2CA8A

Structure of sh28gst in complex with gsh at ph 6.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
208
structure length
208
Chain Sequence
b'DHIKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAATPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE 28 KDA
publication title Probing the Mechanism of Gsh Activation in Schistosoma Haematobium Glutathione-S-Transferase by Site-Directed Mutagenesis and X-Ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
molecule tags Transferase
total genus 68
structure length 208
sequence length 208
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ca8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ca8A01
1SD9A 1FO5A 4IJ3A 3L0HA 2GDRA 2REMA 4TR1A 5LNKe 2AJQB 2E7PA 1R5PA 5D93A 1SKRB 3R3EA 2I4AA 4EUYA 1S3CA 5HR3A 4G0LA 4EXJA 5CO3A 4ULXA 5EPFA 2WFCA 2XBQA 4ZXGA 2H1GA 1TRWA 4OO5A 1X9WB 2TRCP 2H0IA 5CP1A 4WBRD 2O8VB 1T8EB 2WRTA 1GWCA 5IM9A 1ERTA 1TU7A 4K2DA 1NM3A 1FOVA 4WKWA 3L9SA 5HFGA 3RDWA 3EU3A 1F37A 2V32A 1Z3EA 1EOGA 3KCMA 1WPIA 1DE1A 2ON7A 1J9BA 4JBBA 3G9BA 2K8SA 1TI3A 4NXIA 2EIRA 4GRFA 1OKTA 2H6XA 4BL7B 6GSXA 1TRSA 1Y6EA 3R2QA 3J7Yb 2VLVA 4IKHA 2HQTA 2OBIA 3APOA 3ZREA 4K7OA 4IN0A 1Z7RA 4KDYA 3KM6A 3US3A 6GSYA 1WE0A 2HRKB 5CRGA 4FIWA 5D8IA 3KMOA 4MK3A 4F0CA 5AN1A 3I6AA 4ZBBA 4V2MA 3HCZA 1X0RA 4HS1A 4BVYA 2C3QA 4TXOB 3UL3A 3VWWA 5J5NA 3K8NA 2ZUPA 3LQ7A 3VWVA 4DSSB 2OKAA 3KH9A 1EV4A 3D0ZA 1U6TA 5G2ZA 3QR6A 2YPMA 5G5EA 4IQAA 1X5CA 4WETA 2L4QA 1IYHA 3ZVJA 1WJKA 4L0WA 2YV7A 2PMTA 2MBTA 4DVCA 2YZHA 4OFNA 1RW1A 10GSA 2L5OA 2WB9A 1FB0A 2HSNB 3UEMA 3APSA 1VF3A 5DAKB 3GX0A 5J3RA 3BOAA 1F3BA 2M72A 2R37A 2AYTA 3H93A 3GTUA 4WF5A 1BEDA 2NDOA 3DKSA 2K9FA 2HXKA 3DIEA 2PU9C 3HHVA 5COHA 2EIOA 3KJYA 3N5OA 5C04A 1TW9A 3WT2A 4ML1A 4BVXB 2FGXA 3ERWA 4OO4A 2A2RA 3TCOA 1K0AA 2H6ZA 4KA0A 1QK8A 1R7HA 4JEDA 2HRAA 2XHFA 1K3YA 2GT6A 1U88A 5FWGA 4CDOA 1ERWA 3RPPA 5A4VA 2MMOA 1SKWB 1QXHA 4HI7A 2CVKA 2VCWA 1GUKA 3IE3A 3WGDA 3GHAA 2JL4A 2X99A 3F3QA 3DYRA 4XTSA 5IOWA 2DJ1A 4OFMA 2DJ3A 3QCPA 4GSNA 3GN3A 2F8AA 5FT3A 3TRQA 3UIWA 5ID2B 2KLXA 2O85A 4G9HA 1YKCA 4FYCA 1XCCA 1WWJA 4TR0A 1EWXA 4XS4A 2RUEA 1K0MA 2H19A 4WXTA 1SKSB 2YJ7A 1FAAA 2H75A 4G19A 4N11A 2WZ9A 3LXZA 4XS1A 1WOUA 1K0DA 2C3NA 1F9MA 3C7MA 3PH9A 4HZ2A 3UARA 4F82A 1EEJA 4MZWA 2NVLA 4BWSA 1MDIA 2O89A 2J9HA 4ML6A 1J08A 2I81A 3OR5A 1F6MC 2DBCA 4OMVA 1Z9HA 1SK2A 4GXZA 3TKSC 1BX9A 3CYNA 3TKSA 4MP4A 1YF0A 3SBCA 4LMWA 2V6KA 2H1DA 1X9SB 1XOBA 4POBA 4H86A 3ZTLA 2H71A 3UMAA 1THXA 4JR6A 3UVHA 2AB6A 2YCDA 2JACA 5D73A 1GSDA 2E0QA 3JCML 4OCFA 4ECBA 1DSBA 6GSTA 4MMMA 4EDYA 4ZL9A 1XVWA 2CZ2A 2L57A 3FKFA 1O85A 1T1VA 1QFNA 4RQXA 4ZIJA 3ME7A 3D21A 1EP8A 3GKKA 2CQ9A 2YOIA 1YDKA 2OA7A 4ZB6A 1TK8B 2YWIA 3FZ5A 4YAPA 2HZEA 4JU5A 3CSIA 3QFAC 4NAXA 2DIZA 4IVFA 2IFQB 5ENUA 2C80A 3QMXA 2L59A 5DCGA 5H5SA 5G1LA 14GSA 4O5RA 4PQ1A 4PX1A 4HOJA 3P8WA 2LRTA 4POLA 1GTUA 4IQ1A 1V40A 5ABRA 3GL5A 1BAYA 2V6OA 4NWYA 2JZRA 5AGYA 2OJLA 2XPDA 6GSSA 1PA3A 4PUFC 1U3AA 1EZKA 4HU9A 4N0VA 2VLUA 5DCHA 4EKZA 4TR3A 3DVWA 3UAPA 2GSRA 1DE2A 4MF6A 3ZFBA 1M2BA 3IC4A 4YQVA 1E6BA 1NW2A 2FNOA 2L6DA 3TOTA 5IMDA 1V2AA 4MZCA 2WS2A 2WGRA 3IDVA 3EYTA 4MH3A 4MF5A 5E4WA 3H4KA 3ZRDA 3C1SA 5F0GA 2GZPA 2HRNA 3HVXA 1K0OA 5IIZA 1F3AA 4PUAA 1ACVA 4IW9A 4MZBA 3G7YA 4G0KA 1V98A 4L5LA 4V1Ag 3LORA 1R5AA 4AJ7A 4G0IA 5EY6A 2VL3A 3M8NA 4ZBDA 2OACA 4HU7A 4MPFA 1BJXA 1KNGA 3TJBA 2LJKA 3IHQA 1MD3A 3GL3A 2V1MA 2VM1A 3EC3A 1PKWA 4X0XA 5D9XA 3H1NA 1TRUA 4MJBA 2HLSA 1OKDA 5E59A 4YH2A 1NHOA 1ST9A 5ECIB 2C8UA 1LBKA 4HQZA 1O7UA 4NMUA 2FCHA 3ERGA 2FWFA 3KZQA 4K6XA 2H73A 3L78A 2I1UA 3QAVA 4ACSA 4OCEA 1UC7A 1KEBA 2NTOA 2EIQA 1HQOA 1AQVA 3GURA 2CVDA 1GSFA 5ECRB 1OE7A 4D73B 3EINA 1B48A 1JLVA 5J9BA 4MH2A 1PQNA 5ECPB 4F2IA 4KNDA 4FO5A 4NHWA 2RIIA 2YJHA 5GSSA 3KEBA 3FRCA 1FB6A 4ECCA 2PVOC 1PN9A 1OC9A 1M9AA 3GNJA 2CAIA 1WMJA 1S3DA 6GSUA 4KCAA 1AXDA 2M46A 3D4TA 3PR8A 2LRCA 3ZZXA 1SYRA 4K7IA 4KSOA 5G1KA 3UBKA 4NHZA 5CYYA 1UVZA 4WBJA 2GQMA 4IP6A 4KDXA 1X5EA 3GKNA 5J4UA 3O3TA 5KN3A 4FYBA 2LUSA 2OE3A 3TKPA 3LYKA 3RHBA 2F3MA 5DQSA 2KUCA 5HR2A 3HYPA 3N9JA 1TDIA 4TKYA 2L5LA 3FZAA 1THOA 3ZITA 4XCSA 2FD3A 3ZL5A 3WD6A 4LMVA 3TRXA 3VWUA 3F9UA 4J2FA 5HR1A 4EC0A 2VCTA 2AUVA 2N5FA 1CQHA 5INYA 4WEYA 3TJJA 3QAGA 3F6DA 2PVQA 1XWBA 2LS5A 3C71A 5AISA 4DEJA 3EWLA 2PBJA 3NOFA 3FZ4A 5JWQB 5FHIA 1MEKA 1WRYA 4Q5FA 2LSTA 1XXUA 4V2LA 4L0UA 4EVMA 2GSTA 3LJRA 1VF2A 3VURA 5ELAA 3DVXA 3A3TA 2H74A 1A8YA 4KE3A 3NIVA 1PD21 2C0FA 2BMXA 3CBUA 2QKEA 2RM6A 5ELGA 2VCVA 5BMUA 2MMZA 1XW6A 2LEGA 2KP2A 2CAQA 4LLRA 2B7KA 4V2NA 2A4VA 4E8HA 2DJ0A 2R2JA 1TXXA 4Z7XA 4GF0A 1OYJA 4PURA 1SYXA 2BJXA 1GUHA 3A2WA 4MF7A 5DALA 2HSMA 5F05A 2ON5A 5JCUA 1EP7A 1YQ1A 4NV2A 5DQYA 3M9JA 2VD0A 1VGLA 2CV4A 2IMKA 3ZMKA 5KN2A 1JZOA 3ERFA 4POKA 2ALBA 3KTLA 1Q4JA 1BG5A 1YJ6A 1M2AA 1YZXA 3TGZA 1PRXA 2B6MA 3IRAA 4K0NA 2WULA 4YQUA 4FQUA 3HKRA 4GCIA 1HNAA 2YANA 22GSA 5D9WA 1FG4A 5DDLA 3TUEA 2PPTA 1ZCPA 2AHEA 1WP0A 4YQMA 3GH6A 2CX4A 2H1BA 5IMCA 5ECLB 3A5WA 4AGSA 2PERA 1GTIA 1FVJA 5GAND 3D5JA 3TOUA 5C00A 2HYXA 3Q18A 2F51A 3VFIA 2QC7A 3KMNA 4MABA 2VAFA 2JZTA 1PL1A 2DMLA 2IMDA 2KHPA 1KTEA 3HY2A 4F0BA 3UOMA 5H5QA 4TR1B 2CA8A 1AW9A 3PGTA 2YWNA 4GQFA 4NV5A 1SL2B 3IPZA 2DC5A 1B4PA 2WJUA 1M0UA 2VLTA 3CMIA 3TJKA 1R26A 4BA7A 4KH7A 4EDZA 3D6IA 3DWVA 3RPNA 4K8MA 5IQYA 1BYEA 4I97A 2N5AA 3FZ9A 3LEFA 1TRVA 3U5RE 2CVBA 4KUNA 4O7HA 5EL8A 3ZMLA 3P90A 4PQIA 1T00A 2GT5A 4MLYA 12GSA 1PX6A 1VF4A 3IV4A 2EC4A 5J9CA 3M3MA 2HT9A 1YY7A 5CNWA 2X8GA 1KBNA 4ZL8A 3VI7A 2HZFA 2YWMA 3L4NA 1SENA 3IXRA 3C1RA 2AAWA 4I5QA 2H0HA 2JSZA 1PGTA 4PGTA 4P3YB 1B8XA 5CAXA 2B1LA 1IYIA 5HR0A 3GV1A 1LJRA 3L9VA 5B8AA 2LNSA 2VUPA 1C72A 2X8HA 16GSA 1RQMA 2R6KA 1ZL9A 5D9VA 2P5QA 13GSA 4I2UA 1ON4A 1TI1A 3QOUA 4E8EA 3IK7A 3BJ5A 3IR4A 4MCUA 3U6VA 4GSSA 1TK5B 3RHCA 3FW2A 1F2EA 1MTCA 5DJMA 3W8JA 4RQRA 5ECHB 3UBLA 5IMZA 5A4UA 4IJIA 1OVNA 2JZSA 2VIMA 1FHEA 2V41A 4BVYB 4GTUA 2NPBA 5CRWA 1QMVA 4USSA 3E0UA 2DLXA 2LV3A 3H8QA 2FWHA 2B1KA 3QDNA 2FY6A 5A5KA 1G6YA 4NPBA 1UN2A 4GQCA 1RK4A 1XBSA 2RUFA 2ZCTA 18GSA 3I9V2 1PKZA 3VWXA 1OC8A 5A4WA 5AIXA 3FR3A 2HSMB 1XVQA 2IL3A 2L6CA 5ECKB 4BL7A 1HD2A 1MDJA 4EE0A 2OE0A 3ZFLA 5GZZB 4HEA2 1H4OA 2C4JA 3IK9A 1SJZA 4XRAA 3GIXA 3M9KA 3GTUB 3GSSA 1B4QA 2RLIA 4K7NA 4AJ8A 1ZYEA 3E9JB 3F63A 3CSHA 2VO4A 2BTOT 4QL7A 4KGIA 1ZOFA 2B7JA 1K3LA 4MJEA 5AIVA 5G5FA 3TKQA 3EMXA 1GNWA 5IOXA 2HRKA 1JZDA 4HQSA 3GFKA 4GWRA 3F0IA 1AQWA 3ME8A 2HSYA 4PQHA 2R3XA 5JCWA 3MNGA 3GMFA 1GLQA 4TXOA 3ZIVA 4V1Ap 2C0EA 1W89A 2AV4A 3WT1A 5CRDA 3FR6A 4DSSA 3M1GA 3D22A 1TKDB 2DJJA 3EU4A 2VL9A 1Q98A 3SWLA 2H72A 4IGJA 5ECSA 2DSAA 4KB3A 3I69A 1G7OA 3KIJA 1EGRA 1VF1A 3ISOA 1G7EA 1TOFA 2QSIA 3CSJA 1SK0A 4WF4A 3WGEA 2MZCA 2LTKA 4XS4B 4TRXA 4HDEA 1ZMAA 1I5GA 1DUGA 2H0GA 1GRXA 2H8LA 4I2TA 2XPEA 1J0FA 4BVXA 1AUCA 4ZL7A 1G6WA 2CZ3A 5HFKA 5LD0A 1X9MB 2JADA 2K18A 3J7Yk 1M7TA 3IAS2 4BWQA 1XPVA 1XZOA 3KH7A 3MWHA 1GH2A 4QL9A 1YF1A 4JRRA 1XFLA 4RI6A 2VCZA 3Q74A 2FUG2 2H66A 1LU4A 1DBYA 2DMMA 1XW5A 4GSTA 5F8BA 4KX4A 1ILOA 2HNLA 1M9BA 1PSQA 5G30A 17GSA 4ID0A 2P0GA 3TJFA 5DBQA 2VD1A 1V58A 3CXGA 1YEXA 1T4YA 3FEUA 3BD2A 2UZ8A 2KOKA 3TJGA 3Q19A 4XS6A 2H1AA 5ID2A 2YNXA 4G2EA 3TDGA 5KN1A 4PNGA 1XWAA 2PWJA 1XWGA 4Q5RA 4ZBAA 4X1UA 3F4TA 1XOAA 1QQ2A 3KXOA 3KD0A 2H6YA 2JSYA 2H76A 3I43A 2VL2C 4EF0A 1K0NA 2F8FA 5ECOB 2VL2A 4TXVA 2TIRA 1XW9A 2HZEB 3G7IA 5L71A 4IBPA 1W4VA 3LFLA 4I8BA 4J56E 1SK1A 5HQPA 3EURA 3DMLA 2DJKA 2B3SA 2YWOA 1AAZA 2OBKA 4LA1A 4IS0A 1GNEA 1A8LA 2FWEA 1GTAA 5ECMB 3QD9A 1V57A 4J57E 4O92A 9GSSA 2VOCA 4KF9A 4KW6A 2GZZA 5KN0A 1T3BA 3GH9A 3NZNA 1XIYA 2GTUA 2HI7A 2RM5A 1TK0B 2OE1A 2D2ZA 4MA9A 3ZIJA 3VPTA 1SD8A 2E2MA 1K3OA 3UVTA 1U3IA 3FHKA 2I9HA 2YP6A 3TRPA 1A0FA 3BCKA 2G2QA 4N30A 2LRNA 1N2AA 6GSWA 2YN1A 2VM2A 4CW9A 4XHMA 1JFUA 2R5GA 4ECIA 2KP1A 4XRDA 1GSYA 1HYUA 2JU5A 1U87A 2LJAA 4KCEA 3APQA 2IFQA 1PX7A 3LWAA 1HNBA 1USBA 4K0GA 1S3AA 2HE3A 1PL2A 5JWRB 2GGTA 2J23A 4CHSA 7GSSA 2FHEA 5IMVA 2C3TA 2GSQA 1HNCA 2PGTA 2P31A 4HJMA 1K0BA 2IPAA 4ECJA 4FYUA 1GL8A 3HJPA 5D9TA 1SL0B 1A0RP 2L4CA 1BQ7A 2IWTA 1CQGA 3LYPA 4MDCA 2HRFA 2LKUA 5CREA 5DJLA 2MMAA 4F03A 2I3YA 3IAM2 3CRUA 4IELA 4O32A 4JR4A 3MAKA 4YAVA 1A2LA 5B6NA 4I6XA 1E2YA 1ZGNA 1M99A 3O76A 3HJMA 1K0CA 3VK9A 1ABAA 3FR9A 2C1YA 3BBYA 4JZQA 1QUWA 4L5OA 3RBTA 3KP8A 1VRSD 3W8SA 1AQXA 5IPHA 2G0FA 2XC2A 1SJIA 2HFDA 3GA4A 3HZ8A 1GP1A 2C0GA 5G31A 3C73A 3H79A 11GSA 5KEJA 2C0DA 3LXTA 1ML6A 1AC1A 3RAZA 1GTBA 4XIHA 2X8CA 4KSMA 1Z6NA 3AY8A 4OWYA 3MSZA 3IC8A 2FLSA 4ISDA 3ZLPA 5GSTA 2GLRA 1PMTA 1OC9B 1YKAA 4BPYA 4TN8A 1R4WA 5F07A 4MJCA 2O87A 2IN3A 5HFIA 1H75A 4PXOA 3D4MA 2X64A 5ECQB 2K6VA 1NSWA 3E3EA 3KGKA 2OADA 5B6MA 4HZ4A 1GLPA 1SU9A 3GKXA 3A2VA 1ERUA 3MDKA 2GVPA 2LNTA 2MYGA 3TKSE 1ERVA 1Y25A 2HSHA 2LQQA 5JCGA 3EE2A 4IHUA 1GUMA 2ZNMA 1WIKA 2H30A 5IMFA 1B9XC 1Z7PA 3F8UA 3HJOA 3A2XA 4L8EA 3F4RA 2P5RA 4D73A 2H70A 5DVBA 1I9DA 1OAZA 3GX8A 1G0TA 1GSEA 3LSZA 3FK8A 3TB2A 19GSA 1AIUA 2LJRA 3UJ1A 1O8XA 2VCQA 3HVVA 1TJDA 1MDKA 4F9ZA 4ILFA 5EVOA 3IBHA 3PINA 1UA5A 2IJYA 3ED3A 1MD4A 2H01A 4DSQA 3LG6A 1OC3A 3GSTA 1O6JA 2CX3A 4POMA 3GUSA 3WGXA 4G10A 2A2SA 5J41A 3VLNA 4DSRA 3DXBA 3LGCA 4GLTA 4OD7A 3EVIA 3Q6OA 5LCZA 4KAEA 5CRHA 2DIYA 4FH8A 2R4VA 4EO3A 2WCIA 5IPGA 4PTSA 5DALB 2B5EA 4TVEA 4TR4A 3PPUA 4PNFA 3V1WA 2K8VA 4RUVA 3HA9A 5F06A 3WYWA 2MBSA 4EL1A 2CT6A 3F4SA 5IO2A 3GKMA 2VCXA 2IMEA 1X5DA 5JWOB 1A24A 3DD3A 2FA8A 2M80A 1A2MA 2FA4A 1GSSA 5B7CA 3QAWA 1Z5YE 2MMNA 4N10A 1EEMA 4AF2A 4Q5NA 3HD5A 1FW1A 4MPGA 1GSQA 1T4ZA 1QGVA 2E2GA 4K9ZA 1JLWA 4ZB8A 3QPMA 3M0FA 3DGQA 4WR5A 1JZWA 2QGVA 3W6GA 4K1FA 1SL1B 2Z9SA 1A2JA 2N5BA 5D96A 5H5RA 3QFBC 5GAPD 3HVSA 3DEXA 1Z6MA 2NBSA 3HZ4A 1GULA 4HUAA 6GSVA 1O81A 5IMAA 3BCIA 2ES7A 1M2DA 3C8EA 3GYKA 1JZRA 1SJ6A 3VPQA 4RI7A 3GRXA 1OE8A 4HJ2A 3HXSA 1XWKA 1B9YC 2TRXA 3DRNA 1O8WA 3VI5A 4TW5A 4JE1A 3S9FA 4KDUA 1A23A 3CRTA 3KP9A 4MJAA 2PUKC 20GSA 1YEPA 5ECNB 1O73A 4ZB9A 2LQOA 1TP9A 4N0ZA 5DAKA 1N8JA 4WR4A 3KTBA 1URMA 2XBIA 3HDCA 1JHBA 2DJ2A 3IOSA 4QQ7A 2GQKA 3CTFA 5IO0A 1GSUA 3F3RA 1TTZA 2B5YA 1FVKA 4TOPA 2PN8A 3P2AA 1ZZYA 3FYGA 3L9UA 3ZYWA 2YV9A 2GS3A 1NHYA 3G7JA 1EGOA 2B5XA 1EOHA 2GZYA 3ZVJD 4IP1A 3F6FA 5B8BA 1T7PB 2YZUA 3EMPA 4LL1B 2IMIA 4LL4B 4AJ6A 3CTGA 2F9SA 2IMFA 4OFTA 3IA1A 2GSSA 2V2GA 2IIYA 1V9WA 8GSSA 4X43A 2WDUA 3TKRA 2GQLA 3O6TA 1EV9A 4ZILA 1ZYQB 3FY7A 1TU8A 4Q5QA 3P7XA 2FWGA 1XWCA 2O7KA
chains in the Genus database with same CATH superfamily
1SD9A 1FO5A 4IJ3A 3L0HA 2GDRA 2REMA 4TR1A 5LNKe 2AJQB 2E7PA 1R5PA 5D93A 1SKRB 3R3EA 2I4AA 4EUYA 1S3CA 5HR3A 4G0LA 4EXJA 5CO3A 4ULXA 5EPFA 2WFCA 2WW0A 2XBQA 4ZXGA 5KOWA 2H1GA 1TRWA 4OO5A 1X9WB 2TRCP 2H0IA 5CP1A 4WBRD 2O8VB 1T8EB 2WRTA 1GWCA 5IM9A 1ERTA 1TU7A 4K2DA 1NM3A 1FOVA 4WKWA 3L9SA 5HFGA 3RDWA 3EU3A 1F37A 2WVXB 4K2XA 2V32A 1Z3EA 1EOGA 3CWGA 3KCMA 1WPIA 1DE1A 2ON7A 1J9BA 4JBBA 3G9BA 2K8SA 1TI3A 4NXIA 2EIRA 4GRFA 1OKTA 2H6XA 4BL7B 6GSXA 1TRSA 1Y6EA 3R2QA 3J7Yb 2VLVA 1M3JA 4IKHA 2HQTA 2OBIA 3APOA 3ZREA 4K7OA 4IN0A 1Z7RA 4KDYA 3KM6A 3US3A 5A1NA 6GSYA 1WE0A 2HRKB 5CRGA 4FIWA 5D8IA 3KMOA 1PFOA 4MK3A 4F0CA 2DKIA 5AN1A 3I6AA 4ZBBA 4V2MA 3HCZA 1X0RA 4HS1A 2QA2A 4BVYA 2C3QA 4TXOB 3UL3A 3VWWA 4FXYP 5J5NA 3K8NA 2ZUPA 3LQ7A 3VWVA 4DSSB 2OKAA 2R0GA 1EV4A 3D0ZA 3KH9A 1U6TA 5G2ZA 3QR6A 2YPMA 5G5EA 4IQAA 1X5CA 4WETA 2L4QA 1IYHA 3ZVJA 1WJKA 4L0WA 2YV7A 2PMTA 2MBTA 4DVCA 2YZHA 4OFNA 1RW1A 10GSA 2L5OA 2WB9A 5A5HA 1FB0A 2HSNB 3UEMA 3APSA 1VF3A 5DAKB 3GX0A 5J3RA 3BOAA 1F3BA 4PI0C 2M72A 2R37A 2AYTA 3H93A 3GTUA 4WF5A 1BEDA 2NDOA 3MYDA 3DKSA 2K9FA 2HXKA 3DIEA 2PU9C 3HHVA 5COHA 2EIOA 4A5PA 3KJYA 3N5OA 5J47A 5C04A 1TW9A 3WT2A 4ML1A 4BVXB 2OT3A 2FGXA 3ERWA 4OO4A 1SVOA 2A2RA 3TCOA 1K0AA 2H6ZA 4KA0A 4AKIA 1QK8A 1R7HA 4JEDA 2HRAA 2XHFA 1K3YA 2GT6A 1U88A 5FWGA 4CDOA 1ERWA 3RPPA 5A4VA 2MMOA 1SKWB 1QXHA 4HI7A 2EFDA 2CVKA 2VCWA 1GUKA 3IE3A 1BF5A 3WGDA 3GHAA 3RGBC 2JL4A 2X99A 3F3QA 3DYRA 4XTSA 5IOWA 2DJ1A 4OFMA 2DJ3A 3QCPA 4GSNA 3GN3A 2F8AA 5FT3A 3TRQA 3UIWA 5ID2B 2KLXA 2O85A 4G9HA 5BRTA 1YKCA 4FYCA 1XCCA 1WWJA 4TR0A 1EWXA 4XS4A 2RUEA 1K0MA 2H19A 4WXTA 1SKSB 2YJ7A 1FAAA 2H75A 4G19A 4N11A 2WZ9A 3LXZA 4XS1A 1WOUA 1K0DA 2C3NA 1F9MA 3C7MA 3PH9A 4HZ2A 3UARA 4F82A 1EEJA 4MZWA 2NVLA 4BWSA 2EFCA 1MDIA 2O89A 2J9HA 4ML6A 1J08A 2I81A 3HMJG 3OR5A 5A34B 1F6MC 2DBCA 4OMVA 1Z9HA 3A5IA 1SK2A 4GXZA 3TKSC 1BX9A 3CYNA 1ZYPA 3TKSA 4MP4A 1YF0A 3SBCA 4LMWA 2V6KA 2H1DA 1X9SB 1XOBA 4POBA 1ZYNA 4CY8A 4H86A 3ZTLA 2H71A 3UMAA 1THXA 4JR6A 3UVHA 2AB6A 2YCDA 2JACA 5D73A 1GSDA 2E0QA 3JCML 4OCFA 2WW2A 4ECBA 1DSBA 6GSTA 4MMMA 4EDYA 4ZL9A 1XVWA 2CZ2A 2L57A 3FKFA 1O85A 1T1VA 1QFNA 4RQXA 4ZIJA 3ME7A 3D21A 1EP8A 3GKKA 2CQ9A 2YOIA 1YDKA 2OA7A 4ZB6A 1TK8B 2YWIA 3FZ5A 4Z2RA 4YAPA 2HZEA 4JU5A 3CSIA 3QFAC 4NAXA 2DIZA 4IVFA 3CQFA 2IFQB 5ENUA 2C80A 3QMXA 2L59A 5DCGA 5H5SA 5G1LA 14GSA 4O5RA 4PQ1A 4PX1A 4HOJA 3P8WA 2LRTA 4POLA 1GTUA 4IQ1A 1V40A 5ABRA 3GL5A 1BAYA 2V6OA 4NWYA 2JZRA 5AGYA 2OJLA 2XPDA 6GSSA 4BIKA 1PA3A 4PUFC 1U3AA 1EZKA 4HU9A 4N0VA 2VLUA 5DCHA 4EKZA 4TR3A 3DVWA 3UAPA 2GSRA 1DE2A 4MF6A 3ZFBA 1M2BA 1YVLA 3IC4A 4YQVA 1E6BA 1NW2A 3EPTA 2FNOA 2L6DA 4AKXB 3TOTA 5IMDA 1V2AA 4MZCA 2WS2A 2WGRA 3IDVA 3EYTA 4MH3A 4MF5A 5E4WA 3H4KA 3ZRDA 3C1SA 5F0GA 2GZPA 2HRNA 3HVXA 1K0OA 2WZSA 5IIZA 4O5UA 1F3AA 4PUAA 1ACVA 4IW9A 4MZBA 3G7YA 4G0KA 1V98A 4L5LA 4PHZC 4V1Ag 3LORA 1R5AA 4AJ7A 4G0IA 5EY6A 2VL3A 3M8NA 4ZBDA 2OACA 4HU7A 4MPFA 4G01A 1BJXA 1KNGA 3TJBA 2LJKA 3IHQA 1MD3A 3GL3A 2V1MA 2VM1A 3EC3A 1PKWA 4X0XA 5D9XA 3H1NA 1TRUA 4MJBA 2HLSA 1OKDA 5E59A 4YH2A 1NHOA 1ST9A 2R0CA 5ECIB 2C8UA 1LBKA 4HQZA 1O7UA 4NMUA 2FCHA 3ERGA 2FWFA 3KZQA 4K6XA 2H73A 3L78A 2I1UA 3QAVA 4ACSA 4OCEA 2O3EA 1UC7A 1KEBA 4X4JA 2NTOA 2EIQA 4K5RA 1HQOA 1AQVA 5KOXA 3GURA 2CVDA 1GSFA 5ECRB 1OE7A 4D73B 3EINA 1N25A 1B48A 1JLVA 5J9BA 4MH2A 1PQNA 5ECPB 4F2IA 4KNDA 4FO5A 4NHWA 2RIIA 2YJHA 5GSSA 3KEBA 3FRCA 1FB6A 4ECCA 2PVOC 1PN9A 1OC9A 1M9AA 3GNJA 2CAIA 1WMJA 1S3DA 6GSUA 4KCAA 1AXDA 2M46A 3D4TA 3PR8A 2LRCA 3TU3B 3ZZXA 1SYRA 4K7IA 4KSOA 5G1KA 3UBKA 4NHZA 5CYYA 1UVZA 4MNNA 4WBJA 2GQMA 4IP6A 4KDXA 1X5EA 3GKNA 5J4UA 3O3TA 5KN3A 4FYBA 2LUSA 2OE3A 3TKPA 3LYKA 3RHBA 2F3MA 5DQSA 2KUCA 5HR2A 3HYPA 3N9JA 4AKHA 1TDIA 4TKYA 2L5LA 3FZAA 1THOA 3ZITA 4XCSA 2FD3A 3ZL5A 3WD6A 4LMVA 3TRXA 3VWUA 3F9UA 4J2FA 5HR1A 4EC0A 2VCTA 2AUVA 2N5FA 1CQHA 5INYA 4WEYA 3TJJA 3QAGA 3F6DA 2PVQA 1XWBA 2LS5A 3C71A 5AISA 4DEJA 3EWLA 2PBJA 3NOFA 3FZ4A 5JWQB 1M3IA 4QMKA 5FHIA 1MEKA 1WRYA 4Q5FA 2LSTA 1XXUA 4V2LA 4PI2C 4L0UA 4EVMA 2GSTA 3LJRA 1VF2A 3VURA 5ELAA 3DVXA 3A3TA 2H74A 1A8YA 4KE3A 3NIVA 1PD21 2C0FA 2BMXA 2QA1A 4W66A 3CBUA 2QKEA 2RM6A 5ELGA 2VCVA 5BMUA 4Z2TA 2MMZA 1XW6A 2LEGA 2KP2A 2CAQA 4LLRA 2B7KA 4V2NA 2A4VA 4E8HA 2DJ0A 2R2JA 1TXXA 4Z7XA 4GF0A 1OYJA 4PURA 1SYXA 2BJXA 1GUHA 3A2WA 4MF7A 5DALA 2HSMA 5F05A 2ON5A 5JCUA 1EP7A 1YQ1A 4NV2A 5DQYA 3M9JA 2VD0A 4K5SA 1VGLA 2CV4A 2IMKA 2O5VA 3ZMKA 5KN2A 1JZOA 3ERFA 4POKA 2ALBA 3KTLA 1Q4JA 1BG5A 1YJ6A 1M2AA 1YZXA 3TGZA 1PRXA 2B6MA 3IRAA 4K0NA 2WULA 4YQUA 4FQUA 3HKRA 4GCIA 1HNAA 2YANA 22GSA 5D9WA 1FG4A 5DDLA 3TUEA 2PPTA 1ZCPA 2AHEA 1WP0A 4YQMA 3GH6A 2CX4A 2H1BA 5IMCA 4Z2UA 5ECLB 3A5WA 4AGSA 2PERA 1GTIA 1FVJA 5GAND 3D5JA 3TOUA 5C00A 2HYXA 3Q18A 2F51A 3VFIA 2QC7A 3KMNA 4MABA 2VAFA 2JZTA 1PL1A 2DMLA 2IMDA 2KHPA 1KTEA 3HY2A 4F0BA 3UOMA 5H5QA 4TR1B 2CA8A 1AW9A 3PGTA 2YWNA 4GQFA 4NV5A 1SL2B 3IPZA 2DC5A 1B4PA 5J4VA 2WJUA 3MIXA 1M0UA 2VLTA 3CMIA 3TJKA 1R26A 4BA7A 4KH7A 4EDZA 2VKZG 3D6IA 3DWVA 3RPNA 4K8MA 2WVYA 5IQYA 1BYEA 4I97A 2N5AA 3FZ9A 3LEFA 1TRVA 3U5RE 2CVBA 4KUNA 4O7HA 5EL8A 3ZMLA 3P90A 2WW3A 4PQIA 1T00A 2GT5A 4MLYA 12GSA 1PX6A 1VF4A 3IV4A 2EC4A 5J9CA 3M3MA 2HT9A 1YY7A 5CNWA 2X8GA 1FOHA 1KBNA 4ZL8A 3VI7A 2HZFA 2YWMA 3L4NA 1SENA 3IXRA 3C1RA 2AAWA 4I5QA 3HVNA 2H0HA 2JSZA 1PGTA 4PGTA 4P3YB 1B8XA 5CAXA 2B1LA 5J4YA 1IYIA 5HR0A 3GV1A 1LJRA 3L9VA 5B8AA 2LNSA 2VUPA 1C72A 2X8HA 4HSCX 16GSA 1RQMA 2R6KA 1ZL9A 5D9VA 2P5QA 13GSA 4I2UA 1ON4A 1TI1A 5A1NB 3QOUA 4E8EA 3IK7A 3BJ5A 3IR4A 4MCUA 3U6VA 4GSSA 1TK5B 3RHCA 3FW2A 1F2EA 1MTCA 5DJMA 3W8JA 4RQRA 5ECHB 3UBLA 5IMZA 5A4UA 2A2PA 4IJIA 1OVNA 2JZSA 2VIMA 1FHEA 2V41A 4BVYB 4GTUA 2NPBA 5CRWA 1QMVA 4USSA 3E0UA 2DLXA 2LV3A 3H8QA 2FWHA 4AKGA 2B1KA 3FMWA 3QDNA 2FY6A 5A5KA 2WVXA 1G6YA 4NPBA 1UN2A 4GQCA 1RK4A 1XBSA 2RUFA 2ZCTA 18GSA 3I9V2 1PKZA 3VWXA 1OC8A 5A4WA 5J40A 5AIXA 3FR3A 2HSMB 1XVQA 2IL3A 2L6CA 5ECKB 4BL7A 1HD2A 1MDJA 4EE0A 2OE0A 3ZFLA 5GZZB 5A5HB 3RFRC 4HEA2 1H4OA 2C4JA 3IK9A 1SJZA 4XRAA 3GIXA 3M9KA 3GTUB 3GSSA 1B4QA 2RLIA 4K7NA 4AI6A 4AJ8A 1ZYEA 3E9JB 3F63A 3CSHA 2VO4A 2BTOT 4QL7A 4KGIA 1ZOFA 2B7JA 1K3LA 4MJEA 5AIVA 5G5FA 3TKQA 3EMXA 1GNWA 5IOXA 2HRKA 1JZDA 4HQSA 3GFKA 1S4BP 4GWRA 3F0IA 1AQWA 3ME8A 2HSYA 4PQHA 2R3XA 5JCWA 3MNGA 3GMFA 1GLQA 4TXOA 3ZIVA 4V1Ap 2C0EA 1W89A 2AV4A 3WT1A 5CRDA 3FR6A 4DSSA 3M1GA 3D22A 1TKDB 1TXUA 2DJJA 3EU4A 2VL9A 1Q98A 3SWLA 1BG1A 2H72A 4IGJA 5ECSA 2DSAA 2X4AA 4KB3A 2HSNA 2X49A 3I69A 1G7OA 3KIJA 1EGRA 1VF1A 3ISOA 1G7EA 1TOFA 2QSIA 3CSJA 1SK0A 4WF4A 3WGEA 2MZCA 2LTKA 4XS4B 4TRXA 4HDEA 1ZMAA 1I5GA 1DUGA 2H0GA 1GRXA 2H8LA 4I2TA 2XPEA 1J0FA 4BVXA 1AUCA 4ZL7A 1G6WA 2CZ3A 5HFKA 5LD0A 1X9MB 4YKGA 2JADA 2K18A 3J7Yk 1M7TA 3IAS2 4BWQA 1XPVA 1XZOA 3KH7A 3MWHA 1GH2A 4QL9A 1YF1A 4JRRA 1XFLA 4RI6A 2VCZA 3Q74A 2FUG2 3CHXC 2H66A 1LU4A 1DBYA 2EFEA 2DMMA 1XW5A 4GSTA 5F8BA 4KX4A 1ILOA 2HNLA 1M9BA 1PSQA 5G30A 17GSA 4ID0A 2P0GA 3TJFA 5DBQA 2VD1A 1V58A 3CXGA 1YEXA 1T4YA 3FEUA 3BD2A 2UZ8A 2KOKA 3TJGA 3Q19A 4XS6A 2H1AA 5ID2A 2YNXA 4G2EA 3TDGA 5KN1A 4PNGA 1XWAA 2PWJA 1XWGA 4Q5RA 4ZBAA 4X1UA 1XG8A 3F4TA 1XOAA 1QQ2A 1S3RA 3KXOA 3KD0A 2H6YA 2JSYA 2H76A 3I43A 2VL2C 4EF0A 1K0NA 2F8FA 5ECOB 2VL2A 4TXVA 4ZB7A 2TIRA 1XW9A 2HZEB 3G7IA 5L71A 4GDFA 4IBPA 1W4VA 3LFLA 4I8BA 4J56E 1SK1A 5HQPA 3EURA 3DMLA 2DJKA 2B3SA 2YWOA 1SVLA 1AAZA 2OBKA 4LA1A 5A34A 4IS0A 1GNEA 1A8LA 2FWEA 1GTAA 5ECMB 3QD9A 1V57A 1YEWC 4O92A 4J57E 9GSSA 2VOCA 4KF9A 4KW6A 2GZZA 5KN0A 1T3BA 3GH9A 3NZNA 1XIYA 2GTUA 2HI7A 2RM5A 1TK0B 2EFHA 2OE1A 2D2ZA 4MA9A 3ZIJA 3VPTA 1SD8A 2E2MA 1K3OA 3UVTA 1U3IA 3FHKA 2I9HA 2YP6A 3TRPA 1A0FA 3BCKA 2G2QA 4N30A 2LRNA 1N2AA 6GSWA 2YN1A 2VM2A 4CW9A 4XHMA 1JFUA 2R5GA 4ECIA 2KP1A 4XRDA 1GSYA 1HYUA 2JU5A 1U87A 2LJAA 4KCEA 3APQA 2IFQA 1PX7A 3LWAA 1HNBA 1USBA 4K0GA 1S3AA 2HE3A 1PL2A 5JWRB 2GGTA 2J23A 4CHSA 7GSSA 2FHEA 5IMVA 2C3TA 2GSQA 1HNCA 2PGTA 2P31A 4HJMA 1K0BA 2IPAA 4ECJA 4FYUA 1I1IP 1GL8A 3HJPA 5D9TA 2UV8G 1SL0B 1A0RP 2L4CA 1BQ7A 2IWTA 1CQGA 1SVMA 3LYPA 4MDCA 2HRFA 2LKUA 5CREA 5DJLA 2MMAA 4F03A 2I3YA 3IAM2 3CRUA 4IELA 4O32A 4JR4A 3MAKA 4YAVA 4CY6A 1A2LA 5B6NA 4I6XA 1E2YA 1ZGNA 1M99A 3HJMA 1K0CA 3O76A 3VK9A 1ABAA 3FR9A 2C1YA 3BBYA 4JZQA 1QUWA 4L5OA 3RBTA 3KP8A 1VRSD 3W8SA 1AQXA 5IPHA 2G0FA 2XC2A 1SJIA 2HFDA 3GA4A 3HZ8A 1GP1A 2C0GA 5G31A 3C73A 3H79A 11GSA 5KEJA 2C0DA 3LXTA 1ML6A 1AC1A 3RAZA 1GTBA 4XIHA 2X8CA 4KSMA 1Z6NA 3AY8A 4OWYA 3MSZA 3IC8A 2FLSA 4ISDA 4ICYA 3ZLPA 5GSTA 2GLRA 1PMTA 1OC9B 1YKAA 4BPYA 4TN8A 1R4WA 5F07A 4MJCA 2O87A 4EIPA 1Y1UA 2IN3A 5HFIA 1H75A 4PXOA 3D4MA 2X64A 5ECQB 2K6VA 1NSWA 3E3EA 3KGKA 2OADA 5B6MA 4HZ4A 1GLPA 1SU9A 3GKXA 3A2VA 1ERUA 3MDKA 2GVPA 2LNTA 2MYGA 3TKSE 1ERVA 1Y25A 2HSHA 2LQQA 5JCGA 3EE2A 4IHUA 1GUMA 2ZNMA 1WIKA 2H30A 5IMFA 1B9XC 1Z7PA 3F8UA 3HJOA 3A2XA 4L8EA 3F4RA 2P5RA 4D73A 2H70A 5DVBA 1I9DA 1OAZA 3GX8A 1G0TA 1GSEA 3LSZA 3FK8A 3TB2A 19GSA 1AIUA 2LJRA 3UJ1A 1O8XA 2VCQA 3HVVA 1TJDA 1MDKA 4F9ZA 2WW1A 4ILFA 5EVOA 3IBHA 3PINA 1UA5A 2IJYA 3ED3A 1MD4A 2H01A 4DSQA 3LG6A 1OC3A 3GSTA 2WVZA 1O6JA 2CX3A 4POMA 3GUSA 3WGXA 4G10A 2A2SA 5J41A 3VLNA 4DSRA 3DXBA 3LGCA 4GLTA 5BMUB 4OD7A 3EVIA 3Q6OA 5LCZA 4KAEA 5CRHA 2R0PA 2DIYA 4FH8A 2R4VA 4EO3A 2WCIA 5IPGA 4PTSA 5DALB 2B5EA 2O36A 4TVEA 4TR4A 3PPUA 4EIQA 4PNFA 3V1WA 2K8VA 4RUVA 3HA9A 5F06A 3WYWA 3IHGA 2MBSA 4EL1A 2CT6A 3F4SA 5IO2A 3GKMA 4O5QA 2VCXA 2IMEA 1X5DA 5JWOB 1A24A 3DD3A 2FA8A 2M80A 1A2MA 2FA4A 1PN0A 1GSSA 5B7CA 3QAWA 1Z5YE 2MMNA 4N10A 1EEMA 4AF2A 4Q5NA 3HD5A 1FW1A 4MPGA 2DKHA 1GSQA 1T4ZA 1QGVA 2E2GA 1JLWA 4K9ZA 4ZB8A 3QPMA 3M0FA 3DGQA 4WR5A 1JZWA 2QGVA 3W6GA 4K1FA 1SL1B 2Z9SA 1A2JA 2N5BA 5D96A 5H5RA 3QFBC 5GAPD 3HVSA 3DEXA 1Z6MA 2NBSA 3HZ4A 1GULA 4HUAA 6GSVA 1O81A 2A4HA 5IMAA 3BCIA 2ES7A 1M2DA 3C8EA 3GYKA 1JZRA 1SJ6A 3VPQA 4RI7A 3GRXA 1OE8A 4HJ2A 4N3ZA 3HXSA 3DRNA 1XWKA 1B9YC 2TRXA 1O8WA 4YKFA 3VI5A 4TW5A 4JE1A 3S9FA 4KDUA 1A23A 3CRTA 3KP9A 4MJAA 2PUKC 20GSA 1YEPA 5ECNB 1O73A 4ZB9A 2LQOA 1TP9A 4N0ZA 5DAKA 1N8JA 4WR4A 4E68A 3KTBA 1URMA 2XBIA 3HDCA 1JHBA 2DJ2A 3IOSA 4QQ7A 2GQKA 3CTFA 5IO0A 1GSUA 3F3RA 1TTZA 2B5YA 1FVKA 4TOPA 2PN8A 3P2AA 1ZZYA 3FYGA 3L9UA 3ZYWA 2YV9A 2GS3A 1NHYA 3G7JA 1EGOA 2B5XA 1EOHA 2GZYA 3ZVJD 4IP1A 3F6FA 5B8BA 3LW9A 1T7PB 2YZUA 3EMPA 4LL1B 2IMIA 4LL4B 4AJ6A 3CTGA 2F9SA 2IMFA 2H1LA 4OFTA 3IA1A 2GSSA 2V2GA 2IIYA 1V9WA 8GSSA 4X43A 2WDUA 3TKRA 2GQLA 3O6TA 1EV9A 4ZILA 1ZYQB 3FY7A 1TU8A 4Q5QA 3P7XA 2FWGA 1XWCA 2O7KA
chains in the Genus database with same CATH topology
1SD9A 1FO5A 4IJ3A 3L0HA 2GDRA 2REMA 4TR1A 5LNKe 2AJQB 2E7PA 1R5PA 5D93A 1SKRB 3R3EA 2I4AA 4EUYA 1S3CA 5HR3A 4G0LA 4EXJA 5CO3A 4ULXA 5EPFA 2WFCA 2XBQA 4ZXGA 5KOWA 2H1GA 1TRWA 4OO5A 1X9WB 2TRCP 2H0IA 5CP1A 4WBRD 2O8VB 1T8EB 2WRTA 1GWCA 5IM9A 1ERTA 1TU7A 4K2DA 1NM3A 1FOVA 4WKWA 3L9SA 5HFGA 3RDWA 3EU3A 1F37A 4K2XA 2V32A 1Z3EA 1EOGA 3CWGA 3KCMA 1WPIA 1DE1A 2ON7A 1J9BA 4JBBA 3G9BA 2K8SA 1TI3A 4NXIA 2EIRA 4GRFA 1OKTA 2H6XA 4BL7B 6GSXA 1TRSA 1Y6EA 3R2QA 3J7Yb 2VLVA 4IKHA 2HQTA 2OBIA 3APOA 3ZREA 4K7OA 4IN0A 1Z7RA 4KDYA 3KM6A 3US3A 5A1NA 6GSYA 1WE0A 2HRKB 5CRGA 4FIWA 5D8IA 3KMOA 4MK3A 4F0CA 2DKIA 5AN1A 3I6AA 4ZBBA 4V2MA 3HCZA 1X0RA 4HS1A 2QA2A 4BVYA 2C3QA 4TXOB 3UL3A 3VWWA 5J5NA 3K8NA 2ZUPA 3LQ7A 3VWVA 4DSSB 2OKAA 2R0GA 1EV4A 3D0ZA 3KH9A 1U6TA 5G2ZA 3QR6A 2YPMA 5G5EA 4IQAA 1X5CA 4WETA 2L4QA 1IYHA 3ZVJA 1WJKA 4L0WA 2YV7A 2PMTA 2MBTA 4DVCA 2YZHA 4OFNA 1RW1A 10GSA 2L5OA 2WB9A 5A5HA 1FB0A 2HSNB 3UEMA 3APSA 1VF3A 5DAKB 3GX0A 5J3RA 3BOAA 1F3BA 2M72A 2R37A 2AYTA 3H93A 3GTUA 4WF5A 1BEDA 2NDOA 3MYDA 3DKSA 2K9FA 2HXKA 3DIEA 2PU9C 3HHVA 5COHA 2EIOA 4A5PA 3KJYA 3N5OA 5J47A 5C04A 1TW9A 3WT2A 4ML1A 4BVXB 2OT3A 2FGXA 3ERWA 4OO4A 1SVOA 2A2RA 3TCOA 1K0AA 2H6ZA 4KA0A 4AKIA 1QK8A 1R7HA 4JEDA 2HRAA 2XHFA 1K3YA 2GT6A 1U88A 5FWGA 4CDOA 1ERWA 3RPPA 5A4VA 2MMOA 1SKWB 1QXHA 4HI7A 2EFDA 2CVKA 2VCWA 1GUKA 3IE3A 1BF5A 3WGDA 3GHAA 2JL4A 2X99A 3F3QA 3DYRA 4XTSA 5IOWA 2DJ1A 4OFMA 2DJ3A 3QCPA 4GSNA 3GN3A 2F8AA 5FT3A 3TRQA 3UIWA 5ID2B 2KLXA 2O85A 4G9HA 5BRTA 1YKCA 4FYCA 1XCCA 1WWJA 4TR0A 1EWXA 4XS4A 2RUEA 1K0MA 2H19A 4WXTA 1SKSB 2YJ7A 1FAAA 2H75A 4G19A 4N11A 2WZ9A 3LXZA 4XS1A 1WOUA 1K0DA 2C3NA 1F9MA 3C7MA 3PH9A 4HZ2A 3UARA 4F82A 1EEJA 4MZWA 2NVLA 4BWSA 2EFCA 1MDIA 2O89A 2J9HA 4ML6A 1J08A 2I81A 3HMJG 3OR5A 5A34B 1F6MC 2DBCA 4OMVA 1Z9HA 3A5IA 1SK2A 4GXZA 3TKSC 1BX9A 3CYNA 1ZYPA 3TKSA 4MP4A 1YF0A 3SBCA 4LMWA 2V6KA 2H1DA 1X9SB 1XOBA 4POBA 1ZYNA 4CY8A 4H86A 3ZTLA 2H71A 3UMAA 1THXA 4JR6A 3UVHA 2AB6A 2YCDA 2JACA 5D73A 1GSDA 2E0QA 3JCML 4OCFA 4ECBA 1DSBA 6GSTA 4MMMA 4EDYA 4ZL9A 1XVWA 2CZ2A 2L57A 3FKFA 1O85A 1T1VA 1QFNA 4RQXA 4ZIJA 3ME7A 3D21A 1EP8A 3GKKA 2CQ9A 2YOIA 1YDKA 2OA7A 4ZB6A 1TK8B 2YWIA 3FZ5A 4Z2RA 4YAPA 2HZEA 4JU5A 3CSIA 3QFAC 4NAXA 2DIZA 4IVFA 2IFQB 5ENUA 2C80A 3QMXA 2L59A 5DCGA 5H5SA 5G1LA 14GSA 4O5RA 4PQ1A 4PX1A 4HOJA 3P8WA 2LRTA 4POLA 1GTUA 4IQ1A 1V40A 5ABRA 3GL5A 1BAYA 2V6OA 4NWYA 2JZRA 5AGYA 2OJLA 2XPDA 6GSSA 1PA3A 4PUFC 1U3AA 1EZKA 4HU9A 4N0VA 2VLUA 5DCHA 4EKZA 4TR3A 3DVWA 3UAPA 2GSRA 1DE2A 4MF6A 3ZFBA 1M2BA 1YVLA 3IC4A 4YQVA 1E6BA 1NW2A 3EPTA 2FNOA 2L6DA 4AKXB 3TOTA 5IMDA 1V2AA 4MZCA 2WS2A 2WGRA 3IDVA 3EYTA 4MH3A 4MF5A 5E4WA 3H4KA 3ZRDA 3C1SA 5F0GA 2GZPA 2HRNA 3HVXA 1K0OA 5IIZA 4O5UA 1F3AA 4PUAA 1ACVA 4IW9A 4MZBA 3G7YA 4G0KA 1V98A 4L5LA 4V1Ag 3LORA 1R5AA 4AJ7A 4G0IA 5EY6A 2VL3A 3M8NA 4ZBDA 2OACA 4HU7A 4MPFA 4G01A 1BJXA 1KNGA 3TJBA 2LJKA 3IHQA 1MD3A 3GL3A 2V1MA 2VM1A 3EC3A 1PKWA 4X0XA 5D9XA 3H1NA 1TRUA 4MJBA 2HLSA 1OKDA 5E59A 4YH2A 1NHOA 1ST9A 2R0CA 5ECIB 2C8UA 1LBKA 4HQZA 1O7UA 4NMUA 2FCHA 3ERGA 2FWFA 3KZQA 4K6XA 2H73A 3L78A 2I1UA 3QAVA 4ACSA 4OCEA 1UC7A 1KEBA 4X4JA 2NTOA 2EIQA 4K5RA 1HQOA 1AQVA 5KOXA 3GURA 2CVDA 1GSFA 5ECRB 1OE7A 4D73B 3EINA 1N25A 1B48A 1JLVA 5J9BA 4MH2A 1PQNA 5ECPB 4F2IA 4KNDA 4FO5A 4NHWA 2RIIA 2YJHA 5GSSA 3KEBA 3FRCA 1FB6A 4ECCA 2PVOC 1PN9A 1OC9A 1M9AA 3GNJA 2CAIA 1WMJA 1S3DA 6GSUA 4KCAA 1AXDA 2M46A 3D4TA 3PR8A 2LRCA 3TU3B 3ZZXA 1SYRA 4K7IA 4KSOA 5G1KA 3UBKA 4NHZA 5CYYA 1UVZA 4MNNA 4WBJA 2GQMA 4IP6A 4KDXA 1X5EA 3GKNA 5J4UA 3O3TA 5KN3A 4FYBA 2LUSA 2OE3A 3TKPA 3LYKA 3RHBA 2F3MA 5DQSA 2KUCA 5HR2A 3HYPA 3N9JA 4AKHA 1TDIA 4TKYA 2L5LA 3FZAA 1THOA 3ZITA 4XCSA 2FD3A 3ZL5A 3WD6A 4LMVA 3TRXA 3VWUA 3F9UA 4J2FA 5HR1A 4EC0A 2VCTA 2AUVA 2N5FA 1CQHA 5INYA 4WEYA 3TJJA 3QAGA 3F6DA 2PVQA 1XWBA 2LS5A 3C71A 5AISA 4DEJA 3EWLA 2PBJA 3NOFA 3FZ4A 5JWQB 4QMKA 5FHIA 1MEKA 1WRYA 4Q5FA 2LSTA 1XXUA 4V2LA 4L0UA 4EVMA 2GSTA 3LJRA 1VF2A 3VURA 5ELAA 3DVXA 3A3TA 2H74A 1A8YA 4KE3A 3NIVA 1PD21 2C0FA 2BMXA 2QA1A 4W66A 3CBUA 2QKEA 2RM6A 5ELGA 2VCVA 5BMUA 4Z2TA 2MMZA 1XW6A 2LEGA 2KP2A 2CAQA 4LLRA 2B7KA 4V2NA 2A4VA 4E8HA 2DJ0A 2R2JA 1TXXA 4Z7XA 4GF0A 1OYJA 4PURA 1SYXA 2BJXA 1GUHA 3A2WA 4MF7A 5DALA 2HSMA 5F05A 2ON5A 5JCUA 1EP7A 1YQ1A 4NV2A 5DQYA 3M9JA 2VD0A 4K5SA 1VGLA 2CV4A 2IMKA 2O5VA 3ZMKA 5KN2A 1JZOA 3ERFA 4POKA 2ALBA 3KTLA 1Q4JA 1BG5A 1YJ6A 1M2AA 1YZXA 3TGZA 1PRXA 2B6MA 3IRAA 4K0NA 2WULA 4YQUA 4FQUA 3HKRA 4GCIA 1HNAA 2YANA 22GSA 5D9WA 1FG4A 5DDLA 3TUEA 2PPTA 1ZCPA 2AHEA 1WP0A 4YQMA 3GH6A 2CX4A 2H1BA 5IMCA 4Z2UA 5ECLB 3A5WA 4AGSA 2PERA 1GTIA 1FVJA 5GAND 3D5JA 3TOUA 5C00A 2HYXA 3Q18A 2F51A 3VFIA 2QC7A 3KMNA 4MABA 2VAFA 2JZTA 1PL1A 2DMLA 2IMDA 2KHPA 1KTEA 3HY2A 4F0BA 3UOMA 5H5QA 4TR1B 2CA8A 1AW9A 3PGTA 2YWNA 4GQFA 4NV5A 1SL2B 3IPZA 2DC5A 1B4PA 5J4VA 2WJUA 3MIXA 1M0UA 2VLTA 3CMIA 3TJKA 1R26A 4BA7A 4KH7A 4EDZA 2VKZG 3D6IA 3DWVA 3RPNA 4K8MA 5IQYA 1BYEA 4I97A 2N5AA 3FZ9A 3LEFA 1TRVA 3U5RE 2CVBA 4KUNA 4O7HA 5EL8A 3ZMLA 3P90A 4PQIA 1T00A 2GT5A 4MLYA 12GSA 1PX6A 1VF4A 3IV4A 2EC4A 5J9CA 3M3MA 2HT9A 1YY7A 5CNWA 2X8GA 1FOHA 1KBNA 4ZL8A 3VI7A 2HZFA 2YWMA 3L4NA 1SENA 3IXRA 3C1RA 2AAWA 4I5QA 2H0HA 2JSZA 1PGTA 4PGTA 4P3YB 1B8XA 5CAXA 2B1LA 5J4YA 1IYIA 5HR0A 3GV1A 1LJRA 3L9VA 5B8AA 2LNSA 2VUPA 1C72A 2X8HA 16GSA 1RQMA 2R6KA 1ZL9A 5D9VA 2P5QA 13GSA 4I2UA 1ON4A 1TI1A 5A1NB 3QOUA 4E8EA 3IK7A 3BJ5A 3IR4A 4MCUA 3U6VA 4GSSA 1TK5B 3RHCA 3FW2A 1F2EA 1MTCA 5DJMA 3W8JA 4RQRA 5ECHB 3UBLA 5IMZA 5A4UA 2A2PA 4IJIA 1OVNA 2JZSA 2VIMA 1FHEA 2V41A 4BVYB 4GTUA 2NPBA 5CRWA 1QMVA 4USSA 3E0UA 2DLXA 2LV3A 3H8QA 2FWHA 4AKGA 2B1KA 3FMWA 3QDNA 2FY6A 5A5KA 1G6YA 4NPBA 1UN2A 4GQCA 1RK4A 1XBSA 2RUFA 2ZCTA 18GSA 3I9V2 1PKZA 3VWXA 1OC8A 5A4WA 5J40A 5AIXA 3FR3A 2HSMB 1XVQA 2IL3A 2L6CA 5ECKB 4BL7A 1HD2A 1MDJA 4EE0A 2OE0A 3ZFLA 5GZZB 5A5HB 4HEA2 1H4OA 2C4JA 3IK9A 1SJZA 4XRAA 3GIXA 3M9KA 3GTUB 3GSSA 1B4QA 2RLIA 4K7NA 4AI6A 4AJ8A 1ZYEA 3E9JB 3F63A 3CSHA 2VO4A 2BTOT 4QL7A 4KGIA 1ZOFA 2B7JA 1K3LA 4MJEA 5AIVA 5G5FA 3TKQA 3EMXA 1GNWA 5IOXA 2HRKA 1JZDA 4HQSA 3GFKA 4GWRA 3F0IA 1AQWA 3ME8A 2HSYA 4PQHA 2R3XA 5JCWA 3MNGA 3GMFA 1GLQA 4TXOA 3ZIVA 4V1Ap 2C0EA 1W89A 2AV4A 3WT1A 5CRDA 3FR6A 4DSSA 3M1GA 3D22A 1TKDB 1TXUA 2DJJA 3EU4A 2VL9A 1Q98A 3SWLA 1BG1A 2H72A 4IGJA 5ECSA 2DSAA 2X4AA 4KB3A 2HSNA 2X49A 3I69A 1G7OA 3KIJA 1EGRA 1VF1A 3ISOA 1G7EA 1TOFA 2QSIA 3CSJA 1SK0A 4WF4A 3WGEA 2MZCA 2LTKA 4XS4B 4TRXA 4HDEA 1ZMAA 1I5GA 1DUGA 2H0GA 1GRXA 2H8LA 4I2TA 2XPEA 1J0FA 4BVXA 1AUCA 4ZL7A 1G6WA 2CZ3A 5HFKA 5LD0A 1X9MB 4YKGA 2JADA 2K18A 3J7Yk 1M7TA 3IAS2 4BWQA 1XPVA 1XZOA 3KH7A 3MWHA 1GH2A 4QL9A 1YF1A 4JRRA 1XFLA 4RI6A 2VCZA 3Q74A 2FUG2 2H66A 1LU4A 1DBYA 2EFEA 2DMMA 1XW5A 4GSTA 5F8BA 4KX4A 1ILOA 2HNLA 1M9BA 1PSQA 5G30A 17GSA 4ID0A 2P0GA 3TJFA 5DBQA 2VD1A 1V58A 3CXGA 1YEXA 1T4YA 3FEUA 3BD2A 2UZ8A 2KOKA 3TJGA 3Q19A 4XS6A 2H1AA 5ID2A 2YNXA 4G2EA 3TDGA 5KN1A 4PNGA 1XWAA 2PWJA 1XWGA 4Q5RA 4ZBAA 4X1UA 3F4TA 1XOAA 1QQ2A 3KXOA 3KD0A 2H6YA 2JSYA 2H76A 3I43A 2VL2C 4EF0A 1K0NA 2F8FA 5ECOB 2VL2A 4TXVA 4ZB7A 2TIRA 1XW9A 2HZEB 3G7IA 5L71A 4GDFA 4IBPA 1W4VA 3LFLA 4I8BA 4J56E 1SK1A 5HQPA 3EURA 3DMLA 2DJKA 2B3SA 2YWOA 1SVLA 1AAZA 2OBKA 4LA1A 5A34A 4IS0A 1GNEA 1A8LA 2FWEA 1GTAA 5ECMB 3QD9A 1V57A 4J57E 4O92A 9GSSA 2VOCA 4KF9A 4KW6A 2GZZA 5KN0A 1T3BA 3GH9A 3NZNA 1XIYA 2GTUA 2HI7A 2RM5A 1TK0B 2EFHA 2OE1A 2D2ZA 4MA9A 3ZIJA 3VPTA 1SD8A 2E2MA 1K3OA 3UVTA 1U3IA 3FHKA 2I9HA 2YP6A 3TRPA 1A0FA 3BCKA 2G2QA 4N30A 2LRNA 1N2AA 6GSWA 2YN1A 2VM2A 4CW9A 4XHMA 1JFUA 2R5GA 4ECIA 2KP1A 4XRDA 1GSYA 1HYUA 2JU5A 1U87A 2LJAA 4KCEA 3APQA 2IFQA 1PX7A 3LWAA 1HNBA 1USBA 4K0GA 1S3AA 2HE3A 1PL2A 5JWRB 2GGTA 2J23A 4CHSA 7GSSA 2FHEA 5IMVA 2C3TA 2GSQA 1HNCA 2PGTA 2P31A 4HJMA 1K0BA 2IPAA 4ECJA 4FYUA 1GL8A 3HJPA 5D9TA 2UV8G 1SL0B 1A0RP 2L4CA 1BQ7A 2IWTA 1CQGA 1SVMA 3LYPA 4MDCA 2HRFA 2LKUA 5CREA 5DJLA 2MMAA 4F03A 2I3YA 3IAM2 3CRUA 4IELA 4O32A 4JR4A 3MAKA 4YAVA 4CY6A 1A2LA 5B6NA 4I6XA 1E2YA 1ZGNA 1M99A 3HJMA 1K0CA 3O76A 3VK9A 1ABAA 3FR9A 2C1YA 3BBYA 4JZQA 1QUWA 4L5OA 3RBTA 3KP8A 1VRSD 3W8SA 1AQXA 5IPHA 2G0FA 2XC2A 1SJIA 2HFDA 3GA4A 3HZ8A 1GP1A 2C0GA 5G31A 3C73A 3H79A 11GSA 5KEJA 2C0DA 3LXTA 1ML6A 1AC1A 3RAZA 1GTBA 4XIHA 2X8CA 4KSMA 1Z6NA 3AY8A 4OWYA 3MSZA 3IC8A 2FLSA 4ISDA 4ICYA 3ZLPA 5GSTA 2GLRA 1PMTA 1OC9B 1YKAA 4BPYA 4TN8A 1R4WA 5F07A 4MJCA 2O87A 4EIPA 1Y1UA 2IN3A 5HFIA 1H75A 4PXOA 3D4MA 2X64A 5ECQB 2K6VA 1NSWA 3E3EA 3KGKA 2OADA 5B6MA 4HZ4A 1GLPA 1SU9A 3GKXA 3A2VA 1ERUA 3MDKA 2GVPA 2LNTA 2MYGA 3TKSE 1ERVA 1Y25A 2HSHA 2LQQA 5JCGA 3EE2A 4IHUA 1GUMA 2ZNMA 1WIKA 2H30A 5IMFA 1B9XC 1Z7PA 3F8UA 3HJOA 3A2XA 4L8EA 3F4RA 2P5RA 4D73A 2H70A 5DVBA 1I9DA 1OAZA 3GX8A 1G0TA 1GSEA 3LSZA 3FK8A 3TB2A 19GSA 1AIUA 2LJRA 3UJ1A 1O8XA 2VCQA 3HVVA 1TJDA 1MDKA 4F9ZA 4ILFA 5EVOA 3IBHA 3PINA 1UA5A 2IJYA 3ED3A 1MD4A 2H01A 4DSQA 3LG6A 1OC3A 3GSTA 1O6JA 2CX3A 4POMA 3GUSA 3WGXA 4G10A 2A2SA 5J41A 3VLNA 4DSRA 3DXBA 3LGCA 4GLTA 5BMUB 4OD7A 3EVIA 3Q6OA 5LCZA 4KAEA 5CRHA 2R0PA 2DIYA 4FH8A 2R4VA 4EO3A 2WCIA 5IPGA 4PTSA 5DALB 2B5EA 4TVEA 4TR4A 3PPUA 4EIQA 4PNFA 3V1WA 2K8VA 4RUVA 3HA9A 5F06A 3WYWA 3IHGA 2MBSA 4EL1A 2CT6A 3F4SA 5IO2A 3GKMA 4O5QA 2VCXA 2IMEA 1X5DA 5JWOB 1A24A 3DD3A 2FA8A 2M80A 1A2MA 2FA4A 1PN0A 1GSSA 5B7CA 3QAWA 1Z5YE 2MMNA 4N10A 1EEMA 4AF2A 4Q5NA 3HD5A 1FW1A 4MPGA 2DKHA 1GSQA 1T4ZA 1QGVA 2E2GA 1JLWA 4K9ZA 4ZB8A 3QPMA 3M0FA 3DGQA 4WR5A 1JZWA 2QGVA 3W6GA 4K1FA 1SL1B 2Z9SA 1A2JA 2N5BA 5D96A 5H5RA 3QFBC 5GAPD 3HVSA 3DEXA 1Z6MA 2NBSA 3HZ4A 1GULA 4HUAA 6GSVA 1O81A 2A4HA 5IMAA 3BCIA 2ES7A 1M2DA 3C8EA 3GYKA 1JZRA 1SJ6A 3VPQA 4RI7A 3GRXA 1OE8A 4HJ2A 4N3ZA 3HXSA 3DRNA 1XWKA 1B9YC 2TRXA 1O8WA 4YKFA 3VI5A 4TW5A 4JE1A 3S9FA 4KDUA 1A23A 3CRTA 3KP9A 4MJAA 2PUKC 20GSA 1YEPA 5ECNB 1O73A 4ZB9A 2LQOA 1TP9A 4N0ZA 5DAKA 1N8JA 4WR4A 4E68A 3KTBA 1URMA 2XBIA 3HDCA 1JHBA 2DJ2A 3IOSA 4QQ7A 2GQKA 3CTFA 5IO0A 1GSUA 3F3RA 1TTZA 2B5YA 1FVKA 4TOPA 2PN8A 3P2AA 1ZZYA 3FYGA 3L9UA 3ZYWA 2YV9A 2GS3A 1NHYA 3G7JA 1EGOA 2B5XA 1EOHA 2GZYA 3ZVJD 4IP1A 3F6FA 5B8BA 3LW9A 1T7PB 2YZUA 3EMPA 4LL1B 2IMIA 4LL4B 4AJ6A 3CTGA 2F9SA 2IMFA 2H1LA 4OFTA 3IA1A 2GSSA 2V2GA 2IIYA 1V9WA 8GSSA 4X43A 2WDUA 3TKRA 2GQLA 3O6TA 1EV9A 4ZILA 1ZYQB 3FY7A 1TU8A 4Q5QA 3P7XA 2FWGA 1XWCA 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD9 A;  1FO5 A;  4IJ3 A;  3L0H A;  2GDR A;  2REM A;  4TR1 A;  5LNK e;  2AJQ B;  2E7P A;  1R5P A;  5D93 A;  1SKR B;  3R3E A;  2I4A A;  4EUY A;  1S3C A;  5HR3 A;  4G0L A;  4EXJ A;  5CO3 A;  4ULX A;  5EPF A;  2WFC A;  2XBQ A;  4ZXG A;  2H1G A;  1TRW A;  4OO5 A;  1X9W B;  2TRC P;  2H0I A;  5CP1 A;  4WBR D;  2O8V B;  1T8E B;  2WRT A;  1GWC A;  5IM9 A;  1ERT A;  1TU7 A;  4K2D A;  1NM3 A;  1FOV A;  4WKW A;  3L9S A;  5HFG A;  3RDW A;  3EU3 A;  1F37 A;  2V32 A;  1Z3E A;  1EOG A;  3KCM A;  1WPI A;  1DE1 A;  2ON7 A;  1J9B A;  4JBB A;  3G9B A;  2K8S A;  1TI3 A;  4NXI A;  2EIR A;  4GRF A;  1OKT A;  2H6X A;  4BL7 B;  6GSX A;  1TRS A;  1Y6E A;  3R2Q A;  3J7Y b;  2VLV A;  4IKH A;  2HQT A;  2OBI A;  3APO A;  3ZRE A;  4K7O A;  4IN0 A;  1Z7R A;  4KDY A;  3KM6 A;  3US3 A;  6GSY A;  1WE0 A;  2HRK B;  5CRG A;  4FIW A;  5D8I A;  3KMO A;  4MK3 A;  4F0C A;  5AN1 A;  3I6A A;  4ZBB A;  4V2M A;  3HCZ A;  1X0R A;  4HS1 A;  4BVY A;  2C3Q A;  4TXO B;  3UL3 A;  3VWW A;  5J5N A;  3K8N A;  2ZUP A;  3LQ7 A;  3VWV A;  4DSS B;  2OKA A;  3KH9 A;  1EV4 A;  3D0Z A;  1U6T A;  5G2Z A;  3QR6 A;  2YPM A;  5G5E A;  4IQA A;  1X5C A;  4WET A;  2L4Q A;  1IYH A;  3ZVJ A;  1WJK A;  4L0W A;  2YV7 A;  2PMT A;  2MBT A;  4DVC A;  2YZH A;  4OFN A;  1RW1 A;  10GS A;  2L5O A;  2WB9 A;  1FB0 A;  2HSN B;  3UEM A;  3APS A;  1VF3 A;  5DAK B;  3GX0 A;  5J3R A;  3BOA A;  1F3B A;  2M72 A;  2R37 A;  2AYT A;  3H93 A;  3GTU A;  4WF5 A;  1BED A;  2NDO A;  3DKS A;  2K9F A;  2HXK A;  3DIE A;  2PU9 C;  3HHV A;  5COH A;  2EIO A;  3KJY A;  3N5O A;  5C04 A;  1TW9 A;  3WT2 A;  4ML1 A;  4BVX B;  2FGX A;  3ERW A;  4OO4 A;  2A2R A;  3TCO A;  1K0A A;  2H6Z A;  4KA0 A;  1QK8 A;  1R7H A;  4JED A;  2HRA A;  2XHF A;  1K3Y A;  2GT6 A;  1U88 A;  5FWG A;  4CDO A;  1ERW A;  3RPP A;  5A4V A;  2MMO A;  1SKW B;  1QXH A;  4HI7 A;  2CVK A;  2VCW A;  1GUK A;  3IE3 A;  3WGD A;  3GHA A;  2JL4 A;  2X99 A;  3F3Q A;  3DYR A;  4XTS A;  5IOW A;  2DJ1 A;  4OFM A;  2DJ3 A;  3QCP A;  4GSN A;  3GN3 A;  2F8A A;  5FT3 A;  3TRQ A;  3UIW A;  5ID2 B;  2KLX A;  2O85 A;  4G9H A;  1YKC A;  4FYC A;  1XCC A;  1WWJ A;  4TR0 A;  1EWX A;  4XS4 A;  2RUE A;  1K0M A;  2H19 A;  4WXT A;  1SKS B;  2YJ7 A;  1FAA A;  2H75 A;  4G19 A;  4N11 A;  2WZ9 A;  3LXZ A;  4XS1 A;  1WOU A;  1K0D A;  2C3N A;  1F9M A;  3C7M A;  3PH9 A;  4HZ2 A;  3UAR A;  4F82 A;  1EEJ A;  4MZW A;  2NVL A;  4BWS A;  1MDI A;  2O89 A;  2J9H A;  4ML6 A;  1J08 A;  2I81 A;  3OR5 A;  1F6M C;  2DBC A;  4OMV A;  1Z9H A;  1SK2 A;  4GXZ A;  3TKS C;  1BX9 A;  3CYN A;  3TKS A;  4MP4 A;  1YF0 A;  3SBC A;  4LMW A;  2V6K A;  2H1D A;  1X9S B;  1XOB A;  4POB A;  4H86 A;  3ZTL A;  2H71 A;  3UMA A;  1THX A;  4JR6 A;  3UVH A;  2AB6 A;  2YCD A;  2JAC A;  5D73 A;  1GSD A;  2E0Q A;  3JCM L;  4OCF A;  4ECB A;  1DSB A;  6GST A;  4MMM A;  4EDY A;  4ZL9 A;  1XVW A;  2CZ2 A;  2L57 A;  3FKF A;  1O85 A;  1T1V A;  1QFN A;  4RQX A;  4ZIJ A;  3ME7 A;  3D21 A;  1EP8 A;  3GKK A;  2CQ9 A;  2YOI A;  1YDK A;  2OA7 A;  4ZB6 A;  1TK8 B;  2YWI A;  3FZ5 A;  4YAP A;  2HZE A;  4JU5 A;  3CSI A;  3QFA C;  4NAX A;  2DIZ A;  4IVF A;  2IFQ B;  5ENU A;  2C80 A;  3QMX A;  2L59 A;  5DCG A;  5H5S A;  5G1L A;  14GS A;  4O5R A;  4PQ1 A;  4PX1 A;  4HOJ A;  3P8W A;  2LRT A;  4POL A;  1GTU A;  4IQ1 A;  1V40 A;  5ABR A;  3GL5 A;  1BAY A;  2V6O A;  4NWY A;  2JZR A;  5AGY A;  2OJL A;  2XPD A;  6GSS A;  1PA3 A;  4PUF C;  1U3A A;  1EZK A;  4HU9 A;  4N0V A;  2VLU A;  5DCH A;  4EKZ A;  4TR3 A;  3DVW A;  3UAP A;  2GSR A;  1DE2 A;  4MF6 A;  3ZFB A;  1M2B A;  3IC4 A;  4YQV A;  1E6B A;  1NW2 A;  2FNO A;  2L6D A;  3TOT A;  5IMD A;  1V2A A;  4MZC A;  2WS2 A;  2WGR A;  3IDV A;  3EYT A;  4MH3 A;  4MF5 A;  5E4W A;  3H4K A;  3ZRD A;  3C1S A;  5F0G A;  2GZP A;  2HRN A;  3HVX A;  1K0O A;  5IIZ A;  1F3A A;  4PUA A;  1ACV A;  4IW9 A;  4MZB A;  3G7Y A;  4G0K A;  1V98 A;  4L5L A;  4V1A g;  3LOR A;  1R5A A;  4AJ7 A;  4G0I A;  5EY6 A;  2VL3 A;  3M8N A;  4ZBD A;  2OAC A;  4HU7 A;  4MPF A;  1BJX A;  1KNG A;  3TJB A;  2LJK A;  3IHQ A;  1MD3 A;  3GL3 A;  2V1M A;  2VM1 A;  3EC3 A;  1PKW A;  4X0X A;  5D9X A;  3H1N A;  1TRU A;  4MJB A;  2HLS A;  1OKD A;  5E59 A;  4YH2 A;  1NHO A;  1ST9 A;  5ECI B;  2C8U A;  1LBK A;  4HQZ A;  1O7U A;  4NMU A;  2FCH A;  3ERG A;  2FWF A;  3KZQ A;  4K6X A;  2H73 A;  3L78 A;  2I1U A;  3QAV A;  4ACS A;  4OCE A;  1UC7 A;  1KEB A;  2NTO A;  2EIQ A;  1HQO A;  1AQV A;  3GUR A;  2CVD A;  1GSF A;  5ECR B;  1OE7 A;  4D73 B;  3EIN A;  1B48 A;  1JLV A;  5J9B A;  4MH2 A;  1PQN A;  5ECP B;  4F2I A;  4KND A;  4FO5 A;  4NHW A;  2RII A;  2YJH A;  5GSS A;  3KEB A;  3FRC A;  1FB6 A;  4ECC A;  2PVO C;  1PN9 A;  1OC9 A;  1M9A A;  3GNJ A;  2CAI A;  1WMJ A;  1S3D A;  6GSU A;  4KCA A;  1AXD A;  2M46 A;  3D4T A;  3PR8 A;  2LRC A;  3ZZX A;  1SYR A;  4K7I A;  4KSO A;  5G1K A;  3UBK A;  4NHZ A;  5CYY A;  1UVZ A;  4WBJ A;  2GQM A;  4IP6 A;  4KDX A;  1X5E A;  3GKN A;  5J4U A;  3O3T A;  5KN3 A;  4FYB A;  2LUS A;  2OE3 A;  3TKP A;  3LYK A;  3RHB A;  2F3M A;  5DQS A;  2KUC A;  5HR2 A;  3HYP A;  3N9J A;  1TDI A;  4TKY A;  2L5L A;  3FZA A;  1THO A;  3ZIT A;  4XCS A;  2FD3 A;  3ZL5 A;  3WD6 A;  4LMV A;  3TRX A;  3VWU A;  3F9U A;  4J2F A;  5HR1 A;  4EC0 A;  2VCT A;  2AUV A;  2N5F A;  1CQH A;  5INY A;  4WEY A;  3TJJ A;  3QAG A;  3F6D A;  2PVQ A;  1XWB A;  2LS5 A;  3C71 A;  5AIS A;  4DEJ A;  3EWL A;  2PBJ A;  3NOF A;  3FZ4 A;  5JWQ B;  5FHI A;  1MEK A;  1WRY A;  4Q5F A;  2LST A;  1XXU A;  4V2L A;  4L0U A;  4EVM A;  2GST A;  3LJR A;  1VF2 A;  3VUR A;  5ELA A;  3DVX A;  3A3T A;  2H74 A;  1A8Y A;  4KE3 A;  3NIV A;  1PD2 1;  2C0F A;  2BMX A;  3CBU A;  2QKE A;  2RM6 A;  5ELG A;  2VCV A;  5BMU A;  2MMZ A;  1XW6 A;  2LEG A;  2KP2 A;  2CAQ A;  4LLR A;  2B7K A;  4V2N A;  2A4V A;  4E8H A;  2DJ0 A;  2R2J A;  1TXX A;  4Z7X A;  4GF0 A;  1OYJ A;  4PUR A;  1SYX A;  2BJX A;  1GUH A;  3A2W A;  4MF7 A;  5DAL A;  2HSM A;  5F05 A;  2ON5 A;  5JCU A;  1EP7 A;  1YQ1 A;  4NV2 A;  5DQY A;  3M9J A;  2VD0 A;  1VGL A;  2CV4 A;  2IMK A;  3ZMK A;  5KN2 A;  1JZO A;  3ERF A;  4POK A;  2ALB A;  3KTL A;  1Q4J A;  1BG5 A;  1YJ6 A;  1M2A A;  1YZX A;  3TGZ A;  1PRX A;  2B6M A;  3IRA A;  4K0N A;  2WUL A;  4YQU A;  4FQU A;  3HKR A;  4GCI A;  1HNA A;  2YAN A;  22GS A;  5D9W A;  1FG4 A;  5DDL A;  3TUE A;  2PPT A;  1ZCP A;  2AHE A;  1WP0 A;  4YQM A;  3GH6 A;  2CX4 A;  2H1B A;  5IMC A;  5ECL B;  3A5W A;  4AGS A;  2PER A;  1GTI A;  1FVJ A;  5GAN D;  3D5J A;  3TOU A;  5C00 A;  2HYX A;  3Q18 A;  2F51 A;  3VFI A;  2QC7 A;  3KMN A;  4MAB A;  2VAF A;  2JZT A;  1PL1 A;  2DML A;  2IMD A;  2KHP A;  1KTE A;  3HY2 A;  4F0B A;  3UOM A;  5H5Q A;  4TR1 B;  2CA8 A;  1AW9 A;  3PGT A;  2YWN A;  4GQF A;  4NV5 A;  1SL2 B;  3IPZ A;  2DC5 A;  1B4P A;  2WJU A;  1M0U A;  2VLT A;  3CMI A;  3TJK A;  1R26 A;  4BA7 A;  4KH7 A;  4EDZ A;  3D6I A;  3DWV A;  3RPN A;  4K8M A;  5IQY A;  1BYE A;  4I97 A;  2N5A A;  3FZ9 A;  3LEF A;  1TRV A;  3U5R E;  2CVB A;  4KUN A;  4O7H A;  5EL8 A;  3ZML A;  3P90 A;  4PQI A;  1T00 A;  2GT5 A;  4MLY A;  12GS A;  1PX6 A;  1VF4 A;  3IV4 A;  2EC4 A;  5J9C A;  3M3M A;  2HT9 A;  1YY7 A;  5CNW A;  2X8G A;  1KBN A;  4ZL8 A;  3VI7 A;  2HZF A;  2YWM A;  3L4N A;  1SEN A;  3IXR A;  3C1R A;  2AAW A;  4I5Q A;  2H0H A;  2JSZ A;  1PGT A;  4PGT A;  4P3Y B;  1B8X A;  5CAX A;  2B1L A;  1IYI A;  5HR0 A;  3GV1 A;  1LJR A;  3L9V A;  5B8A A;  2LNS A;  2VUP A;  1C72 A;  2X8H A;  16GS A;  1RQM A;  2R6K A;  1ZL9 A;  5D9V A;  2P5Q A;  13GS A;  4I2U A;  1ON4 A;  1TI1 A;  3QOU A;  4E8E A;  3IK7 A;  3BJ5 A;  3IR4 A;  4MCU A;  3U6V A;  4GSS A;  1TK5 B;  3RHC A;  3FW2 A;  1F2E A;  1MTC A;  5DJM A;  3W8J A;  4RQR A;  5ECH B;  3UBL A;  5IMZ A;  5A4U A;  4IJI A;  1OVN A;  2JZS A;  2VIM A;  1FHE A;  2V41 A;  4BVY B;  4GTU A;  2NPB A;  5CRW A;  1QMV A;  4USS A;  3E0U A;  2DLX A;  2LV3 A;  3H8Q A;  2FWH A;  2B1K A;  3QDN A;  2FY6 A;  5A5K A;  1G6Y A;  4NPB A;  1UN2 A;  4GQC A;  1RK4 A;  1XBS A;  2RUF A;  2ZCT A;  18GS A;  3I9V 2;  1PKZ A;  3VWX A;  1OC8 A;  5A4W A;  5AIX A;  3FR3 A;  2HSM B;  1XVQ A;  2IL3 A;  2L6C A;  5ECK B;  4BL7 A;  1HD2 A;  1MDJ A;  4EE0 A;  2OE0 A;  3ZFL A;  5GZZ B;  4HEA 2;  1H4O A;  2C4J A;  3IK9 A;  1SJZ A;  4XRA A;  3GIX A;  3M9K A;  3GTU B;  3GSS A;  1B4Q A;  2RLI A;  4K7N A;  4AJ8 A;  1ZYE A;  3E9J B;  3F63 A;  3CSH A;  2VO4 A;  2BTO T;  4QL7 A;  4KGI A;  1ZOF A;  2B7J A;  1K3L A;  4MJE A;  5AIV A;  5G5F A;  3TKQ A;  3EMX A;  1GNW A;  5IOX A;  2HRK A;  1JZD A;  4HQS A;  3GFK A;  4GWR A;  3F0I A;  1AQW A;  3ME8 A;  2HSY A;  4PQH A;  2R3X A;  5JCW A;  3MNG A;  3GMF A;  1GLQ A;  4TXO A;  3ZIV A;  4V1A p;  2C0E A;  1W89 A;  2AV4 A;  3WT1 A;  5CRD A;  3FR6 A;  4DSS A;  3M1G A;  3D22 A;  1TKD B;  2DJJ A;  3EU4 A;  2VL9 A;  1Q98 A;  3SWL A;  2H72 A;  4IGJ A;  5ECS A;  2DSA A;  4KB3 A;  3I69 A;  1G7O A;  3KIJ A;  1EGR A;  1VF1 A;  3ISO A;  1G7E A;  1TOF A;  2QSI A;  3CSJ A;  1SK0 A;  4WF4 A;  3WGE A;  2MZC A;  2LTK A;  4XS4 B;  4TRX A;  4HDE A;  1ZMA A;  1I5G A;  1DUG A;  2H0G A;  1GRX A;  2H8L A;  4I2T A;  2XPE A;  1J0F A;  4BVX A;  1AUC A;  4ZL7 A;  1G6W A;  2CZ3 A;  5HFK A;  5LD0 A;  1X9M B;  2JAD A;  2K18 A;  3J7Y k;  1M7T A;  3IAS 2;  4BWQ A;  1XPV A;  1XZO A;  3KH7 A;  3MWH A;  1GH2 A;  4QL9 A;  1YF1 A;  4JRR A;  1XFL A;  4RI6 A;  2VCZ A;  3Q74 A;  2FUG 2;  2H66 A;  1LU4 A;  1DBY A;  2DMM A;  1XW5 A;  4GST A;  5F8B A;  4KX4 A;  1ILO A;  2HNL A;  1M9B A;  1PSQ A;  5G30 A;  17GS A;  4ID0 A;  2P0G A;  3TJF A;  5DBQ A;  2VD1 A;  1V58 A;  3CXG A;  1YEX A;  1T4Y A;  3FEU A;  3BD2 A;  2UZ8 A;  2KOK A;  3TJG A;  3Q19 A;  4XS6 A;  2H1A A;  5ID2 A;  2YNX A;  4G2E A;  3TDG A;  5KN1 A;  4PNG A;  1XWA A;  2PWJ A;  1XWG A;  4Q5R A;  4ZBA A;  4X1U A;  3F4T A;  1XOA A;  1QQ2 A;  3KXO A;  3KD0 A;  2H6Y A;  2JSY A;  2H76 A;  3I43 A;  2VL2 C;  4EF0 A;  1K0N A;  2F8F A;  5ECO B;  2VL2 A;  4TXV A;  2TIR A;  1XW9 A;  2HZE B;  3G7I A;  5L71 A;  4IBP A;  1W4V A;  3LFL A;  4I8B A;  4J56 E;  1SK1 A;  5HQP A;  3EUR A;  3DML A;  2DJK A;  2B3S A;  2YWO A;  1AAZ A;  2OBK A;  4LA1 A;  4IS0 A;  1GNE A;  1A8L A;  2FWE A;  1GTA A;  5ECM B;  3QD9 A;  1V57 A;  4J57 E;  4O92 A;  9GSS A;  2VOC A;  4KF9 A;  4KW6 A;  2GZZ A;  5KN0 A;  1T3B A;  3GH9 A;  3NZN A;  1XIY A;  2GTU A;  2HI7 A;  2RM5 A;  1TK0 B;  2OE1 A;  2D2Z A;  4MA9 A;  3ZIJ A;  3VPT A;  1SD8 A;  2E2M A;  1K3O A;  3UVT A;  1U3I A;  3FHK A;  2I9H A;  2YP6 A;  3TRP A;  1A0F A;  3BCK A;  2G2Q A;  4N30 A;  2LRN A;  1N2A A;  6GSW A;  2YN1 A;  2VM2 A;  4CW9 A;  4XHM A;  1JFU A;  2R5G A;  4ECI A;  2KP1 A;  4XRD A;  1GSY A;  1HYU A;  2JU5 A;  1U87 A;  2LJA A;  4KCE A;  3APQ A;  2IFQ A;  1PX7 A;  3LWA A;  1HNB A;  1USB A;  4K0G A;  1S3A A;  2HE3 A;  1PL2 A;  5JWR B;  2GGT A;  2J23 A;  4CHS A;  7GSS A;  2FHE A;  5IMV A;  2C3T A;  2GSQ A;  1HNC A;  2PGT A;  2P31 A;  4HJM A;  1K0B A;  2IPA A;  4ECJ A;  4FYU A;  1GL8 A;  3HJP A;  5D9T A;  1SL0 B;  1A0R P;  2L4C A;  1BQ7 A;  2IWT A;  1CQG A;  3LYP A;  4MDC A;  2HRF A;  2LKU A;  5CRE A;  5DJL A;  2MMA A;  4F03 A;  2I3Y A;  3IAM 2;  3CRU A;  4IEL A;  4O32 A;  4JR4 A;  3MAK A;  4YAV A;  1A2L A;  5B6N A;  4I6X A;  1E2Y A;  1ZGN A;  1M99 A;  3O76 A;  3HJM A;  1K0C A;  3VK9 A;  1ABA A;  3FR9 A;  2C1Y A;  3BBY A;  4JZQ A;  1QUW A;  4L5O A;  3RBT A;  3KP8 A;  1VRS D;  3W8S A;  1AQX A;  5IPH A;  2G0F A;  2XC2 A;  1SJI A;  2HFD A;  3GA4 A;  3HZ8 A;  1GP1 A;  2C0G A;  5G31 A;  3C73 A;  3H79 A;  11GS A;  5KEJ A;  2C0D A;  3LXT A;  1ML6 A;  1AC1 A;  3RAZ A;  1GTB A;  4XIH A;  2X8C A;  4KSM A;  1Z6N A;  3AY8 A;  4OWY A;  3MSZ A;  3IC8 A;  2FLS A;  4ISD A;  3ZLP A;  5GST A;  2GLR A;  1PMT A;  1OC9 B;  1YKA A;  4BPY A;  4TN8 A;  1R4W A;  5F07 A;  4MJC A;  2O87 A;  2IN3 A;  5HFI A;  1H75 A;  4PXO A;  3D4M A;  2X64 A;  5ECQ B;  2K6V A;  1NSW A;  3E3E A;  3KGK A;  2OAD A;  5B6M A;  4HZ4 A;  1GLP A;  1SU9 A;  3GKX A;  3A2V A;  1ERU A;  3MDK A;  2GVP A;  2LNT A;  2MYG A;  3TKS E;  1ERV A;  1Y25 A;  2HSH A;  2LQQ A;  5JCG A;  3EE2 A;  4IHU A;  1GUM A;  2ZNM A;  1WIK A;  2H30 A;  5IMF A;  1B9X C;  1Z7P A;  3F8U A;  3HJO A;  3A2X A;  4L8E A;  3F4R A;  2P5R A;  4D73 A;  2H70 A;  5DVB A;  1I9D A;  1OAZ A;  3GX8 A;  1G0T A;  1GSE A;  3LSZ A;  3FK8 A;  3TB2 A;  19GS A;  1AIU A;  2LJR A;  3UJ1 A;  1O8X A;  2VCQ A;  3HVV A;  1TJD A;  1MDK A;  4F9Z A;  4ILF A;  5EVO A;  3IBH A;  3PIN A;  1UA5 A;  2IJY A;  3ED3 A;  1MD4 A;  2H01 A;  4DSQ A;  3LG6 A;  1OC3 A;  3GST A;  1O6J A;  2CX3 A;  4POM A;  3GUS A;  3WGX A;  4G10 A;  2A2S A;  5J41 A;  3VLN A;  4DSR A;  3DXB A;  3LGC A;  4GLT A;  4OD7 A;  3EVI A;  3Q6O A;  5LCZ A;  4KAE A;  5CRH A;  2DIY A;  4FH8 A;  2R4V A;  4EO3 A;  2WCI A;  5IPG A;  4PTS A;  5DAL B;  2B5E A;  4TVE A;  4TR4 A;  3PPU A;  4PNF A;  3V1W A;  2K8V A;  4RUV A;  3HA9 A;  5F06 A;  3WYW A;  2MBS A;  4EL1 A;  2CT6 A;  3F4S A;  5IO2 A;  3GKM A;  2VCX A;  2IME A;  1X5D A;  5JWO B;  1A24 A;  3DD3 A;  2FA8 A;  2M80 A;  1A2M A;  2FA4 A;  1GSS A;  5B7C A;  3QAW A;  1Z5Y E;  2MMN A;  4N10 A;  1EEM A;  4AF2 A;  4Q5N A;  3HD5 A;  1FW1 A;  4MPG A;  1GSQ A;  1T4Z A;  1QGV A;  2E2G A;  4K9Z A;  1JLW A;  4ZB8 A;  3QPM A;  3M0F A;  3DGQ A;  4WR5 A;  1JZW A;  2QGV A;  3W6G A;  4K1F A;  1SL1 B;  2Z9S A;  1A2J A;  2N5B A;  5D96 A;  5H5R A;  3QFB C;  5GAP D;  3HVS A;  3DEX A;  1Z6M A;  2NBS A;  3HZ4 A;  1GUL A;  4HUA A;  6GSV A;  1O81 A;  5IMA A;  3BCI A;  2ES7 A;  1M2D A;  3C8E A;  3GYK A;  1JZR A;  1SJ6 A;  3VPQ A;  4RI7 A;  3GRX A;  1OE8 A;  4HJ2 A;  3HXS A;  1XWK A;  1B9Y C;  2TRX A;  3DRN A;  1O8W A;  3VI5 A;  4TW5 A;  4JE1 A;  3S9F A;  4KDU A;  1A23 A;  3CRT A;  3KP9 A;  4MJA A;  2PUK C;  20GS A;  1YEP A;  5ECN B;  1O73 A;  4ZB9 A;  2LQO A;  1TP9 A;  4N0Z A;  5DAK A;  1N8J A;  4WR4 A;  3KTB A;  1URM A;  2XBI A;  3HDC A;  1JHB A;  2DJ2 A;  3IOS A;  4QQ7 A;  2GQK A;  3CTF A;  5IO0 A;  1GSU A;  3F3R A;  1TTZ A;  2B5Y A;  1FVK A;  4TOP A;  2PN8 A;  3P2A A;  1ZZY A;  3FYG A;  3L9U A;  3ZYW A;  2YV9 A;  2GS3 A;  1NHY A;  3G7J A;  1EGO A;  2B5X A;  1EOH A;  2GZY A;  3ZVJ D;  4IP1 A;  3F6F A;  5B8B A;  1T7P B;  2YZU A;  3EMP A;  4LL1 B;  2IMI A;  4LL4 B;  4AJ6 A;  3CTG A;  2F9S A;  2IMF A;  4OFT A;  3IA1 A;  2GSS A;  2V2G A;  2IIY A;  1V9W A;  8GSS A;  4X43 A;  2WDU A;  3TKR A;  2GQL A;  3O6T A;  1EV9 A;  4ZIL A;  1ZYQ B;  3FY7 A;  1TU8 A;  4Q5Q A;  3P7X A;  2FWG A;  1XWC A;  2O7K A; 
#chains in the Genus database with same CATH topology
 1SD9 A;  1FO5 A;  4IJ3 A;  3L0H A;  2GDR A;  2REM A;  4TR1 A;  5LNK e;  2AJQ B;  2E7P A;  1R5P A;  5D93 A;  1SKR B;  3R3E A;  2I4A A;  4EUY A;  1S3C A;  5HR3 A;  4G0L A;  4EXJ A;  5CO3 A;  4ULX A;  5EPF A;  2WFC A;  2WW0 A;  2XBQ A;  4ZXG A;  5KOW A;  2H1G A;  1TRW A;  4OO5 A;  1X9W B;  2TRC P;  2H0I A;  5CP1 A;  4WBR D;  2O8V B;  1T8E B;  2WRT A;  1GWC A;  5IM9 A;  1ERT A;  1TU7 A;  4K2D A;  1NM3 A;  1FOV A;  4WKW A;  3L9S A;  5HFG A;  3RDW A;  3EU3 A;  1F37 A;  2WVX B;  4K2X A;  2V32 A;  1Z3E A;  1EOG A;  3CWG A;  3KCM A;  1WPI A;  1DE1 A;  2ON7 A;  1J9B A;  4JBB A;  3G9B A;  2K8S A;  1TI3 A;  4NXI A;  2EIR A;  4GRF A;  1OKT A;  2H6X A;  4BL7 B;  6GSX A;  1TRS A;  1Y6E A;  3R2Q A;  3J7Y b;  2VLV A;  1M3J A;  4IKH A;  2HQT A;  2OBI A;  3APO A;  3ZRE A;  4K7O A;  4IN0 A;  1Z7R A;  4KDY A;  3KM6 A;  3US3 A;  5A1N A;  6GSY A;  1WE0 A;  2HRK B;  5CRG A;  4FIW A;  5D8I A;  3KMO A;  1PFO A;  4MK3 A;  4F0C A;  2DKI A;  5AN1 A;  3I6A A;  4ZBB A;  4V2M A;  3HCZ A;  1X0R A;  4HS1 A;  2QA2 A;  4BVY A;  2C3Q A;  4TXO B;  3UL3 A;  3VWW A;  4FXY P;  5J5N A;  3K8N A;  2ZUP A;  3LQ7 A;  3VWV A;  4DSS B;  2OKA A;  2R0G A;  1EV4 A;  3D0Z A;  3KH9 A;  1U6T A;  5G2Z A;  3QR6 A;  2YPM A;  5G5E A;  4IQA A;  1X5C A;  4WET A;  2L4Q A;  1IYH A;  3ZVJ A;  1WJK A;  4L0W A;  2YV7 A;  2PMT A;  2MBT A;  4DVC A;  2YZH A;  4OFN A;  1RW1 A;  10GS A;  2L5O A;  2WB9 A;  5A5H A;  1FB0 A;  2HSN B;  3UEM A;  3APS A;  1VF3 A;  5DAK B;  3GX0 A;  5J3R A;  3BOA A;  1F3B A;  4PI0 C;  2M72 A;  2R37 A;  2AYT A;  3H93 A;  3GTU A;  4WF5 A;  1BED A;  2NDO A;  3MYD A;  3DKS A;  2K9F A;  2HXK A;  3DIE A;  2PU9 C;  3HHV A;  5COH A;  2EIO A;  4A5P A;  3KJY A;  3N5O A;  5J47 A;  5C04 A;  1TW9 A;  3WT2 A;  4ML1 A;  4BVX B;  2OT3 A;  2FGX A;  3ERW A;  4OO4 A;  1SVO A;  2A2R A;  3TCO A;  1K0A A;  2H6Z A;  4KA0 A;  4AKI A;  1QK8 A;  1R7H A;  4JED A;  2HRA A;  2XHF A;  1K3Y A;  2GT6 A;  1U88 A;  5FWG A;  4CDO A;  1ERW A;  3RPP A;  5A4V A;  2MMO A;  1SKW B;  1QXH A;  4HI7 A;  2EFD A;  2CVK A;  2VCW A;  1GUK A;  3IE3 A;  1BF5 A;  3WGD A;  3GHA A;  3RGB C;  2JL4 A;  2X99 A;  3F3Q A;  3DYR A;  4XTS A;  5IOW A;  2DJ1 A;  4OFM A;  2DJ3 A;  3QCP A;  4GSN A;  3GN3 A;  2F8A A;  5FT3 A;  3TRQ A;  3UIW A;  5ID2 B;  2KLX A;  2O85 A;  4G9H A;  5BRT A;  1YKC A;  4FYC A;  1XCC A;  1WWJ A;  4TR0 A;  1EWX A;  4XS4 A;  2RUE A;  1K0M A;  2H19 A;  4WXT A;  1SKS B;  2YJ7 A;  1FAA A;  2H75 A;  4G19 A;  4N11 A;  2WZ9 A;  3LXZ A;  4XS1 A;  1WOU A;  1K0D A;  2C3N A;  1F9M A;  3C7M A;  3PH9 A;  4HZ2 A;  3UAR A;  4F82 A;  1EEJ A;  4MZW A;  2NVL A;  4BWS A;  2EFC A;  1MDI A;  2O89 A;  2J9H A;  4ML6 A;  1J08 A;  2I81 A;  3HMJ G;  3OR5 A;  5A34 B;  1F6M C;  2DBC A;  4OMV A;  1Z9H A;  3A5I A;  1SK2 A;  4GXZ A;  3TKS C;  1BX9 A;  3CYN A;  1ZYP A;  3TKS A;  4MP4 A;  1YF0 A;  3SBC A;  4LMW A;  2V6K A;  2H1D A;  1X9S B;  1XOB A;  4POB A;  1ZYN A;  4CY8 A;  4H86 A;  3ZTL A;  2H71 A;  3UMA A;  1THX A;  4JR6 A;  3UVH A;  2AB6 A;  2YCD A;  2JAC A;  5D73 A;  1GSD A;  2E0Q A;  3JCM L;  4OCF A;  2WW2 A;  4ECB A;  1DSB A;  6GST A;  4MMM A;  4EDY A;  4ZL9 A;  1XVW A;  2CZ2 A;  2L57 A;  3FKF A;  1O85 A;  1T1V A;  1QFN A;  4RQX A;  4ZIJ A;  3ME7 A;  3D21 A;  1EP8 A;  3GKK A;  2CQ9 A;  2YOI A;  1YDK A;  2OA7 A;  4ZB6 A;  1TK8 B;  2YWI A;  3FZ5 A;  4Z2R A;  4YAP A;  2HZE A;  4JU5 A;  3CSI A;  3QFA C;  4NAX A;  2DIZ A;  4IVF A;  3CQF A;  2IFQ B;  5ENU A;  2C80 A;  3QMX A;  2L59 A;  5DCG A;  5H5S A;  5G1L A;  14GS A;  4O5R A;  4PQ1 A;  4PX1 A;  4HOJ A;  3P8W A;  2LRT A;  4POL A;  1GTU A;  4IQ1 A;  1V40 A;  5ABR A;  3GL5 A;  1BAY A;  2V6O A;  4NWY A;  2JZR A;  5AGY A;  2OJL A;  2XPD A;  6GSS A;  4BIK A;  1PA3 A;  4PUF C;  1U3A A;  1EZK A;  4HU9 A;  4N0V A;  2VLU A;  5DCH A;  4EKZ A;  4TR3 A;  3DVW A;  3UAP A;  2GSR A;  1DE2 A;  4MF6 A;  3ZFB A;  1M2B A;  1YVL A;  3IC4 A;  4YQV A;  1E6B A;  1NW2 A;  3EPT A;  2FNO A;  2L6D A;  4AKX B;  3TOT A;  5IMD A;  1V2A A;  4MZC A;  2WS2 A;  2WGR A;  3IDV A;  3EYT A;  4MH3 A;  4MF5 A;  5E4W A;  3H4K A;  3ZRD A;  3C1S A;  5F0G A;  2GZP A;  2HRN A;  3HVX A;  1K0O A;  2WZS A;  5IIZ A;  4O5U A;  1F3A A;  4PUA A;  1ACV A;  4IW9 A;  4MZB A;  3G7Y A;  4G0K A;  1V98 A;  4L5L A;  4PHZ C;  4V1A g;  3LOR A;  1R5A A;  4AJ7 A;  4G0I A;  5EY6 A;  2VL3 A;  3M8N A;  4ZBD A;  2OAC A;  4HU7 A;  4MPF A;  4G01 A;  1BJX A;  1KNG A;  3TJB A;  2LJK A;  3IHQ A;  1MD3 A;  3GL3 A;  2V1M A;  2VM1 A;  3EC3 A;  1PKW A;  4X0X A;  5D9X A;  3H1N A;  1TRU A;  4MJB A;  2HLS A;  1OKD A;  5E59 A;  4YH2 A;  1NHO A;  1ST9 A;  2R0C A;  5ECI B;  2C8U A;  1LBK A;  4HQZ A;  1O7U A;  4NMU A;  2FCH A;  3ERG A;  2FWF A;  3KZQ A;  4K6X A;  2H73 A;  3L78 A;  2I1U A;  3QAV A;  4ACS A;  4OCE A;  2O3E A;  1UC7 A;  1KEB A;  4X4J A;  2NTO A;  2EIQ A;  4K5R A;  1HQO A;  1AQV A;  5KOX A;  3GUR A;  2CVD A;  1GSF A;  5ECR B;  1OE7 A;  4D73 B;  3EIN A;  1N25 A;  1B48 A;  1JLV A;  5J9B A;  4MH2 A;  1PQN A;  5ECP B;  4F2I A;  4KND A;  4FO5 A;  4NHW A;  2RII A;  2YJH A;  5GSS A;  3KEB A;  3FRC A;  1FB6 A;  4ECC A;  2PVO C;  1PN9 A;  1OC9 A;  1M9A A;  3GNJ A;  2CAI A;  1WMJ A;  1S3D A;  6GSU A;  4KCA A;  1AXD A;  2M46 A;  3D4T A;  3PR8 A;  2LRC A;  3TU3 B;  3ZZX A;  1SYR A;  4K7I A;  4KSO A;  5G1K A;  3UBK A;  4NHZ A;  5CYY A;  1UVZ A;  4MNN A;  4WBJ A;  2GQM A;  4IP6 A;  4KDX A;  1X5E A;  3GKN A;  5J4U A;  3O3T A;  5KN3 A;  4FYB A;  2LUS A;  2OE3 A;  3TKP A;  3LYK A;  3RHB A;  2F3M A;  5DQS A;  2KUC A;  5HR2 A;  3HYP A;  3N9J A;  4AKH A;  1TDI A;  4TKY A;  2L5L A;  3FZA A;  1THO A;  3ZIT A;  4XCS A;  2FD3 A;  3ZL5 A;  3WD6 A;  4LMV A;  3TRX A;  3VWU A;  3F9U A;  4J2F A;  5HR1 A;  4EC0 A;  2VCT A;  2AUV A;  2N5F A;  1CQH A;  5INY A;  4WEY A;  3TJJ A;  3QAG A;  3F6D A;  2PVQ A;  1XWB A;  2LS5 A;  3C71 A;  5AIS A;  4DEJ A;  3EWL A;  2PBJ A;  3NOF A;  3FZ4 A;  5JWQ B;  1M3I A;  4QMK A;  5FHI A;  1MEK A;  1WRY A;  4Q5F A;  2LST A;  1XXU A;  4V2L A;  4PI2 C;  4L0U A;  4EVM A;  2GST A;  3LJR A;  1VF2 A;  3VUR A;  5ELA A;  3DVX A;  3A3T A;  2H74 A;  1A8Y A;  4KE3 A;  3NIV A;  1PD2 1;  2C0F A;  2BMX A;  2QA1 A;  4W66 A;  3CBU A;  2QKE A;  2RM6 A;  5ELG A;  2VCV A;  5BMU A;  4Z2T A;  2MMZ A;  1XW6 A;  2LEG A;  2KP2 A;  2CAQ A;  4LLR A;  2B7K A;  4V2N A;  2A4V A;  4E8H A;  2DJ0 A;  2R2J A;  1TXX A;  4Z7X A;  4GF0 A;  1OYJ A;  4PUR A;  1SYX A;  2BJX A;  1GUH A;  3A2W A;  4MF7 A;  5DAL A;  2HSM A;  5F05 A;  2ON5 A;  5JCU A;  1EP7 A;  1YQ1 A;  4NV2 A;  5DQY A;  3M9J A;  2VD0 A;  4K5S A;  1VGL A;  2CV4 A;  2IMK A;  2O5V A;  3ZMK A;  5KN2 A;  1JZO A;  3ERF A;  4POK A;  2ALB A;  3KTL A;  1Q4J A;  1BG5 A;  1YJ6 A;  1M2A A;  1YZX A;  3TGZ A;  1PRX A;  2B6M A;  3IRA A;  4K0N A;  2WUL A;  4YQU A;  4FQU A;  3HKR A;  4GCI A;  1HNA A;  2YAN A;  22GS A;  5D9W A;  1FG4 A;  5DDL A;  3TUE A;  2PPT A;  1ZCP A;  2AHE A;  1WP0 A;  4YQM A;  3GH6 A;  2CX4 A;  2H1B A;  5IMC A;  4Z2U A;  5ECL B;  3A5W A;  4AGS A;  2PER A;  1GTI A;  1FVJ A;  5GAN D;  3D5J A;  3TOU A;  5C00 A;  2HYX A;  3Q18 A;  2F51 A;  3VFI A;  2QC7 A;  3KMN A;  4MAB A;  2VAF A;  2JZT A;  1PL1 A;  2DML A;  2IMD A;  2KHP A;  1KTE A;  3HY2 A;  4F0B A;  3UOM A;  5H5Q A;  4TR1 B;  2CA8 A;  1AW9 A;  3PGT A;  2YWN A;  4GQF A;  4NV5 A;  1SL2 B;  3IPZ A;  2DC5 A;  1B4P A;  5J4V A;  2WJU A;  3MIX A;  1M0U A;  2VLT A;  3CMI A;  3TJK A;  1R26 A;  4BA7 A;  4KH7 A;  4EDZ A;  2VKZ G;  3D6I A;  3DWV A;  3RPN A;  4K8M A;  2WVY A;  5IQY A;  1BYE A;  4I97 A;  2N5A A;  3FZ9 A;  3LEF A;  1TRV A;  3U5R E;  2CVB A;  4KUN A;  4O7H A;  5EL8 A;  3ZML A;  3P90 A;  2WW3 A;  4PQI A;  1T00 A;  2GT5 A;  4MLY A;  12GS A;  1PX6 A;  1VF4 A;  3IV4 A;  2EC4 A;  5J9C A;  3M3M A;  2HT9 A;  1YY7 A;  5CNW A;  2X8G A;  1FOH A;  1KBN A;  4ZL8 A;  3VI7 A;  2HZF A;  2YWM A;  3L4N A;  1SEN A;  3IXR A;  3C1R A;  2AAW A;  4I5Q A;  3HVN A;  2H0H A;  2JSZ A;  1PGT A;  4PGT A;  4P3Y B;  1B8X A;  5CAX A;  2B1L A;  5J4Y A;  1IYI A;  5HR0 A;  3GV1 A;  1LJR A;  3L9V A;  5B8A A;  2LNS A;  2VUP A;  1C72 A;  2X8H A;  4HSC X;  16GS A;  1RQM A;  2R6K A;  1ZL9 A;  5D9V A;  2P5Q A;  13GS A;  4I2U A;  1ON4 A;  1TI1 A;  5A1N B;  3QOU A;  4E8E A;  3IK7 A;  3BJ5 A;  3IR4 A;  4MCU A;  3U6V A;  4GSS A;  1TK5 B;  3RHC A;  3FW2 A;  1F2E A;  1MTC A;  5DJM A;  3W8J A;  4RQR A;  5ECH B;  3UBL A;  5IMZ A;  5A4U A;  2A2P A;  4IJI A;  1OVN A;  2JZS A;  2VIM A;  1FHE A;  2V41 A;  4BVY B;  4GTU A;  2NPB A;  5CRW A;  1QMV A;  4USS A;  3E0U A;  2DLX A;  2LV3 A;  3H8Q A;  2FWH A;  4AKG A;  2B1K A;  3FMW A;  3QDN A;  2FY6 A;  5A5K A;  2WVX A;  1G6Y A;  4NPB A;  1UN2 A;  4GQC A;  1RK4 A;  1XBS A;  2RUF A;  2ZCT A;  18GS A;  3I9V 2;  1PKZ A;  3VWX A;  1OC8 A;  5A4W A;  5J40 A;  5AIX A;  3FR3 A;  2HSM B;  1XVQ A;  2IL3 A;  2L6C A;  5ECK B;  4BL7 A;  1HD2 A;  1MDJ A;  4EE0 A;  2OE0 A;  3ZFL A;  5GZZ B;  5A5H B;  3RFR C;  4HEA 2;  1H4O A;  2C4J A;  3IK9 A;  1SJZ A;  4XRA A;  3GIX A;  3M9K A;  3GTU B;  3GSS A;  1B4Q A;  2RLI A;  4K7N A;  4AI6 A;  4AJ8 A;  1ZYE A;  3E9J B;  3F63 A;  3CSH A;  2VO4 A;  2BTO T;  4QL7 A;  4KGI A;  1ZOF A;  2B7J A;  1K3L A;  4MJE A;  5AIV A;  5G5F A;  3TKQ A;  3EMX A;  1GNW A;  5IOX A;  2HRK A;  1JZD A;  4HQS A;  3GFK A;  1S4B P;  4GWR A;  3F0I A;  1AQW A;  3ME8 A;  2HSY A;  4PQH A;  2R3X A;  5JCW A;  3MNG A;  3GMF A;  1GLQ A;  4TXO A;  3ZIV A;  4V1A p;  2C0E A;  1W89 A;  2AV4 A;  3WT1 A;  5CRD A;  3FR6 A;  4DSS A;  3M1G A;  3D22 A;  1TKD B;  1TXU A;  2DJJ A;  3EU4 A;  2VL9 A;  1Q98 A;  3SWL A;  1BG1 A;  2H72 A;  4IGJ A;  5ECS A;  2DSA A;  2X4A A;  4KB3 A;  2HSN A;  2X49 A;  3I69 A;  1G7O A;  3KIJ A;  1EGR A;  1VF1 A;  3ISO A;  1G7E A;  1TOF A;  2QSI A;  3CSJ A;  1SK0 A;  4WF4 A;  3WGE A;  2MZC A;  2LTK A;  4XS4 B;  4TRX A;  4HDE A;  1ZMA A;  1I5G A;  1DUG A;  2H0G A;  1GRX A;  2H8L A;  4I2T A;  2XPE A;  1J0F A;  4BVX A;  1AUC A;  4ZL7 A;  1G6W A;  2CZ3 A;  5HFK A;  5LD0 A;  1X9M B;  4YKG A;  2JAD A;  2K18 A;  3J7Y k;  1M7T A;  3IAS 2;  4BWQ A;  1XPV A;  1XZO A;  3KH7 A;  3MWH A;  1GH2 A;  4QL9 A;  1YF1 A;  4JRR A;  1XFL A;  4RI6 A;  2VCZ A;  3Q74 A;  2FUG 2;  3CHX C;  2H66 A;  1LU4 A;  1DBY A;  2EFE A;  2DMM A;  1XW5 A;  4GST A;  5F8B A;  4KX4 A;  1ILO A;  2HNL A;  1M9B A;  1PSQ A;  5G30 A;  17GS A;  4ID0 A;  2P0G A;  3TJF A;  5DBQ A;  2VD1 A;  1V58 A;  3CXG A;  1YEX A;  1T4Y A;  3FEU A;  3BD2 A;  2UZ8 A;  2KOK A;  3TJG A;  3Q19 A;  4XS6 A;  2H1A A;  5ID2 A;  2YNX A;  4G2E A;  3TDG A;  5KN1 A;  4PNG A;  1XWA A;  2PWJ A;  1XWG A;  4Q5R A;  4ZBA A;  4X1U A;  1XG8 A;  3F4T A;  1XOA A;  1QQ2 A;  1S3R A;  3KXO A;  3KD0 A;  2H6Y A;  2JSY A;  2H76 A;  3I43 A;  2VL2 C;  4EF0 A;  1K0N A;  2F8F A;  5ECO B;  2VL2 A;  4TXV A;  4ZB7 A;  2TIR A;  1XW9 A;  2HZE B;  3G7I A;  5L71 A;  4GDF A;  4IBP A;  1W4V A;  3LFL A;  4I8B A;  4J56 E;  1SK1 A;  5HQP A;  3EUR A;  3DML A;  2DJK A;  2B3S A;  2YWO A;  1SVL A;  1AAZ A;  2OBK A;  4LA1 A;  5A34 A;  4IS0 A;  1GNE A;  1A8L A;  2FWE A;  1GTA A;  5ECM B;  3QD9 A;  1V57 A;  1YEW C;  4O92 A;  4J57 E;  9GSS A;  2VOC A;  4KF9 A;  4KW6 A;  2GZZ A;  5KN0 A;  1T3B A;  3GH9 A;  3NZN A;  1XIY A;  2GTU A;  2HI7 A;  2RM5 A;  1TK0 B;  2EFH A;  2OE1 A;  2D2Z A;  4MA9 A;  3ZIJ A;  3VPT A;  1SD8 A;  2E2M A;  1K3O A;  3UVT A;  1U3I A;  3FHK A;  2I9H A;  2YP6 A;  3TRP A;  1A0F A;  3BCK A;  2G2Q A;  4N30 A;  2LRN A;  1N2A A;  6GSW A;  2YN1 A;  2VM2 A;  4CW9 A;  4XHM A;  1JFU A;  2R5G A;  4ECI A;  2KP1 A;  4XRD A;  1GSY A;  1HYU A;  2JU5 A;  1U87 A;  2LJA A;  4KCE A;  3APQ A;  2IFQ A;  1PX7 A;  3LWA A;  1HNB A;  1USB A;  4K0G A;  1S3A A;  2HE3 A;  1PL2 A;  5JWR B;  2GGT A;  2J23 A;  4CHS A;  7GSS A;  2FHE A;  5IMV A;  2C3T A;  2GSQ A;  1HNC A;  2PGT A;  2P31 A;  4HJM A;  1K0B A;  2IPA A;  4ECJ A;  4FYU A;  1I1I P;  1GL8 A;  3HJP A;  5D9T A;  2UV8 G;  1SL0 B;  1A0R P;  2L4C A;  1BQ7 A;  2IWT A;  1CQG A;  1SVM A;  3LYP A;  4MDC A;  2HRF A;  2LKU A;  5CRE A;  5DJL A;  2MMA A;  4F03 A;  2I3Y A;  3IAM 2;  3CRU A;  4IEL A;  4O32 A;  4JR4 A;  3MAK A;  4YAV A;  4CY6 A;  1A2L A;  5B6N A;  4I6X A;  1E2Y A;  1ZGN A;  1M99 A;  3HJM A;  1K0C A;  3O76 A;  3VK9 A;  1ABA A;  3FR9 A;  2C1Y A;  3BBY A;  4JZQ A;  1QUW A;  4L5O A;  3RBT A;  3KP8 A;  1VRS D;  3W8S A;  1AQX A;  5IPH A;  2G0F A;  2XC2 A;  1SJI A;  2HFD A;  3GA4 A;  3HZ8 A;  1GP1 A;  2C0G A;  5G31 A;  3C73 A;  3H79 A;  11GS A;  5KEJ A;  2C0D A;  3LXT A;  1ML6 A;  1AC1 A;  3RAZ A;  1GTB A;  4XIH A;  2X8C A;  4KSM A;  1Z6N A;  3AY8 A;  4OWY A;  3MSZ A;  3IC8 A;  2FLS A;  4ISD A;  4ICY A;  3ZLP A;  5GST A;  2GLR A;  1PMT A;  1OC9 B;  1YKA A;  4BPY A;  4TN8 A;  1R4W A;  5F07 A;  4MJC A;  2O87 A;  4EIP A;  1Y1U A;  2IN3 A;  5HFI A;  1H75 A;  4PXO A;  3D4M A;  2X64 A;  5ECQ B;  2K6V A;  1NSW A;  3E3E A;  3KGK A;  2OAD A;  5B6M A;  4HZ4 A;  1GLP A;  1SU9 A;  3GKX A;  3A2V A;  1ERU A;  3MDK A;  2GVP A;  2LNT A;  2MYG A;  3TKS E;  1ERV A;  1Y25 A;  2HSH A;  2LQQ A;  5JCG A;  3EE2 A;  4IHU A;  1GUM A;  2ZNM A;  1WIK A;  2H30 A;  5IMF A;  1B9X C;  1Z7P A;  3F8U A;  3HJO A;  3A2X A;  4L8E A;  3F4R A;  2P5R A;  4D73 A;  2H70 A;  5DVB A;  1I9D A;  1OAZ A;  3GX8 A;  1G0T A;  1GSE A;  3LSZ A;  3FK8 A;  3TB2 A;  19GS A;  1AIU A;  2LJR A;  3UJ1 A;  1O8X A;  2VCQ A;  3HVV A;  1TJD A;  1MDK A;  4F9Z A;  2WW1 A;  4ILF A;  5EVO A;  3IBH A;  3PIN A;  1UA5 A;  2IJY A;  3ED3 A;  1MD4 A;  2H01 A;  4DSQ A;  3LG6 A;  1OC3 A;  3GST A;  2WVZ A;  1O6J A;  2CX3 A;  4POM A;  3GUS A;  3WGX A;  4G10 A;  2A2S A;  5J41 A;  3VLN A;  4DSR A;  3DXB A;  3LGC A;  4GLT A;  5BMU B;  4OD7 A;  3EVI A;  3Q6O A;  5LCZ A;  4KAE A;  5CRH A;  2R0P A;  2DIY A;  4FH8 A;  2R4V A;  4EO3 A;  2WCI A;  5IPG A;  4PTS A;  5DAL B;  2B5E A;  2O36 A;  4TVE A;  4TR4 A;  3PPU A;  4EIQ A;  4PNF A;  3V1W A;  2K8V A;  4RUV A;  3HA9 A;  5F06 A;  3WYW A;  3IHG A;  2MBS A;  4EL1 A;  2CT6 A;  3F4S A;  5IO2 A;  3GKM A;  4O5Q A;  2VCX A;  2IME A;  1X5D A;  5JWO B;  1A24 A;  3DD3 A;  2FA8 A;  2M80 A;  1A2M A;  2FA4 A;  1PN0 A;  1GSS A;  5B7C A;  3QAW A;  1Z5Y E;  2MMN A;  4N10 A;  1EEM A;  4AF2 A;  4Q5N A;  3HD5 A;  1FW1 A;  4MPG A;  2DKH A;  1GSQ A;  1T4Z A;  1QGV A;  2E2G A;  1JLW A;  4K9Z A;  4ZB8 A;  3QPM A;  3M0F A;  3DGQ A;  4WR5 A;  1JZW A;  2QGV A;  3W6G A;  4K1F A;  1SL1 B;  2Z9S A;  1A2J A;  2N5B A;  5D96 A;  5H5R A;  3QFB C;  5GAP D;  3HVS A;  3DEX A;  1Z6M A;  2NBS A;  3HZ4 A;  1GUL A;  4HUA A;  6GSV A;  1O81 A;  2A4H A;  5IMA A;  3BCI A;  2ES7 A;  1M2D A;  3C8E A;  3GYK A;  1JZR A;  1SJ6 A;  3VPQ A;  4RI7 A;  3GRX A;  1OE8 A;  4HJ2 A;  4N3Z A;  3HXS A;  3DRN A;  1XWK A;  1B9Y C;  2TRX A;  1O8W A;  4YKF A;  3VI5 A;  4TW5 A;  4JE1 A;  3S9F A;  4KDU A;  1A23 A;  3CRT A;  3KP9 A;  4MJA A;  2PUK C;  20GS A;  1YEP A;  5ECN B;  1O73 A;  4ZB9 A;  2LQO A;  1TP9 A;  4N0Z A;  5DAK A;  1N8J A;  4WR4 A;  4E68 A;  3KTB A;  1URM A;  2XBI A;  3HDC A;  1JHB A;  2DJ2 A;  3IOS A;  4QQ7 A;  2GQK A;  3CTF A;  5IO0 A;  1GSU A;  3F3R A;  1TTZ A;  2B5Y A;  1FVK A;  4TOP A;  2PN8 A;  3P2A A;  1ZZY A;  3FYG A;  3L9U A;  3ZYW A;  2YV9 A;  2GS3 A;  1NHY A;  3G7J A;  1EGO A;  2B5X A;  1EOH A;  2GZY A;  3ZVJ D;  4IP1 A;  3F6F A;  5B8B A;  3LW9 A;  1T7P B;  2YZU A;  3EMP A;  4LL1 B;  2IMI A;  4LL4 B;  4AJ6 A;  3CTG A;  2F9S A;  2IMF A;  2H1L A;  4OFT A;  3IA1 A;  2GSS A;  2V2G A;  2IIY A;  1V9W A;  8GSS A;  4X43 A;  2WDU A;  3TKR A;  2GQL A;  3O6T A;  1EV9 A;  4ZIL A;  1ZYQ B;  3FY7 A;  1TU8 A;  4Q5Q A;  3P7X A;  2FWG A;  1XWC A;  2O7K A; 
#chains in the Genus database with same CATH homology
 1SD9 A;  1FO5 A;  4IJ3 A;  3L0H A;  2GDR A;  2REM A;  4TR1 A;  5LNK e;  2AJQ B;  2E7P A;  1R5P A;  5D93 A;  1SKR B;  3R3E A;  2I4A A;  4EUY A;  1S3C A;  5HR3 A;  4G0L A;  4EXJ A;  5CO3 A;  4ULX A;  5EPF A;  2WFC A;  2XBQ A;  4ZXG A;  5KOW A;  2H1G A;  1TRW A;  4OO5 A;  1X9W B;  2TRC P;  2H0I A;  5CP1 A;  4WBR D;  2O8V B;  1T8E B;  2WRT A;  1GWC A;  5IM9 A;  1ERT A;  1TU7 A;  4K2D A;  1NM3 A;  1FOV A;  4WKW A;  3L9S A;  5HFG A;  3RDW A;  3EU3 A;  1F37 A;  4K2X A;  2V32 A;  1Z3E A;  1EOG A;  3CWG A;  3KCM A;  1WPI A;  1DE1 A;  2ON7 A;  1J9B A;  4JBB A;  3G9B A;  2K8S A;  1TI3 A;  4NXI A;  2EIR A;  4GRF A;  1OKT A;  2H6X A;  4BL7 B;  6GSX A;  1TRS A;  1Y6E A;  3R2Q A;  3J7Y b;  2VLV A;  4IKH A;  2HQT A;  2OBI A;  3APO A;  3ZRE A;  4K7O A;  4IN0 A;  1Z7R A;  4KDY A;  3KM6 A;  3US3 A;  5A1N A;  6GSY A;  1WE0 A;  2HRK B;  5CRG A;  4FIW A;  5D8I A;  3KMO A;  4MK3 A;  4F0C A;  2DKI A;  5AN1 A;  3I6A A;  4ZBB A;  4V2M A;  3HCZ A;  1X0R A;  4HS1 A;  2QA2 A;  4BVY A;  2C3Q A;  4TXO B;  3UL3 A;  3VWW A;  5J5N A;  3K8N A;  2ZUP A;  3LQ7 A;  3VWV A;  4DSS B;  2OKA A;  2R0G A;  1EV4 A;  3D0Z A;  3KH9 A;  1U6T A;  5G2Z A;  3QR6 A;  2YPM A;  5G5E A;  4IQA A;  1X5C A;  4WET A;  2L4Q A;  1IYH A;  3ZVJ A;  1WJK A;  4L0W A;  2YV7 A;  2PMT A;  2MBT A;  4DVC A;  2YZH A;  4OFN A;  1RW1 A;  10GS A;  2L5O A;  2WB9 A;  5A5H A;  1FB0 A;  2HSN B;  3UEM A;  3APS A;  1VF3 A;  5DAK B;  3GX0 A;  5J3R A;  3BOA A;  1F3B A;  2M72 A;  2R37 A;  2AYT A;  3H93 A;  3GTU A;  4WF5 A;  1BED A;  2NDO A;  3MYD A;  3DKS A;  2K9F A;  2HXK A;  3DIE A;  2PU9 C;  3HHV A;  5COH A;  2EIO A;  4A5P A;  3KJY A;  3N5O A;  5J47 A;  5C04 A;  1TW9 A;  3WT2 A;  4ML1 A;  4BVX B;  2OT3 A;  2FGX A;  3ERW A;  4OO4 A;  1SVO A;  2A2R A;  3TCO A;  1K0A A;  2H6Z A;  4KA0 A;  4AKI A;  1QK8 A;  1R7H A;  4JED A;  2HRA A;  2XHF A;  1K3Y A;  2GT6 A;  1U88 A;  5FWG A;  4CDO A;  1ERW A;  3RPP A;  5A4V A;  2MMO A;  1SKW B;  1QXH A;  4HI7 A;  2EFD A;  2CVK A;  2VCW A;  1GUK A;  3IE3 A;  1BF5 A;  3WGD A;  3GHA A;  2JL4 A;  2X99 A;  3F3Q A;  3DYR A;  4XTS A;  5IOW A;  2DJ1 A;  4OFM A;  2DJ3 A;  3QCP A;  4GSN A;  3GN3 A;  2F8A A;  5FT3 A;  3TRQ A;  3UIW A;  5ID2 B;  2KLX A;  2O85 A;  4G9H A;  5BRT A;  1YKC A;  4FYC A;  1XCC A;  1WWJ A;  4TR0 A;  1EWX A;  4XS4 A;  2RUE A;  1K0M A;  2H19 A;  4WXT A;  1SKS B;  2YJ7 A;  1FAA A;  2H75 A;  4G19 A;  4N11 A;  2WZ9 A;  3LXZ A;  4XS1 A;  1WOU A;  1K0D A;  2C3N A;  1F9M A;  3C7M A;  3PH9 A;  4HZ2 A;  3UAR A;  4F82 A;  1EEJ A;  4MZW A;  2NVL A;  4BWS A;  2EFC A;  1MDI A;  2O89 A;  2J9H A;  4ML6 A;  1J08 A;  2I81 A;  3HMJ G;  3OR5 A;  5A34 B;  1F6M C;  2DBC A;  4OMV A;  1Z9H A;  3A5I A;  1SK2 A;  4GXZ A;  3TKS C;  1BX9 A;  3CYN A;  1ZYP A;  3TKS A;  4MP4 A;  1YF0 A;  3SBC A;  4LMW A;  2V6K A;  2H1D A;  1X9S B;  1XOB A;  4POB A;  1ZYN A;  4CY8 A;  4H86 A;  3ZTL A;  2H71 A;  3UMA A;  1THX A;  4JR6 A;  3UVH A;  2AB6 A;  2YCD A;  2JAC A;  5D73 A;  1GSD A;  2E0Q A;  3JCM L;  4OCF A;  4ECB A;  1DSB A;  6GST A;  4MMM A;  4EDY A;  4ZL9 A;  1XVW A;  2CZ2 A;  2L57 A;  3FKF A;  1O85 A;  1T1V A;  1QFN A;  4RQX A;  4ZIJ A;  3ME7 A;  3D21 A;  1EP8 A;  3GKK A;  2CQ9 A;  2YOI A;  1YDK A;  2OA7 A;  4ZB6 A;  1TK8 B;  2YWI A;  3FZ5 A;  4Z2R A;  4YAP A;  2HZE A;  4JU5 A;  3CSI A;  3QFA C;  4NAX A;  2DIZ A;  4IVF A;  2IFQ B;  5ENU A;  2C80 A;  3QMX A;  2L59 A;  5DCG A;  5H5S A;  5G1L A;  14GS A;  4O5R A;  4PQ1 A;  4PX1 A;  4HOJ A;  3P8W A;  2LRT A;  4POL A;  1GTU A;  4IQ1 A;  1V40 A;  5ABR A;  3GL5 A;  1BAY A;  2V6O A;  4NWY A;  2JZR A;  5AGY A;  2OJL A;  2XPD A;  6GSS A;  1PA3 A;  4PUF C;  1U3A A;  1EZK A;  4HU9 A;  4N0V A;  2VLU A;  5DCH A;  4EKZ A;  4TR3 A;  3DVW A;  3UAP A;  2GSR A;  1DE2 A;  4MF6 A;  3ZFB A;  1M2B A;  1YVL A;  3IC4 A;  4YQV A;  1E6B A;  1NW2 A;  3EPT A;  2FNO A;  2L6D A;  4AKX B;  3TOT A;  5IMD A;  1V2A A;  4MZC A;  2WS2 A;  2WGR A;  3IDV A;  3EYT A;  4MH3 A;  4MF5 A;  5E4W A;  3H4K A;  3ZRD A;  3C1S A;  5F0G A;  2GZP A;  2HRN A;  3HVX A;  1K0O A;  5IIZ A;  4O5U A;  1F3A A;  4PUA A;  1ACV A;  4IW9 A;  4MZB A;  3G7Y A;  4G0K A;  1V98 A;  4L5L A;  4V1A g;  3LOR A;  1R5A A;  4AJ7 A;  4G0I A;  5EY6 A;  2VL3 A;  3M8N A;  4ZBD A;  2OAC A;  4HU7 A;  4MPF A;  4G01 A;  1BJX A;  1KNG A;  3TJB A;  2LJK A;  3IHQ A;  1MD3 A;  3GL3 A;  2V1M A;  2VM1 A;  3EC3 A;  1PKW A;  4X0X A;  5D9X A;  3H1N A;  1TRU A;  4MJB A;  2HLS A;  1OKD A;  5E59 A;  4YH2 A;  1NHO A;  1ST9 A;  2R0C A;  5ECI B;  2C8U A;  1LBK A;  4HQZ A;  1O7U A;  4NMU A;  2FCH A;  3ERG A;  2FWF A;  3KZQ A;  4K6X A;  2H73 A;  3L78 A;  2I1U A;  3QAV A;  4ACS A;  4OCE A;  1UC7 A;  1KEB A;  4X4J A;  2NTO A;  2EIQ A;  4K5R A;  1HQO A;  1AQV A;  5KOX A;  3GUR A;  2CVD A;  1GSF A;  5ECR B;  1OE7 A;  4D73 B;  3EIN A;  1N25 A;  1B48 A;  1JLV A;  5J9B A;  4MH2 A;  1PQN A;  5ECP B;  4F2I A;  4KND A;  4FO5 A;  4NHW A;  2RII A;  2YJH A;  5GSS A;  3KEB A;  3FRC A;  1FB6 A;  4ECC A;  2PVO C;  1PN9 A;  1OC9 A;  1M9A A;  3GNJ A;  2CAI A;  1WMJ A;  1S3D A;  6GSU A;  4KCA A;  1AXD A;  2M46 A;  3D4T A;  3PR8 A;  2LRC A;  3TU3 B;  3ZZX A;  1SYR A;  4K7I A;  4KSO A;  5G1K A;  3UBK A;  4NHZ A;  5CYY A;  1UVZ A;  4MNN A;  4WBJ A;  2GQM A;  4IP6 A;  4KDX A;  1X5E A;  3GKN A;  5J4U A;  3O3T A;  5KN3 A;  4FYB A;  2LUS A;  2OE3 A;  3TKP A;  3LYK A;  3RHB A;  2F3M A;  5DQS A;  2KUC A;  5HR2 A;  3HYP A;  3N9J A;  4AKH A;  1TDI A;  4TKY A;  2L5L A;  3FZA A;  1THO A;  3ZIT A;  4XCS A;  2FD3 A;  3ZL5 A;  3WD6 A;  4LMV A;  3TRX A;  3VWU A;  3F9U A;  4J2F A;  5HR1 A;  4EC0 A;  2VCT A;  2AUV A;  2N5F A;  1CQH A;  5INY A;  4WEY A;  3TJJ A;  3QAG A;  3F6D A;  2PVQ A;  1XWB A;  2LS5 A;  3C71 A;  5AIS A;  4DEJ A;  3EWL A;  2PBJ A;  3NOF A;  3FZ4 A;  5JWQ B;  4QMK A;  5FHI A;  1MEK A;  1WRY A;  4Q5F A;  2LST A;  1XXU A;  4V2L A;  4L0U A;  4EVM A;  2GST A;  3LJR A;  1VF2 A;  3VUR A;  5ELA A;  3DVX A;  3A3T A;  2H74 A;  1A8Y A;  4KE3 A;  3NIV A;  1PD2 1;  2C0F A;  2BMX A;  2QA1 A;  4W66 A;  3CBU A;  2QKE A;  2RM6 A;  5ELG A;  2VCV A;  5BMU A;  4Z2T A;  2MMZ A;  1XW6 A;  2LEG A;  2KP2 A;  2CAQ A;  4LLR A;  2B7K A;  4V2N A;  2A4V A;  4E8H A;  2DJ0 A;  2R2J A;  1TXX A;  4Z7X A;  4GF0 A;  1OYJ A;  4PUR A;  1SYX A;  2BJX A;  1GUH A;  3A2W A;  4MF7 A;  5DAL A;  2HSM A;  5F05 A;  2ON5 A;  5JCU A;  1EP7 A;  1YQ1 A;  4NV2 A;  5DQY A;  3M9J A;  2VD0 A;  4K5S A;  1VGL A;  2CV4 A;  2IMK A;  2O5V A;  3ZMK A;  5KN2 A;  1JZO A;  3ERF A;  4POK A;  2ALB A;  3KTL A;  1Q4J A;  1BG5 A;  1YJ6 A;  1M2A A;  1YZX A;  3TGZ A;  1PRX A;  2B6M A;  3IRA A;  4K0N A;  2WUL A;  4YQU A;  4FQU A;  3HKR A;  4GCI A;  1HNA A;  2YAN A;  22GS A;  5D9W A;  1FG4 A;  5DDL A;  3TUE A;  2PPT A;  1ZCP A;  2AHE A;  1WP0 A;  4YQM A;  3GH6 A;  2CX4 A;  2H1B A;  5IMC A;  4Z2U A;  5ECL B;  3A5W A;  4AGS A;  2PER A;  1GTI A;  1FVJ A;  5GAN D;  3D5J A;  3TOU A;  5C00 A;  2HYX A;  3Q18 A;  2F51 A;  3VFI A;  2QC7 A;  3KMN A;  4MAB A;  2VAF A;  2JZT A;  1PL1 A;  2DML A;  2IMD A;  2KHP A;  1KTE A;  3HY2 A;  4F0B A;  3UOM A;  5H5Q A;  4TR1 B;  2CA8 A;  1AW9 A;  3PGT A;  2YWN A;  4GQF A;  4NV5 A;  1SL2 B;  3IPZ A;  2DC5 A;  1B4P A;  5J4V A;  2WJU A;  3MIX A;  1M0U A;  2VLT A;  3CMI A;  3TJK A;  1R26 A;  4BA7 A;  4KH7 A;  4EDZ A;  2VKZ G;  3D6I A;  3DWV A;  3RPN A;  4K8M A;  5IQY A;  1BYE A;  4I97 A;  2N5A A;  3FZ9 A;  3LEF A;  1TRV A;  3U5R E;  2CVB A;  4KUN A;  4O7H A;  5EL8 A;  3ZML A;  3P90 A;  4PQI A;  1T00 A;  2GT5 A;  4MLY A;  12GS A;  1PX6 A;  1VF4 A;  3IV4 A;  2EC4 A;  5J9C A;  3M3M A;  2HT9 A;  1YY7 A;  5CNW A;  2X8G A;  1FOH A;  1KBN A;  4ZL8 A;  3VI7 A;  2HZF A;  2YWM A;  3L4N A;  1SEN A;  3IXR A;  3C1R A;  2AAW A;  4I5Q A;  2H0H A;  2JSZ A;  1PGT A;  4PGT A;  4P3Y B;  1B8X A;  5CAX A;  2B1L A;  5J4Y A;  1IYI A;  5HR0 A;  3GV1 A;  1LJR A;  3L9V A;  5B8A A;  2LNS A;  2VUP A;  1C72 A;  2X8H A;  16GS A;  1RQM A;  2R6K A;  1ZL9 A;  5D9V A;  2P5Q A;  13GS A;  4I2U A;  1ON4 A;  1TI1 A;  5A1N B;  3QOU A;  4E8E A;  3IK7 A;  3BJ5 A;  3IR4 A;  4MCU A;  3U6V A;  4GSS A;  1TK5 B;  3RHC A;  3FW2 A;  1F2E A;  1MTC A;  5DJM A;  3W8J A;  4RQR A;  5ECH B;  3UBL A;  5IMZ A;  5A4U A;  2A2P A;  4IJI A;  1OVN A;  2JZS A;  2VIM A;  1FHE A;  2V41 A;  4BVY B;  4GTU A;  2NPB A;  5CRW A;  1QMV A;  4USS A;  3E0U A;  2DLX A;  2LV3 A;  3H8Q A;  2FWH A;  4AKG A;  2B1K A;  3FMW A;  3QDN A;  2FY6 A;  5A5K A;  1G6Y A;  4NPB A;  1UN2 A;  4GQC A;  1RK4 A;  1XBS A;  2RUF A;  2ZCT A;  18GS A;  3I9V 2;  1PKZ A;  3VWX A;  1OC8 A;  5A4W A;  5J40 A;  5AIX A;  3FR3 A;  2HSM B;  1XVQ A;  2IL3 A;  2L6C A;  5ECK B;  4BL7 A;  1HD2 A;  1MDJ A;  4EE0 A;  2OE0 A;  3ZFL A;  5GZZ B;  5A5H B;  4HEA 2;  1H4O A;  2C4J A;  3IK9 A;  1SJZ A;  4XRA A;  3GIX A;  3M9K A;  3GTU B;  3GSS A;  1B4Q A;  2RLI A;  4K7N A;  4AI6 A;  4AJ8 A;  1ZYE A;  3E9J B;  3F63 A;  3CSH A;  2VO4 A;  2BTO T;  4QL7 A;  4KGI A;  1ZOF A;  2B7J A;  1K3L A;  4MJE A;  5AIV A;  5G5F A;  3TKQ A;  3EMX A;  1GNW A;  5IOX A;  2HRK A;  1JZD A;  4HQS A;  3GFK A;  4GWR A;  3F0I A;  1AQW A;  3ME8 A;  2HSY A;  4PQH A;  2R3X A;  5JCW A;  3MNG A;  3GMF A;  1GLQ A;  4TXO A;  3ZIV A;  4V1A p;  2C0E A;  1W89 A;  2AV4 A;  3WT1 A;  5CRD A;  3FR6 A;  4DSS A;  3M1G A;  3D22 A;  1TKD B;  1TXU A;  2DJJ A;  3EU4 A;  2VL9 A;  1Q98 A;  3SWL A;  1BG1 A;  2H72 A;  4IGJ A;  5ECS A;  2DSA A;  2X4A A;  4KB3 A;  2HSN A;  2X49 A;  3I69 A;  1G7O A;  3KIJ A;  1EGR A;  1VF1 A;  3ISO A;  1G7E A;  1TOF A;  2QSI A;  3CSJ A;  1SK0 A;  4WF4 A;  3WGE A;  2MZC A;  2LTK A;  4XS4 B;  4TRX A;  4HDE A;  1ZMA A;  1I5G A;  1DUG A;  2H0G A;  1GRX A;  2H8L A;  4I2T A;  2XPE A;  1J0F A;  4BVX A;  1AUC A;  4ZL7 A;  1G6W A;  2CZ3 A;  5HFK A;  5LD0 A;  1X9M B;  4YKG A;  2JAD A;  2K18 A;  3J7Y k;  1M7T A;  3IAS 2;  4BWQ A;  1XPV A;  1XZO A;  3KH7 A;  3MWH A;  1GH2 A;  4QL9 A;  1YF1 A;  4JRR A;  1XFL A;  4RI6 A;  2VCZ A;  3Q74 A;  2FUG 2;  2H66 A;  1LU4 A;  1DBY A;  2EFE A;  2DMM A;  1XW5 A;  4GST A;  5F8B A;  4KX4 A;  1ILO A;  2HNL A;  1M9B A;  1PSQ A;  5G30 A;  17GS A;  4ID0 A;  2P0G A;  3TJF A;  5DBQ A;  2VD1 A;  1V58 A;  3CXG A;  1YEX A;  1T4Y A;  3FEU A;  3BD2 A;  2UZ8 A;  2KOK A;  3TJG A;  3Q19 A;  4XS6 A;  2H1A A;  5ID2 A;  2YNX A;  4G2E A;  3TDG A;  5KN1 A;  4PNG A;  1XWA A;  2PWJ A;  1XWG A;  4Q5R A;  4ZBA A;  4X1U A;  3F4T A;  1XOA A;  1QQ2 A;  3KXO A;  3KD0 A;  2H6Y A;  2JSY A;  2H76 A;  3I43 A;  2VL2 C;  4EF0 A;  1K0N A;  2F8F A;  5ECO B;  2VL2 A;  4TXV A;  4ZB7 A;  2TIR A;  1XW9 A;  2HZE B;  3G7I A;  5L71 A;  4GDF A;  4IBP A;  1W4V A;  3LFL A;  4I8B A;  4J56 E;  1SK1 A;  5HQP A;  3EUR A;  3DML A;  2DJK A;  2B3S A;  2YWO A;  1SVL A;  1AAZ A;  2OBK A;  4LA1 A;  5A34 A;  4IS0 A;  1GNE A;  1A8L A;  2FWE A;  1GTA A;  5ECM B;  3QD9 A;  1V57 A;  4J57 E;  4O92 A;  9GSS A;  2VOC A;  4KF9 A;  4KW6 A;  2GZZ A;  5KN0 A;  1T3B A;  3GH9 A;  3NZN A;  1XIY A;  2GTU A;  2HI7 A;  2RM5 A;  1TK0 B;  2EFH A;  2OE1 A;  2D2Z A;  4MA9 A;  3ZIJ A;  3VPT A;  1SD8 A;  2E2M A;  1K3O A;  3UVT A;  1U3I A;  3FHK A;  2I9H A;  2YP6 A;  3TRP A;  1A0F A;  3BCK A;  2G2Q A;  4N30 A;  2LRN A;  1N2A A;  6GSW A;  2YN1 A;  2VM2 A;  4CW9 A;  4XHM A;  1JFU A;  2R5G A;  4ECI A;  2KP1 A;  4XRD A;  1GSY A;  1HYU A;  2JU5 A;  1U87 A;  2LJA A;  4KCE A;  3APQ A;  2IFQ A;  1PX7 A;  3LWA A;  1HNB A;  1USB A;  4K0G A;  1S3A A;  2HE3 A;  1PL2 A;  5JWR B;  2GGT A;  2J23 A;  4CHS A;  7GSS A;  2FHE A;  5IMV A;  2C3T A;  2GSQ A;  1HNC A;  2PGT A;  2P31 A;  4HJM A;  1K0B A;  2IPA A;  4ECJ A;  4FYU A;  1GL8 A;  3HJP A;  5D9T A;  2UV8 G;  1SL0 B;  1A0R P;  2L4C A;  1BQ7 A;  2IWT A;  1CQG A;  1SVM A;  3LYP A;  4MDC A;  2HRF A;  2LKU A;  5CRE A;  5DJL A;  2MMA A;  4F03 A;  2I3Y A;  3IAM 2;  3CRU A;  4IEL A;  4O32 A;  4JR4 A;  3MAK A;  4YAV A;  4CY6 A;  1A2L A;  5B6N A;  4I6X A;  1E2Y A;  1ZGN A;  1M99 A;  3HJM A;  1K0C A;  3O76 A;  3VK9 A;  1ABA A;  3FR9 A;  2C1Y A;  3BBY A;  4JZQ A;  1QUW A;  4L5O A;  3RBT A;  3KP8 A;  1VRS D;  3W8S A;  1AQX A;  5IPH A;  2G0F A;  2XC2 A;  1SJI A;  2HFD A;  3GA4 A;  3HZ8 A;  1GP1 A;  2C0G A;  5G31 A;  3C73 A;  3H79 A;  11GS A;  5KEJ A;  2C0D A;  3LXT A;  1ML6 A;  1AC1 A;  3RAZ A;  1GTB A;  4XIH A;  2X8C A;  4KSM A;  1Z6N A;  3AY8 A;  4OWY A;  3MSZ A;  3IC8 A;  2FLS A;  4ISD A;  4ICY A;  3ZLP A;  5GST A;  2GLR A;  1PMT A;  1OC9 B;  1YKA A;  4BPY A;  4TN8 A;  1R4W A;  5F07 A;  4MJC A;  2O87 A;  4EIP A;  1Y1U A;  2IN3 A;  5HFI A;  1H75 A;  4PXO A;  3D4M A;  2X64 A;  5ECQ B;  2K6V A;  1NSW A;  3E3E A;  3KGK A;  2OAD A;  5B6M A;  4HZ4 A;  1GLP A;  1SU9 A;  3GKX A;  3A2V A;  1ERU A;  3MDK A;  2GVP A;  2LNT A;  2MYG A;  3TKS E;  1ERV A;  1Y25 A;  2HSH A;  2LQQ A;  5JCG A;  3EE2 A;  4IHU A;  1GUM A;  2ZNM A;  1WIK A;  2H30 A;  5IMF A;  1B9X C;  1Z7P A;  3F8U A;  3HJO A;  3A2X A;  4L8E A;  3F4R A;  2P5R A;  4D73 A;  2H70 A;  5DVB A;  1I9D A;  1OAZ A;  3GX8 A;  1G0T A;  1GSE A;  3LSZ A;  3FK8 A;  3TB2 A;  19GS A;  1AIU A;  2LJR A;  3UJ1 A;  1O8X A;  2VCQ A;  3HVV A;  1TJD A;  1MDK A;  4F9Z A;  4ILF A;  5EVO A;  3IBH A;  3PIN A;  1UA5 A;  2IJY A;  3ED3 A;  1MD4 A;  2H01 A;  4DSQ A;  3LG6 A;  1OC3 A;  3GST A;  1O6J A;  2CX3 A;  4POM A;  3GUS A;  3WGX A;  4G10 A;  2A2S A;  5J41 A;  3VLN A;  4DSR A;  3DXB A;  3LGC A;  4GLT A;  5BMU B;  4OD7 A;  3EVI A;  3Q6O A;  5LCZ A;  4KAE A;  5CRH A;  2R0P A;  2DIY A;  4FH8 A;  2R4V A;  4EO3 A;  2WCI A;  5IPG A;  4PTS A;  5DAL B;  2B5E A;  4TVE A;  4TR4 A;  3PPU A;  4EIQ A;  4PNF A;  3V1W A;  2K8V A;  4RUV A;  3HA9 A;  5F06 A;  3WYW A;  3IHG A;  2MBS A;  4EL1 A;  2CT6 A;  3F4S A;  5IO2 A;  3GKM A;  4O5Q A;  2VCX A;  2IME A;  1X5D A;  5JWO B;  1A24 A;  3DD3 A;  2FA8 A;  2M80 A;  1A2M A;  2FA4 A;  1PN0 A;  1GSS A;  5B7C A;  3QAW A;  1Z5Y E;  2MMN A;  4N10 A;  1EEM A;  4AF2 A;  4Q5N A;  3HD5 A;  1FW1 A;  4MPG A;  2DKH A;  1GSQ A;  1T4Z A;  1QGV A;  2E2G A;  1JLW A;  4K9Z A;  4ZB8 A;  3QPM A;  3M0F A;  3DGQ A;  4WR5 A;  1JZW A;  2QGV A;  3W6G A;  4K1F A;  1SL1 B;  2Z9S A;  1A2J A;  2N5B A;  5D96 A;  5H5R A;  3QFB C;  5GAP D;  3HVS A;  3DEX A;  1Z6M A;  2NBS A;  3HZ4 A;  1GUL A;  4HUA A;  6GSV A;  1O81 A;  2A4H A;  5IMA A;  3BCI A;  2ES7 A;  1M2D A;  3C8E A;  3GYK A;  1JZR A;  1SJ6 A;  3VPQ A;  4RI7 A;  3GRX A;  1OE8 A;  4HJ2 A;  4N3Z A;  3HXS A;  3DRN A;  1XWK A;  1B9Y C;  2TRX A;  1O8W A;  4YKF A;  3VI5 A;  4TW5 A;  4JE1 A;  3S9F A;  4KDU A;  1A23 A;  3CRT A;  3KP9 A;  4MJA A;  2PUK C;  20GS A;  1YEP A;  5ECN B;  1O73 A;  4ZB9 A;  2LQO A;  1TP9 A;  4N0Z A;  5DAK A;  1N8J A;  4WR4 A;  4E68 A;  3KTB A;  1URM A;  2XBI A;  3HDC A;  1JHB A;  2DJ2 A;  3IOS A;  4QQ7 A;  2GQK A;  3CTF A;  5IO0 A;  1GSU A;  3F3R A;  1TTZ A;  2B5Y A;  1FVK A;  4TOP A;  2PN8 A;  3P2A A;  1ZZY A;  3FYG A;  3L9U A;  3ZYW A;  2YV9 A;  2GS3 A;  1NHY A;  3G7J A;  1EGO A;  2B5X A;  1EOH A;  2GZY A;  3ZVJ D;  4IP1 A;  3F6F A;  5B8B A;  3LW9 A;  1T7P B;  2YZU A;  3EMP A;  4LL1 B;  2IMI A;  4LL4 B;  4AJ6 A;  3CTG A;  2F9S A;  2IMF A;  2H1L A;  4OFT A;  3IA1 A;  2GSS A;  2V2G A;  2IIY A;  1V9W A;  8GSS A;  4X43 A;  2WDU A;  3TKR A;  2GQL A;  3O6T A;  1EV9 A;  4ZIL A;  1ZYQ B;  3FY7 A;  1TU8 A;  4Q5Q A;  3P7X A;  2FWG A;  1XWC A;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...