2CA5A

Mxih needle protein of shigella flexneri (monomeric form, residues 1- 78)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
DDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Model of a Type III Secretion System Needle: Implications for Host-Cell Sensing
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Transport protein
molecule keywords MXIH
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ca5A00
1ZKEA 2C5JA 4DNDA 2C5IT 2XTLA 2CA5A 2IC9A 3QK6A 4B6XA 2X9YA 1LRZA 3FXEB 4L0RA 1IJ5A 3MXZA 4J2CA 3N5LA 3S4UA 2KWIB 1LVFA 2G0UA 2X9XA 3L3PA 4EYYR 1Z0PA 3QUJA 3P7IA 2MBGA 2X9WA 1IJ6A 1H7CA 2IC6A 2C5KT 3FXDB 2KWHA 2K48A 3CKDA 4CQIA 1QSDA 4FI5A 3CVRA 3TKLB
chains in the Genus database with same CATH superfamily
5A1LA 2WZHA 3ZC1A 4DNDA 4B3RT 4DR4T 2KMFA 3OKQA 3C4WA 3UU6A 4GKJT 5IWAT 2LHRA 4TN7B 4EEBA 4LFCT 2ACZA 4U2ZA 4AKGA 2LRLA 2B76A 2L3LA 3KDSE 5JQGE 1OEDB 1IJ5A 4OK0A 4WW0A 5HAXA 3EDUA 1XMOT 1E2AA 3LK42 2BG9C 1FMWA 2PG8A 2WAUA 3P4SA 3PTRB 3DP7A 4CN6A 2CWOA 2G0UA 5C3JA 4LFBT 2L8KA 3F57A 4CXXA 3AE4A 2WCAA 3BQLA 3P4PA 3JCFA 2V5CA 1MNEA 3I1AA 2WSSV 3HR0A 4HEAA 5LMNT 2BBJA 1YKHB 2WDRA 3I9WA 2UU9T 2MYSA 3AE7A 4JEHB 2ZLYA 2V6YB 4EZ4A 4YSXA 4ZHQE 4DR6T 1WCRA 3ZJ2A 4YHHT 2DNXA 4A97A 2LSYA 4U72A 4AKRB 2R6GF 1D0YA 2UXBT 3ANWB 4AQFA 5J2TE 1XMQT 1HG5A 4ZS3A 3U3IA 4AKIA 2D9DA 2UUBT 4UXNB 2XASB 4CN4A 2EHOB 3CX6B 3P4QA 2E5VA 3ONLC 1VRBA 2PTFA 5LP6E 1WR6A 4B6XA 5LHIB 4X62T 1HR0T 4EXTA 4LMKA 2VVSA 3RPUA 1MIVA 3QC9A 2V1DB 4ZI2D 5LJMA 3LG7A 4HFCA 4DV2T 3VU7H 1T72A 2VL8A 3PURA 5L3BB 3U78A 4LF6T 3ZN1B 2LOSA 3CX8B 3I0QA 4NUVA 5ETWA 2WB5A 4P0BA 2V7LA 4YTPA 4ILAA 5LGUB 2UXCT 2M6BA 5HXRA 2ZMAA 5IUXA 5L4EA 3NRXA 1UGOA 2KINB 5GONE 3C98B 3RGLA 3AA7B 2KZ7B 4U7YA 3KV4A 4IDQA 5H6QB 4Z90A 4QXCB 5L2LA 4LF5T 4KHPT 2XTLA 4IDNA 5FVKA 2VQET 2ZM6T 3IF8B 4Z91A 1WLXA 3L8RA 1HG2A 3AE6A 4AQYT 4TV9E 3R84B 4XBFB 2HH7A 3RYFE 2YEVC 2X9YA 3C50A 3VHLA 2H3RA 1KFYA 5L3EB 2I59A 5JRCB 1W0BA 3PUZF 3LSVA 5AQNB 3CQGB 3Q5DA 4UV8B 2XSBA 3S4UA 3UT5E 2ODUA 2W67A 5KX5E 2ZM8A 1OEDA 1UCUA 2CRBA 5EK2A 2PJQA 4X65T 4IL9A 2FJDA 4BJMA 2V26A 2BZBA 3PUYF 5AQQB 2LM2A 2QVAA 3ZSSA 4AI6A 1N34T 5F3JA 3M3ZB 2IHR1 5HCMA 3ZYMA 2E5LT 2C0SA 3FB2A 5KDMC 4H9OC 3AAAB 2LSIA 3MZKB 2Y6XA 2IW5B 1XNRT 4JI2T 4ILUA 4DMWA 1OXZA 2CE7A 5HEJA 5ABFA 3Q5XA 3ZT5A 4DBRA 3RLFF 5L3FB 2Z6EA 4CI1B 4DR3T 2WMNA 5LNKA 4EB6E 2CBJA 3PJAJ 4PJMA 5AQPB 1NEKA 5E0OA 2CHOA 3GWHA 3PUQA 4HWHA 4DIDB 2YK0A 1YKEB 3FXEB 4WNKA 2AE9A 2QRXA 3LDQB 2YINA 5LHHB 2KSRA 1ZOYA 4IIJE 3ZMZB 4AKHA 4KP3C 2XY8B 2I6HA 4HFHA 2CLYC 3VKGA 2XQ9A 2NTXA 2XPKA 3CQCB 4YJ3E 1IJ6A 1US7B 4COFA 2E9XC 1N36T 3MA9A 2UUAT 3EAMA 2XZEA 3I9YA 4EYUA 4KMCA 4YT0A 4IREA 3FBZA 2H7OA 2ES0A 1X9BA 1UUSA 3A5XA 3AE2A 2X68A 3B5MA 3EABA 3UUBA 1HX1B 3V5SA 3ZSTA 2VASA 4DV3T 3TKLB 2N9DA 2C5JA 2E2AA 5LHGB 1IZNB 3QB5K 5F5WA 4YSZA 2E9XA 2VKOA 2W4XA 4I4TE 4ISTA 4UVAB 3RYCE 3UFEA 2D0TA 3LK3B 3ZCJA 2NTYA 1E7PA 1V9DA 5HXHA 3AECA 5EK3A 2IIUA 2ACXA 5HEUA 1QLBA 2LKGA 1SHZC 3FBLA 4N78D 4NUUA 5FXZA 4C91A 4O2BE 4BA9A 4ZZBA 5JDNA 1YQ4A 3AEGA 4QX7B 3ZPOA 3GN5A 3RIAA 4EYYR 5JRCA 4DV4T 1FJGT 1YQ3A 5FVLA 1ZV4X 2XHEB 2D5UA 5AQIB 3ZYLA 2X9WA 3ZEFB 5KXJA 2VKDA 3T1YT 4XZCA 4KBMB 3OJAA 3J7Yq 2XQ5A 2IC6A 3N9PA 4UR9A 3KV6A 1YW0A 4LFAT 1WFDA 3TLUA 1W9RA 3MKDA 4JI5T 2K48A 4GKKT 2MOZA 2NOXA 2ZM2A 3HA4A 1QSDA 4U3CA 2XAHB 5CA1E 1NAFA 1ZKEA 2ZM0A 3ETVA 2IC9A 1IAPA 1KNRA 5HWXA 4F8HA 2CWYA 4O4JE 5AQVB 4OHFA 2X9HA 4UEMA 2MTQA 4U74A 1LRZA 1BR1A 3KFWX 4L0RA 2V5DA 1CHUA 4ANJA 4UF0A 3OBVE 4PNIA 3O9XA 1HNWT 2V7IA 4IE7A 3TLVA 2BG9E 3NBXX 4QH1A 2WZIA 2M6IA 5LG4A 2XM1A 2VB6A 2WWUA 2BS4A 2XAJB 2A3DA 2W2UA 4O4IE 2V6YA 3RQWA 2LRKA 3O4XE 3O1JA 4EGWA 5AQLB 3CKDA 4BAYB 2BG9A 2NWBA 5L3DB 2H89A 2VL0A 3ANWA 3ONXA 3QNUA 1GQEA 3QUJA 5CB4E 4B3TT 4DR7T 2F4VT 3K3NA 5HYAA 3C64A 2BVLA 4YSYA 4E7ZA 3FZMB 1YD8G 5FL1A 1CUNA 4DV6T 5IHYA 4BJNA 1KF6A 1WYCA 1EZ3A 2CLYB 2X67A 4H9NC 3PU8A 4MLKA 4QXHB 2J1DG 2OA5A 4YFSA 2V7MA 2E9XB 3CPZA 2NW7A 4J2CA 3UU5A 5FXXA 3P8CD 3LJCA 3HKBE 2JMKA 1LVFA 4MALA 1VCTA 4X20E 1T7SA 2VURA 1Z8UA 2BKNA 3PUXF 4UVBB 4JI1T 3FZFB 2JQKA 2FJBA 3PJAA 1Y01A 4PAGA 1R8IA 3E08A 4L9IA 5AQSB 3RX6A 4IT4A 3HKCE 1W09A 2K24A 4HFBA 4V1Av 2X0LB 5M4YA 4IDPA 4TWHA 1N32T 2YDQA 2KWHA 3KVAA 5JDQA 3VR8A 3D0TA 1BR0A 5LYJE 1OEDE 2Q9QC 4HN9A 4ZXLA 1ZEEA 4WBNE 3PUSA 4GOUA 3RRCA 3P4WA 4TNVA 5AQKB 2Y48B 5FY1A 2B1EA 3AEBA 2E8IA 2CXFA 2JRKA 3C4ZA 3O1HA 5IYZE 3UFGA 2LSKA 3LFMA 2HPLA 4JI7T 4EEDA 4CZZB 4FJOA 4K0KT 3AVRA 1WYBA 4P1NA 3UU4A 2DWGA 4O4LE 4UELA 2IMLA 3FZLB 3NWIA 5LCYA 2CEAA 1T98A 3JC6C 2BVMA 3N5LA 3UTKA 3EI0A 3T1HT 4PFOA 3IA3A 4LMJA 4A98A 1IBKT 4QKNA 4IE6A 5AFUL 3HL6A 3KV9A 3UULA 5ABHA 1AJ3A 1XWMA 2MBGA 3I0OA 3WI3A 5J0ZA 1KNPA 3UUXB 3N2GE 4WZXA 3ZCIA 5AQRB 3CIRA 3AE8A 4KUMB 2SPCA 4IDZA 4PW8A 1D0XA 1M62A 4LMLA 5ABGA 2KT9A 5J1GA 2WM9A 2XAFB 4PK6A 5BMVE 3EVYA 3RQUA 2CMRA 2W62A 2LHNA 3PV0F 4NPPA 3GA8A 1KEYA 4Q25A 4C90A 4EAHA 4KX6A 4DV5T 4PJNA 4YHJA 3X1DA 5JDHA 3VKHA 1HF8A 4HFIA 3TLWA 2UUCT 2M67A 2KNDA 2OV9A 3K3OA 3MACA 3NKZA 2CPTA 4UIGA 4GYSA 3RYIE 3UQ7A 4ZEYA 1UURA 3WAJA 4OFZA 3CX7B 2WP9A 4HFEA 5J2UE 5EK4A 1HNXT 3VR9A 3AEFA 4WYVA 5DQVA 4H9RC 1Z0PA 5JR9B 4CI3B 2BG9B 4HWIB 4IL4A 2XQYA 1MIYA 3ABVA 1MIWA 5JDGA 4DBQA 3LK2B 2W0GA 5FY0A 2RPAA 1SE7A 2VQFT 2JPFA 3AEEA 4CN1A 4OYKA 1S94A 3RF1A 3SWHA 5CFBA 4G2AA 2IDOB 3JAEA 4ISSA 1VOMA 3B13A 4QWNB 2IAKA 2WU2A 4F6RC 3SFEA 2LOPA 3MK7C 4IDOA 5HXSA 1T8BA 1KNZA 2XQ6A 2UXXB 4GYRA 4TWDA 3UUNA 4X1YE 1D1CA 3BQKA 2W66A 2WMOA 3IEEA 2CXLA 2JQQA 2NR4A 4PK5A 3VRAA 1B7TA 4QHOA 3ESLA 4ZZCA 2XAQB 2XQ7A 2XM2A 5L3GB 4L5GA 3C51A 4X5TA 2CXDA 2XQ8A 4AQFC 3Q5EA 3UUMA 5JDFA 2KWIB 2QA7A 5LOVE 1UK5A 3AAEB 2WDVA 1NENA 2LE8A 3AEDA 3H3AA 4ILBA 3AE5A 2CCQA 5AQOB 5LBQB 5LB7B 4ZI7E 5CGMA 4DR2T 3Q2MA 3ZC0A 4PJJA 4I55E 5DQWA 2WDQA 1HCIA 4DV7T 2DHRA 4JI8T 1SUMB 3RIUA 2BS3A 2MPKA 1XZYA 2EHOA 4HTEA 5JR9A 4CQIA 4X1IE 2JQHA 3UU8A 3K8PC 5KMGP 4HE8A 4U2YA 2K5BB 4X64T 4NXMT 1HS7A 2LJLA 3RIFA 2C5IT 4ADZA 4EZHA 2D0UA 3PDYA 1J5ET 2W61A 3A8YC 4CI2B 4DVDA 3AA6B 3AE1A 1LKXA 3BK9A 3RIUC 2VKHA 3RC8A 2LLYA 2X0HA 4OX9T 3SFDA 2FBWA 2I0MA 3ZLIA 3N2KE 3H37A 2RP4A 4U31A 3ZT7A 4PFPA 2A9UA 2VVNA 4YXDA 4DUZT 1XDPA 1FMVA 2VK9A 2BS2A 2X9XA 3RRWA 2XQ4A 3P7IA 1IBLT 4JV5T 2J62A 2XUEA 2IUBA 3Q9DA 1DU2A 3WAKA 1MMGA 1XDOA 4ILCA 3W15B 4P09A 4JLEA 3Q5WA 3K1SA 3AE3A 3MJXA 3N9LA 3ONJA 1O3XA 2QYWA 2AXDS 1FEWA 4KI0F 4AISA 5L3CB 4CXWA 1Y64B 2J47A 4EOZB 5LGTB 3JADA 5JTGA 1D1AA 1OEDC 3OVUA 5AQHB 1BR4A 1U5PA 2K3WA 3ZMVB 5AQUB 3ZMSB 2N2NA 2H88A 5CJ5A 4TWFA 5LJNA 4EIWA 5HXCA 5JVDE 4HGAA 3PUAA 3KV5A 3L39A 3M65A 3ZJ1A 4X66T 3NZQA 1QUUA 5ADXL 4HWDA 1G73A 4KHZF 5JR9C 4JI0T 2W63A 3OYZA 4O4HE 3L3PA 3AXJA 5JDLA 3OPCA 2WU5A 2HHHT 4ZOLE 2LEHA 3J9X1 4I0UA 3UQ4A 3QB5A 3KBTA 5FKYA 4UVCB 5FXWA 4HWCA 2C5KT 2JIWA 2NW8A 3E0ZA 3E22E 3B57A 2VWAA 2CBIA 3FXDB 3KVBA 4IHJE 4ZI3C 3N9QA 4CXYA 2FUPA 3AB3B 3HKEE 2UXNB 2DI4A 3G06A 3CVRA 4JUYA 1JNZA 2LKHA 2XJ7A 2JQ9A 2K9AA 4GIWA 2FJEA 3IBPA 5BR8T 2UXDT 1I94T 5AQGB 2L9QA 3N9MA 3O1IA 3ZYKA 4DV1T 4YTMA 3PUWF 4LF7T 3VRBA 4HKAA 4NIQA 4E7SA 5DJQC 3AEAA 3UU3A 5EZYE 1E1HB 4UV9B 3AE9A 1VCSA 2FJAA 1G8XA 2WY2A 3EHZA 2X66A 2Y8DA 3H3MA 3KBUA 4O8SA 3RH3A 3ZN0B 4JI4T 3CQXC 2OLTA 3IHRA 1MMDA 5JDMA 3AA1B 3A7MA 3ZKRA 2MAWA 2YDRA 1FIOA 2KLQA 2V7JA 4TX5A 2WBLA 1KK7A 2X0YA 2A72A 2VKJA 1HX8A 2Q9QD 4WBOA 5LBMA 1I6ZA 2KXPB 4A5XA 3HI2A 4IE4A 4DR1T 1IBMT 2BKPA 2WWVA 4H63H 2YKSA 3P4RA 3ZMUB 1S35A 2RA1A 2BKOA 1UX4A 4UF0B 2WS3A 3QOFA 2HN2A 3N9NA 4U7IA 1D1BA 5AQJB 3ZMTB 2YU1A 3JAFA 4MHCA 1L0VA 3PUVF 3SS1A 2D2SA 2BDEA 4HFDA 2LSGA 5FYMA 4Z8XA 4P0AA 4LF4T 3L09A 3MXZA 2XQ3A 5HEHA 2QGSA 2YDSA 2BBHA 2DLRA 2EHOD 3AAIA 5FMNA 3NVOA 5TAOA 3RYHE 2LM9A 4K0UA 3JC6D 1JNRA 2YN6A 2ODVA 3FZHB 2YOEA 3NZPA 4QXBB 2E9XD 2NP9A 2XQAA 3FZKB 4H9PC 4ZS2A 4IE5A 4DMVA 4OYJA 3T8OA 3RKOA 3RHWA 4QH5A 5ABEA 4G63A 2P9BA 5FL0A 5HXEA 4TZ4C 1MMAA 1YXRA 4JBWF 4QX8B 2V8SV 3FHNA 3ETUA 5L4HA 2NW9A 2DL1A 3NRYA 5LG3A 5C8YE 5LMUT 4YLHA 1HNZT 1LVKA 4PK4A 4AXPA 2PFVA 4FI5A 4ZI3D 4YY3T 1WR0A 3DTOA 3BQIA 3AVSA 5HWYA 4B3MT 3ZT6A 4A56A 4JI3T 2W00A 3QK6A 4DR5T 3HKDE 1J1JA 2JMHA 5HEOA 4I50E 5AQFB 4DUYT 2LT3A 2HN1A 2XSAA 3V5UA 4YJ2E 5CA0E 4B3ST 4IE0A 1OWAA 3EDVA 3GN5B 3OTOT 5HEGA 5AQTB 5F8PA 5FP3A 5LXTE 4PJLA 3LBXA 2H7VC 2DWKA 4HFVA 4AKLA 2XAGB 4M1PA 4AQGA 3SRZA 1X79A 4ASKA 3PE0A 4HWFA 1H7CA 1MMNA 2CHNA 3PU3A 4H9QC 4MFRA 5FNVE 1HTJF 1M7KA 4YTNA 2HPJA 3AA0B 5LGNB 2EHOC 4H63V 4QH4A 4AIUA 1D0ZA 2LSJA 3P50A 2CM0A 3RI5A 2PBIA 4LF9T 4JYAT 4TUYE 1N33T 1MNDA 1SA0E 5FXVA 3TLSA 5L47A 3CMLA 1ZHCA 2CA5A 3KINB 4JI6T 2DCFA 2Q9QB 4DV0T 5H6RB 3RKGA 4ZI2C 5LA6E 2WQYA 5FY7A 3N2OA 2V6XA 4IGUA 2YU2A 4TV8E 1HFAA 2GK9A 3R6NA 2V7KA 3AXJB 4H9SE 5DABA 2Q9QA 1ZP0A 4XAXB 1UX5A 2A2FX 3CWZB 3RC3A 3TLTA 4GK0E 1W0AA 4DO0A 3CK6A 3K3QC 3DJBA 4JEUB 3SOLA 4U33A 5ABFB 1BR2A 2N1GA 3GMIA 3N9OA 4LF8T 5C2TA 4MBQA 3PUGA 5AQMB 4ERRA 3F31A 1XNQT 3EUHA 5HCJA 1NWMX 5JH7E 3OYXA 4X1KE 1J5WA 4EV6A 2X51A 4I43B 1WRDA 3F2EA 1U4QA 4O2AE 2J4GA 4TNWA 5JREA 2JJ9A 4GK5E 3C4XA 3LBXB 4NXNT
chains in the Genus database with same CATH topology
5A1LA 3ZC1A 4DNDA 2KMFA 3OKQA 3C4WA 2LHRA 4TN7B 4AKGA 2L3LA 3KDSE 5JQGE 1IJ5A 4OK0A 4WW0A 5HAXA 3EDUA 3LK42 1FMWA 2PG8A 2WAUA 3PTRB 3DP7A 2CWOA 2G0UA 2L8KA 3F57A 4CXXA 3BQLA 1MNEA 3I1AA 2WSSV 3HR0A 4HEAA 1YKHB 3I9WA 2MYSA 4JEHB 2ZLYA 4EZ4A 4ZHQE 3ZJ2A 2DNXA 4AKRB 2LSYA 4U72A 1D0YA 3ANWB 4AQFA 5J2TE 4AKIA 1HG5A 4ZS3A 3U3IA 4UXNB 2XASB 2EHOB 3CX6B 1VRBA 5LP6E 1WR6A 4B6XA 5LHIB 4EXTA 3RPUA 4ZI2D 1MIVA 3QC9A 2V1DB 5LJMA 3LG7A 3VU7H 2VL8A 3PURA 5L3BB 3U78A 3ZN1B 2LOSA 3CX8B 3I0QA 4NUVA 5ETWA 4P0BA 2V7LA 5LGUB 5HXRA 2ZMAA 3NRXA 2KINB 5GONE 3C98B 3AA7B 2KZ7B 5H6QB 3KV4A 5L2LA 4QXCB 2XTLA 3IF8B 1WLXA 1HG2A 4TV9E 3R84B 4XBFB 2HH7A 3RYFE 2YEVC 2X9YA 3C50A 3VHLA 2H3RA 5L3EB 5JRCB 2I59A 3S4UA 3CQGB 3UT5E 4UV8B 2ODUA 5KX5E 2ZM8A 1UCUA 5EK2A 2PJQA 4BJMA 2V26A 2BZBA 4AI6A 5F3JA 1AJ3A 3ZYMA 2C0SA 3FB2A 5KDMC 4H9OC 3AAAB 2LSIA 3MZKB 2Y6XA 2IW5B 4ILUA 4DMWA 1OXZA 2CE7A 3Q5XA 4DBRA 5L3FB 2Z6EA 4CI1B 2WMNA 5LNKA 4EB6E 4PJMA 5E0OA 3GWHA 3PUQA 2YK0A 1YKEB 3FXEB 4WNKA 2YINA 5LHHB 4IIJE 4AKHA 4KP3C 2CLYC 3VKGA 2NTXA 3CQCB 4YJ3E 1IJ6A 1US7B 2E9XC 3MA9A 3I9YA 4EYUA 4KMCA 3FBZA 2H7OA 2ES0A 3A5XA 2X68A 3V5SA 2VASA 3TKLB 2N9DA 2C5JA 5LHGB 1IZNB 2E9XA 2VKOA 4I4TE 4ISTA 4UVAB 3RYCE 3UFEA 2D0TA 3LK3B 3ZCJA 2NTYA 1V9DA 5HXHA 5EK3A 2ACXA 1SHZC 3FBLA 4N78D 4NUUA 5FXZA 4C91A 4O2BE 4BA9A 5JDNA 4QX7B 3ZPOA 3GN5A 4EYYR 5JRCA 1ZV4X 2XHEB 2D5UA 3ZYLA 3ZEFB 2X9WA 2VKDA 4XZCA 4KBMB 3OJAA 3J7Yq 3N9PA 2IC6A 3KV6A 1YW0A 3MKDA 2K48A 2MOZA 2NOXA 2ZM2A 3HA4A 1QSDA 2XAHB 5CA1E 1NAFA 1ZKEA 2ZM0A 3ETVA 2IC9A 1IAPA 5HWXA 2CWYA 4O4JE 4OHFA 2X9HA 4UEMA 2MTQA 4U74A 1LRZA 1BR1A 3KFWX 4L0RA 4ANJA 4UF0A 3OBVE 4PNIA 3O9XA 2V7IA 4IE7A 3NBXX 5LG4A 2VB6A 2WWUA 2XAJB 2A3DA 4O4IE 3O4XE 3O1JA 3CKDA 4BAYB 2NWBA 5L3DB 3ONXA 3ANWA 3QUJA 5CB4E 3K3NA 5HYAA 3C64A 2BVLA 4E7ZA 1YD8G 1CUNA 5IHYA 4BJNA 1WYCA 2CLYB 1EZ3A 2X67A 4H9NC 4MLKA 3PU8A 4QXHB 2J1DG 2OA5A 4YFSA 2V7MA 2E9XB 3CPZA 2NW7A 4J2CA 5FXXA 3P8CD 3LJCA 3HKBE 2JMKA 1LVFA 4MALA 4X20E 4UVBB 4PAGA 4L9IA 3E08A 3RX6A 3HKCE 4V1Av 2K24A 2X0LB 5M4YA 2KWHA 3KVAA 5JDQA 1BR0A 3D0TA 5LYJE 2Q9QC 4HN9A 1ZEEA 4WBNE 3PUSA 4GOUA 3RRCA 2Y48B 5FY1A 2B1EA 3C4ZA 2E8IA 2CXFA 2JRKA 3O1HA 5IYZE 2LSKA 3LFMA 2HPLA 4CZZB 4FJOA 3AVRA 1WYBA 2DWGA 4O4LE 4UELA 5LCYA 2CEAA 1T98A 3JC6C 2BVMA 3N5LA 3UTKA 4PFOA 4QKNA 4IE6A 5AFUL 3HL6A 3KV9A 3UULA 2MBGA 3I0OA 3WI3A 3UUXB 3N2GE 3ZCIA 4KUMB 2SPCA 4IDZA 4PW8A 1D0XA 2KT9A 5J1GA 2WM9A 2XAFB 4PK6A 5BMVE 3EVYA 2CMRA 2W62A 2LHNA 4C90A 4EAHA 3GA8A 5L3CB 4PJNA 4YHJA 5JDHA 3VKHA 1HF8A 2M67A 2KNDA 4UIGA 3K3OA 3MACA 4GYSA 3RYIE 3WAJA 4OFZA 3CX7B 5J2UE 5EK4A 5DQVA 4H9RC 1Z0PA 5JR9B 4CI3B 5JDGA 2XQYA 1MIYA 1MIWA 4DBQA 3LK2B 2W0GA 5FY0A 2JPFA 4OYKA 1S94A 3SWHA 4G2AA 4ISSA 1VOMA 3B13A 4QWNB 2IAKA 2LOPA 3MK7C 5HXSA 1KNZA 2UXXB 4GYRA 3UUNA 4X1YE 1D1CA 3BQKA 2WMOA 3IEEA 4PK5A 2CXLA 2JQQA 1B7TA 4QHOA 3ESLA 2XAQB 5L3GB 4L5GA 3C51A 2CXDA 4AQFC 3UUMA 5JDFA 2KWIB 2QA7A 5LOVE 3AAEB 2LE8A 3H3AA 5LBQB 4ZI7E 2CCQA 3ZC0A 3Q2MA 4PJJA 4I55E 5DQWA 1HCIA 2DHRA 2EHOA 4HTEA 5JR9A 4CQIA 4X1IE 5KMGP 3K8PC 4HE8A 2K5BB 1HS7A 2LJLA 2C5IT 4ADZA 4EZHA 2D0UA 3PDYA 2W61A 4CI2B 4DVDA 3AA6B 3BK9A 1LKXA 3RC8A 2VKHA 3ZLIA 3N2KE 3H37A 2RP4A 4PFPA 1FMVA 2VK9A 2X9XA 3P7IA 2XUEA 3Q9DA 3WAKA 1MMGA 3W15B 4P09A 4JLEA 3Q5WA 3MJXA 3N9LA 1O3XA 1FEWA 4CXWA 1Y64B 4EOZB 5LGTB 1D1AA 1BR4A 1U5PA 3ZMVB 3ZMSB 2N2NA 5LJNA 4EIWA 5HXCA 5JVDE 4HGAA 3PUAA 3KV5A 3M65A 3ZJ1A 3NZQA 1QUUA 5ADXL 1G73A 5JR9C 2W63A 3OYZA 4O4HE 3L3PA 5JDLA 4ZOLE 2LEHA 3J9X1 3KBTA 3RRWA 4UVCB 5FXWA 2C5KT 3E0ZA 2NW8A 3FXDB 3E22E 3B57A 2VWAA 3KVBA 4IHJE 4ZI3C 4CXYA 3N9QA 3AB3B 3HKEE 2UXNB 2DI4A 3CVRA 4JUYA 2K9AA 4GIWA 3IBPA 2L9QA 3N9MA 3O1IA 3ZYKA 4HKAA 4E7SA 5DJQC 5EZYE 1E1HB 4UV9B 1G8XA 3KBUA 4O8SA 2X66A 2Y8DA 3RH3A 3ZN0B 3CQXC 3IHRA 1MMDA 3AA1B 4TX5A 1FIOA 2KLQA 2V7JA 2WBLA 1KK7A 2A72A 2VKJA 1HX8A 2Q9QD 4WBOA 5LBMA 2KXPB 3HI2A 4IE4A 4H63H 3ZMUB 1S35A 2RA1A 1UX4A 4UF0B 3N9NA 1D1BA 3ZMTB 2YU1A 4MHCA 3SS1A 4P0AA 2D2SA 2BDEA 5FYMA 2LSGA 4Z8XA 3L09A 3MXZA 2QGSA 3AAIA 2DLRA 2EHOD 5FMNA 3RYHE 5TAOA 2LM9A 4K0UA 3JC6D 3NZPA 4QXBB 2ODVA 3ZMZB 2E9XD 2NP9A 4H9PC 4ZS2A 4DMVA 4IE5A 4OYJA 3T8OA 3RKOA 4G63A 2P9BA 5HXEA 4TZ4C 1MMAA 4QX8B 2NW9A 3FHNA 3ETUA 3NRYA 5C8YE 4YLHA 1LVKA 4PK4A 4AXPA 2PFVA 4FI5A 4ZI3D 3DTOA 3BQIA 3AVSA 5HWYA 4A56A 2W00A 3QK6A 3HKDE 2JMHA 4I50E 2LT3A 4YJ2E 3V5UA 5CA0E 4IE0A 1OWAA 3EDVA 3GN5B 5F8PA 5FP3A 5LXTE 4PJLA 3LBXA 2H7VC 2DWKA 4HFVA 4AKLA 2XAGB 4M1PA 4AQGA 3SRZA 1X79A 4ASKA 3PE0A 1H7CA 1MMNA 3PU3A 4H9QC 4MFRA 5FNVE 1HTJF 5LGNB 2HPJA 3AA0B 2EHOC 4H63V 1D0ZA 2LSJA 2CM0A 2PBIA 4TUYE 1MNDA 1SA0E 5FXVA 3CMLA 1ZHCA 2CA5A 3KINB 2DCFA 2Q9QB 5H6RB 4ZI2C 5LA6E 5FY7A 3N2OA 4IGUA 2YU2A 4TV8E 1HFAA 2GK9A 3R6NA 2V7KA 4H9SE 5DABA 2Q9QA 4XAXB 4F6RC 1UX5A 2A2FX 3CWZB 3RC3A 4DO0A 4GK0E 5JDMA 3K3QC 3SOLA 3DJBA 4JEUB 1BR2A 2N1GA 3GMIA 3N9OA 4MBQA 3PUGA 4ERRA 3F31A 3EUHA 1NWMX 5JH7E 3OYXA 4X1KE 2X51A 4I43B 3F2EA 1WRDA 1U4QA 4O2AE 5JREA 2JJ9A 4GK5E 3C4XA 3LBXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKE A;  2C5J A;  4DND A;  2C5I T;  2XTL A;  2CA5 A;  2IC9 A;  3QK6 A;  4B6X A;  2X9Y A;  1LRZ A;  3FXE B;  4L0R A;  1IJ5 A;  3MXZ A;  4J2C A;  3N5L A;  3S4U A;  2KWI B;  1LVF A;  2G0U A;  2X9X A;  3L3P A;  4EYY R;  1Z0P A;  3QUJ A;  3P7I A;  2MBG A;  2X9W A;  1IJ6 A;  1H7C A;  2IC6 A;  2C5K T;  3FXD B;  2KWH A;  2K48 A;  3CKD A;  4CQI A;  1QSD A;  4FI5 A;  3CVR A;  3TKL B; 
#chains in the Genus database with same CATH topology
 5A1L A;  2WZH A;  3ZC1 A;  4DND A;  4B3R T;  4DR4 T;  2KMF A;  3OKQ A;  3C4W A;  3UU6 A;  4GKJ T;  5IWA T;  2LHR A;  4TN7 B;  4EEB A;  4LFC T;  2ACZ A;  4U2Z A;  4AKG A;  2LRL A;  2B76 A;  2L3L A;  3KDS E;  5JQG E;  1OED B;  1IJ5 A;  4OK0 A;  4WW0 A;  5HAX A;  3EDU A;  1XMO T;  1E2A A;  3LK4 2;  2BG9 C;  1FMW A;  2PG8 A;  2WAU A;  3P4S A;  3PTR B;  3DP7 A;  4CN6 A;  2CWO A;  2G0U A;  5C3J A;  4LFB T;  2L8K A;  3F57 A;  4CXX A;  3AE4 A;  2WCA A;  3BQL A;  3P4P A;  3JCF A;  2V5C A;  1MNE A;  3I1A A;  2WSS V;  3HR0 A;  4HEA A;  5LMN T;  2BBJ A;  1YKH B;  2WDR A;  3I9W A;  2UU9 T;  2MYS A;  3AE7 A;  4JEH B;  2ZLY A;  2V6Y B;  4EZ4 A;  4YSX A;  4ZHQ E;  4DR6 T;  1WCR A;  3ZJ2 A;  4YHH T;  2DNX A;  4A97 A;  2LSY A;  4U72 A;  4AKR B;  2R6G F;  1D0Y A;  2UXB T;  3ANW B;  4AQF A;  5J2T E;  1XMQ T;  1HG5 A;  4ZS3 A;  3U3I A;  4AKI A;  2D9D A;  2UUB T;  4UXN B;  2XAS B;  4CN4 A;  2EHO B;  3CX6 B;  3P4Q A;  2E5V A;  3ONL C;  1VRB A;  2PTF A;  5LP6 E;  1WR6 A;  4B6X A;  5LHI B;  4X62 T;  1HR0 T;  4EXT A;  4LMK A;  2VVS A;  3RPU A;  1MIV A;  3QC9 A;  2V1D B;  4ZI2 D;  5LJM A;  3LG7 A;  4HFC A;  4DV2 T;  3VU7 H;  1T72 A;  2VL8 A;  3PUR A;  5L3B B;  3U78 A;  4LF6 T;  3ZN1 B;  2LOS A;  3CX8 B;  3I0Q A;  4NUV A;  5ETW A;  2WB5 A;  4P0B A;  2V7L A;  4YTP A;  4ILA A;  5LGU B;  2UXC T;  2M6B A;  5HXR A;  2ZMA A;  5IUX A;  5L4E A;  3NRX A;  1UGO A;  2KIN B;  5GON E;  3C98 B;  3RGL A;  3AA7 B;  2KZ7 B;  4U7Y A;  3KV4 A;  4IDQ A;  5H6Q B;  4Z90 A;  4QXC B;  5L2L A;  4LF5 T;  4KHP T;  2XTL A;  4IDN A;  5FVK A;  2VQE T;  2ZM6 T;  3IF8 B;  4Z91 A;  1WLX A;  3L8R A;  1HG2 A;  3AE6 A;  4AQY T;  4TV9 E;  3R84 B;  4XBF B;  2HH7 A;  3RYF E;  2YEV C;  2X9Y A;  3C50 A;  3VHL A;  2H3R A;  1KFY A;  5L3E B;  2I59 A;  5JRC B;  1W0B A;  3PUZ F;  3LSV A;  5AQN B;  3CQG B;  3Q5D A;  4UV8 B;  2XSB A;  3S4U A;  3UT5 E;  2ODU A;  2W67 A;  5KX5 E;  2ZM8 A;  1OED A;  1UCU A;  2CRB A;  5EK2 A;  2PJQ A;  4X65 T;  4IL9 A;  2FJD A;  4BJM A;  2V26 A;  2BZB A;  3PUY F;  5AQQ B;  2LM2 A;  2QVA A;  3ZSS A;  4AI6 A;  1N34 T;  5F3J A;  3M3Z B;  2IHR 1;  5HCM A;  3ZYM A;  2E5L T;  2C0S A;  3FB2 A;  5KDM C;  4H9O C;  3AAA B;  2LSI A;  3MZK B;  2Y6X A;  2IW5 B;  1XNR T;  4JI2 T;  4ILU A;  4DMW A;  1OXZ A;  2CE7 A;  5HEJ A;  5ABF A;  3Q5X A;  3ZT5 A;  4DBR A;  3RLF F;  5L3F B;  2Z6E A;  4CI1 B;  4DR3 T;  2WMN A;  5LNK A;  4EB6 E;  2CBJ A;  3PJA J;  4PJM A;  5AQP B;  1NEK A;  5E0O A;  2CHO A;  3GWH A;  3PUQ A;  4HWH A;  4DID B;  2YK0 A;  1YKE B;  3FXE B;  4WNK A;  2AE9 A;  2QRX A;  3LDQ B;  2YIN A;  5LHH B;  2KSR A;  1ZOY A;  4IIJ E;  3ZMZ B;  4AKH A;  4KP3 C;  2XY8 B;  2I6H A;  4HFH A;  2CLY C;  3VKG A;  2XQ9 A;  2NTX A;  2XPK A;  3CQC B;  4YJ3 E;  1IJ6 A;  1US7 B;  4COF A;  2E9X C;  1N36 T;  3MA9 A;  2UUA T;  3EAM A;  2XZE A;  3I9Y A;  4EYU A;  4KMC A;  4YT0 A;  4IRE A;  3FBZ A;  2H7O A;  2ES0 A;  1X9B A;  1UUS A;  3A5X A;  3AE2 A;  2X68 A;  3B5M A;  3EAB A;  3UUB A;  1HX1 B;  3V5S A;  3ZST A;  2VAS A;  4DV3 T;  3TKL B;  2N9D A;  2C5J A;  2E2A A;  5LHG B;  1IZN B;  3QB5 K;  5F5W A;  4YSZ A;  2E9X A;  2VKO A;  2W4X A;  4I4T E;  4IST A;  4UVA B;  3RYC E;  3UFE A;  2D0T A;  3LK3 B;  3ZCJ A;  2NTY A;  1E7P A;  1V9D A;  5HXH A;  3AEC A;  5EK3 A;  2IIU A;  2ACX A;  5HEU A;  1QLB A;  2LKG A;  1SHZ C;  3FBL A;  4N78 D;  4NUU A;  5FXZ A;  4C91 A;  4O2B E;  4BA9 A;  4ZZB A;  5JDN A;  1YQ4 A;  3AEG A;  4QX7 B;  3ZPO A;  3GN5 A;  3RIA A;  4EYY R;  5JRC A;  4DV4 T;  1FJG T;  1YQ3 A;  5FVL A;  1ZV4 X;  2XHE B;  2D5U A;  5AQI B;  3ZYL A;  2X9W A;  3ZEF B;  5KXJ A;  2VKD A;  3T1Y T;  4XZC A;  4KBM B;  3OJA A;  3J7Y q;  2XQ5 A;  2IC6 A;  3N9P A;  4UR9 A;  3KV6 A;  1YW0 A;  4LFA T;  1WFD A;  3TLU A;  1W9R A;  3MKD A;  4JI5 T;  2K48 A;  4GKK T;  2MOZ A;  2NOX A;  2ZM2 A;  3HA4 A;  1QSD A;  4U3C A;  2XAH B;  5CA1 E;  1NAF A;  1ZKE A;  2ZM0 A;  3ETV A;  2IC9 A;  1IAP A;  1KNR A;  5HWX A;  4F8H A;  2CWY A;  4O4J E;  5AQV B;  4OHF A;  2X9H A;  4UEM A;  2MTQ A;  4U74 A;  1LRZ A;  1BR1 A;  3KFW X;  4L0R A;  2V5D A;  1CHU A;  4ANJ A;  4UF0 A;  3OBV E;  4PNI A;  3O9X A;  1HNW T;  2V7I A;  4IE7 A;  3TLV A;  2BG9 E;  3NBX X;  4QH1 A;  2WZI A;  2M6I A;  5LG4 A;  2XM1 A;  2VB6 A;  2WWU A;  2BS4 A;  2XAJ B;  2A3D A;  2W2U A;  4O4I E;  2V6Y A;  3RQW A;  2LRK A;  3O4X E;  3O1J A;  4EGW A;  5AQL B;  3CKD A;  4BAY B;  2BG9 A;  2NWB A;  5L3D B;  2H89 A;  2VL0 A;  3ANW A;  3ONX A;  3QNU A;  1GQE A;  3QUJ A;  5CB4 E;  4B3T T;  4DR7 T;  2F4V T;  3K3N A;  5HYA A;  3C64 A;  2BVL A;  4YSY A;  4E7Z A;  3FZM B;  1YD8 G;  5FL1 A;  1CUN A;  4DV6 T;  5IHY A;  4BJN A;  1KF6 A;  1WYC A;  1EZ3 A;  2CLY B;  2X67 A;  4H9N C;  3PU8 A;  4MLK A;  4QXH B;  2J1D G;  2OA5 A;  4YFS A;  2V7M A;  2E9X B;  3CPZ A;  2NW7 A;  4J2C A;  3UU5 A;  5FXX A;  3P8C D;  3LJC A;  3HKB E;  2JMK A;  1LVF A;  4MAL A;  1VCT A;  4X20 E;  1T7S A;  2VUR A;  1Z8U A;  2BKN A;  3PUX F;  4UVB B;  4JI1 T;  3FZF B;  2JQK A;  2FJB A;  3PJA A;  1Y01 A;  4PAG A;  1R8I A;  3E08 A;  4L9I A;  5AQS B;  3RX6 A;  4IT4 A;  3HKC E;  1W09 A;  2K24 A;  4HFB A;  4V1A v;  2X0L B;  5M4Y A;  4IDP A;  4TWH A;  1N32 T;  2YDQ A;  2KWH A;  3KVA A;  5JDQ A;  3VR8 A;  3D0T A;  1BR0 A;  5LYJ E;  1OED E;  2Q9Q C;  4HN9 A;  4ZXL A;  1ZEE A;  4WBN E;  3PUS A;  4GOU A;  3RRC A;  3P4W A;  4TNV A;  5AQK B;  2Y48 B;  5FY1 A;  2B1E A;  3AEB A;  2E8I A;  2CXF A;  2JRK A;  3C4Z A;  3O1H A;  5IYZ E;  3UFG A;  2LSK A;  3LFM A;  2HPL A;  4JI7 T;  4EED A;  4CZZ B;  4FJO A;  4K0K T;  3AVR A;  1WYB A;  4P1N A;  3UU4 A;  2DWG A;  4O4L E;  4UEL A;  2IML A;  3FZL B;  3NWI A;  5LCY A;  2CEA A;  1T98 A;  3JC6 C;  2BVM A;  3N5L A;  3UTK A;  3EI0 A;  3T1H T;  4PFO A;  3IA3 A;  4LMJ A;  4A98 A;  1IBK T;  4QKN A;  4IE6 A;  5AFU L;  3HL6 A;  3KV9 A;  3UUL A;  5ABH A;  1AJ3 A;  1XWM A;  2MBG A;  3I0O A;  3WI3 A;  5J0Z A;  1KNP A;  3UUX B;  3N2G E;  4WZX A;  3ZCI A;  5AQR B;  3CIR A;  3AE8 A;  4KUM B;  2SPC A;  4IDZ A;  4PW8 A;  1D0X A;  1M62 A;  4LML A;  5ABG A;  2KT9 A;  5J1G A;  2WM9 A;  2XAF B;  4PK6 A;  5BMV E;  3EVY A;  3RQU A;  2CMR A;  2W62 A;  2LHN A;  3PV0 F;  4NPP A;  3GA8 A;  1KEY A;  4Q25 A;  4C90 A;  4EAH A;  4KX6 A;  4DV5 T;  4PJN A;  4YHJ A;  3X1D A;  5JDH A;  3VKH A;  1HF8 A;  4HFI A;  3TLW A;  2UUC T;  2M67 A;  2KND A;  2OV9 A;  3K3O A;  3MAC A;  3NKZ A;  2CPT A;  4UIG A;  4GYS A;  3RYI E;  3UQ7 A;  4ZEY A;  1UUR A;  3WAJ A;  4OFZ A;  3CX7 B;  2WP9 A;  4HFE A;  5J2U E;  5EK4 A;  1HNX T;  3VR9 A;  3AEF A;  4WYV A;  5DQV A;  4H9R C;  1Z0P A;  5JR9 B;  4CI3 B;  2BG9 B;  4HWI B;  4IL4 A;  2XQY A;  1MIY A;  3ABV A;  1MIW A;  5JDG A;  4DBQ A;  3LK2 B;  2W0G A;  5FY0 A;  2RPA A;  1SE7 A;  2VQF T;  2JPF A;  3AEE A;  4CN1 A;  4OYK A;  1S94 A;  3RF1 A;  3SWH A;  5CFB A;  4G2A A;  2IDO B;  3JAE A;  4ISS A;  1VOM A;  3B13 A;  4QWN B;  2IAK A;  2WU2 A;  4F6R C;  3SFE A;  2LOP A;  3MK7 C;  4IDO A;  5HXS A;  1T8B A;  1KNZ A;  2XQ6 A;  2UXX B;  4GYR A;  4TWD A;  3UUN A;  4X1Y E;  1D1C A;  3BQK A;  2W66 A;  2WMO A;  3IEE A;  2CXL A;  2JQQ A;  2NR4 A;  4PK5 A;  3VRA A;  1B7T A;  4QHO A;  3ESL A;  4ZZC A;  2XAQ B;  2XQ7 A;  2XM2 A;  5L3G B;  4L5G A;  3C51 A;  4X5T A;  2CXD A;  2XQ8 A;  4AQF C;  3Q5E A;  3UUM A;  5JDF A;  2KWI B;  2QA7 A;  5LOV E;  1UK5 A;  3AAE B;  2WDV A;  1NEN A;  2LE8 A;  3AED A;  3H3A A;  4ILB A;  3AE5 A;  2CCQ A;  5AQO B;  5LBQ B;  5LB7 B;  4ZI7 E;  5CGM A;  4DR2 T;  3Q2M A;  3ZC0 A;  4PJJ A;  4I55 E;  5DQW A;  2WDQ A;  1HCI A;  4DV7 T;  2DHR A;  4JI8 T;  1SUM B;  3RIU A;  2BS3 A;  2MPK A;  1XZY A;  2EHO A;  4HTE A;  5JR9 A;  4CQI A;  4X1I E;  2JQH A;  3UU8 A;  3K8P C;  5KMG P;  4HE8 A;  4U2Y A;  2K5B B;  4X64 T;  4NXM T;  1HS7 A;  2LJL A;  3RIF A;  2C5I T;  4ADZ A;  4EZH A;  2D0U A;  3PDY A;  1J5E T;  2W61 A;  3A8Y C;  4CI2 B;  4DVD A;  3AA6 B;  3AE1 A;  1LKX A;  3BK9 A;  3RIU C;  2VKH A;  3RC8 A;  2LLY A;  2X0H A;  4OX9 T;  3SFD A;  2FBW A;  2I0M A;  3ZLI A;  3N2K E;  3H37 A;  2RP4 A;  4U31 A;  3ZT7 A;  4PFP A;  2A9U A;  2VVN A;  4YXD A;  4DUZ T;  1XDP A;  1FMV A;  2VK9 A;  2BS2 A;  2X9X A;  3RRW A;  2XQ4 A;  3P7I A;  1IBL T;  4JV5 T;  2J62 A;  2XUE A;  2IUB A;  3Q9D A;  1DU2 A;  3WAK A;  1MMG A;  1XDO A;  4ILC A;  3W15 B;  4P09 A;  4JLE A;  3Q5W A;  3K1S A;  3AE3 A;  3MJX A;  3N9L A;  3ONJ A;  1O3X A;  2QYW A;  2AXD S;  1FEW A;  4KI0 F;  4AIS A;  5L3C B;  4CXW A;  1Y64 B;  2J47 A;  4EOZ B;  5LGT B;  3JAD A;  5JTG A;  1D1A A;  1OED C;  3OVU A;  5AQH B;  1BR4 A;  1U5P A;  2K3W A;  3ZMV B;  5AQU B;  3ZMS B;  2N2N A;  2H88 A;  5CJ5 A;  4TWF A;  5LJN A;  4EIW A;  5HXC A;  5JVD E;  4HGA A;  3PUA A;  3KV5 A;  3L39 A;  3M65 A;  3ZJ1 A;  4X66 T;  3NZQ A;  1QUU A;  5ADX L;  4HWD A;  1G73 A;  4KHZ F;  5JR9 C;  4JI0 T;  2W63 A;  3OYZ A;  4O4H E;  3L3P A;  3AXJ A;  5JDL A;  3OPC A;  2WU5 A;  2HHH T;  4ZOL E;  2LEH A;  3J9X 1;  4I0U A;  3UQ4 A;  3QB5 A;  3KBT A;  5FKY A;  4UVC B;  5FXW A;  4HWC A;  2C5K T;  2JIW A;  2NW8 A;  3E0Z A;  3E22 E;  3B57 A;  2VWA A;  2CBI A;  3FXD B;  3KVB A;  4IHJ E;  4ZI3 C;  3N9Q A;  4CXY A;  2FUP A;  3AB3 B;  3HKE E;  2UXN B;  2DI4 A;  3G06 A;  3CVR A;  4JUY A;  1JNZ A;  2LKH A;  2XJ7 A;  2JQ9 A;  2K9A A;  4GIW A;  2FJE A;  3IBP A;  5BR8 T;  2UXD T;  1I94 T;  5AQG B;  2L9Q A;  3N9M A;  3O1I A;  3ZYK A;  4DV1 T;  4YTM A;  3PUW F;  4LF7 T;  3VRB A;  4HKA A;  4NIQ A;  4E7S A;  5DJQ C;  3AEA A;  3UU3 A;  5EZY E;  1E1H B;  4UV9 B;  3AE9 A;  1VCS A;  2FJA A;  1G8X A;  2WY2 A;  3EHZ A;  2X66 A;  2Y8D A;  3H3M A;  3KBU A;  4O8S A;  3RH3 A;  3ZN0 B;  4JI4 T;  3CQX C;  2OLT A;  3IHR A;  1MMD A;  5JDM A;  3AA1 B;  3A7M A;  3ZKR A;  2MAW A;  2YDR A;  1FIO A;  2KLQ A;  2V7J A;  4TX5 A;  2WBL A;  1KK7 A;  2X0Y A;  2A72 A;  2VKJ A;  1HX8 A;  2Q9Q D;  4WBO A;  5LBM A;  1I6Z A;  2KXP B;  4A5X A;  3HI2 A;  4IE4 A;  4DR1 T;  1IBM T;  2BKP A;  2WWV A;  4H63 H;  2YKS A;  3P4R A;  3ZMU B;  1S35 A;  2RA1 A;  2BKO A;  1UX4 A;  4UF0 B;  2WS3 A;  3QOF A;  2HN2 A;  3N9N A;  4U7I A;  1D1B A;  5AQJ B;  3ZMT B;  2YU1 A;  3JAF A;  4MHC A;  1L0V A;  3PUV F;  3SS1 A;  2D2S A;  2BDE A;  4HFD A;  2LSG A;  5FYM A;  4Z8X A;  4P0A A;  4LF4 T;  3L09 A;  3MXZ A;  2XQ3 A;  5HEH A;  2QGS A;  2YDS A;  2BBH A;  2DLR A;  2EHO D;  3AAI A;  5FMN A;  3NVO A;  5TAO A;  3RYH E;  2LM9 A;  4K0U A;  3JC6 D;  1JNR A;  2YN6 A;  2ODV A;  3FZH B;  2YOE A;  3NZP A;  4QXB B;  2E9X D;  2NP9 A;  2XQA A;  3FZK B;  4H9P C;  4ZS2 A;  4IE5 A;  4DMV A;  4OYJ A;  3T8O A;  3RKO A;  3RHW A;  4QH5 A;  5ABE A;  4G63 A;  2P9B A;  5FL0 A;  5HXE A;  4TZ4 C;  1MMA A;  1YXR A;  4JBW F;  4QX8 B;  2V8S V;  3FHN A;  3ETU A;  5L4H A;  2NW9 A;  2DL1 A;  3NRY A;  5LG3 A;  5C8Y E;  5LMU T;  4YLH A;  1HNZ T;  1LVK A;  4PK4 A;  4AXP A;  2PFV A;  4FI5 A;  4ZI3 D;  4YY3 T;  1WR0 A;  3DTO A;  3BQI A;  3AVS A;  5HWY A;  4B3M T;  3ZT6 A;  4A56 A;  4JI3 T;  2W00 A;  3QK6 A;  4DR5 T;  3HKD E;  1J1J A;  2JMH A;  5HEO A;  4I50 E;  5AQF B;  4DUY T;  2LT3 A;  2HN1 A;  2XSA A;  3V5U A;  4YJ2 E;  5CA0 E;  4B3S T;  4IE0 A;  1OWA A;  3EDV A;  3GN5 B;  3OTO T;  5HEG A;  5AQT B;  5F8P A;  5FP3 A;  5LXT E;  4PJL A;  3LBX A;  2H7V C;  2DWK A;  4HFV A;  4AKL A;  2XAG B;  4M1P A;  4AQG A;  3SRZ A;  1X79 A;  4ASK A;  3PE0 A;  4HWF A;  1H7C A;  1MMN A;  2CHN A;  3PU3 A;  4H9Q C;  4MFR A;  5FNV E;  1HTJ F;  1M7K A;  4YTN A;  2HPJ A;  3AA0 B;  5LGN B;  2EHO C;  4H63 V;  4QH4 A;  4AIU A;  1D0Z A;  2LSJ A;  3P50 A;  2CM0 A;  3RI5 A;  2PBI A;  4LF9 T;  4JYA T;  4TUY E;  1N33 T;  1MND A;  1SA0 E;  5FXV A;  3TLS A;  5L47 A;  3CML A;  1ZHC A;  2CA5 A;  3KIN B;  4JI6 T;  2DCF A;  2Q9Q B;  4DV0 T;  5H6R B;  3RKG A;  4ZI2 C;  5LA6 E;  2WQY A;  5FY7 A;  3N2O A;  2V6X A;  4IGU A;  2YU2 A;  4TV8 E;  1HFA A;  2GK9 A;  3R6N A;  2V7K A;  3AXJ B;  4H9S E;  5DAB A;  2Q9Q A;  1ZP0 A;  4XAX B;  1UX5 A;  2A2F X;  3CWZ B;  3RC3 A;  3TLT A;  4GK0 E;  1W0A A;  4DO0 A;  3CK6 A;  3K3Q C;  3DJB A;  4JEU B;  3SOL A;  4U33 A;  5ABF B;  1BR2 A;  2N1G A;  3GMI A;  3N9O A;  4LF8 T;  5C2T A;  4MBQ A;  3PUG A;  5AQM B;  4ERR A;  3F31 A;  1XNQ T;  3EUH A;  5HCJ A;  1NWM X;  5JH7 E;  3OYX A;  4X1K E;  1J5W A;  4EV6 A;  2X51 A;  4I43 B;  1WRD A;  3F2E A;  1U4Q A;  4O2A E;  2J4G A;  4TNW A;  5JRE A;  2JJ9 A;  4GK5 E;  3C4X A;  3LBX B;  4NXN T; 
#chains in the Genus database with same CATH homology
 5A1L A;  3ZC1 A;  4DND A;  2KMF A;  3OKQ A;  3C4W A;  2LHR A;  4TN7 B;  4AKG A;  2L3L A;  3KDS E;  5JQG E;  1IJ5 A;  4OK0 A;  4WW0 A;  5HAX A;  3EDU A;  3LK4 2;  1FMW A;  2PG8 A;  2WAU A;  3PTR B;  3DP7 A;  2CWO A;  2G0U A;  2L8K A;  3F57 A;  4CXX A;  3BQL A;  1MNE A;  3I1A A;  2WSS V;  3HR0 A;  4HEA A;  1YKH B;  3I9W A;  2MYS A;  4JEH B;  2ZLY A;  4EZ4 A;  4ZHQ E;  3ZJ2 A;  2DNX A;  4AKR B;  2LSY A;  4U72 A;  1D0Y A;  3ANW B;  4AQF A;  5J2T E;  4AKI A;  1HG5 A;  4ZS3 A;  3U3I A;  4UXN B;  2XAS B;  2EHO B;  3CX6 B;  1VRB A;  5LP6 E;  1WR6 A;  4B6X A;  5LHI B;  4EXT A;  3RPU A;  4ZI2 D;  1MIV A;  3QC9 A;  2V1D B;  5LJM A;  3LG7 A;  3VU7 H;  2VL8 A;  3PUR A;  5L3B B;  3U78 A;  3ZN1 B;  2LOS A;  3CX8 B;  3I0Q A;  4NUV A;  5ETW A;  4P0B A;  2V7L A;  5LGU B;  5HXR A;  2ZMA A;  3NRX A;  2KIN B;  5GON E;  3C98 B;  3AA7 B;  2KZ7 B;  5H6Q B;  3KV4 A;  5L2L A;  4QXC B;  2XTL A;  3IF8 B;  1WLX A;  1HG2 A;  4TV9 E;  3R84 B;  4XBF B;  2HH7 A;  3RYF E;  2YEV C;  2X9Y A;  3C50 A;  3VHL A;  2H3R A;  5L3E B;  5JRC B;  2I59 A;  3S4U A;  3CQG B;  3UT5 E;  4UV8 B;  2ODU A;  5KX5 E;  2ZM8 A;  1UCU A;  5EK2 A;  2PJQ A;  4BJM A;  2V26 A;  2BZB A;  4AI6 A;  5F3J A;  1AJ3 A;  3ZYM A;  2C0S A;  3FB2 A;  5KDM C;  4H9O C;  3AAA B;  2LSI A;  3MZK B;  2Y6X A;  2IW5 B;  4ILU A;  4DMW A;  1OXZ A;  2CE7 A;  3Q5X A;  4DBR A;  5L3F B;  2Z6E A;  4CI1 B;  2WMN A;  5LNK A;  4EB6 E;  4PJM A;  5E0O A;  3GWH A;  3PUQ A;  2YK0 A;  1YKE B;  3FXE B;  4WNK A;  2YIN A;  5LHH B;  4IIJ E;  4AKH A;  4KP3 C;  2CLY C;  3VKG A;  2NTX A;  3CQC B;  4YJ3 E;  1IJ6 A;  1US7 B;  2E9X C;  3MA9 A;  3I9Y A;  4EYU A;  4KMC A;  3FBZ A;  2H7O A;  2ES0 A;  3A5X A;  2X68 A;  3V5S A;  2VAS A;  3TKL B;  2N9D A;  2C5J A;  5LHG B;  1IZN B;  2E9X A;  2VKO A;  4I4T E;  4IST A;  4UVA B;  3RYC E;  3UFE A;  2D0T A;  3LK3 B;  3ZCJ A;  2NTY A;  1V9D A;  5HXH A;  5EK3 A;  2ACX A;  1SHZ C;  3FBL A;  4N78 D;  4NUU A;  5FXZ A;  4C91 A;  4O2B E;  4BA9 A;  5JDN A;  4QX7 B;  3ZPO A;  3GN5 A;  4EYY R;  5JRC A;  1ZV4 X;  2XHE B;  2D5U A;  3ZYL A;  3ZEF B;  2X9W A;  2VKD A;  4XZC A;  4KBM B;  3OJA A;  3J7Y q;  3N9P A;  2IC6 A;  3KV6 A;  1YW0 A;  3MKD A;  2K48 A;  2MOZ A;  2NOX A;  2ZM2 A;  3HA4 A;  1QSD A;  2XAH B;  5CA1 E;  1NAF A;  1ZKE A;  2ZM0 A;  3ETV A;  2IC9 A;  1IAP A;  5HWX A;  2CWY A;  4O4J E;  4OHF A;  2X9H A;  4UEM A;  2MTQ A;  4U74 A;  1LRZ A;  1BR1 A;  3KFW X;  4L0R A;  4ANJ A;  4UF0 A;  3OBV E;  4PNI A;  3O9X A;  2V7I A;  4IE7 A;  3NBX X;  5LG4 A;  2VB6 A;  2WWU A;  2XAJ B;  2A3D A;  4O4I E;  3O4X E;  3O1J A;  3CKD A;  4BAY B;  2NWB A;  5L3D B;  3ONX A;  3ANW A;  3QUJ A;  5CB4 E;  3K3N A;  5HYA A;  3C64 A;  2BVL A;  4E7Z A;  1YD8 G;  1CUN A;  5IHY A;  4BJN A;  1WYC A;  2CLY B;  1EZ3 A;  2X67 A;  4H9N C;  4MLK A;  3PU8 A;  4QXH B;  2J1D G;  2OA5 A;  4YFS A;  2V7M A;  2E9X B;  3CPZ A;  2NW7 A;  4J2C A;  5FXX A;  3P8C D;  3LJC A;  3HKB E;  2JMK A;  1LVF A;  4MAL A;  4X20 E;  4UVB B;  4PAG A;  4L9I A;  3E08 A;  3RX6 A;  3HKC E;  4V1A v;  2K24 A;  2X0L B;  5M4Y A;  2KWH A;  3KVA A;  5JDQ A;  1BR0 A;  3D0T A;  5LYJ E;  2Q9Q C;  4HN9 A;  1ZEE A;  4WBN E;  3PUS A;  4GOU A;  3RRC A;  2Y48 B;  5FY1 A;  2B1E A;  3C4Z A;  2E8I A;  2CXF A;  2JRK A;  3O1H A;  5IYZ E;  2LSK A;  3LFM A;  2HPL A;  4CZZ B;  4FJO A;  3AVR A;  1WYB A;  2DWG A;  4O4L E;  4UEL A;  5LCY A;  2CEA A;  1T98 A;  3JC6 C;  2BVM A;  3N5L A;  3UTK A;  4PFO A;  4QKN A;  4IE6 A;  5AFU L;  3HL6 A;  3KV9 A;  3UUL A;  2MBG A;  3I0O A;  3WI3 A;  3UUX B;  3N2G E;  3ZCI A;  4KUM B;  2SPC A;  4IDZ A;  4PW8 A;  1D0X A;  2KT9 A;  5J1G A;  2WM9 A;  2XAF B;  4PK6 A;  5BMV E;  3EVY A;  2CMR A;  2W62 A;  2LHN A;  4C90 A;  4EAH A;  3GA8 A;  5L3C B;  4PJN A;  4YHJ A;  5JDH A;  3VKH A;  1HF8 A;  2M67 A;  2KND A;  4UIG A;  3K3O A;  3MAC A;  4GYS A;  3RYI E;  3WAJ A;  4OFZ A;  3CX7 B;  5J2U E;  5EK4 A;  5DQV A;  4H9R C;  1Z0P A;  5JR9 B;  4CI3 B;  5JDG A;  2XQY A;  1MIY A;  1MIW A;  4DBQ A;  3LK2 B;  2W0G A;  5FY0 A;  2JPF A;  4OYK A;  1S94 A;  3SWH A;  4G2A A;  4ISS A;  1VOM A;  3B13 A;  4QWN B;  2IAK A;  2LOP A;  3MK7 C;  5HXS A;  1KNZ A;  2UXX B;  4GYR A;  3UUN A;  4X1Y E;  1D1C A;  3BQK A;  2WMO A;  3IEE A;  4PK5 A;  2CXL A;  2JQQ A;  1B7T A;  4QHO A;  3ESL A;  2XAQ B;  5L3G B;  4L5G A;  3C51 A;  2CXD A;  4AQF C;  3UUM A;  5JDF A;  2KWI B;  2QA7 A;  5LOV E;  3AAE B;  2LE8 A;  3H3A A;  5LBQ B;  4ZI7 E;  2CCQ A;  3ZC0 A;  3Q2M A;  4PJJ A;  4I55 E;  5DQW A;  1HCI A;  2DHR A;  2EHO A;  4HTE A;  5JR9 A;  4CQI A;  4X1I E;  5KMG P;  3K8P C;  4HE8 A;  2K5B B;  1HS7 A;  2LJL A;  2C5I T;  4ADZ A;  4EZH A;  2D0U A;  3PDY A;  2W61 A;  4CI2 B;  4DVD A;  3AA6 B;  3BK9 A;  1LKX A;  3RC8 A;  2VKH A;  3ZLI A;  3N2K E;  3H37 A;  2RP4 A;  4PFP A;  1FMV A;  2VK9 A;  2X9X A;  3P7I A;  2XUE A;  3Q9D A;  3WAK A;  1MMG A;  3W15 B;  4P09 A;  4JLE A;  3Q5W A;  3MJX A;  3N9L A;  1O3X A;  1FEW A;  4CXW A;  1Y64 B;  4EOZ B;  5LGT B;  1D1A A;  1BR4 A;  1U5P A;  3ZMV B;  3ZMS B;  2N2N A;  5LJN A;  4EIW A;  5HXC A;  5JVD E;  4HGA A;  3PUA A;  3KV5 A;  3M65 A;  3ZJ1 A;  3NZQ A;  1QUU A;  5ADX L;  1G73 A;  5JR9 C;  2W63 A;  3OYZ A;  4O4H E;  3L3P A;  5JDL A;  4ZOL E;  2LEH A;  3J9X 1;  3KBT A;  3RRW A;  4UVC B;  5FXW A;  2C5K T;  3E0Z A;  2NW8 A;  3FXD B;  3E22 E;  3B57 A;  2VWA A;  3KVB A;  4IHJ E;  4ZI3 C;  4CXY A;  3N9Q A;  3AB3 B;  3HKE E;  2UXN B;  2DI4 A;  3CVR A;  4JUY A;  2K9A A;  4GIW A;  3IBP A;  2L9Q A;  3N9M A;  3O1I A;  3ZYK A;  4HKA A;  4E7S A;  5DJQ C;  5EZY E;  1E1H B;  4UV9 B;  1G8X A;  3KBU A;  4O8S A;  2X66 A;  2Y8D A;  3RH3 A;  3ZN0 B;  3CQX C;  3IHR A;  1MMD A;  3AA1 B;  4TX5 A;  1FIO A;  2KLQ A;  2V7J A;  2WBL A;  1KK7 A;  2A72 A;  2VKJ A;  1HX8 A;  2Q9Q D;  4WBO A;  5LBM A;  2KXP B;  3HI2 A;  4IE4 A;  4H63 H;  3ZMU B;  1S35 A;  2RA1 A;  1UX4 A;  4UF0 B;  3N9N A;  1D1B A;  3ZMT B;  2YU1 A;  4MHC A;  3SS1 A;  4P0A A;  2D2S A;  2BDE A;  5FYM A;  2LSG A;  4Z8X A;  3L09 A;  3MXZ A;  2QGS A;  3AAI A;  2DLR A;  2EHO D;  5FMN A;  3RYH E;  5TAO A;  2LM9 A;  4K0U A;  3JC6 D;  3NZP A;  4QXB B;  2ODV A;  3ZMZ B;  2E9X D;  2NP9 A;  4H9P C;  4ZS2 A;  4DMV A;  4IE5 A;  4OYJ A;  3T8O A;  3RKO A;  4G63 A;  2P9B A;  5HXE A;  4TZ4 C;  1MMA A;  4QX8 B;  2NW9 A;  3FHN A;  3ETU A;  3NRY A;  5C8Y E;  4YLH A;  1LVK A;  4PK4 A;  4AXP A;  2PFV A;  4FI5 A;  4ZI3 D;  3DTO A;  3BQI A;  3AVS A;  5HWY A;  4A56 A;  2W00 A;  3QK6 A;  3HKD E;  2JMH A;  4I50 E;  2LT3 A;  4YJ2 E;  3V5U A;  5CA0 E;  4IE0 A;  1OWA A;  3EDV A;  3GN5 B;  5F8P A;  5FP3 A;  5LXT E;  4PJL A;  3LBX A;  2H7V C;  2DWK A;  4HFV A;  4AKL A;  2XAG B;  4M1P A;  4AQG A;  3SRZ A;  1X79 A;  4ASK A;  3PE0 A;  1H7C A;  1MMN A;  3PU3 A;  4H9Q C;  4MFR A;  5FNV E;  1HTJ F;  5LGN B;  2HPJ A;  3AA0 B;  2EHO C;  4H63 V;  1D0Z A;  2LSJ A;  2CM0 A;  2PBI A;  4TUY E;  1MND A;  1SA0 E;  5FXV A;  3CML A;  1ZHC A;  2CA5 A;  3KIN B;  2DCF A;  2Q9Q B;  5H6R B;  4ZI2 C;  5LA6 E;  5FY7 A;  3N2O A;  4IGU A;  2YU2 A;  4TV8 E;  1HFA A;  2GK9 A;  3R6N A;  2V7K A;  4H9S E;  5DAB A;  2Q9Q A;  4XAX B;  4F6R C;  1UX5 A;  2A2F X;  3CWZ B;  3RC3 A;  4DO0 A;  4GK0 E;  5JDM A;  3K3Q C;  3SOL A;  3DJB A;  4JEU B;  1BR2 A;  2N1G A;  3GMI A;  3N9O A;  4MBQ A;  3PUG A;  4ERR A;  3F31 A;  3EUH A;  1NWM X;  5JH7 E;  3OYX A;  4X1K E;  2X51 A;  4I43 B;  3F2E A;  1WRD A;  1U4Q A;  4O2A E;  5JRE A;  2JJ9 A;  4GK5 E;  3C4X A;  3LBX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...