2CA5A

Mxih needle protein of shigella flexneri (monomeric form, residues 1- 78)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
DDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Model of a Type III Secretion System Needle: Implications for Host-Cell Sensing
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Transport protein
molecule keywords MXIH
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ca5A00
2G0UA 3S4UA 1Z0PA 1H7CA 2CA5A 3P7IA 2X9WA 2KWHA 1IJ6A 4DNDA 4EYYR 3N5LA 2X9XA 3CKDA 1ZKEA 3MXZA 2C5JA 2K48A 2C5IT 1LVFA 2IC6A 4CQIA 3TKLB 3QUJA 3QK6A 2XTLA 4B6XA 2MBGA 1IJ5A 1QSDA 4L0RA 2C5KT 2IC9A 4FI5A 2X9YA 3CVRA 3FXDB 3FXEB 1LRZA 3L3PA 2KWIB 4J2CA
chains in the Genus database with same CATH superfamily
3Q5WA 3ONLC 4QXBB 2M6BA 1YKHB 4PW8A 4X5TA 4X1KE 2YU2A 5AQTB 5C3JA 5JDFA 4KX6A 2Q9QA 4X66T 1IZNB 2L3LA 1E1HB 3PUAA 3UQ4A 1D0XA 3L8RA 5L3EB 1DU2A 5AQJB 2FJBA 1WLXA 2DI4A 2CWYA 3K3OA 1UGOA 4AQFC 2HN2A 4N78D 4LF8T 1IAPA 2C5IT 3DJBA 3C51A 2KMFA 2XQ7A 4PK6A 5HEHA 4ANJA 4EIWA 2UUAT 4L9IA 3PU8A 4UF0B 4ZI2D 4DR4T 2WAUA 2J62A 2YOEA 4L5GA 2YDRA 5L4EA 5HWYA 2BKPA 2DWGA 2DLRA 2CM0A 3V5UA 2V6XA 4IDOA 3VKGA 3V5SA 2NP9A 2IIUA 5AFUL 1W0BA 2LJLA 3B57A 3CWZB 5C2TA 3H3MA 3P7IA 4WNKA 4TWDA 4H9QC 2HPJA 1I6ZA 2WZHA 3KV4A 4HFCA 3FB2A 3ONXA 4LF6T 4GYRA 5CGMA 2WDVA 3EDUA 4YHHT 5LHGB 3IEEA 2VVSA 4AKGA 1JNZA 1UK5A 1FEWA 2VVNA 2WP9A 2XAGB 2YKSA 5LG3A 1W9RA 1NEKA 2XSAA 3MXZA 3N9LA 4HKAA 5JR9A 3AEFA 5CA0E 5L3BB 3LBXA 5L2LA 1NENA 2CCQA 4H9OC 3N9NA 3P4WA 4UXNB 3ETVA 3TKLB 4PNIA 3ZN0B 1YKEB 4HEAA 4JI4T 5JRCB 1MNEA 3PUYF 4DR5T 4TV8E 5LYJE 4HFIA 2LSYA 5FY1A 4Q25A 3CMLA 4ZI7E 3SOLA 4WZXA 4DMWA 2L9QA 4ZS2A 2PBIA 3CVRA 5AQMB 4WBNE 2KWHA 3FZHB 3NZQA 2X0LB 1KFYA 2CEAA 2FJDA 4AXPA 1XWMA 2WU5A 3CK6A 2WMOA 5F8PA 5HXRA 4A97A 2ACXA 2WDQA 5L47A 3UQ7A 2BVLA 5BR8T 2WQYA 2ODVA 2Q9QC 2VKOA 4KP3C 3N2GE 3TLUA 2X9WA 3ZSSA 4BA9A 5LGTB 3NWIA 4LFCT 3B13A 4O4LE 3VRBA 4ZHQE 4IIJE 4DBQA 2UXDT 4LMLA 4U2YA 1ZKEA 2CHNA 3P4PA 3JC6C 4HFVA 3KBUA 5HYAA 4DV0T 1QLBA 3AVSA 4MFRA 3RC3A 2HH7A 3WAKA 5LGUB 1ZOYA 2EHOC 3JADA 1IBLT 3CQXC 4EV6A 3TLWA 3EVYA 2X0HA 4DV5T 4NUUA 2LSJA 4IE5A 3AE5A 1ZV4X 4CXWA 4X64T 1N34T 2OA5A 1YXRA 3PURA 2XUEA 2V7IA 1T72A 3FBZA 1G8XA 3AE6A 3ETUA 3T8OA 1D0ZA 2DNXA 3FXDB 3FXEB 4YLHA 5EK2A 5ADXL 2NW8A 5FMNA 3LSVA 5A1LA 2LEHA 3HR0A 2CMRA 1WYBA 2IMLA 3CPZA 2G0UA 3MACA 2QVAA 4G2AA 2D5UA 5LBMA 5ABGA 4I43B 4QH5A 2WDRA 4IGUA 2E9XA 1WRDA 3P4SA 2ZLYA 4K0KT 3RQUA 3ZEFB 1LVKA 3OYXA 3RRWA 2ZM8A 5AQQB 3N5LA 3DP7A 4U7YA 3DTOA 3UULA 4CN4A 3E0ZA 2K5BB 4EZHA 2XQAA 2BG9E 3HI2A 5LJNA 2UXXB 4I0UA 4JI8T 2NWBA 1N32T 3ABVA 4EGWA 5ABFB 3ZT7A 2BBJA 4CN6A 5JR9B 1UURA 5LG4A 2RPAA 2AXDS 3I9YA 5AQOB 4JI6T 2UXCT 2XM1A 3SS1A 4GKKT 4ZEYA 2W2UA 4WYVA 1HF8A 2CXDA 5LOVE 3AECA 4B3TT 3D0TA 5EK4A 4C91A 5AQLB 2DWKA 2VKDA 4M1PA 3VU7H 3ZCIA 4JI0T 2A9UA 2JMKA 4LF5T 2RP4A 5HAXA 2W67A 3ZCJA 1OEDA 3I0OA 4DV3T 2DL1A 1LKXA 2LOSA 3E08A 2FJEA 3C50A 3BQKA 1Y01A 5EZYE 3UUMA 4XZCA 3LG7A 4QX7B 5GONE 4AQGA 2V5CA 5J2UE 4IE7A 1XDPA 4YXDA 2BZBA 3TLTA 2B1EA 3PJAA 3CIRA 2UXNB 2MAWA 5DJQC 2LOPA 2K48A 1HTJF 2J47A 3MZKB 4QHOA 4U31A 4COFA 1AJ3A 2D9DA 4ILBA 4CQIA 1I94T 4AKIA 4ADZA 5LMNT 3AE4A 3O1IA 2NTYA 3O1JA 4K0UA 3ZYLA 2YN6A 1W0AA 1V9DA 2K24A 3AEEA 2FUPA 3PDYA 4QKNA 4QWNB 1Y64B 3LK3B 3C4XA 2R6GF 4EEBA 5J0ZA 2VQET 2LT3A 2XQYA 3GMIA 5ABFA 1GQEA 2V1DB 2V7MA 3EAMA 1Z8UA 1MMDA 1X9BA 5AQHB 5LGNB 3IA3A 5JR9C 2E5LT 2XZEA 1ZEEA 4CZZB 3ZJ2A 4X1IE 5JDMA 4A98A 1M62A 3KV9A 5FKYA 4GOUA 3IBPA 2D2SA 5HCMA 4LFAT 2WZIA 4ILCA 5HXEA 3AA0B 1XDOA 2VL8A 4U33A 3O4XE 5HXCA 5LCYA 3U3IA 4GYSA 3HKEE 3ZMTB 2KZ7B 2X9XA 4EXTA 3AE1A 3ANWA 3N2KE 3OPCA 4H9RC 2DHRA 3PUVF 3UFEA 5FL0A 4ASKA 3KV5A 3HKBE 1BR4A 2ZMAA 4TUYE 5HXHA 2K3WA 4TNVA 2JQ9A 2LE8A 3QOFA 2BKOA 3JAFA 5M4YA 2FJAA 2SPCA 3UTKA 4LF7T 4DV2T 3OTOT 4AKRB 1WR0A 2P9BA 5LP6E 5KMGP 3IF8B 2JRKA 2JQHA 2W62A 4UIGA 4YHJA 4HWFA 2UU9T 2Y8DA 3KV6A 2HHHT 2IUBA 3QB5A 4HWCA 5FXWA 3UT5E 4DIDB 4F8HA 4CI1B 2KWIB 3RYHE 3TLVA 2XAJB 3ZN1B 4BJNA 3G06A 4LF4T 2JIWA 1KEYA 3MA9A 3JC6D 1FIOA 4MLKA 4YJ3E 3F2EA 2BDEA 3AEGA 4HWHA 4U3CA 5F3JA 4DV7T 4H9SE 3AA7B 2Q9QB 4JBWF 1BR1A 1MMAA 4MHCA 3OKQA 4HFHA 1VRBA 3RYCE 1MIVA 1XNQT 3ZMZB 4YTNA 2D0TA 2KNDA 5LHIB 2J4GA 4MBQA 3ZT6A 3QK6A 2XTLA 5DQWA 5J1GA 3P4RA 4IHJE 4JI2T 4HFEA 2MBGA 2GK9A 2JQQA 3MK7C 4LFBT 3F57A 3FBLA 3WI3A 2K9AA 5BMVE 4PJJA 5JQGE 4QXHB 5JRCA 3VHLA 3PUSA 4ZOLE 4PJNA 4O2AE 4KUMB 2YU1A 4FI5A 3AE7A 2X9YA 4P09A 3RGLA 3A8YC 3SFEA 4CXYA 4P0AA 1IBMT 3VKHA 1KK7A 1VCSA 1WFDA 4NPPA 2X0YA 4GK5E 5HXSA 1WR6A 2QGSA 2E9XD 5DQVA 1OEDE 3K3NA 3LDQB 4JI7T 2X66A 2VKHA 3AE8A 3N9OA 3OJAA 3KFWX 2N1GA 4JV5T 1ZP0A 5JDGA 2D0UA 5FXZA 1KF6A 2L8KA 3KVBA 4P0BA 2C5JA 4I4TE 4ZS3A 2VWAA 3PU3A 3QNUA 3EUHA 3L09A 3I0QA 4U74A 4EB6E 4AQYT 4F6RC 2MYSA 3CX8B 4KI0F 3H37A 4Z91A 5HEOA 5FL1A 2WY2A 2ZM0A 1UUSA 4TWHA 5HWXA 4ISSA 2VKJA 3PUXF 2HPLA 2LKGA 2N9DA 3PUQA 3RRCA 5ETWA 4IDNA 2XAHB 3LK42 1FMWA 1FMVA 3OVUA 2XHEB 4P1NA 3SFDA 2ZM6T 2H88A 2ES0A 1OWAA 4JI1T 3UU4A 4KBMB 5EK3A 1G73A 5JVDE 3C4ZA 2V5DA 2IDOB 3EHZA 4ILAA 3VR9A 3PTRB 4EEDA 3UU3A 2H3RA 2YINA 2AE9A 3ZKRA 2CPTA 4DNDA 2UUCT 3NRYA 2NR4A 2BG9C 1D1BA 2NW7A 5H6RB 2X9HA 1D1AA 3UFGA 2WS3A 2W63A 1KNPA 5LMUT 5KXJA 3FHNA 2JMHA 3PJAJ 3AA1B 3AAEB 5C8YE 4O4HE 4PK5A 4JLEA 3JAEA 2KINB 2BS4A 2XQ9A 5AQNB 3HKCE 1N33T 2JQKA 3Q2MA 2W66A 4OK0A 4JEHB 5FP3A 4GKJT 1YD8G 3AEAA 4BJMA 3ZYMA 3RYIE 1N36T 1OEDB 4O4JE 4YT0A 4KHZF 5LBQB 4ZI3D 4CN1A 4ZXLA 4PJLA 3ZSTA 3S4UA 3FZFB 3TLSA 1Z0PA 3WAJA 2F4VT 2CA5A 2XJ7A 1BR2A 3ANWB 3HL6A 3A7MA 4O2BE 5AQKB 3EI0A 4PJMA 4OX9T 4AI6A 3PUZF 4C90A 4YY3T 2UXBT 5JDHA 3L39A 5E0OA 3RKGA 4WW0A 2YK0A 2BS3A 4QXCB 3B5MA 3ZPOA 1NAFA 4IDZA 3ZT5A 4UVCB 1HNZT 2W4XA 2VL0A 1OEDC 3AA6B 3AAAB 3BQLA 1MIWA 2XY8B 4PFOA 2NTXA 5IHYA 3VR8A 3EABA 4V1Av 4IE6A 5FVKA 5ABEA 3N2OA 5LB7B 4YSXA 4HE8A 4JYAT 2CBJA 2WM9A 4DV4T 2E2AA 3AAIA 3P8CD 1WCRA 3HA4A 1HX8A 1LRZA 2CXLA 2W00A 3KVAA 3LJCA 5FNVE 3GN5B 3U78A 3GN5A 2V6YB 4B3MT 5HCJA 4HTEA 3Q5DA 3MJXA 5FY7A 2XQ6A 4IDPA 3RPUA 3T1HT 2CXFA 1T7SA 1HX1B 4X62T 4DBRA 4X1YE 4PK4A 2BVMA 2QA7A 3SRZA 4UF0A 4EZ4A 5AQRB 3LBXB 4TN7B 4U72A 4H63H 4YTMA 5F5WA 3Q5EA 1X79A 4A5XA 2MPKA 2X68A 5DABA 4BAYB 3PUWF 4HGAA 3RQWA 2VB6A 3UU5A 5AQFB 5IWAT 5L3FB 1UX4A 1SE7A 3MKDA 5FVLA 4YSZA 5CB4E 5ABHA 5IYZE 3ZLIA 3RF1A 2YDSA 2NW9A 5FXVA 1QSDA 2XQ5A 5JDLA 1HG5A 4DV1T 1HNXT 2LHRA 2Q9QD 2VASA 2Y48B 3CX7B 4U7IA 2WU2A 3O1HA 4ZZCA 2WMNA 4QH1A 4DO0A 3J7Yq 3W15B 2LM2A 4HWDA 4E7SA 4FJOA 3RI5A 3VRAA 4DR1T 4G63A 1E7PA 1YQ3A 4IE4A 2EHOB 3Q5XA 4ILUA 4IE0A 2XM2A 2XAFB 3LFMA 5HEJA 4QH4A 2V7JA 1IJ6A 2M6IA 4LMKA 1T8BA 3K3QC 3ONJA 4YFSA 2V7LA 5FY0A 3UUNA 5CFBA 4DUZT 3JCFA 2VURA 4KMCA 4AKHA 2WB5A 5HEUA 2V8SV 5L3DB 2IAKA 1KNRA 1JNRA 3NRXA 2CWOA 3RLFF 4UVAB 3GA8A 2IW5B 4DR3T 2PJQA 4OYJA 5AQPB 1XNRT 2ZM2A 3QUJA 2H7VC 2KSRA 3H3AA 2YDQA 2CE7A 2E8IA 4YTPA 4ERRA 3CX6B 2I59A 3J9X1 3M65A 4JUYA 2V26A 1T98A 2ODUA 2XASB 2I6HA 4H9PC 3E22E 3ZMVB 1XMQT 2E9XC 1MMNA 1U5PA 4NXNT 1HCIA 3C98B 1S94A 2J1DG 5AQSB 1FJGT 4DR6T 4L0RA 2WSSV 2QRXA 1SHZC 1VOMA 2X67A 2HN1A 3UU8A 4DVDA 3AXJA 3OYZA 5L3CB 3FZLB 2H7OA 2I0MA 2W61A 3OBVE 4GK0E 4WBOA 4Z8XA 4EAHA 2N2NA 2XQ4A 4IL4A 5AQIB 1R8IA 1J1JA 4CI3B 4OHFA 4TWFA 1S35A 3P4QA 4IL9A 2VK9A 1CHUA 4KHPT 2KT9A 5JDNA 1LVFA 4PAGA 4UEMA 4CXXA 3C4WA 3K8PC 2KXPB 2Y6XA 2C0SA 3AE3A 2DCFA 3Q9DA 2FBWA 5LA6E 1IJ5A 3R84B 3QC9A 5KDMC 5FYMA 1CUNA 2JJ9A 3PE0A 2A2FX 3AEBA 3RHWA 1NWMX 3ZMSB 5H6QB 3ZC0A 3BK9A 3R6NA 3RIUA 1MMGA 5L3GB 2XQ3A 4MALA 4TNWA 3RYFE 2PG8A 4NXMT 3AE9A 4EYYR 4JI3T 4EYUA 2WBLA 1BR0A 4LF9T 4JI5T 1XMOT 2OV9A 3IHRA 4HFDA 3I9WA 5HEGA 5TAOA 3T1YT 2PTFA 3AB3B 5LXTE 4UV8B 5JREA 5LJMA 4DUYT 2E9XB 4O8SA 1M7KA 4Z90A 1US7B 1EZ3A 1QUUA 2LM9A 2LRKA 1ZHCA 2NOXA 3AXJB 3K1SA 4IDQA 4E7ZA 1W09A 2M67A 1UX5A 1U4QA 3P50A 5LHHB 4B3ST 2ACZA 1HFAA 2LSGA 2WWUA 2EHOD 4NUVA 4UVBB 2A3DA 3RX6A 4ZZBA 3N9PA 3RIAA 1HG2A 5IUXA 4AIUA 4PFPA 2CLYC 1VCTA 3PV0F 1J5ET 4HN9A 2XPKA 3EDVA 4IREA 3N9QA 4TV9E 4GIWA 4H63V 2BBHA 3UU6A 2BS2A 2IC9A 2CLYB 4CI2B 4DR7T 3X1DA 2IHR1 4XBFB 1HR0T 4ZI3C 4J2CA 2BG9A 3NKZA 2V6YA 3RC8A 4JEUB 5L4HA 5AQUB 2CBIA 4X20E 2VQFT 2MOZA 3KBTA 2XAQB 3C64A 2H89A 3NBXX 1J5WA 4HFBA 1E2AA 2W0GA 1SUMB 2E5VA 3QB5K 4OFZA 1HNWT 3ZMUB 5JH7E 2CHOA 1SA0E 2MTQA 2KLQA 3NVOA 3RIFA 4AISA 4A56A 1HS7A 3F31A 3BQIA 5FXXA 4UR9A 2V7KA 4LMJA 2IC6A 4DV6T 3UUXB 1B7TA 4B6XA 5JDQA 3LK2B 5KX5E 2YEVC 3UUBA 3ESLA 3HKDE 3AEDA 3RH3A 3GWHA 3ZYKA 3CQGB 2LSKA 2LLYA 3ZJ1A 1XZYA 4AKLA 2PFVA 3I1AA 4U2ZA 4O4IE 2LKHA 4I50E 3L3PA 3AVRA 5AQVB 4YJ2E 1OXZA 2JPFA 1MIYA 3FZKB 3RIUC 3NZPA 3ZC1A 4EOZB 2BG9B 3KDSE 5CA1E 3O9XA 2RA1A 4IT4A 2LSIA 1H7CA 2LHNA 2Z6EA 4UV9B 4X65T 3SWHA 1MNDA 3CKDA 2QYWA 4OYKA 2A72A 2OLTA 1D1CA 2CRBA 2XQ8A 3FZMB 3N9MA 5AQGB 1YQ4A 2WCAA 3KINB 4ZI2C 1KNZA 2WWVA 1D0YA 2LRLA 4I55E 1O3XA 3A5XA 3CQCB 3AE2A 2B76A 4ISTA 5JTGA 2X51A 4XAXB 4AQFA 1IBKT 5LNKA 5CJ5A 2UUBT 2BKNA 2C5KT 4TX5A 1WYCA 3M3ZB 4DR2T 2XSBA 2EHOA 4H9NC 4HWIB 1YW0A 4DMVA 1L0VA 4YSYA 3PUGA 5J2TE 3RKOA 4B3RT 4UELA 4NIQA 1UCUA 4TZ4C 4QX8B
chains in the Genus database with same CATH topology
3Q5WA 4QXBB 1YKHB 4PW8A 4X1KE 2YU2A 5JDFA 2Q9QA 1IZNB 2L3LA 1E1HB 3PUAA 5L3EB 1D0XA 1WLXA 2DI4A 2CWYA 3K3OA 4AQFC 4N78D 1IAPA 2C5IT 3DJBA 3C51A 2KMFA 4PK6A 4ANJA 4EIWA 4L9IA 3PU8A 4UF0B 4ZI2D 2WAUA 4L5GA 5HWYA 2DWGA 2DLRA 2CM0A 3V5UA 3VKGA 3V5SA 2NP9A 5AFUL 2LJLA 3B57A 3CWZB 3P7IA 4WNKA 4H9QC 2HPJA 3KV4A 3FB2A 3ONXA 4GYRA 3EDUA 5LHGB 3IEEA 2XAGB 1FEWA 3MXZA 3N9LA 4HKAA 5JR9A 5CA0E 5L3BB 3LBXA 5L2LA 2CCQA 4H9OC 3N9NA 3TKLB 4UXNB 3ETVA 3ZN0B 4PNIA 1YKEB 4HEAA 5JRCB 1MNEA 4TV8E 5LYJE 2LSYA 5FY1A 3CMLA 4ZI7E 3SOLA 4DMWA 2L9QA 4ZS2A 2PBIA 3CVRA 4WBNE 2KWHA 3NZQA 2X0LB 2CEAA 4AXPA 5HXRA 5F8PA 2WMOA 2ACXA 2BVLA 4KP3C 2ODVA 2Q9QC 2VKOA 3N2GE 4BA9A 2X9WA 3B13A 4O4LE 4ZHQE 4IIJE 4DBQA 1ZKEA 4HFVA 3JC6C 3KBUA 5HYAA 3AVSA 4MFRA 3RC3A 2HH7A 3WAKA 5LGUB 2EHOC 3CQXC 3EVYA 4NUUA 2LSJA 4IE5A 4CXWA 1ZV4X 2OA5A 3PURA 2XUEA 2V7IA 3FBZA 1G8XA 3T8OA 3ETUA 1D0ZA 2DNXA 3FXDB 3FXEB 4YLHA 5EK2A 5ADXL 2NW8A 5FMNA 5A1LA 2LEHA 3HR0A 2CMRA 1WYBA 3CPZA 3MACA 2G0UA 4G2AA 4HGAA 5LBMA 2D5UA 4I43B 4IGUA 2E9XA 1WRDA 2ZLYA 3ZEFB 1LVKA 3OYXA 3RRWA 2ZM8A 3UULA 3N5LA 3DP7A 3DTOA 3E0ZA 2K5BB 4EZHA 5LJNA 3HI2A 2UXXB 2NWBA 5JR9B 5LG4A 3I9YA 3SS1A 5LOVE 1HF8A 2CXDA 3D0TA 5EK4A 4C91A 2DWKA 2VKDA 4M1PA 3VU7H 3ZCIA 2JMKA 2RP4A 5HAXA 3ZCJA 3I0OA 1LKXA 2LOSA 3E08A 3C50A 3BQKA 5EZYE 3UUMA 4XZCA 3LG7A 4QX7B 5GONE 4AQGA 5J2UE 4IE7A 2BZBA 2B1EA 2UXNB 5DJQC 2LOPA 2K48A 1HTJF 3MZKB 4QHOA 1AJ3A 4CQIA 4AKIA 4ADZA 3O1IA 2NTYA 3O1JA 4K0UA 3ZYLA 4QWNB 5JDHA 1V9DA 2K24A 3PDYA 4QKNA 1Y64B 3LK3B 3C4XA 2LT3A 2XQYA 3GMIA 2V1DB 2V7MA 5LGNB 1MMDA 5JR9C 1ZEEA 4CZZB 3ZJ2A 4X1IE 5JDMA 3KV9A 4GOUA 3IBPA 2D2SA 5HXEA 3AA0B 2VL8A 5HXCA 3O4XE 5LCYA 3U3IA 4GYSA 3HKEE 3ZMTB 2KZ7B 2X9XA 4EXTA 3ANWA 3N2KE 4H9RC 2DHRA 3UFEA 4ASKA 3KV5A 3HKBE 1BR4A 2ZMAA 4TUYE 5HXHA 5M4YA 2LE8A 2SPCA 3UTKA 4AKRB 2P9BA 5LP6E 5KMGP 3IF8B 2JRKA 2W62A 4YHJA 4UIGA 2Y8DA 3KV6A 4CI1B 5FXWA 3UT5E 4AKGA 2KWIB 4BJNA 2XAJB 3ZN1B 3MA9A 3JC6D 1FIOA 4MLKA 4YJ3E 3F2EA 2BDEA 5F3JA 4H9SE 3AA7B 2Q9QB 1BR1A 1MMAA 4MHCA 3OKQA 3RYCE 1VRBA 1MIVA 3ZMZB 2D0TA 2KNDA 5LHIB 4MBQA 3QK6A 2XTLA 5DQWA 5J1GA 4IHJE 2MBGA 2GK9A 2JQQA 3MK7C 3F57A 3FBLA 3WI3A 2K9AA 5BMVE 4PJJA 5JQGE 4QXHB 5JRCA 3VHLA 3PUSA 4ZOLE 4PJNA 4O2AE 4KUMB 2YU1A 4FI5A 4P09A 2X9YA 4P0AA 3VKHA 1KK7A 4GK5E 5HXSA 1WR6A 2QGSA 2E9XD 5DQVA 3K3NA 2X66A 2VKHA 3N9OA 3OJAA 3KFWX 2N1GA 5JDGA 2D0UA 5FXZA 2L8KA 3KVBA 4P0BA 2C5JA 4I4TE 4ZS3A 2VWAA 3PU3A 3EUHA 3L09A 3I0QA 4U74A 4EB6E 4F6RC 2MYSA 3CX8B 3H37A 2ZM0A 5HWXA 4ISSA 2VKJA 2HPLA 2N9DA 3PUQA 3RRCA 5ETWA 2XAHB 3LK42 1FMWA 1FMVA 2XHEB 2ES0A 1OWAA 4KBMB 5EK3A 1G73A 5JVDE 3C4ZA 3PTRB 2H3RA 2YINA 4DNDA 3NRYA 2NW7A 1D1BA 5H6RB 2X9HA 1D1AA 2W63A 3FHNA 2JMHA 3AA1B 3AAEB 5C8YE 4O4HE 4PK5A 4JLEA 2KINB 3HKCE 3Q2MA 4OK0A 4JEHB 5FP3A 1YD8G 4BJMA 3ZYMA 3RYIE 4O4JE 5LBQB 4ZI3D 4PJLA 3WAJA 3S4UA 1Z0PA 2CA5A 3ANWB 1BR2A 3HL6A 4O2BE 4PJMA 4AI6A 4C90A 5E0OA 4WW0A 2YK0A 4QXCB 3ZPOA 1NAFA 4IDZA 4UVCB 5IHYA 3AA6B 3AAAB 4PFOA 3BQLA 1MIWA 3RYHE 2NTXA 4V1Av 4IE6A 3N2OA 4HE8A 2WM9A 3AAIA 3P8CD 3HA4A 3KVAA 1HX8A 1LRZA 2CXLA 2W00A 3LJCA 5FNVE 3GN5B 3U78A 3GN5A 4HTEA 5FY7A 3MJXA 3RPUA 2CXFA 4DBRA 4X1YE 4PK4A 2BVMA 2QA7A 3SRZA 4UF0A 4EZ4A 3LBXB 4TN7B 4U72A 4H63H 1X79A 2X68A 5DABA 4BAYB 2VB6A 5L3FB 1UX4A 5LGTB 3MKDA 5CB4E 5IYZE 3ZLIA 5JDLA 2NW9A 5FXVA 1QSDA 1HG5A 2LHRA 2Q9QD 2VASA 2Y48B 3CX7B 3O1HA 2WMNA 4DO0A 3J7Yq 3W15B 4E7SA 4FJOA 4G63A 4IE4A 2EHOB 3Q5XA 4ILUA 4IE0A 2XAFB 3LFMA 2V7JA 1IJ6A 4YFSA 3K3QC 2V7LA 5FY0A 3UUNA 4AKHA 4KMCA 5L3DB 2IAKA 3NRXA 2CWOA 4UVAB 3GA8A 2IW5B 2PJQA 4OYJA 2ZM2A 3QUJA 2H7VC 3H3AA 2CE7A 2E8IA 4ERRA 3CX6B 2I59A 3J9X1 3M65A 4JUYA 2V26A 1T98A 2ODUA 2XASB 4H9PC 3E22E 3ZMVB 2E9XC 1MMNA 1U5PA 1HCIA 3C98B 1S94A 2J1DG 4L0RA 2X67A 2WSSV 1SHZC 1VOMA 4DVDA 3OYZA 5L3CB 2H7OA 2W61A 3OBVE 4GK0E 4WBOA 4Z8XA 4EAHA 3ZC0A 2N2NA 4CI3B 4OHFA 1S35A 2VK9A 2KT9A 5JDNA 1LVFA 4PAGA 4UEMA 4CXXA 3C4WA 3K8PC 2KXPB 2Y6XA 2C0SA 3R84B 2DCFA 3Q9DA 5LA6E 1IJ5A 3QC9A 5KDMC 5FYMA 1CUNA 2JJ9A 3PE0A 2A2FX 3ZMSB 1NWMX 5H6QB 3BK9A 3R6NA 1MMGA 5L3GB 4MALA 3RYFE 2PG8A 4EYUA 2WBLA 1BR0A 3IHRA 5TAOA 3I9WA 3AB3B 5LXTE 4UV8B 5JREA 5LJMA 2E9XB 4O8SA 1US7B 1EZ3A 1QUUA 2LM9A 4EYYR 1ZHCA 2NOXA 4E7ZA 2M67A 1UX5A 1U4QA 5LHHB 1HFAA 2LSGA 2WWUA 2EHOD 4NUVA 4UVBB 2A3DA 3RX6A 3N9PA 1HG2A 4PFPA 2CLYC 4HN9A 3EDVA 3N9QA 4TV9E 4GIWA 4H63V 4CI2B 4CXYA 2IC9A 2CLYB 4XBFB 4ZI3C 4J2CA 3RC8A 4JEUB 4X20E 2MOZA 3KBTA 2XAQB 3C64A 3NBXX 2W0GA 4OFZA 3ZMUB 5JH7E 1SA0E 2MTQA 2KLQA 4A56A 1HS7A 3F31A 3BQIA 5FXXA 2V7KA 2IC6A 3UUXB 1B7TA 4B6XA 5JDQA 3LK2B 5KX5E 2YEVC 3ESLA 3HKDE 3RH3A 3ZYKA 3GWHA 3CQGB 2LSKA 3ZJ1A 4AKLA 2PFVA 3I1AA 4O4IE 4I50E 3L3PA 3AVRA 4YJ2E 1OXZA 1MIYA 2JPFA 3ZC1A 4EOZB 3NZPA 3O9XA 3KDSE 5CA1E 2RA1A 2LSIA 1H7CA 2LHNA 2Z6EA 4UV9B 3SWHA 1MNDA 3CKDA 4OYKA 5LNKA 2A72A 1D1CA 3N9MA 1KNZA 3KINB 4ZI2C 1D0YA 4I55E 1O3XA 3A5XA 3CQCB 4ISTA 2X51A 4XAXB 4AQFA 2C5KT 4TX5A 1WYCA 4H9NC 2EHOA 1YW0A 4DMVA 3PUGA 5J2TE 3RKOA 4UELA 1UCUA 4TZ4C 4QX8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0U A;  3S4U A;  1Z0P A;  1H7C A;  2CA5 A;  3P7I A;  2X9W A;  2KWH A;  1IJ6 A;  4DND A;  4EYY R;  3N5L A;  2X9X A;  3CKD A;  1ZKE A;  3MXZ A;  2C5J A;  2K48 A;  2C5I T;  1LVF A;  2IC6 A;  4CQI A;  3TKL B;  3QUJ A;  3QK6 A;  2XTL A;  4B6X A;  2MBG A;  1IJ5 A;  1QSD A;  4L0R A;  2C5K T;  2IC9 A;  4FI5 A;  2X9Y A;  3CVR A;  3FXD B;  3FXE B;  1LRZ A;  3L3P A;  2KWI B;  4J2C A; 
#chains in the Genus database with same CATH topology
 3Q5W A;  3ONL C;  4QXB B;  2M6B A;  1YKH B;  4PW8 A;  4X5T A;  4X1K E;  2YU2 A;  5AQT B;  5C3J A;  5JDF A;  4KX6 A;  2Q9Q A;  4X66 T;  1IZN B;  2L3L A;  1E1H B;  3PUA A;  3UQ4 A;  1D0X A;  3L8R A;  5L3E B;  1DU2 A;  5AQJ B;  2FJB A;  1WLX A;  2DI4 A;  2CWY A;  3K3O A;  1UGO A;  4AQF C;  2HN2 A;  4N78 D;  4LF8 T;  1IAP A;  2C5I T;  3DJB A;  3C51 A;  2KMF A;  2XQ7 A;  4PK6 A;  5HEH A;  4ANJ A;  4EIW A;  2UUA T;  4L9I A;  3PU8 A;  4UF0 B;  4ZI2 D;  4DR4 T;  2WAU A;  2J62 A;  2YOE A;  4L5G A;  2YDR A;  5L4E A;  5HWY A;  2BKP A;  2DWG A;  2DLR A;  2CM0 A;  3V5U A;  2V6X A;  4IDO A;  3VKG A;  3V5S A;  2NP9 A;  2IIU A;  5AFU L;  1W0B A;  2LJL A;  3B57 A;  3CWZ B;  5C2T A;  3H3M A;  3P7I A;  4WNK A;  4TWD A;  4H9Q C;  2HPJ A;  1I6Z A;  2WZH A;  3KV4 A;  4HFC A;  3FB2 A;  3ONX A;  4LF6 T;  4GYR A;  5CGM A;  2WDV A;  3EDU A;  4YHH T;  5LHG B;  3IEE A;  2VVS A;  4AKG A;  1JNZ A;  1UK5 A;  1FEW A;  2VVN A;  2WP9 A;  2XAG B;  2YKS A;  5LG3 A;  1W9R A;  1NEK A;  2XSA A;  3MXZ A;  3N9L A;  4HKA A;  5JR9 A;  3AEF A;  5CA0 E;  5L3B B;  3LBX A;  5L2L A;  1NEN A;  2CCQ A;  4H9O C;  3N9N A;  3P4W A;  4UXN B;  3ETV A;  3TKL B;  4PNI A;  3ZN0 B;  1YKE B;  4HEA A;  4JI4 T;  5JRC B;  1MNE A;  3PUY F;  4DR5 T;  4TV8 E;  5LYJ E;  4HFI A;  2LSY A;  5FY1 A;  4Q25 A;  3CML A;  4ZI7 E;  3SOL A;  4WZX A;  4DMW A;  2L9Q A;  4ZS2 A;  2PBI A;  3CVR A;  5AQM B;  4WBN E;  2KWH A;  3FZH B;  3NZQ A;  2X0L B;  1KFY A;  2CEA A;  2FJD A;  4AXP A;  1XWM A;  2WU5 A;  3CK6 A;  2WMO A;  5F8P A;  5HXR A;  4A97 A;  2ACX A;  2WDQ A;  5L47 A;  3UQ7 A;  2BVL A;  5BR8 T;  2WQY A;  2ODV A;  2Q9Q C;  2VKO A;  4KP3 C;  3N2G E;  3TLU A;  2X9W A;  3ZSS A;  4BA9 A;  5LGT B;  3NWI A;  4LFC T;  3B13 A;  4O4L E;  3VRB A;  4ZHQ E;  4IIJ E;  4DBQ A;  2UXD T;  4LML A;  4U2Y A;  1ZKE A;  2CHN A;  3P4P A;  3JC6 C;  4HFV A;  3KBU A;  5HYA A;  4DV0 T;  1QLB A;  3AVS A;  4MFR A;  3RC3 A;  2HH7 A;  3WAK A;  5LGU B;  1ZOY A;  2EHO C;  3JAD A;  1IBL T;  3CQX C;  4EV6 A;  3TLW A;  3EVY A;  2X0H A;  4DV5 T;  4NUU A;  2LSJ A;  4IE5 A;  3AE5 A;  1ZV4 X;  4CXW A;  4X64 T;  1N34 T;  2OA5 A;  1YXR A;  3PUR A;  2XUE A;  2V7I A;  1T72 A;  3FBZ A;  1G8X A;  3AE6 A;  3ETU A;  3T8O A;  1D0Z A;  2DNX A;  3FXD B;  3FXE B;  4YLH A;  5EK2 A;  5ADX L;  2NW8 A;  5FMN A;  3LSV A;  5A1L A;  2LEH A;  3HR0 A;  2CMR A;  1WYB A;  2IML A;  3CPZ A;  2G0U A;  3MAC A;  2QVA A;  4G2A A;  2D5U A;  5LBM A;  5ABG A;  4I43 B;  4QH5 A;  2WDR A;  4IGU A;  2E9X A;  1WRD A;  3P4S A;  2ZLY A;  4K0K T;  3RQU A;  3ZEF B;  1LVK A;  3OYX A;  3RRW A;  2ZM8 A;  5AQQ B;  3N5L A;  3DP7 A;  4U7Y A;  3DTO A;  3UUL A;  4CN4 A;  3E0Z A;  2K5B B;  4EZH A;  2XQA A;  2BG9 E;  3HI2 A;  5LJN A;  2UXX B;  4I0U A;  4JI8 T;  2NWB A;  1N32 T;  3ABV A;  4EGW A;  5ABF B;  3ZT7 A;  2BBJ A;  4CN6 A;  5JR9 B;  1UUR A;  5LG4 A;  2RPA A;  2AXD S;  3I9Y A;  5AQO B;  4JI6 T;  2UXC T;  2XM1 A;  3SS1 A;  4GKK T;  4ZEY A;  2W2U A;  4WYV A;  1HF8 A;  2CXD A;  5LOV E;  3AEC A;  4B3T T;  3D0T A;  5EK4 A;  4C91 A;  5AQL B;  2DWK A;  2VKD A;  4M1P A;  3VU7 H;  3ZCI A;  4JI0 T;  2A9U A;  2JMK A;  4LF5 T;  2RP4 A;  5HAX A;  2W67 A;  3ZCJ A;  1OED A;  3I0O A;  4DV3 T;  2DL1 A;  1LKX A;  2LOS A;  3E08 A;  2FJE A;  3C50 A;  3BQK A;  1Y01 A;  5EZY E;  3UUM A;  4XZC A;  3LG7 A;  4QX7 B;  5GON E;  4AQG A;  2V5C A;  5J2U E;  4IE7 A;  1XDP A;  4YXD A;  2BZB A;  3TLT A;  2B1E A;  3PJA A;  3CIR A;  2UXN B;  2MAW A;  5DJQ C;  2LOP A;  2K48 A;  1HTJ F;  2J47 A;  3MZK B;  4QHO A;  4U31 A;  4COF A;  1AJ3 A;  2D9D A;  4ILB A;  4CQI A;  1I94 T;  4AKI A;  4ADZ A;  5LMN T;  3AE4 A;  3O1I A;  2NTY A;  3O1J A;  4K0U A;  3ZYL A;  2YN6 A;  1W0A A;  1V9D A;  2K24 A;  3AEE A;  2FUP A;  3PDY A;  4QKN A;  4QWN B;  1Y64 B;  3LK3 B;  3C4X A;  2R6G F;  4EEB A;  5J0Z A;  2VQE T;  2LT3 A;  2XQY A;  3GMI A;  5ABF A;  1GQE A;  2V1D B;  2V7M A;  3EAM A;  1Z8U A;  1MMD A;  1X9B A;  5AQH B;  5LGN B;  3IA3 A;  5JR9 C;  2E5L T;  2XZE A;  1ZEE A;  4CZZ B;  3ZJ2 A;  4X1I E;  5JDM A;  4A98 A;  1M62 A;  3KV9 A;  5FKY A;  4GOU A;  3IBP A;  2D2S A;  5HCM A;  4LFA T;  2WZI A;  4ILC A;  5HXE A;  3AA0 B;  1XDO A;  2VL8 A;  4U33 A;  3O4X E;  5HXC A;  5LCY A;  3U3I A;  4GYS A;  3HKE E;  3ZMT B;  2KZ7 B;  2X9X A;  4EXT A;  3AE1 A;  3ANW A;  3N2K E;  3OPC A;  4H9R C;  2DHR A;  3PUV F;  3UFE A;  5FL0 A;  4ASK A;  3KV5 A;  3HKB E;  1BR4 A;  2ZMA A;  4TUY E;  5HXH A;  2K3W A;  4TNV A;  2JQ9 A;  2LE8 A;  3QOF A;  2BKO A;  3JAF A;  5M4Y A;  2FJA A;  2SPC A;  3UTK A;  4LF7 T;  4DV2 T;  3OTO T;  4AKR B;  1WR0 A;  2P9B A;  5LP6 E;  5KMG P;  3IF8 B;  2JRK A;  2JQH A;  2W62 A;  4UIG A;  4YHJ A;  4HWF A;  2UU9 T;  2Y8D A;  3KV6 A;  2HHH T;  2IUB A;  3QB5 A;  4HWC A;  5FXW A;  3UT5 E;  4DID B;  4F8H A;  4CI1 B;  2KWI B;  3RYH E;  3TLV A;  2XAJ B;  3ZN1 B;  4BJN A;  3G06 A;  4LF4 T;  2JIW A;  1KEY A;  3MA9 A;  3JC6 D;  1FIO A;  4MLK A;  4YJ3 E;  3F2E A;  2BDE A;  3AEG A;  4HWH A;  4U3C A;  5F3J A;  4DV7 T;  4H9S E;  3AA7 B;  2Q9Q B;  4JBW F;  1BR1 A;  1MMA A;  4MHC A;  3OKQ A;  4HFH A;  1VRB A;  3RYC E;  1MIV A;  1XNQ T;  3ZMZ B;  4YTN A;  2D0T A;  2KND A;  5LHI B;  2J4G A;  4MBQ A;  3ZT6 A;  3QK6 A;  2XTL A;  5DQW A;  5J1G A;  3P4R A;  4IHJ E;  4JI2 T;  4HFE A;  2MBG A;  2GK9 A;  2JQQ A;  3MK7 C;  4LFB T;  3F57 A;  3FBL A;  3WI3 A;  2K9A A;  5BMV E;  4PJJ A;  5JQG E;  4QXH B;  5JRC A;  3VHL A;  3PUS A;  4ZOL E;  4PJN A;  4O2A E;  4KUM B;  2YU1 A;  4FI5 A;  3AE7 A;  2X9Y A;  4P09 A;  3RGL A;  3A8Y C;  3SFE A;  4CXY A;  4P0A A;  1IBM T;  3VKH A;  1KK7 A;  1VCS A;  1WFD A;  4NPP A;  2X0Y A;  4GK5 E;  5HXS A;  1WR6 A;  2QGS A;  2E9X D;  5DQV A;  1OED E;  3K3N A;  3LDQ B;  4JI7 T;  2X66 A;  2VKH A;  3AE8 A;  3N9O A;  3OJA A;  3KFW X;  2N1G A;  4JV5 T;  1ZP0 A;  5JDG A;  2D0U A;  5FXZ A;  1KF6 A;  2L8K A;  3KVB A;  4P0B A;  2C5J A;  4I4T E;  4ZS3 A;  2VWA A;  3PU3 A;  3QNU A;  3EUH A;  3L09 A;  3I0Q A;  4U74 A;  4EB6 E;  4AQY T;  4F6R C;  2MYS A;  3CX8 B;  4KI0 F;  3H37 A;  4Z91 A;  5HEO A;  5FL1 A;  2WY2 A;  2ZM0 A;  1UUS A;  4TWH A;  5HWX A;  4ISS A;  2VKJ A;  3PUX F;  2HPL A;  2LKG A;  2N9D A;  3PUQ A;  3RRC A;  5ETW A;  4IDN A;  2XAH B;  3LK4 2;  1FMW A;  1FMV A;  3OVU A;  2XHE B;  4P1N A;  3SFD A;  2ZM6 T;  2H88 A;  2ES0 A;  1OWA A;  4JI1 T;  3UU4 A;  4KBM B;  5EK3 A;  1G73 A;  5JVD E;  3C4Z A;  2V5D A;  2IDO B;  3EHZ A;  4ILA A;  3VR9 A;  3PTR B;  4EED A;  3UU3 A;  2H3R A;  2YIN A;  2AE9 A;  3ZKR A;  2CPT A;  4DND A;  2UUC T;  3NRY A;  2NR4 A;  2BG9 C;  1D1B A;  2NW7 A;  5H6R B;  2X9H A;  1D1A A;  3UFG A;  2WS3 A;  2W63 A;  1KNP A;  5LMU T;  5KXJ A;  3FHN A;  2JMH A;  3PJA J;  3AA1 B;  3AAE B;  5C8Y E;  4O4H E;  4PK5 A;  4JLE A;  3JAE A;  2KIN B;  2BS4 A;  2XQ9 A;  5AQN B;  3HKC E;  1N33 T;  2JQK A;  3Q2M A;  2W66 A;  4OK0 A;  4JEH B;  5FP3 A;  4GKJ T;  1YD8 G;  3AEA A;  4BJM A;  3ZYM A;  3RYI E;  1N36 T;  1OED B;  4O4J E;  4YT0 A;  4KHZ F;  5LBQ B;  4ZI3 D;  4CN1 A;  4ZXL A;  4PJL A;  3ZST A;  3S4U A;  3FZF B;  3TLS A;  1Z0P A;  3WAJ A;  2F4V T;  2CA5 A;  2XJ7 A;  1BR2 A;  3ANW B;  3HL6 A;  3A7M A;  4O2B E;  5AQK B;  3EI0 A;  4PJM A;  4OX9 T;  4AI6 A;  3PUZ F;  4C90 A;  4YY3 T;  2UXB T;  5JDH A;  3L39 A;  5E0O A;  3RKG A;  4WW0 A;  2YK0 A;  2BS3 A;  4QXC B;  3B5M A;  3ZPO A;  1NAF A;  4IDZ A;  3ZT5 A;  4UVC B;  1HNZ T;  2W4X A;  2VL0 A;  1OED C;  3AA6 B;  3AAA B;  3BQL A;  1MIW A;  2XY8 B;  4PFO A;  2NTX A;  5IHY A;  3VR8 A;  3EAB A;  4V1A v;  4IE6 A;  5FVK A;  5ABE A;  3N2O A;  5LB7 B;  4YSX A;  4HE8 A;  4JYA T;  2CBJ A;  2WM9 A;  4DV4 T;  2E2A A;  3AAI A;  3P8C D;  1WCR A;  3HA4 A;  1HX8 A;  1LRZ A;  2CXL A;  2W00 A;  3KVA A;  3LJC A;  5FNV E;  3GN5 B;  3U78 A;  3GN5 A;  2V6Y B;  4B3M T;  5HCJ A;  4HTE A;  3Q5D A;  3MJX A;  5FY7 A;  2XQ6 A;  4IDP A;  3RPU A;  3T1H T;  2CXF A;  1T7S A;  1HX1 B;  4X62 T;  4DBR A;  4X1Y E;  4PK4 A;  2BVM A;  2QA7 A;  3SRZ A;  4UF0 A;  4EZ4 A;  5AQR B;  3LBX B;  4TN7 B;  4U72 A;  4H63 H;  4YTM A;  5F5W A;  3Q5E A;  1X79 A;  4A5X A;  2MPK A;  2X68 A;  5DAB A;  4BAY B;  3PUW F;  4HGA A;  3RQW A;  2VB6 A;  3UU5 A;  5AQF B;  5IWA T;  5L3F B;  1UX4 A;  1SE7 A;  3MKD A;  5FVL A;  4YSZ A;  5CB4 E;  5ABH A;  5IYZ E;  3ZLI A;  3RF1 A;  2YDS A;  2NW9 A;  5FXV A;  1QSD A;  2XQ5 A;  5JDL A;  1HG5 A;  4DV1 T;  1HNX T;  2LHR A;  2Q9Q D;  2VAS A;  2Y48 B;  3CX7 B;  4U7I A;  2WU2 A;  3O1H A;  4ZZC A;  2WMN A;  4QH1 A;  4DO0 A;  3J7Y q;  3W15 B;  2LM2 A;  4HWD A;  4E7S A;  4FJO A;  3RI5 A;  3VRA A;  4DR1 T;  4G63 A;  1E7P A;  1YQ3 A;  4IE4 A;  2EHO B;  3Q5X A;  4ILU A;  4IE0 A;  2XM2 A;  2XAF B;  3LFM A;  5HEJ A;  4QH4 A;  2V7J A;  1IJ6 A;  2M6I A;  4LMK A;  1T8B A;  3K3Q C;  3ONJ A;  4YFS A;  2V7L A;  5FY0 A;  3UUN A;  5CFB A;  4DUZ T;  3JCF A;  2VUR A;  4KMC A;  4AKH A;  2WB5 A;  5HEU A;  2V8S V;  5L3D B;  2IAK A;  1KNR A;  1JNR A;  3NRX A;  2CWO A;  3RLF F;  4UVA B;  3GA8 A;  2IW5 B;  4DR3 T;  2PJQ A;  4OYJ A;  5AQP B;  1XNR T;  2ZM2 A;  3QUJ A;  2H7V C;  2KSR A;  3H3A A;  2YDQ A;  2CE7 A;  2E8I A;  4YTP A;  4ERR A;  3CX6 B;  2I59 A;  3J9X 1;  3M65 A;  4JUY A;  2V26 A;  1T98 A;  2ODU A;  2XAS B;  2I6H A;  4H9P C;  3E22 E;  3ZMV B;  1XMQ T;  2E9X C;  1MMN A;  1U5P A;  4NXN T;  1HCI A;  3C98 B;  1S94 A;  2J1D G;  5AQS B;  1FJG T;  4DR6 T;  4L0R A;  2WSS V;  2QRX A;  1SHZ C;  1VOM A;  2X67 A;  2HN1 A;  3UU8 A;  4DVD A;  3AXJ A;  3OYZ A;  5L3C B;  3FZL B;  2H7O A;  2I0M A;  2W61 A;  3OBV E;  4GK0 E;  4WBO A;  4Z8X A;  4EAH A;  2N2N A;  2XQ4 A;  4IL4 A;  5AQI B;  1R8I A;  1J1J A;  4CI3 B;  4OHF A;  4TWF A;  1S35 A;  3P4Q A;  4IL9 A;  2VK9 A;  1CHU A;  4KHP T;  2KT9 A;  5JDN A;  1LVF A;  4PAG A;  4UEM A;  4CXX A;  3C4W A;  3K8P C;  2KXP B;  2Y6X A;  2C0S A;  3AE3 A;  2DCF A;  3Q9D A;  2FBW A;  5LA6 E;  1IJ5 A;  3R84 B;  3QC9 A;  5KDM C;  5FYM A;  1CUN A;  2JJ9 A;  3PE0 A;  2A2F X;  3AEB A;  3RHW A;  1NWM X;  3ZMS B;  5H6Q B;  3ZC0 A;  3BK9 A;  3R6N A;  3RIU A;  1MMG A;  5L3G B;  2XQ3 A;  4MAL A;  4TNW A;  3RYF E;  2PG8 A;  4NXM T;  3AE9 A;  4EYY R;  4JI3 T;  4EYU A;  2WBL A;  1BR0 A;  4LF9 T;  4JI5 T;  1XMO T;  2OV9 A;  3IHR A;  4HFD A;  3I9W A;  5HEG A;  5TAO A;  3T1Y T;  2PTF A;  3AB3 B;  5LXT E;  4UV8 B;  5JRE A;  5LJM A;  4DUY T;  2E9X B;  4O8S A;  1M7K A;  4Z90 A;  1US7 B;  1EZ3 A;  1QUU A;  2LM9 A;  2LRK A;  1ZHC A;  2NOX A;  3AXJ B;  3K1S A;  4IDQ A;  4E7Z A;  1W09 A;  2M67 A;  1UX5 A;  1U4Q A;  3P50 A;  5LHH B;  4B3S T;  2ACZ A;  1HFA A;  2LSG A;  2WWU A;  2EHO D;  4NUV A;  4UVB B;  2A3D A;  3RX6 A;  4ZZB A;  3N9P A;  3RIA A;  1HG2 A;  5IUX A;  4AIU A;  4PFP A;  2CLY C;  1VCT A;  3PV0 F;  1J5E T;  4HN9 A;  2XPK A;  3EDV A;  4IRE A;  3N9Q A;  4TV9 E;  4GIW A;  4H63 V;  2BBH A;  3UU6 A;  2BS2 A;  2IC9 A;  2CLY B;  4CI2 B;  4DR7 T;  3X1D A;  2IHR 1;  4XBF B;  1HR0 T;  4ZI3 C;  4J2C A;  2BG9 A;  3NKZ A;  2V6Y A;  3RC8 A;  4JEU B;  5L4H A;  5AQU B;  2CBI A;  4X20 E;  2VQF T;  2MOZ A;  3KBT A;  2XAQ B;  3C64 A;  2H89 A;  3NBX X;  1J5W A;  4HFB A;  1E2A A;  2W0G A;  1SUM B;  2E5V A;  3QB5 K;  4OFZ A;  1HNW T;  3ZMU B;  5JH7 E;  2CHO A;  1SA0 E;  2MTQ A;  2KLQ A;  3NVO A;  3RIF A;  4AIS A;  4A56 A;  1HS7 A;  3F31 A;  3BQI A;  5FXX A;  4UR9 A;  2V7K A;  4LMJ A;  2IC6 A;  4DV6 T;  3UUX B;  1B7T A;  4B6X A;  5JDQ A;  3LK2 B;  5KX5 E;  2YEV C;  3UUB A;  3ESL A;  3HKD E;  3AED A;  3RH3 A;  3GWH A;  3ZYK A;  3CQG B;  2LSK A;  2LLY A;  3ZJ1 A;  1XZY A;  4AKL A;  2PFV A;  3I1A A;  4U2Z A;  4O4I E;  2LKH A;  4I50 E;  3L3P A;  3AVR A;  5AQV B;  4YJ2 E;  1OXZ A;  2JPF A;  1MIY A;  3FZK B;  3RIU C;  3NZP A;  3ZC1 A;  4EOZ B;  2BG9 B;  3KDS E;  5CA1 E;  3O9X A;  2RA1 A;  4IT4 A;  2LSI A;  1H7C A;  2LHN A;  2Z6E A;  4UV9 B;  4X65 T;  3SWH A;  1MND A;  3CKD A;  2QYW A;  4OYK A;  2A72 A;  2OLT A;  1D1C A;  2CRB A;  2XQ8 A;  3FZM B;  3N9M A;  5AQG B;  1YQ4 A;  2WCA A;  3KIN B;  4ZI2 C;  1KNZ A;  2WWV A;  1D0Y A;  2LRL A;  4I55 E;  1O3X A;  3A5X A;  3CQC B;  3AE2 A;  2B76 A;  4IST A;  5JTG A;  2X51 A;  4XAX B;  4AQF A;  1IBK T;  5LNK A;  5CJ5 A;  2UUB T;  2BKN A;  2C5K T;  4TX5 A;  1WYC A;  3M3Z B;  4DR2 T;  2XSB A;  2EHO A;  4H9N C;  4HWI B;  1YW0 A;  4DMV A;  1L0V A;  4YSY A;  3PUG A;  5J2T E;  3RKO A;  4B3R T;  4UEL A;  4NIQ A;  1UCU A;  4TZ4 C;  4QX8 B; 
#chains in the Genus database with same CATH homology
 3Q5W A;  4QXB B;  1YKH B;  4PW8 A;  4X1K E;  2YU2 A;  5JDF A;  2Q9Q A;  1IZN B;  2L3L A;  1E1H B;  3PUA A;  5L3E B;  1D0X A;  1WLX A;  2DI4 A;  2CWY A;  3K3O A;  4AQF C;  4N78 D;  1IAP A;  2C5I T;  3DJB A;  3C51 A;  2KMF A;  4PK6 A;  4ANJ A;  4EIW A;  4L9I A;  3PU8 A;  4UF0 B;  4ZI2 D;  2WAU A;  4L5G A;  5HWY A;  2DWG A;  2DLR A;  2CM0 A;  3V5U A;  3VKG A;  3V5S A;  2NP9 A;  5AFU L;  2LJL A;  3B57 A;  3CWZ B;  3P7I A;  4WNK A;  4H9Q C;  2HPJ A;  3KV4 A;  3FB2 A;  3ONX A;  4GYR A;  3EDU A;  5LHG B;  3IEE A;  2XAG B;  1FEW A;  3MXZ A;  3N9L A;  4HKA A;  5JR9 A;  5CA0 E;  5L3B B;  3LBX A;  5L2L A;  2CCQ A;  4H9O C;  3N9N A;  3TKL B;  4UXN B;  3ETV A;  3ZN0 B;  4PNI A;  1YKE B;  4HEA A;  5JRC B;  1MNE A;  4TV8 E;  5LYJ E;  2LSY A;  5FY1 A;  3CML A;  4ZI7 E;  3SOL A;  4DMW A;  2L9Q A;  4ZS2 A;  2PBI A;  3CVR A;  4WBN E;  2KWH A;  3NZQ A;  2X0L B;  2CEA A;  4AXP A;  5HXR A;  5F8P A;  2WMO A;  2ACX A;  2BVL A;  4KP3 C;  2ODV A;  2Q9Q C;  2VKO A;  3N2G E;  4BA9 A;  2X9W A;  3B13 A;  4O4L E;  4ZHQ E;  4IIJ E;  4DBQ A;  1ZKE A;  4HFV A;  3JC6 C;  3KBU A;  5HYA A;  3AVS A;  4MFR A;  3RC3 A;  2HH7 A;  3WAK A;  5LGU B;  2EHO C;  3CQX C;  3EVY A;  4NUU A;  2LSJ A;  4IE5 A;  4CXW A;  1ZV4 X;  2OA5 A;  3PUR A;  2XUE A;  2V7I A;  3FBZ A;  1G8X A;  3T8O A;  3ETU A;  1D0Z A;  2DNX A;  3FXD B;  3FXE B;  4YLH A;  5EK2 A;  5ADX L;  2NW8 A;  5FMN A;  5A1L A;  2LEH A;  3HR0 A;  2CMR A;  1WYB A;  3CPZ A;  3MAC A;  2G0U A;  4G2A A;  4HGA A;  5LBM A;  2D5U A;  4I43 B;  4IGU A;  2E9X A;  1WRD A;  2ZLY A;  3ZEF B;  1LVK A;  3OYX A;  3RRW A;  2ZM8 A;  3UUL A;  3N5L A;  3DP7 A;  3DTO A;  3E0Z A;  2K5B B;  4EZH A;  5LJN A;  3HI2 A;  2UXX B;  2NWB A;  5JR9 B;  5LG4 A;  3I9Y A;  3SS1 A;  5LOV E;  1HF8 A;  2CXD A;  3D0T A;  5EK4 A;  4C91 A;  2DWK A;  2VKD A;  4M1P A;  3VU7 H;  3ZCI A;  2JMK A;  2RP4 A;  5HAX A;  3ZCJ A;  3I0O A;  1LKX A;  2LOS A;  3E08 A;  3C50 A;  3BQK A;  5EZY E;  3UUM A;  4XZC A;  3LG7 A;  4QX7 B;  5GON E;  4AQG A;  5J2U E;  4IE7 A;  2BZB A;  2B1E A;  2UXN B;  5DJQ C;  2LOP A;  2K48 A;  1HTJ F;  3MZK B;  4QHO A;  1AJ3 A;  4CQI A;  4AKI A;  4ADZ A;  3O1I A;  2NTY A;  3O1J A;  4K0U A;  3ZYL A;  4QWN B;  5JDH A;  1V9D A;  2K24 A;  3PDY A;  4QKN A;  1Y64 B;  3LK3 B;  3C4X A;  2LT3 A;  2XQY A;  3GMI A;  2V1D B;  2V7M A;  5LGN B;  1MMD A;  5JR9 C;  1ZEE A;  4CZZ B;  3ZJ2 A;  4X1I E;  5JDM A;  3KV9 A;  4GOU A;  3IBP A;  2D2S A;  5HXE A;  3AA0 B;  2VL8 A;  5HXC A;  3O4X E;  5LCY A;  3U3I A;  4GYS A;  3HKE E;  3ZMT B;  2KZ7 B;  2X9X A;  4EXT A;  3ANW A;  3N2K E;  4H9R C;  2DHR A;  3UFE A;  4ASK A;  3KV5 A;  3HKB E;  1BR4 A;  2ZMA A;  4TUY E;  5HXH A;  5M4Y A;  2LE8 A;  2SPC A;  3UTK A;  4AKR B;  2P9B A;  5LP6 E;  5KMG P;  3IF8 B;  2JRK A;  2W62 A;  4YHJ A;  4UIG A;  2Y8D A;  3KV6 A;  4CI1 B;  5FXW A;  3UT5 E;  4AKG A;  2KWI B;  4BJN A;  2XAJ B;  3ZN1 B;  3MA9 A;  3JC6 D;  1FIO A;  4MLK A;  4YJ3 E;  3F2E A;  2BDE A;  5F3J A;  4H9S E;  3AA7 B;  2Q9Q B;  1BR1 A;  1MMA A;  4MHC A;  3OKQ A;  3RYC E;  1VRB A;  1MIV A;  3ZMZ B;  2D0T A;  2KND A;  5LHI B;  4MBQ A;  3QK6 A;  2XTL A;  5DQW A;  5J1G A;  4IHJ E;  2MBG A;  2GK9 A;  2JQQ A;  3MK7 C;  3F57 A;  3FBL A;  3WI3 A;  2K9A A;  5BMV E;  4PJJ A;  5JQG E;  4QXH B;  5JRC A;  3VHL A;  3PUS A;  4ZOL E;  4PJN A;  4O2A E;  4KUM B;  2YU1 A;  4FI5 A;  4P09 A;  2X9Y A;  4P0A A;  3VKH A;  1KK7 A;  4GK5 E;  5HXS A;  1WR6 A;  2QGS A;  2E9X D;  5DQV A;  3K3N A;  2X66 A;  2VKH A;  3N9O A;  3OJA A;  3KFW X;  2N1G A;  5JDG A;  2D0U A;  5FXZ A;  2L8K A;  3KVB A;  4P0B A;  2C5J A;  4I4T E;  4ZS3 A;  2VWA A;  3PU3 A;  3EUH A;  3L09 A;  3I0Q A;  4U74 A;  4EB6 E;  4F6R C;  2MYS A;  3CX8 B;  3H37 A;  2ZM0 A;  5HWX A;  4ISS A;  2VKJ A;  2HPL A;  2N9D A;  3PUQ A;  3RRC A;  5ETW A;  2XAH B;  3LK4 2;  1FMW A;  1FMV A;  2XHE B;  2ES0 A;  1OWA A;  4KBM B;  5EK3 A;  1G73 A;  5JVD E;  3C4Z A;  3PTR B;  2H3R A;  2YIN A;  4DND A;  3NRY A;  2NW7 A;  1D1B A;  5H6R B;  2X9H A;  1D1A A;  2W63 A;  3FHN A;  2JMH A;  3AA1 B;  3AAE B;  5C8Y E;  4O4H E;  4PK5 A;  4JLE A;  2KIN B;  3HKC E;  3Q2M A;  4OK0 A;  4JEH B;  5FP3 A;  1YD8 G;  4BJM A;  3ZYM A;  3RYI E;  4O4J E;  5LBQ B;  4ZI3 D;  4PJL A;  3WAJ A;  3S4U A;  1Z0P A;  2CA5 A;  3ANW B;  1BR2 A;  3HL6 A;  4O2B E;  4PJM A;  4AI6 A;  4C90 A;  5E0O A;  4WW0 A;  2YK0 A;  4QXC B;  3ZPO A;  1NAF A;  4IDZ A;  4UVC B;  5IHY A;  3AA6 B;  3AAA B;  4PFO A;  3BQL A;  1MIW A;  3RYH E;  2NTX A;  4V1A v;  4IE6 A;  3N2O A;  4HE8 A;  2WM9 A;  3AAI A;  3P8C D;  3HA4 A;  3KVA A;  1HX8 A;  1LRZ A;  2CXL A;  2W00 A;  3LJC A;  5FNV E;  3GN5 B;  3U78 A;  3GN5 A;  4HTE A;  5FY7 A;  3MJX A;  3RPU A;  2CXF A;  4DBR A;  4X1Y E;  4PK4 A;  2BVM A;  2QA7 A;  3SRZ A;  4UF0 A;  4EZ4 A;  3LBX B;  4TN7 B;  4U72 A;  4H63 H;  1X79 A;  2X68 A;  5DAB A;  4BAY B;  2VB6 A;  5L3F B;  1UX4 A;  5LGT B;  3MKD A;  5CB4 E;  5IYZ E;  3ZLI A;  5JDL A;  2NW9 A;  5FXV A;  1QSD A;  1HG5 A;  2LHR A;  2Q9Q D;  2VAS A;  2Y48 B;  3CX7 B;  3O1H A;  2WMN A;  4DO0 A;  3J7Y q;  3W15 B;  4E7S A;  4FJO A;  4G63 A;  4IE4 A;  2EHO B;  3Q5X A;  4ILU A;  4IE0 A;  2XAF B;  3LFM A;  2V7J A;  1IJ6 A;  4YFS A;  3K3Q C;  2V7L A;  5FY0 A;  3UUN A;  4AKH A;  4KMC A;  5L3D B;  2IAK A;  3NRX A;  2CWO A;  4UVA B;  3GA8 A;  2IW5 B;  2PJQ A;  4OYJ A;  2ZM2 A;  3QUJ A;  2H7V C;  3H3A A;  2CE7 A;  2E8I A;  4ERR A;  3CX6 B;  2I59 A;  3J9X 1;  3M65 A;  4JUY A;  2V26 A;  1T98 A;  2ODU A;  2XAS B;  4H9P C;  3E22 E;  3ZMV B;  2E9X C;  1MMN A;  1U5P A;  1HCI A;  3C98 B;  1S94 A;  2J1D G;  4L0R A;  2X67 A;  2WSS V;  1SHZ C;  1VOM A;  4DVD A;  3OYZ A;  5L3C B;  2H7O A;  2W61 A;  3OBV E;  4GK0 E;  4WBO A;  4Z8X A;  4EAH A;  3ZC0 A;  2N2N A;  4CI3 B;  4OHF A;  1S35 A;  2VK9 A;  2KT9 A;  5JDN A;  1LVF A;  4PAG A;  4UEM A;  4CXX A;  3C4W A;  3K8P C;  2KXP B;  2Y6X A;  2C0S A;  3R84 B;  2DCF A;  3Q9D A;  5LA6 E;  1IJ5 A;  3QC9 A;  5KDM C;  5FYM A;  1CUN A;  2JJ9 A;  3PE0 A;  2A2F X;  3ZMS B;  1NWM X;  5H6Q B;  3BK9 A;  3R6N A;  1MMG A;  5L3G B;  4MAL A;  3RYF E;  2PG8 A;  4EYU A;  2WBL A;  1BR0 A;  3IHR A;  5TAO A;  3I9W A;  3AB3 B;  5LXT E;  4UV8 B;  5JRE A;  5LJM A;  2E9X B;  4O8S A;  1US7 B;  1EZ3 A;  1QUU A;  2LM9 A;  4EYY R;  1ZHC A;  2NOX A;  4E7Z A;  2M67 A;  1UX5 A;  1U4Q A;  5LHH B;  1HFA A;  2LSG A;  2WWU A;  2EHO D;  4NUV A;  4UVB B;  2A3D A;  3RX6 A;  3N9P A;  1HG2 A;  4PFP A;  2CLY C;  4HN9 A;  3EDV A;  3N9Q A;  4TV9 E;  4GIW A;  4H63 V;  4CI2 B;  4CXY A;  2IC9 A;  2CLY B;  4XBF B;  4ZI3 C;  4J2C A;  3RC8 A;  4JEU B;  4X20 E;  2MOZ A;  3KBT A;  2XAQ B;  3C64 A;  3NBX X;  2W0G A;  4OFZ A;  3ZMU B;  5JH7 E;  1SA0 E;  2MTQ A;  2KLQ A;  4A56 A;  1HS7 A;  3F31 A;  3BQI A;  5FXX A;  2V7K A;  2IC6 A;  3UUX B;  1B7T A;  4B6X A;  5JDQ A;  3LK2 B;  5KX5 E;  2YEV C;  3ESL A;  3HKD E;  3RH3 A;  3ZYK A;  3GWH A;  3CQG B;  2LSK A;  3ZJ1 A;  4AKL A;  2PFV A;  3I1A A;  4O4I E;  4I50 E;  3L3P A;  3AVR A;  4YJ2 E;  1OXZ A;  1MIY A;  2JPF A;  3ZC1 A;  4EOZ B;  3NZP A;  3O9X A;  3KDS E;  5CA1 E;  2RA1 A;  2LSI A;  1H7C A;  2LHN A;  2Z6E A;  4UV9 B;  3SWH A;  1MND A;  3CKD A;  4OYK A;  5LNK A;  2A72 A;  1D1C A;  3N9M A;  1KNZ A;  3KIN B;  4ZI2 C;  1D0Y A;  4I55 E;  1O3X A;  3A5X A;  3CQC B;  4IST A;  2X51 A;  4XAX B;  4AQF A;  2C5K T;  4TX5 A;  1WYC A;  4H9N C;  2EHO A;  1YW0 A;  4DMV A;  3PUG A;  5J2T E;  3RKO A;  4UEL A;  1UCU A;  4TZ4 C;  4QX8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...