A;  3L09 A;  4ASK A;  3RKO A;  4QKN A;  4H9N C;  2W62 A;  3OBV E;  4IIJ E;  2KWI B;  2K9A A;  3R84 B;  4CQI A;  2ODV A;  4PK5 A;  3AAI A;  3UUX B;  4NUV A;  4E7S A;  3ZC0 A;  1ZV4 X;  2W0G A;  2LSJ A;  4PNI A;  4B6X A;  4GYR A;  5L3B B;  5J2T E;  2JMH A;  1G8X A;  5ETW A;  5KMG P;  3ZLI A;  4PJJ A;  2JJ9 A;  4X1K E;  2XAS B;  5JR9 A;  4YJ2 E;  3CX6 B;  3I9Y A;  2Q9Q D;  3KV9 A;  3UUM A;  1YW0 A;  4KBM B;  1UX5 A;  3GN5 B;  3ZMT B;  2DWG A;  4AQF C;  5TAO A;  3RYI E;  2K48 A;  3HR0 A;  3EDU A;  5LBQ B;  4DBR A;  4EYU A;  1OWA A;  2ODU A;  4TX5 A;  1KK7 A;  2GK9 A;  3GWH A;  4TUY E;  3V5U A;  3N9N A;  5LCY A;  5JRE A;  3HKC E;  2DNX A;  4K0U A;  4UEL A;  1LVK A;  3QUJ A;  3CX8 B;  2QA7 A;  4E7Z A;  2LSY A;  4HFV A;  5LYJ E;  4JLE A;  2CXD A;  4KP3 C;  3EDV A;  4DMV A;  4NUU A;  3KDS E;  2D0U A;  5KDM C;  2DCF A;  3PU3 A;  1D1A A;  4TN7 B;  2EHO D;  1UX4 A;  5LGN B;  3OYX A;  5JDM A;  4ZI2 C;  2LOS A;  3KBU A;  3SS1 A;  2EHO B;  4O4I E;  2HPJ A;  3ZMU B;  4AKG A;  3GMI A;  3KIN B;  5JRC A;  3LBX B;  5DQV A;  2MOZ A;  2X68 A;  4MLK A;  4O4L E;  1HCI A;  2IW5 B;  1MMA A;  2ZMA A;  2YEV C;  4C90 A;  3O9X A;  3JC6 C;  1BR2 A;  3ANW B;  3ZCJ A;  3BQK A;  3PUQ A;  4ADZ A;  5DJQ C;  5HWX A;  2KWH A;  3LK2 B;  1SHZ C;  4EIW A;  2VK9 A;  4AI6 A;  4QX8 B;  3KVA A;  3Q9D A;  1CUN A;  3ZN1 B;  2Y48 B;  3C51 A;  2Z6E A;  1MMG A;  3C4W A;  4AKI A;  3O4X E;  5L3G B;  5CB4 E;  3ZC1 A;  4AQG A;  5IYZ E;  3HKB E;  5JDG A;  4UVB B;  3CPZ A;  3NZP A;  5HXR A;  2D2S A;  3WI3 A;  3QK6 A;  1BR1 A;  3LG7 A;  4H9P C;  2VB6 A;  3ZN0 B;  2LHR A;  2X9H A;  3RYH E;  4EYY R;  3RH3 A;  3UFE A;  5CA0 E;  4ZS3 A;  3N9O A;  2HPL A;  1HTJ F;  2D5U A;  5HXE A;  4TV9 E;  4YHJ A;  2N2N A;  3OYZ A;  3PUR A;  1LVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...