2CA9A

Apo-nikr from helicobacter pylori in closed trans-conformation
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
139
structure length
132
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 33
structure length 132
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2ca9A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2ca9A02
1ARQA 2BNZA 2BJ9A 1IRQA 2HZVA 2WVEA 2CAXA 2K29A 2KELA 1BDVA 2Y3YA 3GXQA 1B28A 1X93A 3VEBA 2NZCA 2CADA 3BKTA 2K1OA 3QSIA 1PARA 1Q5YA 2JXGA 1P94A 1BDTA 2PC6A 1QTGA 3FT7A 1MYKA 1MNTA 1B01A 2K5JA 2RBFA 2BJ3A 2JXHA 1NLAA 1Q5VA 2GPEA 2K9IA 3QOQA 2BSQE 1ARRA 2CAJA 2WVDA 2K6LA 4FXEA 2WVBA 2BJ1A 2JXIA 4ME7E 1EA4A 2BJ7A 2CPGA 2BNWA 3PHTA 2WVFA 4HV0A 2CA9A 4D8JA 2BJ8A 3FMTA 3BKUA 2F1FA 3H87C 3VEAA 3BKFA 2BA3A 2FGCA 2H1OE 1BAZA 2WVCA 2HZAA 1U9PA 3VW4A 1MYLA 3OD2A 2AY0A 3LGHA
chains in the Genus database with same CATH superfamily
1AUDA 2F63A 3NOCA 3BR9A 4CYUB 2B9XA 1EQMA 2ZWOA 4QR0A 4DX6A 4JI4F 2Q43A 1VIXA 3OR2B 5F8IA 2VH7A 4TU8A 3M6UA 2R7TA 2HFVA 2HVZA 3A12A 4MIAA 1LXNA 2YNIA 2XNRA 2R8HA 2ZC4A 4WFNQ 1RWMB 5LM7E 1U1NA 3RB6A 3BQ0A 3C14A 2QA2A 1FXDA 3T19A 1SKRA 1D8ZA 3GIRA 1KVJA 1FFWB 1Z2LA 5H9EJ 2MKJA 1UTAA 5HMXA 1FRJA 5HLFA 3H8YA 2FZGB 1WNEA 5HJYA 1SI9A 1PAEX 3FBEA 1U1PA 3SFGA 4ED4A 2OFGX 3BO2A 3TA0A 3A8EA 4NXMF 3MHYA 2X3DA 2YKMA 4E0DA 1M90T 1NSQA 1RB0A 2NCKL 1CG2A 2IC3B 3VZHA 2UZAA 4ECXA 2UV8A 3CC7S 1SC1B 3DXBA 2DTJA 2HLTA 2IAJB 2OI2A 3Q89A 3A1YG 4MK8A 4OI3A 1R8AA 1MN9A 3MM8B 3D3CJ 4MH8A 1R8CA 2GJIA 4H4OB 1IBMF 5EN1A 2BOAA 2OTJS 1X4GA 2RKIA 1M5SA 1B4SA 1YJNS 4KE5A 5CYMB 5C42B 1S0MA 2NQPA 3K0JA 2AP6A 2YBVA 4KFBA 4KYZA 5K20B 2VG5B 2E1PA 1MSWD 3KMSA 3W9IA 5J2QB 1ZOTA 3HVAA 1UVMA 3W2VA 1RWOB 3QT5A 2PEBA 2QYGA 1N54B 3ILJA 2K7JA 2N7YA 5KFEA 2F65A 3VQSA 3J7AN 1V5IB 2JHEA 1AYEA 3US5A 2Z0GA 5HANA 1KRPA 1L3SA 3KG4A 3G8SA 4KBIA 3QATA 1WG5A 3EJMA 4GC6A 1YG0A 4OYWA 1K73T 4RW6A 4KKOB 3W5ZA 3QRQA 4DL2A 3SQOP 1EX8A 1JLCA 1GFWB 1HWLA 4CZCA 2UP1A 5HVFA 3EUNA 4DSEA 1U47A 5M2UA 5C5JA 2UUAJ 5EX3A 3IS9B 4HL9A 1GXUA 1OQ6A 1S9GA 5ETVA 2B3TB 2MQ8A 2F3JA 3VCDA 4KTQA 4PQUA 1HWJA 1WKLA 3ZTOA 1ZZNA 5H9EK 3OXLA 2XMWA 3HZGA 4ZLJA 2BDPA 2K8GA 3CNQP 2XBPA 2V9WA 4QIWD 1K0VA 1WC6A 5B7WA 4WK3A 2JNJA 3UCGA 4NXNF 2YVSA 3EGNA 3WDOA 4EFAC 3D6MB 1PIEA 2R3VA 1RA7A 2ZBRA 2W4DA 2MLXA 2HBZB 5JMNA 3IR5B 5F3TA 4OHYA 1LWEB 1YITS 3DCAA 2OELA 4PPDA 1LWFA 4XAKA 3SYZA 1SV5A 2JEFA 3I4HX 5IOLA 1B0TA 2LQ8A 1LNQA 1T9TA 1KSPA 2AY0A 2HURA 4IH5A 3MECB 1LKZA 2QMWA 4LF2A 3V2UC 5D77A 4ES1A 5AE1A 3M05A 4X4QA 2V9KA 3GP9A 4FBTA 2C2NA 4RR5A 4FDFA 3PNIA 3K5MA 4LF9F 3IGVA 5HP1A 1CS4A 2XSJB 1F9HA 1U6BA 3S01A 2FY1A 4F02A 2MXYA 4DV5F 2EPIA 1DRZA 2M8HA 2RMLA 5HAOA 1NU4A 4KO0A 5KFAA 2OJ3A 3FGVA 2EW9A 1PILA 2IDEA 1RUSA 3M2RA 3GR0A 2HGLA 2WOMA 4PZVA 2QL9B 5L39A 5LMNJ 4DV7J 4PAAA 3QRPA 3HF5A 3TQEA 4USUA 5CABA 3V4IB 3BSNA 4LT6A 3NCPA 4WIIA 3P5BP 5B0GA 3THPA 4A48A 2F4VJ 2E5GA 4RW6B 4RNNA 1BUXA 2V5HG 5ETQA 4EO6A 4N56A 4FKXA 4IH7A 4B9NA 1VK8A 4I2QA 2HRYA 1YBTA 4Y2MA 5J1EB 4IR9A 2ZOMA 2APOA 4MKVA 4U67Q 3OTOF 2CXEA 4DV2J 4PR6A 2IDLA 1SB6A 4X84A 2WVEA 1HQ2A 3PYDA 4CO5A 4ED7A 1JWWA 2CNNB 2GHVC 1KQGB 3HT0A 4MT1A 4OI6A 4ES2A 2ZE2B 4PQAA 3UCZP 4YHHF 2WSEC 1FKPB 4DSIA 2HIQA 3QAEA 3SMZA 1VQNS 2NXCA 2XMUA 1AROP 3MOZA 4JI4J 2CWKA 4K4YA 2CIMA 4AL7A 2HRUA 5K8NA 4ME7E 1TL5A 1TV6A 4MTPA 2MQOA 1YK9A 3F41A 3OSPA 5K14B 1N0VC 3I6PA 4QBUA 1UA0A 4WXWA 1Y0HA 3FRYA 4DI6A 1UW4A 5KTQA 1XNRJ 1OWXA 3GYNA 5KFCA 2G13A 5CD4A 1M0SA 1OYDA 2VASA 1VLYA 1S4EA 2MMYA 1YJTA 1ZPWX 2ACYA 2VFUA 3FUYA 3TUJC 4ZHRB 5IFMA 3GJRB 5K14A 2CVEA 3CC2S 2AMCB 9ATCB 2OEMA 4DQQA 1PJ5A 3QGIA 3BN7A 3MPVA 4X4OA 4B08A 4ED6A 1Y3JA 3PW0A 3BSCA 2KVQE 4CLKA 3P5TL 2FLPA 3PW5A 1BD6A 2NREA 1MLAA 1YI2S 2NXNA 3PYFA 1KVKA 2GPEA 4S0MA 4O3PA 3TW0A 3TZXA 1CJKB 2B9WA 2CJYB 2Z2YB 3BEGB 4P10A 1YBAA 4PG7A 4UTGA 4IQXA 2RJZA 1TK8A 1Q7YT 2A3JA 4FYDA 5LSRA 2DR7A 1S7HA 3LWLA 1CULB 1H3DA 3FMTA 2P2CB 1Q78A 1CPZA 1RAHB 4TXSA 5F41A 3AQPA 4B3SJ 3V6DA 5HO4A 1LK5A 3PKYA 1MU2B 3KJQB 1JK9B 2HEKA 2RDDA 5GAHU 2GO9A 1XMBA 2MSSA 2VD3A 4UOFA 2UVRA 1NPRA 4RWWA 3RYLA 3PX4A 3DOMB 2V8DA 1VQSA 1MMNA 2OPQB 3L7UA 4JI7F 3H4BA 2GHWA 4ICLB 2R2TA 1A6LA 1ZM4A 2DNZA 3BS9A 4UF4A 4WU3A 2RS2A 5IWAJ 2ZOGA 2H9ZA 3UDEA 1MYKA 4J9UE 3T5LA 1NK0A 3DHWC 2BJ3A 1IM6A 2A0FB 2MY8A 3TZWA 3CCSS 1VC5A 2B9YA 4LR7A 3W5XA 5D15A 2F40A 3D5MA 2BNWA 2DGSA 2CPGA 4UOCA 1VRUA 5KT3A 4X4TA 1KNZA 1BE4A 3R6GB 4ZVGA 2KJWA 5KFJA 2CQPA 2IBOA 1IR1A 2OD4A 4RUHA 5ETSA 2LYVA 3E2EA 1KEKA 2ZM6F 3T5JA 2R7XA 2R2RA 4IG0B 3IXQA 3W8PA 2BABA 1DAXA 1LWEA 1U2RA 3CD6S 1UFWA 2LDIA 1M5VC 6FDRA 4JI6J 2IVMA 2CPJA 3LPYA 4I0WA 5HSPA 2XGPA 3BF4A 2KH9A 2NZCA 3K8VA 1T9YA 2YWGA 3KK2B 3CCWA 2Q79A 3TNVA 1VQKS 2D9OA 4IQMA 5D0GA 3HZEA 3S7RA 3S8SA 2UUAF 3M8QB 1B0PA 1GQEA 3HLUA 1UWBA 4PWDB 1QE1A 3BV8A 5IT9U 1RHRB 4XPEA 4DR3J 2PEHA 4WYLA 5T41A 5CH7B 3H4DA 5BXIA 1N56A 3GFYA 1MN7A 1OQ3A 2XULA 3RJMB 1FJ7A 1REVB 5G0RB 1S6PB 2VPXB 4DV1F 2F8HA 2W9AA 1VC6A 4OJGA 1LFWA 4PEOA 1CJVB 3MEDA 4B17A 4OI0A 3SCKE 1S97A 3N5BA 1U48A 2YNGA 1QUVA 2HSEB 2VJUA 1HA1A 5H1SV 1KBRA 1IRQA 4WU2A 1GK8A 4X64F 3CCUS 3HHLC 1HMVB 4FBUA 4HEA9 5DDOC 3IC1A 2V2VA 1UPPA 1NDLA 3GTYX 4CH7A 3AFGA 3G4SS 3T3FA 3WIUA 2KVIA 2PDAA 3EDQB 1WF1A 2VICA 2FYXA 1IWAA 1QSSA 3FSYA 5AXLA 3OVBA 1T9XA 3QLHB 1R8BA 2A1BA 1Y3KA 4OZ0A 2K7KA 3R6LB 4TN2A 2XZDB 4U6PA 4D3HA 1ICEB 5M2PA 2LQJA 2MDAA 3H0PA 3OR1B 2DNOA 4QZVB 4F0HA 2IC3A 4OHWA 3RAMA 3IBCB 3O8WA 2IRYA 1RT3B 2GW8A 3NAHA 4F4KA 1U0SA 4FNIA 4O3NA 3U1NA 4DG1B 3LTOA 2JVRA 1WC3A 4ZLPA 1OPZA 1VCTA 2JZ5A 3GJSB 2Q3PA 4NYZA 4QPXA 2LXUA 4DEZA 4ECTA 2WTFA 1HBMB 1T9UA 2GAGC 1YGYA 2VPWB 3A3PB 4K8RA 5HQ8A 1SJ3P 4GO7X 4PYDA 2M7SA 2DNLA 2G1DA 3KHHA 2DT9A 5A6WA 3TR5A 3ZC4A 4DX5A 3LGNA 1WC1A 2YNIB 5F8JA 5GAGU 1RSCA 3C2PA 1HNIA 3LF0A 2QSFA 4DUTA 1HNVB 3KMQA 3ZZRA 4UQTA 4RW8A 1HWUA 3OFEA 5CA5A 4RUCA 1T3OA 2ZH7A 3UCUP 6AT1B 1W26A 4OZJA 5I42A 1U1OA 4DDFA 1K9MT 3DI6A 1HQUA 2XB2D 1X4FA 1JLAB 2OLWA 1GX5A 3N01A 4G1QA 3GWCA 3SV4A 4WFBQ 4TU7A 2HVHA 1PO6A 1C0UA 3G8QA 1FVQA 2FVRA 1KN6A 2E44A 1XN9A 2PSZA 1E6VA 2RQKA 1CULA 3IGNA 3IR7B 3QT8A 4GVLA 3M8WA 3VF0B 1RYSA 4U7UD 2KELA 2C2OB 2CZVC 1UVIA 2J9DE 1SQEA 4UOHA 1DARA 4CLWA 3HVRA 1MWQA 4ZJQA 5A8RA 3BDPA 1KQFB 4LR9A 1K44A 2FHMA 3QQCD 4OI4A 2XWXA 3QFHA 4EEYA 2V6AA 2HWTA 2ZH4A 1HKAA 2J9EA 4KPCA 1NJYA 3PZPA 4KHPF 2FHJA 3CXCR 3IO1A 2KO1A 1HNWJ 2ZH1A 3M2VB 3E01B 1B3TA 1DTTA 2AEFA 3LPEA 4C9DA 2KYZA 2V8HA 4USTA 3I55S 3L95X 1NSPA 3GIJA 4DS5A 1QAJA 1X0PA 2B5JA 2Z8QA 4E98A 3VAIA 3IM8A 3QSYB 1O8BA 1KHVA 2I38A 1IR0A 4Y2IA 4I67A 5F8NA 3I4PA 1IBKJ 2BE2A 2H3EB 2DNPA 3Q2SC 3IG1B 4P7TA 3PM9A 3M2VA 3SV3A 4M1KA 3DM2A 4QYZJ 2OMOA 4F36A 4FYWB 4XTTA 5L9XA 1RDRA 4L72B 1UVKA 2EVZA 3FK4A 1VHIA 3HSGA 3MR5A 2CPEA 2CQDA 5KG1A 3VR1A 1VQOS 1FA0A 4NX9A 2KFYA 2WVDA 3M30A 2UUBJ 2V2KA 3CDUA 2YWFA 1RCXB 3BZQA 5AT1B 4C6AA 3OTCA 3OPKA 3IR7A 5JUMA 4DU8A 4B3MJ 2OTLS 4ZDNA 4N7TA 1RTIB 4GKJJ 4JI5J 2UUCF 4FZVA 3M9MB 3KTQA 2IIHA 5AJ3J 4NXNJ 1TR0A 4TYAA 3RGIA 3VZIA 2P9CA 5HBMB 4CCHA 2V4JA 1RGVA 1VQ9S 2VKRA 5F0UA 3TEGA 4FYVB 4W4MA 2J5AA 4EZ6A 4LMZA 2CJ9A 2NYIA 4PG4A 4TQRA 3UN3A 4YQWA 1HQEB 3LQVA 2LQBA 1J2VA 4PWWA 1FF2A 1DY3A 2AKWB 3KJVA 4DL4A 2BKPA 1JX4A 1K47A 5FDLB 5J2PB 1SC3B 1CVJA 3MFIA 5DRKA 1HNWF 1IWGA 1S4FA 4ZPCA 1HD0A 3G71S 3P45B 3LP0B 2YY3A 1X9MA 4B02A 2HMIB 3C46A 4GKKJ 5HQLA 1BWVA 1TUWA 4ID5B 1WHVA 1CC8A 2BKOA 1NK9A 4KHMA 2KG0A 2DCLA 2GIFA 3AA8A 1QVGR 4IH6A 1FRKA 1NHKL 4NCGB 3I96A 2QFIA 1T03A 4YFUA 4ER8A 4RW9B 4LFCF 1NLKL 1RTHB 2FY8A 1VJQA 2QZ8A 4WBFA 4P71A 4CLZA 3QYYA 4OYXA 1F3FA 2DPJA 4FXVA 3VEBA 1RBAA 2OPPA 1UZDA 3GIMA 3M2UB 3CJ8A 3H5UA 5MLCV 3QMQA 1R89A 2EXUA 3TJ9A 2B4PA 4CQ1A 3X3UA 5L1IA 1YWXA 3KK3A 1X4CA 1ZTTA 4Q0BB 5C2CA 4BWMA 2KI2A 3PIOQ 3I5BA 2ZWPA 1DQAA 1Z4UA 1YHQS 1JLBA 3SXLA 2CDQA 2R7QA 2RU9A 4CO0A 2F5GA 4CNYA 3NLCA 5AJ3F 4KB7A 4J9SA 2H1YA 1PCAA 1FO1A 1D09B 1PKUA 1CJVA 2AJ1A 1NM2A 2KT2A 1IUJA 3MEDB 4PG6A 5L8RC 2JOQA 4ZVTB 3GIKA 1NRKA 3KJFB 3V4MA 2VG7A 4W92B 1UVNA 2HHUA 3ZTSA 2CPZA 1K1QA 2HFNA 4ZVQB 2GMHA 2N7CA 4Z2XA 3OJUA 3HVWA 1HI8A 2YKOA 5LOQA 3VVUA 2DXEA 2I2YA 2G2OA 3RR8A 3G87A 1R31A 3Q24A 4RNMA 4NLVA 4I6YA 2JXGA 3C15A 4M5MA 4Y34A 1LV5A 1RKJA 1X8DA 4MIWA 3I9ZA 5C42A 1S6OA 3DRPB 2M0GB 1FWPA 4BS2A 3PV8A 4OL8A 1KFSA 2OUGA 3FC9A 1IKYA 2WB1D 2BMBA 1W25A 3MPUB 3DM2B 4FPRA 5IT0A 2MLZA 1TMJA 4DV7F 4FP9A 1S12A 5KG4A 3AD7C 2MKKA 4M94A 1NPKA 5LT5A 4H54A 5MAOA 1WDDA 3ZNJ1 2E7VA 2KRBA 1VDHA 3AJ2A 4IKAA 3RW7A 4O3RA 2B7CB 1BAZA 3RZAA 1YLXA 3C6TB 2AJFE 5KFMA 3WX4A 2CG4A 3K5LA 2NUHA 3D6TB 3GR1A 3D3BJ 3HHNB 3JSRA 1C0TB 1H7WA 2W2OP 3AD8C 2RRAA 1NK7A 3K17A 1DTTB 3Q8YA 4UUXA 5KT6A 3RRKA 5KFXA 2WRMA 5DDQC 1S9EB 1VK3A 1NJIT 2L9NA 4OYOA 2MKCA 4FS1A 1Y4ZB 2AZ3A 1JKHA 1QAXA 3JAMU 3GU0A 3VAMA 3AAWB 1YDLA 3U1LA 5HN0A 1HI1A 1FD8A 1XIQA 3R8YA 2IMWP 3F0NA 3PKMA 2QLWA 4LRAA 3JQMA 2K06A 1AXQA 3VAJA 1VRQC 4KRWA 1HBNB 2FLOA 1D9DA 2CRLA 2Y1LB 2HG4A 2CNLB 3DLJA 2JFKA 1RCOB 3GSIA 5FLXY 4DUYJ 3PW4A 1VR6A 2V0NA 3DHXA 5HBMA 3HFVA 4BC7A 4ECUA 5HMZA 2OIHA 3VW4A 4NOHA 4DLGA 2HHXA 1UCNA 1TL7A 5I42B 3BSAA 2I5JA 1PBAA 1VQ6S 3UN2A 1LWXA 4MKBA 2KXHA 3AD9C 2CJBA 4A8XA 1WWHA 3PYEA 2HAFA 2HAIA 4C11B 2XC9A 2Y1IA 4JYAF 2DNYA 3MM5A 4WKRA 1FK9A 2FJEB 2JWNA 2VIHA 3MXHP 1K0TA 1QUPA 1HBUB 4O0NA 3VV2B 4M8LA 3B82A 4AD6A 4DR5J 4LF7J 2JXIA 2EFNA 2DK2A 2AN7A 1S59A 4OFZA 1D9AA 1ZYQA 2UV8G 1S1VA 5KFBA 5CYQB 3CCMS 2NXEA 4QWEA 4DG1A 3CEDA 1V3ZA 2IHR1 2MKSA 2GHPA 1E6YB 4PXBA 4XO0A 1PSDA 1W2IA 5HMWA 1JLEB 1S1WB 4OYBA 1TKTA 2B43A 4DN9A 2AGQA 2J7WA 1HNZF 1WC4A 2J0QD 2ABYA 2BA9A 4DJBA 3H20A 2C28A 3IAS9 2KG1A 2VB6A 4TY8B 4CH0S 3MEGB 5IC6B 5A0YA 3ICLA 3NKYA 3LO3A 4XK8C 5L1LA 4MK7A 3BYPA 3PO5A 3RB0A 4YDXA 4QYZK 4MMOA 2MZJA 4WZMA 4HHUA 2G0CA 5KG3A 1UEUA 1NLAA 3HVTB 2M3DA 5IT4A 1SC6A 3Q86A 4ZK7M 5DETA 3RAQA 2GJ2A 4AXIA 3VGSA 3OFGA 2VA2A 1WOOA 3NMRA 2HHVA 3DYAA 3MMJA 5KG5A 3CDWA 3R7NB 4BDPA 5J1EA 1C0UB 3DRYA 2QA4S 3SSRA 1U8WA 2HKEA 2ZVIA 3PW7A 4G1QB 4GKKF 2V8PA 2VDIA 3DMJA 2DH8A 3MMAB 4PG5A 4UZCA 2B56A 3R7SB 3PIPQ 2WBRA 2BJEA 4M5JA 5L46A 1HI0P 3DI6B 1M5HA 1VMBA 3ISND 4JI1J 3J7A1 1DBDA 4XIUA 3GYGA 1V5VA 3MM9B 5HI7A 2UXBJ 4LQ3A 2Z2MA 4WP8A 2ZJQQ 2MEWA 3KLFB 1SQFA 2J7UA 2K1RA 1G4CA 2RILA 3FEXB 3FFIB 1S57A 3MR7A 4LUBA 1WSVA 5THWA 3M8QA 3KUHA 3FEYB 2QGFB 2WBMA 2XQCA 3GFZA 1DFDA 4PABA 1GMUA 3CJSA 1DLOA 1IXKA 4DV2F 3NEKA 3PDNA 1PC4A 2VUGA 4QYRA 1FX4A 4OMFG 3SZ2A 3FQKA 3GFXA 3IBFB 4I2PA 2YQ3A 3EVOA 2EC0A 3DLEA 1BLUA 3EDRB 1LW2B 2LA6A 1H2TZ 2AU0A 3O5TB 3CUNA 1O51A 2P6SA 5ETNA 1A0OB 1XQIA 3LALA 1TL4A 5E3AA 5LL6d 4FYXB 3FQLA 1NK6A 1BC6A 1IM4A 1M1GA 2AYMA 2Z2LA 2ZNZA 5CCMA 3R5CA 1RXOB 3J81U 1JLGA 5DQGA 3MUTP 5BYRA 3LP0A 4PG8A 1X93A 2GVDA 4K59A 1DLOB 4CRJA 5HL7Q 4O0IA 1EHWA 5D78A 2O66A 3HK2A 1LEOA 1ITPA 1R0CB 2UXCF 2YQ0A 1C1CA 3OTBA 3FFIA 2ZBPA 2E1CA 3RRHA 1S9GB 4LVOP 4HVZA 5KFZA 4YY3J 3CCZA 2FZCB 4ZCLA 4DX8H 5KFIA 1TELA 1QLNA 1VS3A 4NLRA 2YNGB 2B6AA 3AB2B 4DPTA 3LW5C 5BR8F 4DUZF 1BQMA 4QPTA 3G9CA 3ZZPA 3A8JA 3DKDA 2RB7A 3D54A 2LFVA 3DMJB 3HSDA 4ZVOB 2ZHAA 3IWLA 1S6PA 3CCTA 3EX7B 5E3CA 1U1RA 4C7QA 1UVJA 1V9OA 3T5HA 3AB4B 4OHVA 4CI0B 1LQ9A 2QLBB 2ZUGA 4QWCA 1KD1T 1TUVA 3HSJA 4AQYJ 2H5EA 3UI3A 2XM3A 4KFBB 1QE1B 4NLPA 4ZN1A 1SPBP 4RBTA 3ZTQA 4CT9A 2DJWA 2M2BA 4NLTA 4YB5A 2HHHF 4F7VA 2Z4PA 2YKAA 4UZBA 4YB1P 4ECRA 2JLFA 1NAQA 1R8HA 1F5CA 3BB5A 4G6VB 4LSLB 1KOOA 4F3MA 4DV6F 3VAFA 5CQGA 2IY5B 3Q8RB 4IO9Q 3UVJB 2XCPA 3U7JA 4DUYF 4USJC 2YKNB 2YKNA 3B4MA 1X4DA 1Q8KA 4ZCKA 4U7UK 3GSDA 5K8PA 3D1QA 1TL3A 5LXYA 4WFAQ 1U1QA 1FJGJ 2CYYA 1UVLA 2W9BA 3R27A 1FESA 3JYTA 3KHGA 2UUCJ 2DPIA 1PYTA 2MHEA 1JXEA 4N41A 3TO8A 5C7PA 2ZH6A 5JVHQ 3TQ1A 4MIBA 1R0AA 4Q8EA 3BBFA 2KHDA 3P3DA 2KM8B 3GE9A 3G6ES 4ED0A 4ZPAA 2Y8YA 2EWHA 4KGKA 4HI2A 2GCFA 3NGDA 4LBIA 4YN3B 3ZZYA 4YB6A 1UA1A 4X2BA 1OY9A 3PRBA 1BGXT 1H6KX 2M5YA 4X66F 2Q2KA 2BKNA 4URQU 3U27A 1S72S 2ILZA 3EM1A 1RA6A 4K2XA 4I68A 5JXSA 3DLHA 3FZ2A 5L1KA 2HFZA 5IC4B 4PKDB 1XNQJ 4NLUA 2JRSA 4O3SA 1N8RT 4DQIA 1C1BB 2DGVA 4N77A 1VQPS 3KLHA 3OHAA 1I1GA 3EGVA 1N33J 5C25A 2CQ2A 1S6QB 4EYHB 3V4IA 3DLKA 3N6LA 5I3UA 1H0HB 3PR5B 2VG6B 2W25A 3CO0P 4WF9Q 3O6QA 2EFGA 4AT1B 1XMOJ 3FBBA 3NGUA 4YR0A 3RRGA 1ACMB 1FNOA 4JV2A 4ZP8A 2FB0A 1H98A 2B4OA 2PI5A 4DCPB 2PD1A 3K8WA 5KT4A 3PRDA 2ZITA 2D74B 2VBXA 1FE4A 4R8UB 5EHHA 1S9EA 4MAKA 2ZH3A 1JLGB 1L3UA 1NSKL 3CDEA 3CJ5A 3S1TA 2EFPA 2GNKA 3ILOA 3MCMA 4KAIA 5KFWA 4PCQA 1DURA 2PMHA 3HULA 4QIEA 2HHQA 3G6YA 2ZBCA 3TUZC 4GO5X 1Q8IA 1RAJA 3MZIA 3GQCA 1QTMA 3DDNA 4DF4A 3HX9A 2WAQD 4J37A 4NZ0A 3MAAA 3HDSA 5J2NB 1RHQB 2I9SA 1BDTA 2C1EB 1GXLA 3HCXA 3NG8A 3MM7A 1WEZA 3DDIA 3R1HA 3CMQA 2BJDA 4F04B 3HKWA 1WKJA 2ZE2A 1RT7B 2R8GA 1VRTB 2HBRB 3FVYA 2G0IA 5KFVA 3TP2A 1R7IA 3QGHA 2MSTA 4HACB 4J9RA 3K58A 4NRUA 3ZTPA 4L76A 1KVIA 3BGRB 4WE1B 3SSQA 3O2IA 1SJQA 1ZA1B 5LXRA 5J1NA 2QLXA 4O44B 3GJQB 3CD5A 3MCOA 1IKVA 1WUUA 1RK8A 2GGPB 2MQQA 3DOKA 2DR6A 4Q43A 3H25A 2B6AB 4OV6A 4OYMA 5GAEU 3W9HA 2V67A 1NDKA 3KG0A 3PEHA 3MAQA 2F8MA 1CJTB 1CQMA 5B0FA 4DV3F 4QWBA 3R5AA 3JQKA 2AEMA 1RT7A 3RB3A 1UP1A 3GCWP 2VG5A 3HFZB 1FFSB 2FUG9 4I6AA 4J9VA 5DS7A 3AXKA 4FS2A 3KK3B 3HMJG 1SQGA 4ZIVA 4K0KJ 4Z37A 2RKIB 2AD9A 4JI3F 2IBKA 1T05B 1ARRA 2RD5C 1TMMA 2K6LA 2CJKA 3TJAA 1LK7A 1AZSB 1N0UA 2BEFA 4ZJLA 1TL1A 5A0YB 5KFDA 5EWGA 2LDYA 4O3QA 4NXMJ 4NA2A 3NNHA 1TFYA 4RUBA 3KLIA 5E2QA 5DLFA 5D4OA 2FGCA 3BBBA 4ZP9A 1FRLA 1IBLJ 2DISA 4KH1B 4X66J 4RNHA 3A13A 2VJVA 4DR5F 2W9CB 1LW2A 1OY6A 5E33A 1S1TA 4KSEB 3M8YA 5B0EA 5F3ZA 2DR5A 1VBYA 1IBCB 3THTA 1RWVB 1UFLA 4I7FB 3WIVA 5B0CA 4IO1A 4ILLA 1B7FA 4NLGA 1UAWA 3G2XA 3Q83A 4R0EA 1B0VA 4NYOA 1EETA 5DG9A 1Y00A 3RBDA 4F2SA 2LU1A 2E5LJ 1RT1A 4CTAB 1HPZA 2OSQA 4OX7A 5ETLA 3VGVA 4ZVEA 1FK9B 2NYHA 3VGTA 2LVWA 4EO8A 3KLVA 1ZETA 3QOQA 2NPIA 3UQSA 1X5TA 3GB0A 4J9MA 5LJ5Y 4BCAA 2G4BA 2ZUAA 1RI7A 5EUHA 3DLKB 2ZZMA 1Y9OA 2CA9A 1LWCA 1NPPA 4AYBD 3RBXA 1S7IA 4ENOA 2XS5A 3FBCA 4O4GA 1H2VZ 4BWJA 1FJEB 4P52A 1JJ4A 4IRKA 3C3LA 3QWPA 4KKOA 4NE9C 2D41A 1RTJB 2GAHC 3WX8A 7FDRA 3OD2A 2ADCA 3B78A 1DTQA 1U25A 3QBCA 2QO3A 3I5AA 3GV5B 5J2MA 3MTJA 3IWNC 1EZZB 2F8EX 5KOWA 5DLGA 4J9NA 4DFJA 4GVBB 4AQYF 2CPHA 2LXIA 3N4WA 5CZXA 1JIHA 3DLBA 1DQ8A 1ZAWA 2Z2ZA 1TKZB 2PC6A 3RB4A 2XS2A 3PG9A 2ALZA 3NRBA 1YJWS 1RWKB 3GONA 4HYKA 2WVBA 4EYIB 2BZ2A 2IRUA 4LIRA 3JYTB 2IJNA 4NEZA 4ZHRA 1C0TA 1M1HA 1NHUA 4N8OA 4ES3A 3D67A 2MZ1A 1R0BG 4P72A 3K59A 1XBWA 5F9NA 2C3UA 2JBVA 2B5JB 1M5PC 4P2FA 2KFZA 4WYWA 3KG1A 4NI2A 1U1MA 1N33F 2DR8A 1YKWA 3BDEA 2BJ9A 4ECQA 2M70A 3E01A 4U9RA 3UDVA 1ROFA 4WTYA 2L48A 2QN6B 4RBVA 1YQHA 3D7SB 1BQXA 1EJ7L 1RQ0A 1UMJA 2K1OA 1WF2A 1HWKA 1NUEA 2H4YB 2GS8A 3M6WA 5SUHA 1RACB 3DRPA 1K8AT 1KONA 3D1HA 4J9OA 3QFWA 4MYUA 2COLA 2DH9A 2MZRA 3BYRA 1IKWA 4MKAA 1MROB 4LRDA 3GPAA 3PTWA 4KGMA 4V1Ak 5IS2A 4ED2A 4DFKA 1TU0B 3DRRA 2MKYA 3H2UB 3D6FB 2JLEA 3NOGA 1URNA 3LANA 2X1AA 1HNXJ 2XNQA 1GNKA 3HHLA 1JLAA 1WDTA 2DR9A 1ULRA 4ANDA 1PGZA 4B9UA 2CQBA 2G2YA 2OPRA 3ET6A 4QJVA 5DZ7A 4CO2A 4WFYA 3MFHA 3QJPA 3SEOA 2OEJA 3EE3A 1RYRA 2PFDA 2MHNA 4KV8B 3CGIA 4NMLA 4DL3A 4P75A 2KFNA 1EARA 2PE8A 1RZMA 1WSRA 4Q0BA 2M52A 3RTVA 3TAPA 3PY8A 2QFJA 4XDCA 1EETB 3I0RA 2Z57B 3M1VB 1O6XA 4X64J 1P9QC 2Y0SD 2QJ3A 3TUPA 3NGKA 2AF6A 2GA7A 1N34F 3H87C 4QU6A 1Q8LA 3OTOJ 2VA3A 3VHQA 4DX7A 3R3TA 4YP3A 4DR6F 1BQNA 4KR0B 4QU7A 1SUQA 4O3OA 1F3VA 1Q4RA 1GTEA 4CLLA 2M8DB 1YJ7A 4ID5A 4JP8A 1NXIA 1UFKA 1NSAA 2HMIA 2VKZG 2OSRA 5AXKA 1B28A 3C6UB 3JSMA 3FCWA 4CWBA 4UY8T 3NP5A 2DHXA 2GMJA 4I56A 2E7WA 5EGYA 3MEEA 4GC7A 4ILMA 1RAFB 1Y11A 2J9DA 2HRTA 5KG0A 4DL5A 1B01A 1YJ9S 4NA1A 5E3PA 4G1PA 2X1FA 2GVZA 2VL1A 4B3TF 4LF6F 3CULA 1LFPA 4Y65A 2UU9J 3SDEA 3KNAA 2XS7A 4U8VA 2OEKA 1S0NA 3L7PA 3MF5A 2PFFB 2DIVA 1KS2A 2UUTA 2B4VA 2G0JA 2DRAA 1RWWB 4DN0A 1IQZA 5KFFA 3QIPA 4JOUA 2XZWA 2Y9HA 2DYAA 3A4TA 1IQTA 4R0JA 1TZ0A 3BPSP 5E7OB 3UDCA 3TA2A 4X65J 2P6TA 2LQ5A 1W7WA 2YH0A 5GMKa 4ECWA 3BGRA 4WE1A 4X65F 4ZN3A 4FF2A 3ZXWA 4NLOA 3T1YF 2DCUB 2VQFJ 2VOOA 4N5SA 2OPSA 5J2QA 3DC2A 5AXNA 4ELUA 1IKWB 1NEEA 4F3QA 5AE2A 2VF3A 1VBXA 3SI8A 1P1LA 1U02A 5CYMA 3MMCA 3ADAC 2UU9F 1HLWA 1PJ7A 3HFKA 3M2UA 4FPIA 1XNRF 2IYIA 3WC2A 4DCJB 3HPOA 4C8KA 1A9NB 3MAAB 3UD5A 2QE5A 2QG9B 3I32A 4C0BA 4C3LA 1U1KA 1RTHA 5D6GA 1P8GA 4M5IA 4WP9A 3CJ0A 4DBQA 5CYJA 2C2RA 2J6TA 2DGUA 4F4AA 2IA6A 3MOJB 2BQUA 1XERA 3NNCA 2DHGA 1WG1A 3LP2B 4ZP7A 5KFOA 3KLGA 4LQ9A 5ITHA 1U6ZA 2YH1A 5D0EA 3IN5A 4I1TA 4EBEA 4USKA 2ASLA 4DSJA 1KLMB 2YNFB 3J7Z5 2JH3A 4ANEA 3DLGA 1NB7A 3I0RB 1Q5YA 3K5PA 2QA1A 5A6PA 2AJ4A 2Z56B 4F4XA 4IFYB 5F0WA 3O44A 4AE5A 1WHXA 1Q79A 5D0HA 2O1PA 3H98A 1N5VA 3KJVB 3FEZA 4LF8J 3KHLA 1S76D 1M5KC 2IVYA 2YX7A 2BJ7A 3CC4S 2JEGA 3PO4A 3QIDA 3W5YA 4W90B 3J80U 2C42A 4PXDA 3RBEA 5ADZA 3EYZA 1NB2A 2E1MC 1OYEA 2BE7D 1CJUA 1ZS6A 3FCVA 2XO7A 2DY1A 4MK9A 2R2SA 2R7RA 1NBEB 2EG1A 3AH6A 4IOBA 4K7QA 1FXRA 4P7VA 1ZA2B 2DNRA 1R3NA 1IN0A 3ELHA 3KNGA 4DV4F 2ZH8A 2ASDA 1I94F 4FF3A 3W8GA 2XMAA 4O4GB 3PEJA 1FERA 2QL7B 4ZPDA 5LSLA 2N3LA 4AFFA 2OHDA 2N82B 1SL2A 2QEXS 2YX1A 3T1AA 3KK1B 2K2PA 3QRRA 4G3IA 4YB7A 1SH2A 4JI5F 3M8RA 3K57A 4NASA 5HK4A 4B3MF 2Z58B 5FIIA 3OL6A 2UXDF 1YSJA 2D3UA 1RU2A 1WI8A 4ITSA 3TVYA 2K5JA 3W2WA 4CTAA 3E8OA 5KFQA 4X4SA 4C8ZA 1CLFA 1N5YB 5ETRA 5HVHA 1JKHB 2HS0A 4YOEA 4Q7AA 3OFHA 1FJCA 2HS4A 1NJWA 2XG8A 4OHZA 1FEHA 2RDJA 2WSCC 2WW8A 5IV4A 1LOUA 3P4UB 2GZOA 4KQZA 1OPIA 1MWZA 1REGX 3KKFA 3H40A 5IWAF 5DM7Q 1PYSB 1TL3B 2V94A 2EK6A 4Q2MA 3CCVS 4CT8A 1T0TV 2VHGA 1FDDA 4TY9A 1RT3A 3AY0A 4ED8A 1QY7A 1U9PA 2XY5A 1QJHA 4P2SA 4Y28C 3UVJA 3EWGA 4ID8A 4NWBA 4OX6A 4CP5A 1ARQA 2BNZA 4JI3J 1S10A 1VJWA 1WORA 5IQQA 3HKZD 1FDNA 2RF2A 2HFUA 2V8VA 3GXQA 2HQCA 2WONB 3BKTA 3HD2A 5D4PA 2J0SD 5KFGA 3PXGa 2A2BA 4JI1F 2I1RA 3JSYA 4DV3J 1NKEA 4A8KA 4V19J 2DXFA 1BMQB 1O0PA 4Q45A 3I56S 2CFXA 4LF5J 3OJSA 2HHTA 1Q53A 4RNFA 1N5TA 2CQ3A 1XK8A 4LSZB 5I3PA 4YS2A 2ZDPA 5KOXA 1L3KA 1FWLA 1X0FA 2V4RA 3LAKA 1TP7A 3BGFA 3DOKB 2MQMA 4ZKAA 1JJHA 2DGOA 2BANA 4OX9F 1T9VA 3GG0A 2VZ9A 1YBUA 2F9DA 3DNCA 1X4EA 4LRFA 1U09A 2MYFA 5SZTA 3L3CA 3DOLB 1RKIA 2YWKA 3NGSA 4WFXA 3QAUA 4Z7YA 5KFKA 4WZQA 1FE0A 5KFYA 1U24A 3ZZOA 1HYSB 2XMJA 3DLLQ 2L9WA 1RLCL 2DNKA 2QLFB 1PYOB 3MM7B 4DPUA 7AT1B 3MEEB 1F9FA 3KUEA 4KIAA 4OJHA 2BE9B 1EKSA 1GMVA 3AXMA 1CC7A 4H4MB 2Q1LA 5DGAA 1QTNB 2VPZB 1TAUA 1RHKB 1HNXF 2E5LF 5F8HA 2DRBA 1SIWB 1B7YB 3DXSX 1NDPA 3JB9k 4DQSA 4IOAQ 3VALA 4R25A 2V8GA 1U2CA 2YKPA 4LJMA 4L74A 2V69A 4QCLA 5KFTA 4JI8F 4OIXA 3TVKA 1EIYB 1IBLF 3IFEA 2E1AA 3NS5A 4OZ1A 5KT2A 1TL1B 4LF5F 3N6NA 4R5PA 2E9RX 2RQ4A 4KT0C 2PT0A 3ZZZA 2CPDA 3KXDA 1Q16B 1URRA 5T7LA 3UO0A 4DZDA 4C2MA 5DGBA 1KWMA 4B3TJ 2EFVA 4LF6J 1Q5VA 1U45A 1HYSA 4M5LA 2LEPA 4QIFA 3KLFA 1XC9A 3B54A 2AX0A 3IS9A 3IM9A 4DL0C 4CO3A 2F9JA 2W01A 2KM8C 2A2DA 1HNZJ 1B99A 2Q6BA 3AA9A 4FXWA 1OY8A 4LRCA 5KFRA 3CCQS 2V4JB 2DIUA 3TARA 2RQCA 2HVIA 5AXMA 2AV5A 2BW2A 2HQ3A 4DCOB 2E5IA 2YKQA 1RTDB 3PJXA 2CQHA 1REVA 3H2VE 4HH1A 1FTRA 1FRIA 1V3RA 8ATCB 4NCBA 3FMWA 4HDGA 3D1OA 3HM9A 1UETA 1XR7A 2ZKUA 3QJLA 2N4CA 2QT7A 5AE3A 3PJWA 2CQGA 3P49B 4B9TA 2PA3A 1VI7A 3MCNA 5ETOA 1D1UA 3ENAA 2NUUG 3OUYB 3WBZA 2K9IA 2GQCA 3FRZA 4CLUA 3ILIA 3AOCA 4ELVA 2M9KA 1MG7A 5J2NA 1KTQA 2JVOA 1VGYA 2P9GA 1PJ6A 5LJ3Y 3NGTA 5A2QU 2XMKA 3J80Y 3G6VA 1HR0F 4TVAB 4CLSA 3QO9A 2EK1A 3JTNA 3MD1A 4HLBA 4TY8A 4F4YA 1VLOA 1L3TA 1HW8A 3D9BA 4NI2B 4IG0A 2KKHA 1X4HA 2EBGA 2WVCA 2DEIA 2H5IB 2CPIA 5A8WB 5CAAA 5DQIA 3M8SA 4ZOSA 2ERRA 2KOEA 4LIWA 1MMLA 3ZZ0A 1SJ4P 3LGHA 1KLNA 1G1XA 2B51A 3CDBA 1NKBA 4A46A 3QO9B 1FDAA 3ZZTA 4ZPWR 1NDCA 2H48B 2MJUA 4M5KA 5ETPA 2EI5A 3TWZA 1FRMA 2H51B 3Q2TC 4B3RF 1HHSA 2HWHA 1HBUA 2DHSA 2E29A 3R2CJ 3C14B 2HWIA 2AW0A 2CPFA 4NMXA 2VBYA 5A8RB 3Q8SB 3OBIA 2BUNA 3CPWR 3LP1B 1R43A 1Z1ZA 2DVIA 5GAEI 5IM0B 4FXEA 1X5SA 1ZM2A 3KHRA 5K9FA 2DHAA 1JLQB 1XMOF 4K4WA 1Q95G 4JUZA 1DTQB 4ZLNA 4HH0A 1JJ2R 4FVMA 2NPFA 3W64A 1RTDA 3PFEA 3GCXP 3P96A 1F2GA 1GAOA 1IBMJ 2CNKB 3RW6A 3AJ1A 3LAMA 2HK2A 5DDPC 1N32F 1HBNA 2CQIA 1RHUB 3CJQA 2EKYA 3KUGA 2ZBQA 2V2ZA 2KU7A 4ZPVR 2RHQB 3UDLA 5IM0A 4B9SA 3X1LB 2WSFC 2UUWA 3H5YA 4U8YA 1QTGA 2DKOB 4FXDA 1G2EA 1HPZB 3BREA 4Q2LA 3OHBA 5T7LB 1OMSA 4RKUC 4DR6J 3TRGA 5EWEA 5I4MA 3D4JA 2RUGA 1R0AB 2YWEA 1F9EB 1HBMA 1KLMA 2W2NP 3FMBA 3LUYA 2NSCA 5F8MA 2W9BB 4DPWA 5BYSA 1FT8A 2W9CA 2AGOA 1QAIA 2C2EA 1JB0C 2AZ1A 1FCAA 4DLEA 3R5BA 1S99A 2IM2A 2HVEA 3W60A 1I51B 2QSWA 1P6TA 1R6YA 3TUIC 1NK4A 4IDKB 4Y2CA 3H7HB 3OR1A 4FYYB 1FTCA 3GV7B 5FJ4A 2L08A 1KR4A 3OW2R 4LSLA 1JMTA 1YJUA 3WC0A 2DNGA 1O5JA 1TV6B 1NZ8A 4NYPA 1IBKF 5F9LA 1UKUA 3BPDA 4QW9A 1GMWD 3DN9A 4RL1A 4DFPA 5IZHA 3OUYA 1OSDA 1RT6B 3WQPA 4A8MP 1HWIA 2BSQE 2OD6A 3BBCA 4P74A 4OI1A 1QSLA 1T9WA 1ZAXA 4F3OA 1T11A 2XYGB 3P8BB 4K4XA 4B9LA 2D3O1 4QQBA 4KHPJ 2XY7A 3MM9A 1N36F 3C66A 3I9V9 4OJ1A 2HPUA 1FKAF 2JX2A 2E66A 4K5RA 1V6HA 9RUBA 1KP6A 4NZ7A 2VG7B 1Y5NB 3L4BC 3JQJA 2XY6A 4BC9A 1SH0A 3HP6A 4O44A 1MYLA 4IFVA 2GQ2A 1IVZA 3J81Y 3EXCX 3LGMA 3M7VA 3TAQA 5LMUJ 1TK0A 4YR3A 2CAXA 2FQQB 2IRXA 2XO6A 1U8SA 2VU5A 2IA0A 4F50A 1T3NA 1M5OC 1ZBTA 3CD0A 3SDEB 2G1HA 3N9UC 2HIYA 2ZHOA 1RWNB 4PPZA 3CF5Q 4KO0B 1S79A 4ZJOA 1FRHA 1GH8A 3T41A 4L3KA 2H65B 1VOMA 2CQ0A 3OXGA 3OLAA 5DG7A 2CKWA 4ECYA 3EZ5A 2DO0A 4LFBJ 1BXNA 2R7VA 2RF2B 3T1HJ 3MPWA 1UZHA 1RHJB 2G9OA 4CNZA 4IRCA 4CLTA 5U47A 4DL6A 3PR4A 3UE2A 2MTLA 3VEAA 3HJVA 1FD2A 5LMNF 2FJWA 1VBKA 4ED5A 2DNNA 1S1WA 2YKMB 2HHWA 3W63A 1LWFB 4IOCQ 2FJBB 1WELA 2FVCA 3M8ZA 2GFFA 1X4BA 1UEKA 4DR7J 1VQYA 1Y5LB 4C8MA 3NBPB 1RAEB 4I2PB 4PXEA 4C98A 4CM2A 3CJKA 3I82A 2BX6A 4JYAJ 2FHKA 3POTB 3EPGA 2J0XA 2NZ4A 4PXCA 2FHJD 4IRDA 1U0HA 3DRSB 4A8SA 4WPAA 3EPIA 3IP0A 1DJ0A 1RT5B 3OTDA 2HFSA 3OQ2A 4OLPA 5DJBA 2VG6A 5A2QY 3MUMP 2R7SA 4KJIA 5M2RA 3R1LA 4ICLA 3PW2A 3BR8A 4UOGA 2XLJA 2A6OA 3ZFVA 2IFXA 5T14A 1S6QA 1N4LA 1JLCB 2MZQA 2YNHB 1CEZA 1BY9A 4USIA 4U95A 1SH3A 3A3OB 4M5GA 2RH3A 2HNYB 1WHYA 5EWFA 1I6JA 2HZCA 1DHMA 2QIFA 2ZM6J 5A8KB 1KTVA 3H90A 4ZVFA 3IAM9 2DBBA 2JSXA 5IQ6A 3PYGA 4GRSA 3JSBA 2Y0BB 3CVKA 4P9SA 3R97A 4CIOA 4RJVA 1R27B 3NNEA 2N3OA 1N34J 2DGXA 2XSFA 1S5ZA 3MD3A 2ZEJA 3SQGB 4USMA 3TYTA 3V81A 4D3GA 1H74A 3EGWB 3PACA 3RR7A 2JXHA 2C22A 1FHTA 3N28A 1T7PA 4XPCA 1TFWA 1EB0A 4L6V3 1WOPA 1ZAVA 2HNZA 2YNFA 4X4PA 1S0OA 4HR2A 3MEGA 1XWLA 3DDKA 3QGGA 5IXUA 3W9JA 2HLUA 3BSOA 3BKUA 3CJ4A 3ONQA 3OT9A 4HDHA 2X7IA 4K2JA 3T6BA 4WCEQ 2LECA 1TQLA 3DGPA 3ENVA 4P6QA 2VFSA 4DFMA 1YIJS 2ROGA 2ADLA 5E3QA 3U1MA 2KHCA 4TNOA 2XLIA 2POKA 3VVTA 3R2DJ 4Z7CA 4EWTA 1S1VB 2JC1A 3W61A 1JJCB 4Q5VA 4DR1J 4TKTA 1YZ6A 4LF9J 3L09A 3MGJA 3QSIA 4L75A 4DR2J 2BQRA 2DD8S 4RNOA 2QMXA 4C8LA 3W2WB 3K2YA 4NLYA 2GV1A 4NPOA 4JI8J 2W1BA 1TVRA 2W2PP 1Q1KA 2OPSB 4A8FA 1XJWB 2CPYA 2VBWA 3CJRA 5HATA 2MQLA 3TZZA 3W65A 4DR7F 3RUBL 1IJEB 2KT3A 2R7OA 2CQCA 2EKNA 2PMWA 4WP3A 5J2MB 4QWAA 3OL7A 1UL3A 1TL7B 4I64A 2XGQA 1RT4A 4QR2A 1NK8A 4LBHA 1RTJA 1Y10A 2HNYA 2RS8A 2P9EA 4DWIA 5KG2A 1CJUB 5B0BA 2EFOA 4DR1F 1FJGF 2EEYA 4J9KA 3VWSA 4C8YA 5J1PA 1D0EA 2HS3A 2FJVA 2ZBIA 3T5KA 1QSYA 1N32J 2PN6A 4NLDA 4RW8B 4C0OC 1JLBB 1RLDA 2J76E 1P27B 3CIMA 3OL9A 4ZITA 2HBQB 1FEEA 7FD1A 4PUOA 1HD1A 4K4UA 3E51A 2HFOA 1LW0A 4IFYA 1FNMA 1F1BB 1U0HB 3DRSA 3MDFA 4RW7B 2ZH9A 4UY85 5HP1B 3W66A 2AWZA 4URGA 2OPPB 1TKDA 1ZH5A 3VTIA 1ZTWA 3MR3A 3CJKB 1VIOA 1S1TB 3G82A 5C24A 4ZP6A 1VBZA 3FSXA 2I6WA 4RW9A 2L41A 3KLGB 1SL1A 1X60A 2MGZA 2GMLA 2BV3A 2FGOA 2C3OA 3EVMA 3VQTA 3D2WA 1SV5B 3HT3A 4HHJA 1OG7A 4KHRA 3HJFA 2IMOA 3Q8UA 1AUSL 4YDDB 2IVFB 3UD3P 2HZVA 3GYXB 2XCAA 2PGCA 2QX0A 4K5SA 1IKYB 3Q23A 2JLGA 2CADA 4H4MA 1IR2A 1KQSR 1C4CA 2FJAB 1SC4B 4CLYA 1T95A 3FSIA 3MMCB 2CQ1A 2IJRA 3BH6B 2RBFA 2ZDOA 2VC0A 3M6VA 4P2MA 3MR2A 4DV6J 2ASYA 4DPXA 4DL7A 3T1YJ 2ZNYA 4DSLA 4NCAA 5GVQA 4PQUB 3RG6A 1Y5IB 3M4XA 3PX6A 1X4AA 2YWWA 4D8JA 3CD7A 1J5OA 2R8JA 1XR5A 2VODA 1U2FA 2W2MP 2ZZTA 3NS6A 3QPIA 4FF1A 2DITA 4OYPA 1FXLA 3HHLB 3JTOA 1FKOB 4HI1A 3KLEA 2UVWA 2D7SA 3KFWX 1S1XA 4J9QA 5CXTA 1SJ1A 1F6TA 4ZCIA 4QR1A 4JB8B 1J5OB 1B64A 2ACMA 2QTWA 4J90A 2YX4A 2BRKA 2XI2A 2LKZA 3JXOA 4MJKA 4DS4A 1TAQA 1XNQF 1RP5A 1VISA 4ZPBA 2PMZD 2LA4A 4JV0A 3HI9A 3UNGC 5KFUA 2ADBA 4PWDA 4YUDA 1PAUB 2JFDA 4DF8A 2UVVA 3FDSA 3KK2A 2VFVA 4DSFA 1I94J 4LFBF 2WONA 3GG1A 4M5HA 2YPZA 1UJ4A 2QLJB 3MAHA 4A8OA 5HROB 1AB8A 2JC0A 2IAJA 1AW0A 4M5NA 1RT2B 3CJ2A 2E5HA 5ETMA 4EU0A 2UXCJ 2BE2B 2CVIA 1HR0J 1JLFA 5IT9Y 3CCJS 1NK5A 1HW9A 4DU7A 1N6QA 4NA3A 2C2ZB 2HHHJ 1P9YA 2HZAA 4LF8F 4A8WA 2WW4A 4K4SA 2HNDA 3UNYA 2C3MA 1BHNA 3AT1B 3I5CA 2OMLA 1YTYA 2ZZNA 1FI4A 2OKQA 3OV7A 1I5OB 1K1SA 4Y2AA 2C2DA 4HT5A 3K5OA 5K8OA 2K3KA 1NHVA 1EQ0A 3FT7A 2FPHX 4B3RJ 4ED3A 3F56A 1UJ5A 2JDJA 3MPDA 3TVZA 4ELTA 2V63A 5GMDA 1NKCA 1KQKA 4C3MA 1RAIB 1HQEA 3ISNC 1H73A 1LXJA 2MLYA 3V6KA 1XMQF 3O3LA 2RUSA 3TZYA 5I3UB 4HV0A 2FC8A 1E6VB 2AQ4A 4ECZA 3GJTB 1UWAA 4NZ6A 4OZ5A 3GMGA 1WKKA 5CZVA 3TA1A 4U7CA 1APSA 3V6DB 2W7PA 1RTZA 1HBOA 3DU6A 2AYEA 2E5JA 2IM0A 3TAMA 2W8KA 2YNHA 3DRXA 2QMUB 2UXBF 2CDRB 1LWCB 2MY7A 1F2HA 2V68A 3NCRA 3CB4A 3CTRA 1NZAA 2ZH5A 1Y7PA 3EVWA 1TVRB 1HNIB 3UR3C 4OX9J 2RRBA 1S0VA 2R9LA 2R2UA 1ELOA 1F0XA 1VQ8S 2K3IA 3DLGB 3SFUA 4Y00A 1N5QA 4OV1A 3HSZA 3BO4A 5FLXU 4TU9A 1MWYA 2MZSA 2PA8D 3PFOA 4NLXA 4EGLA 2VOPA 3IG1A 2NXUA 1PG5B 4RZRA 4FKYA 1X5OA 4RW4B 2L9DA 3RAXA 2RSQA 3C8YA 3PJ9A 3AOAA 4DUZJ 3JS9A 5GMEA 1RJJA 2C3YA 1N6QB 3D0IE 1JXVA 5DQHA 4OLOA 2FJDB 3M32B 4DV4J 1IKXA 5K5MA 4ZVSB 1RISA 1UEVA 2XHCA 1RT2A 2E1RA 2C3PA 2RNEA 2DNMA 3UW1A 4UQGA 2ROPA 2FZKB 2HNZB 3J7YU 4NL5A 2GIRA 1T05A 4RPFA 1RADB 3OXFA 2CWXA 4USWA 4FVCA 4WK1A 2XYPB 2Y1RI 4UT4A 1WC0A 3EZUA 3BJYA 3PX0A 2AGPA 3SQGA 2LXFA 2W2QP 3FBFA 4C3KA 4DR4F 3GILA 2CAJA 4FN5A 2O3DA 2C2KB 3D68A 4NLSA 4M5DA 4CLFA 5IV3A 2R8IA 1SKSA 1CJTA 2XTJP 3FKBA 1JXLA 2G2ZA 3VAKA 4NRTA 4DV0F 2YTCA 2ZHBA 2FDNA 3SIPB 3CJTA 1IKVB 2GGPA 1FKOA 4ALZA 3LOUA 4ILRA 4RUAA 3KLEB 1X9SA 3AODA 2AT1B 1Q8BA 1WOSA 2VV5A 2U1AA 3MMBA 1VQ7S 2KRRA 2LCWA 2PIIA 2X3GA 2ZC3A 3R5GA 4EI2A 3H5XA 1S9FA 1Z2ZA 1G3OA 5GAGI 1HARA 2BBEA 2KJVA 4F4ZA 4PRFA 3M2RB 1HL6A 1J5EF 4ECSA 2AHOB 3ZTRA 4O4RA 2GVZB 2MQPA 3VAHA 3NO7A 4ZPTR 4B9MA 3I87A 4JBCA 3EICA 1RT1B 1JNRB 2EG2A 4RBUA 3J81j 4J9PA 3MPYA 5C2GA 1J27A 2HQFA 4OHXA 2QV6A 2XEXA 3N6MA 3SCLE 5H9FJ 4R5PB 3ITHB 4KGXB 1RAOA 4M95A 1S6UA 3FZBA 3VGUA 3UR0A 4CLPA 4ZVPB 1FVSA 3V6HA 5HJXA 4Y2KA 2H4WB 2VQFF 4IDKA 3NWRA 3QNWB 3EGZA 4YEAA 1VQ5S 1TKXA 1TKXB 2HW3A 3ENQA 3V6JA 3PHEA 3NMAA 1VFJA 3TX0A 1HFEL 3S6EA 4ATNA 3G82B 2ALYB 5C24B 3RBZA 1ZZFA 1HHQA 4NLWA 1SIWA 4ZMMA 2A18A 1SJFA 3BN4A 2D9PA 3TJ8A 4DR4J 4O23A 2Y3YA 1GT8A 2JL9A 1KHWA 5ETTA 2NLWA 4F25A 2RDIA 2CJXB 3G86A 1R8PA 3QGPA 4NLQA 3TOQA 3LA0A 3QT7A 5CD4H 5BR8J 4GMKA 3I31A 4OQJA 5CCLA 4J9LA 3W3SA 1QM9A 2RU3A 5B0AA 2RVJA 2DHHA 2QYCA 2LQ9A 1I3OB 2JEJA 3N0VA 2VQEJ 3CSKA 2VFRA 2VQEF 4JV5J 3KDNA 1MW7A 4QIVA 1HMVA 2FVQA 3DOMA 1RHMB 2FC9A 1XMQJ 5GADI 4IFVB 5C25B 2J6SA 1M1KT 3F73A 1T02A 1SL0A 2BANB 4L3NA 3IMQJ 3K89A 2VBZA 3R5DA 2CG8A 1C1BA 5DZ6A 3PVXA 4KGZB 2OGUA 5DG8A 5LSOA 1FWKA 2XI3A 2EFQA 2ZD1B 3NY0A 2MB0B 1NO8A 4CO1A 4IG3B 2LP4A 4H4KC 4USVA 1CQNA 4B3OA 3DU5A 1X9WA 1RWPB 3B6BA 1VRTA 1WEYA 1CJKA 1MROA 1U7LA 1H7XA 2WB4A 3OFFA 4OZ2A 4ZVHA 5HVGA 1N48A 1A7GE 1RT6A 2FD2A 3GLJA 5EX0A 2DRDA 4AXJA 4ERDA 4EK2A 2KT5A 1NCLA 4C97A 2AEJA 3JTPA 4LF1A 1MNEA 4F0MA 3Q0AA 4A8YA 3KJNB 3PCOB 3MM6B 3MM8A 2R8KA 3BGLA 1AA1B 2WVFA 2XMMA 2NSBA 3C16A 4DPOA 1Q7LB 3FNNA 4EMDA 1YRTA 4LREA 3OVAA 3M9NB 5CYQA 3LH2S 2OO4A 1G7CB 1HIYA 1YVFA 2H54B 3CE8A 4ZCMA 3ZO7A 2DEJA 3WZ0A 3HD1A 4RW4A 2O67A 5B0DA 1XTZA 3QJJA 4HKQA 4LBPA 1OIAA 1QAYA 1OHNA 4LF4F 4R8UA 3OL8A 4LFCJ 2KB2A 3CCLS 2J6UA 4JV5F 2LU2A 5H9FK 5BJRA 4LFAJ 5KFLA 1N5YA 1QVFR 1EKRA 1VQLS 3LJPA 4ZVRB 1B70B 4LRVA 3V81B 1JQGA 2B0GA 1FKPA 1FRXA 1TKZA 3ETOA 2FIUA 2MPUA 2RHSB 4FNHA 4ZA1A 3H2LA 4X4NA 4X4VA 3G6XA 4UW2A 3UFCX 3UWTA 3QZ8A 3SCIE 3BGUA 8RUCA 4DR2F 3CMES 1X5PA 1N52B 2ZD1A 2B8QA 2I5JB 3NXZA 1FX2A 4J5OA 2FLLA 5A8KA 2HHSA 2X1BA 5D4NA 4CDIA 3Q8QB 1JNZB 1HBOB 1MU2A 2RQMA 1SCJB 2MKHA 2D3OR 4H4KA 1OO0B 4WJBA 5E5NA 2FHOB 4QW8A 4MKYA 3GIIA 4ZS6A 2R42A 4RO0A 3CCES 1R6VA 1GXTA 2QL5B 1NNDA 2WOMB 3HHEA 2KZMA 1C1CB 1ZM9A 1RT5A 1WF0A 4DOZA 2LMIA 3PRVA 2ATCB 4P73A 3NL0A 4GKJF 5L9NA 1TTHB 5ETKA 1W2BR 4B9VA 3POTA 3EXYA 1S49A 1SVDA 3ZZUA 4A8QA 4I7FA 1GMWA 1RWUA 1VHFA 2IM3A 2IJFA 1Q82T 1WEXA 2CUYA 4CH1A 2GX8A 3ETMA 5RUBA 4AUKA 4F8RA 3LP2A 3IR6B 4OZLA 2Q66A 2OH2A 4JI2F 3K7RA 3AQOA 2YWHA 3QWUA 3KLIB 2H3AA 3G8TA 4DXLA 3C16B 5L1JA 1CSJA 2P5VA 1NH8A 4RWXA 3JAMY 2KZZA 1YJRA 1AZSA 1UPMB 2AJ2A 4C8OA 3MURP 4ZVUB 4Q8FA 3QLHA 2JEIA 1G6BA 1EP4A 4LSNB 4EBCA 1J5EJ 2XLKA 3R7BB 3D0HE 4OJ3A 5E0OA 1RAAB 5EDWA 1YX2A 1VQMS 4CM0A 2BR0A 3C15B 1YJVA 2A6MA 4ANCA 2XZTB 5B08A 4RU9A 3HXMA 2ZJPQ 3KWMA 4F2RA 1KC8T 2BW7A 2ZOFA 1SXLA 2CZ4A 3DOLA 4OYZA 2J8AA 2WHOA 3AHPA 4Y3CA 2ASJA 4C0HA 2B4UA 3T6JA 2KKEA 2YXLA 5JVGQ 3ILLA 2ATLA 1VQ4S 3D0GE 1S1XB 1FFGB 3AJDA 4I2QB 1PC5A 2CNOB 4ETXA 3MR6A 2MZTA 3OTEA 2H1OE 4BHQA 1FNXH 4DQPA 4K50A 3MMAA 5D3GB 1BQMB 1WTFA 4F26A 3FCHA 1MMDA 1YRXA 3CIZA 1RABB 2R7WA 4G65A 1L3VA 2GQQA 4ECVA 4DSKA 4FF4A 1N88A 4HHHA 4M63A 1XR6A 3KDOA 3W2VB 2VC1A 4OYIA 5KFNA 2F4FA 5KFPA 2O5DA 2VONA 3IRXA 1S1UB 1CBKA 2CPXA 2MJNA 2OAUA 2V50A 1D3WA 4LSNA 1EP4B 3B4DA 2FVSA 2W8LA 5GAHI 1L5UA 2QA4G 2KL8A 4WTOB 2HGNA 4LFAF 2DH7A 4H4OA 4KGVB 3K5NA 2JJ4D 2CQ4A 2RT3A 2VFTA 3H5SA 3R9LA 4WKYA 2W4CA 3H59A 5JJBA 2V4QA 2WZ1A 2B8PA 1KDNA 4A47A 2MKIA 1TK5A 4WIQA 1BQNB 1SJRA 4J7CA 4C48A 4NCGA 2M88A 2B7BB 3IA0A 4RX6A 5DDRC 1E6YA 1VYAA 2MGZB 1D9FA 4IR1A 2LEBA 5L38A 3WHIA 3BO3A 2J8SA 4QWDA 8AT1B 2ZVSA 3B8HA 2BVZA 2K29A 5HLFB 4JV1A 2UXDJ 3ITHA 2C2MB 3M6XA 3M1VA 3CCRS 1AT1B 3MCSA 3L7OA 3MTKA 1V3SA 3Q22A 4RW7A 3UN5A 3OVSA 3LWMA 3NCQA 1LW0B 3E3XA 5KAKA 3D6HB 4LRBA 3TI0A 4EZ9A 2P8IA 2KXFA 3MM5B 1GX6A 4N8NA 2K1RB 4OZNA 3OLBA 4C11A 1H38A 4OZ3A 3P6YC 3NS7B 2XYHB 4KV8A 3A3NB 3CO9A 4C8NA 2FVPA 2KTQA 2WCXA 2BJ8A 2HK3A 3L9ZA 2NS1B 4ZIWA 2LEAA 3G96A 4K0KF 3MMBB 4TQSA 3BKFA 5BYQA 2EC2A 2J9CA 1WTBA 2DB1A 2I0XA 4TLQA 3M9OB 2GJFA 4B3SF 4IUFA 1RT4B 2PO4A 3EZOA 1YRUA 3BGOP 5KG7A 4ZLLA 3OSNA 4HTJA 2Q6CA 4OI2A 1JLQA 2XHWA 2D69A 4P2XA 4YHHJ 3W62A 1F5AA 4M5DB 3NWGA 2A10A 1EAYC 3NAIA 2KYXA 2BACA 3LP1A 4E8UA 4X62J 4L73A 3DFEA 3MUVP 3G5OA 4X62F 4KH0B 2HQGA 2DNHA 1GEHA 5G4DA 2BQ3A 3IRWP 3KOAA 3J7ZT 4KC5A 2FLNA 4C4WA 3U02A 2GC8A 4OYAA 1EA4A 3HHLD 4DQRA 1U1LA 2AX1A 1SBRA 1FDBA 2CJAA 2X51A 3T9NA 4DR3F 3HO1A 3UPFA 2HNDB 1RWXB 3SBMA 2L3MA 3M32A 1NJZA 5D8HB 5A8WA 4YY3F 1JLEA 1DQ9A 2UVUA 3DGPB 1N5SA 2J7KA 2XWYA 5DO2A 1AFIA 3V5RA 4N47A 4A4JA 1UJ6A 4I6WA 2RIJA 2DXDA 3MM6A 2A2CA 2YQ1A 5DM6Q 3BQ1A 4WXOA 2Z30B 5F8LA 3SCJE 1Q81T 1MNTA 2BM1A 3TX8A 1OJ4A 5K8MA 1DZ5A 4AL5A 3THVA 4E2FB 1RE1B 1ZPVA 2E7XA 4GVBA 4B3OB 4IG3A 2E9ZA 3KK1A 4RLEA 2AJ0A 5I3QA 2F1FA 2LLZA 2DY9A 2QRRA 2ZKTA 3TAMB 2DGQA 3Q8PB 1NMEB 4AAIA 2ILYA 3NGRA 4I4BA 4MFBA 1U26A 2N4DA 4JI7J 1RBLA 3ENWA 3HHDA 3MEKA 1BWEA 2FJXA 4USHA 2KDOA 1PBUA 2EBEA 3CWJA 3I0SA 1RBOB 4K4TA 3D28A 2Y1JA 1SKWA 2AYBA 2U2FA 1RU1A 1HNVA 3W7BA 3CMAS 4YR2A 1UW9A 2KN4A 1P94A 3NNAA 1KFDA 2IPOB 3BQ2A 4TLRA 2R7UA 4KY3A 1GTHA 3W1YC 1Q86T 1Q16A 2BXJA 1SKUB 2WK4A 2M4MA 4UUWA 3J7YI 4U96A 1CS4B 2GVDB 2XSJA 4YMEA 3A8KA 2OP5A 3JSMB 2HBYB 1T8EA 2HYIB 2GIQA 2MQNA 2B9EA 2W7AA 3IBWA 4F0KA 2RRNA 1X31C 3M8PB 4DV0J 2W7OA 3NBPA 3T1HF 3O1LA 3MI7X 1QDUB 3MECA 4JI0F 1SUQB 3ZNUA 2NXJA 3ISZA 1T03B 3H42A 1WC5A 1WI6A 2W4PA 3C6TA 1C4AA 1WG4A 5FD1A 3EMTA 2H5JB 3QZ7A 2IYGA 2BYCA 4AL6A 1JLFB 1N36J 2SXLA 2AYGA 3DLEB 3M8PA 3VAGA 3A8IA 1U49A 4DZ6A 2F7VA 1RAGB 1BDVA 5HROA 4K4VA 1F60B 4HT7A 3FJ2A 1SIZA 2OFHX 4OX8A 5A76A 1PARA 1NJXA 2QC3A 4X4UA 4DMZA 3IWXA 3CDAA 4I69A 5B09A 4J91A 2BRLA 2ZH2A 5J2PA 3TANA 1S1UA 3IRXB 5E3RA 1S77D 4RU2A 4QIGA 1KKHA 5F8GA 4EBDA 2BJ1A 4JI6F 4ED1A 1WHWA 2V34A 4Y0FA 1C2PA 4LVNP 4JI2J 2Y8WA 3BM7A 5KFSA 2BOPA 1F5BA 1WD6A 2J0WA 6FD1A 4BLGA 5D3GA 3TEHB 2BA3A 1KOHA 1WJ9A 1H72C 4F67A 1VC0A 2HHPA 2HQDA 4MJWA 3D66A 4LF7F 2IM1A 5KG6A 5KFHA 3CW2C 5G0RA 1H2UX 3RU0A 3QIPB 1RTIA 2UUBF 2VPYB 3C19A 3HHKA 4IYQA 4PWUA 4EUVA 3DYAB 2I8EA 4Y6IA 2ZJRQ 1AFJA 1S48A 4HACA 4LR8A 3DRRB 5KT7A 4K4ZA 4DHVA 2CZ9A 2X1GA 3M30B 2DNQA 2HQIA 3HVTA 4G1IA 3SSSA 5HQMA 1U6FA 3Q8VA 4KPYA 1UWBB 2V2QA 2KXNB 4PYAA 5CHCB 4Q44A 4TYBA 2DGWA 2D3ZA 1OS5A 1XEZA 3UD4P 2W24A 1X7VA 2ZFHA 1HHTP 2PI4A 3C6UA 3F44A 5D0RA 2NR0A 2DGTA 1P1TA 1IKXB 2BM0A 2GO8A 2YPYA 4WWSA 1TKTB 2VDHA 2XMVA 4MYTA 3CJ3A 2DO4A 3AOBA 5LMUF 1IJFB 2D1CA 2ROEA 2CJQA 5GADU 4N76A 2AIRB 1D8YA 1VRUB 5HMYA 4BBYA 2HGMA 1TUGB 3N5FA 4W98A 4DV1J 1WACA 2O01C 3R5JB 4JI0J 3KYLA 1QD1A 1T94A 2RE1A 2HVDA 1OSCA 4XDDA 4F4WA 3ULHA 2R4FA 1ZM3A 5FDLA 5E41A 4ETZA 4LF4J 4PUOB 3OR2A 3DGVA 3QT6A 4WFZA 2OPQA 3CT9A 2F4VF 2RAQA 3PHTA 3I0SB 3T9ZA 4CO4A 4CYUA 3GV8B 3MWBA 3BH7B 1Q0NA 1YZ7A 2FTRA 2OPRB 2XMTA 3ET6B 3N79A 4DPYA 4X4RA 4V19X 5D4LA 4HTIA 4MFBB 3GZ7A 1U4BA 5KT5A 3KLHB 4QOTA 1NH7A 2AJQA 4URSA 4NEYA 3GFHA 1HQUB 4DV5J 2E9TA
chains in the Genus database with same CATH topology
1ARQA 2BNZA 2BJ9A 1IRQA 2HZVA 2WVEA 2CAXA 2K29A 2KELA 1BDVA 2Y3YA 3GXQA 1B28A 1X93A 3VEBA 2NZCA 2CADA 3BKTA 2K1OA 3QSIA 1PARA 1Q5YA 2JXGA 1P94A 1BDTA 2PC6A 1QTGA 3FT7A 1MYKA 1MNTA 1B01A 2K5JA 2RBFA 2BJ3A 2JXHA 1NLAA 1Q5VA 2GPEA 2K9IA 3QOQA 2BSQE 1ARRA 2CAJA 2WVDA 2K6LA 4FXEA 2WVBA 2BJ1A 2JXIA 4ME7E 1EA4A 2BJ7A 2CPGA 2BNWA 3PHTA 2WVFA 4HV0A 2CA9A 4D8JA 2BJ8A 3FMTA 3BKUA 2F1FA 3H87C 3VEAA 3BKFA 2BA3A 2FGCA 2H1OE 1BAZA 2WVCA 2HZAA 1U9PA 3VW4A 1MYLA 3OD2A 2AY0A 3LGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARQ A;  2BNZ A;  2BJ9 A;  1IRQ A;  2HZV A;  2WVE A;  2CAX A;  2K29 A;  2KEL A;  1BDV A;  2Y3Y A;  3GXQ A;  1B28 A;  1X93 A;  3VEB A;  2NZC A;  2CAD A;  3BKT A;  2K1O A;  3QSI A;  1PAR A;  1Q5Y A;  2JXG A;  1P94 A;  1BDT A;  2PC6 A;  1QTG A;  3FT7 A;  1MYK A;  1MNT A;  1B01 A;  2K5J A;  2RBF A;  2BJ3 A;  2JXH A;  1NLA A;  1Q5V A;  2GPE A;  2K9I A;  3QOQ A;  2BSQ E;  1ARR A;  2CAJ A;  2WVD A;  2K6L A;  4FXE A;  2WVB A;  2BJ1 A;  2JXI A;  4ME7 E;  1EA4 A;  2BJ7 A;  2CPG A;  2BNW A;  3PHT A;  2WVF A;  4HV0 A;  2CA9 A;  4D8J A;  2BJ8 A;  3FMT A;  3BKU A;  2F1F A;  3H87 C;  3VEA A;  3BKF A;  2BA3 A;  2FGC A;  2H1O E;  1BAZ A;  2WVC A;  2HZA A;  1U9P A;  3VW4 A;  1MYL A;  3OD2 A;  2AY0 A;  3LGH A; 
#chains in the Genus database with same CATH topology
 1AUD A;  2F63 A;  3NOC A;  3BR9 A;  4CYU B;  2B9X A;  1EQM A;  2ZWO A;  4QR0 A;  4DX6 A;  4JI4 F;  2Q43 A;  1VIX A;  3OR2 B;  5F8I A;  2VH7 A;  4TU8 A;  3M6U A;  2R7T A;  2HFV A;  2HVZ A;  3A12 A;  4MIA A;  1LXN A;  2YNI A;  2XNR A;  2R8H A;  2ZC4 A;  4WFN Q;  1RWM B;  5LM7 E;  1U1N A;  3RB6 A;  3BQ0 A;  3C14 A;  2QA2 A;  1FXD A;  3T19 A;  1SKR A;  1D8Z A;  3GIR A;  1KVJ A;  1FFW B;  1Z2L A;  5H9E J;  2MKJ A;  1UTA A;  5HMX A;  1FRJ A;  5HLF A;  3H8Y A;  2FZG B;  1WNE A;  5HJY A;  1SI9 A;  1PAE X;  3FBE A;  1U1P A;  3SFG A;  4ED4 A;  2OFG X;  3BO2 A;  3TA0 A;  3A8E A;  4NXM F;  3MHY A;  2X3D A;  2YKM A;  4E0D A;  1M90 T;  1NSQ A;  1RB0 A;  2NCK L;  1CG2 A;  2IC3 B;  3VZH A;  2UZA A;  4ECX A;  2UV8 A;  3CC7 S;  1SC1 B;  3DXB A;  2DTJ A;  2HLT A;  2IAJ B;  2OI2 A;  3Q89 A;  3A1Y G;  4MK8 A;  4OI3 A;  1R8A A;  1MN9 A;  3MM8 B;  3D3C J;  4MH8 A;  1R8C A;  2GJI A;  4H4O B;  1IBM F;  5EN1 A;  2BOA A;  2OTJ S;  1X4G A;  2RKI A;  1M5S A;  1B4S A;  1YJN S;  4KE5 A;  5CYM B;  5C42 B;  1S0M A;  2NQP A;  3K0J A;  2AP6 A;  2YBV A;  4KFB A;  4KYZ A;  5K20 B;  2VG5 B;  2E1P A;  1MSW D;  3KMS A;  3W9I A;  5J2Q B;  1ZOT A;  3HVA A;  1UVM A;  3W2V A;  1RWO B;  3QT5 A;  2PEB A;  2QYG A;  1N54 B;  3ILJ A;  2K7J A;  2N7Y A;  5KFE A;  2F65 A;  3VQS A;  3J7A N;  1V5I B;  2JHE A;  1AYE A;  3US5 A;  2Z0G A;  5HAN A;  1KRP A;  1L3S A;  3KG4 A;  3G8S A;  4KBI A;  3QAT A;  1WG5 A;  3EJM A;  4GC6 A;  1YG0 A;  4OYW A;  1K73 T;  4RW6 A;  4KKO B;  3W5Z A;  3QRQ A;  4DL2 A;  3SQO P;  1EX8 A;  1JLC A;  1GFW B;  1HWL A;  4CZC A;  2UP1 A;  5HVF A;  3EUN A;  4DSE A;  1U47 A;  5M2U A;  5C5J A;  2UUA J;  5EX3 A;  3IS9 B;  4HL9 A;  1GXU A;  1OQ6 A;  1S9G A;  5ETV A;  2B3T B;  2MQ8 A;  2F3J A;  3VCD A;  4KTQ A;  4PQU A;  1HWJ A;  1WKL A;  3ZTO A;  1ZZN A;  5H9E K;  3OXL A;  2XMW A;  3HZG A;  4ZLJ A;  2BDP A;  2K8G A;  3CNQ P;  2XBP A;  2V9W A;  4QIW D;  1K0V A;  1WC6 A;  5B7W A;  4WK3 A;  2JNJ A;  3UCG A;  4NXN F;  2YVS A;  3EGN A;  3WDO A;  4EFA C;  3D6M B;  1PIE A;  2R3V A;  1RA7 A;  2ZBR A;  2W4D A;  2MLX A;  2HBZ B;  5JMN A;  3IR5 B;  5F3T A;  4OHY A;  1LWE B;  1YIT S;  3DCA A;  2OEL A;  4PPD A;  1LWF A;  4XAK A;  3SYZ A;  1SV5 A;  2JEF A;  3I4H X;  5IOL A;  1B0T A;  2LQ8 A;  1LNQ A;  1T9T A;  1KSP A;  2AY0 A;  2HUR A;  4IH5 A;  3MEC B;  1LKZ A;  2QMW A;  4LF2 A;  3V2U C;  5D77 A;  4ES1 A;  5AE1 A;  3M05 A;  4X4Q A;  2V9K A;  3GP9 A;  4FBT A;  2C2N A;  4RR5 A;  4FDF A;  3PNI A;  3K5M A;  4LF9 F;  3IGV A;  5HP1 A;  1CS4 A;  2XSJ B;  1F9H A;  1U6B A;  3S01 A;  2FY1 A;  4F02 A;  2MXY A;  4DV5 F;  2EPI A;  1DRZ A;  2M8H A;  2RML A;  5HAO A;  1NU4 A;  4KO0 A;  5KFA A;  2OJ3 A;  3FGV A;  2EW9 A;  1PIL A;  2IDE A;  1RUS A;  3M2R A;  3GR0 A;  2HGL A;  2WOM A;  4PZV A;  2QL9 B;  5L39 A;  5LMN J;  4DV7 J;  4PAA A;  3QRP A;  3HF5 A;  3TQE A;  4USU A;  5CAB A;  3V4I B;  3BSN A;  4LT6 A;  3NCP A;  4WII A;  3P5B P;  5B0G A;  3THP A;  4A48 A;  2F4V J;  2E5G A;  4RW6 B;  4RNN A;  1BUX A;  2V5H G;  5ETQ A;  4EO6 A;  4N56 A;  4FKX A;  4IH7 A;  4B9N A;  1VK8 A;  4I2Q A;  2HRY A;  1YBT A;  4Y2M A;  5J1E B;  4IR9 A;  2ZOM A;  2APO A;  4MKV A;  4U67 Q;  3OTO F;  2CXE A;  4DV2 J;  4PR6 A;  2IDL A;  1SB6 A;  4X84 A;  2WVE A;  1HQ2 A;  3PYD A;  4CO5 A;  4ED7 A;  1JWW A;  2CNN B;  2GHV C;  1KQG B;  3HT0 A;  4MT1 A;  4OI6 A;  4ES2 A;  2ZE2 B;  4PQA A;  3UCZ P;  4YHH F;  2WSE C;  1FKP B;  4DSI A;  2HIQ A;  3QAE A;  3SMZ A;  1VQN S;  2NXC A;  2XMU A;  1ARO P;  3MOZ A;  4JI4 J;  2CWK A;  4K4Y A;  2CIM A;  4AL7 A;  2HRU A;  5K8N A;  4ME7 E;  1TL5 A;  1TV6 A;  4MTP A;  2MQO A;  1YK9 A;  3F41 A;  3OSP A;  5K14 B;  1N0V C;  3I6P A;  4QBU A;  1UA0 A;  4WXW A;  1Y0H A;  3FRY A;  4DI6 A;  1UW4 A;  5KTQ A;  1XNR J;  1OWX A;  3GYN A;  5KFC A;  2G13 A;  5CD4 A;  1M0S A;  1OYD A;  2VAS A;  1VLY A;  1S4E A;  2MMY A;  1YJT A;  1ZPW X;  2ACY A;  2VFU A;  3FUY A;  3TUJ C;  4ZHR B;  5IFM A;  3GJR B;  5K14 A;  2CVE A;  3CC2 S;  2AMC B;  9ATC B;  2OEM A;  4DQQ A;  1PJ5 A;  3QGI A;  3BN7 A;  3MPV A;  4X4O A;  4B08 A;  4ED6 A;  1Y3J A;  3PW0 A;  3BSC A;  2KVQ E;  4CLK A;  3P5T L;  2FLP A;  3PW5 A;  1BD6 A;  2NRE A;  1MLA A;  1YI2 S;  2NXN A;  3PYF A;  1KVK A;  2GPE A;  4S0M A;  4O3P A;  3TW0 A;  3TZX A;  1CJK B;  2B9W A;  2CJY B;  2Z2Y B;  3BEG B;  4P10 A;  1YBA A;  4PG7 A;  4UTG A;  4IQX A;  2RJZ A;  1TK8 A;  1Q7Y T;  2A3J A;  4FYD A;  5LSR A;  2DR7 A;  1S7H A;  3LWL A;  1CUL B;  1H3D A;  3FMT A;  2P2C B;  1Q78 A;  1CPZ A;  1RAH B;  4TXS A;  5F41 A;  3AQP A;  4B3S J;  3V6D A;  5HO4 A;  1LK5 A;  3PKY A;  1MU2 B;  3KJQ B;  1JK9 B;  2HEK A;  2RDD A;  5GAH U;  2GO9 A;  1XMB A;  2MSS A;  2VD3 A;  4UOF A;  2UVR A;  1NPR A;  4RWW A;  3RYL A;  3PX4 A;  3DOM B;  2V8D A;  1VQS A;  1MMN A;  2OPQ B;  3L7U A;  4JI7 F;  3H4B A;  2GHW A;  4ICL B;  2R2T A;  1A6L A;  1ZM4 A;  2DNZ A;  3BS9 A;  4UF4 A;  4WU3 A;  2RS2 A;  5IWA J;  2ZOG A;  2H9Z A;  3UDE A;  1MYK A;  4J9U E;  3T5L A;  1NK0 A;  3DHW C;  2BJ3 A;  1IM6 A;  2A0F B;  2MY8 A;  3TZW A;  3CCS S;  1VC5 A;  2B9Y A;  4LR7 A;  3W5X A;  5D15 A;  2F40 A;  3D5M A;  2BNW A;  2DGS A;  2CPG A;  4UOC A;  1VRU A;  5KT3 A;  4X4T A;  1KNZ A;  1BE4 A;  3R6G B;  4ZVG A;  2KJW A;  5KFJ A;  2CQP A;  2IBO A;  1IR1 A;  2OD4 A;  4RUH A;  5ETS A;  2LYV A;  3E2E A;  1KEK A;  2ZM6 F;  3T5J A;  2R7X A;  2R2R A;  4IG0 B;  3IXQ A;  3W8P A;  2BAB A;  1DAX A;  1LWE A;  1U2R A;  3CD6 S;  1UFW A;  2LDI A;  1M5V C;  6FDR A;  4JI6 J;  2IVM A;  2CPJ A;  3LPY A;  4I0W A;  5HSP A;  2XGP A;  3BF4 A;  2KH9 A;  2NZC A;  3K8V A;  1T9Y A;  2YWG A;  3KK2 B;  3CCW A;  2Q79 A;  3TNV A;  1VQK S;  2D9O A;  4IQM A;  5D0G A;  3HZE A;  3S7R A;  3S8S A;  2UUA F;  3M8Q B;  1B0P A;  1GQE A;  3HLU A;  1UWB A;  4PWD B;  1QE1 A;  3BV8 A;  5IT9 U;  1RHR B;  4XPE A;  4DR3 J;  2PEH A;  4WYL A;  5T41 A;  5CH7 B;  3H4D A;  5BXI A;  1N56 A;  3GFY A;  1MN7 A;  1OQ3 A;  2XUL A;  3RJM B;  1FJ7 A;  1REV B;  5G0R B;  1S6P B;  2VPX B;  4DV1 F;  2F8H A;  2W9A A;  1VC6 A;  4OJG A;  1LFW A;  4PEO A;  1CJV B;  3MED A;  4B17 A;  4OI0 A;  3SCK E;  1S97 A;  3N5B A;  1U48 A;  2YNG A;  1QUV A;  2HSE B;  2VJU A;  1HA1 A;  5H1S V;  1KBR A;  1IRQ A;  4WU2 A;  1GK8 A;  4X64 F;  3CCU S;  3HHL C;  1HMV B;  4FBU A;  4HEA 9;  5DDO C;  3IC1 A;  2V2V A;  1UPP A;  1NDL A;  3GTY X;  4CH7 A;  3AFG A;  3G4S S;  3T3F A;  3WIU A;  2KVI A;  2PDA A;  3EDQ B;  1WF1 A;  2VIC A;  2FYX A;  1IWA A;  1QSS A;  3FSY A;  5AXL A;  3OVB A;  1T9X A;  3QLH B;  1R8B A;  2A1B A;  1Y3K A;  4OZ0 A;  2K7K A;  3R6L B;  4TN2 A;  2XZD B;  4U6P A;  4D3H A;  1ICE B;  5M2P A;  2LQJ A;  2MDA A;  3H0P A;  3OR1 B;  2DNO A;  4QZV B;  4F0H A;  2IC3 A;  4OHW A;  3RAM A;  3IBC B;  3O8W A;  2IRY A;  1RT3 B;  2GW8 A;  3NAH A;  4F4K A;  1U0S A;  4FNI A;  4O3N A;  3U1N A;  4DG1 B;  3LTO A;  2JVR A;  1WC3 A;  4ZLP A;  1OPZ A;  1VCT A;  2JZ5 A;  3GJS B;  2Q3P A;  4NYZ A;  4QPX A;  2LXU A;  4DEZ A;  4ECT A;  2WTF A;  1HBM B;  1T9U A;  2GAG C;  1YGY A;  2VPW B;  3A3P B;  4K8R A;  5HQ8 A;  1SJ3 P;  4GO7 X;  4PYD A;  2M7S A;  2DNL A;  2G1D A;  3KHH A;  2DT9 A;  5A6W A;  3TR5 A;  3ZC4 A;  4DX5 A;  3LGN A;  1WC1 A;  2YNI B;  5F8J A;  5GAG U;  1RSC A;  3C2P A;  1HNI A;  3LF0 A;  2QSF A;  4DUT A;  1HNV B;  3KMQ A;  3ZZR A;  4UQT A;  4RW8 A;  1HWU A;  3OFE A;  5CA5 A;  4RUC A;  1T3O A;  2ZH7 A;  3UCU P;  6AT1 B;  1W26 A;  4OZJ A;  5I42 A;  1U1O A;  4DDF A;  1K9M T;  3DI6 A;  1HQU A;  2XB2 D;  1X4F A;  1JLA B;  2OLW A;  1GX5 A;  3N01 A;  4G1Q A;  3GWC A;  3SV4 A;  4WFB Q;  4TU7 A;  2HVH A;  1PO6 A;  1C0U A;  3G8Q A;  1FVQ A;  2FVR A;  1KN6 A;  2E44 A;  1XN9 A;  2PSZ A;  1E6V A;  2RQK A;  1CUL A;  3IGN A;  3IR7 B;  3QT8 A;  4GVL A;  3M8W A;  3VF0 B;  1RYS A;  4U7U D;  2KEL A;  2C2O B;  2CZV C;  1UVI A;  2J9D E;  1SQE A;  4UOH A;  1DAR A;  4CLW A;  3HVR A;  1MWQ A;  4ZJQ A;  5A8R A;  3BDP A;  1KQF B;  4LR9 A;  1K44 A;  2FHM A;  3QQC D;  4OI4 A;  2XWX A;  3QFH A;  4EEY A;  2V6A A;  2HWT A;  2ZH4 A;  1HKA A;  2J9E A;  4KPC A;  1NJY A;  3PZP A;  4KHP F;  2FHJ A;  3CXC R;  3IO1 A;  2KO1 A;  1HNW J;  2ZH1 A;  3M2V B;  3E01 B;  1B3T A;  1DTT A;  2AEF A;  3LPE A;  4C9D A;  2KYZ A;  2V8H A;  4UST A;  3I55 S;  3L95 X;  1NSP A;  3GIJ A;  4DS5 A;  1QAJ A;  1X0P A;  2B5J A;  2Z8Q A;  4E98 A;  3VAI A;  3IM8 A;  3QSY B;  1O8B A;  1KHV A;  2I38 A;  1IR0 A;  4Y2I A;  4I67 A;  5F8N A;  3I4P A;  1IBK J;  2BE2 A;  2H3E B;  2DNP A;  3Q2S C;  3IG1 B;  4P7T A;  3PM9 A;  3M2V A;  3SV3 A;  4M1K A;  3DM2 A;  4QYZ J;  2OMO A;  4F36 A;  4FYW B;  4XTT A;  5L9X A;  1RDR A;  4L72 B;  1UVK A;  2EVZ A;  3FK4 A;  1VHI A;  3HSG A;  3MR5 A;  2CPE A;  2CQD A;  5KG1 A;  3VR1 A;  1VQO S;  1FA0 A;  4NX9 A;  2KFY A;  2WVD A;  3M30 A;  2UUB J;  2V2K A;  3CDU A;  2YWF A;  1RCX B;  3BZQ A;  5AT1 B;  4C6A A;  3OTC A;  3OPK A;  3IR7 A;  5JUM A;  4DU8 A;  4B3M J;  2OTL S;  4ZDN A;  4N7T A;  1RTI B;  4GKJ J;  4JI5 J;  2UUC F;  4FZV A;  3M9M B;  3KTQ A;  2IIH A;  5AJ3 J;  4NXN J;  1TR0 A;  4TYA A;  3RGI A;  3VZI A;  2P9C A;  5HBM B;  4CCH A;  2V4J A;  1RGV A;  1VQ9 S;  2VKR A;  5F0U A;  3TEG A;  4FYV B;  4W4M A;  2J5A A;  4EZ6 A;  4LMZ A;  2CJ9 A;  2NYI A;  4PG4 A;  4TQR A;  3UN3 A;  4YQW A;  1HQE B;  3LQV A;  2LQB A;  1J2V A;  4PWW A;  1FF2 A;  1DY3 A;  2AKW B;  3KJV A;  4DL4 A;  2BKP A;  1JX4 A;  1K47 A;  5FDL B;  5J2P B;  1SC3 B;  1CVJ A;  3MFI A;  5DRK A;  1HNW F;  1IWG A;  1S4F A;  4ZPC A;  1HD0 A;  3G71 S;  3P45 B;  3LP0 B;  2YY3 A;  1X9M A;  4B02 A;  2HMI B;  3C46 A;  4GKK J;  5HQL A;  1BWV A;  1TUW A;  4ID5 B;  1WHV A;  1CC8 A;  2BKO A;  1NK9 A;  4KHM A;  2KG0 A;  2DCL A;  2GIF A;  3AA8 A;  1QVG R;  4IH6 A;  1FRK A;  1NHK L;  4NCG B;  3I96 A;  2QFI A;  1T03 A;  4YFU A;  4ER8 A;  4RW9 B;  4LFC F;  1NLK L;  1RTH B;  2FY8 A;  1VJQ A;  2QZ8 A;  4WBF A;  4P71 A;  4CLZ A;  3QYY A;  4OYX A;  1F3F A;  2DPJ A;  4FXV A;  3VEB A;  1RBA A;  2OPP A;  1UZD A;  3GIM A;  3M2U B;  3CJ8 A;  3H5U A;  5MLC V;  3QMQ A;  1R89 A;  2EXU A;  3TJ9 A;  2B4P A;  4CQ1 A;  3X3U A;  5L1I A;  1YWX A;  3KK3 A;  1X4C A;  1ZTT A;  4Q0B B;  5C2C A;  4BWM A;  2KI2 A;  3PIO Q;  3I5B A;  2ZWP A;  1DQA A;  1Z4U A;  1YHQ S;  1JLB A;  3SXL A;  2CDQ A;  2R7Q A;  2RU9 A;  4CO0 A;  2F5G A;  4CNY A;  3NLC A;  5AJ3 F;  4KB7 A;  4J9S A;  2H1Y A;  1PCA A;  1FO1 A;  1D09 B;  1PKU A;  1CJV A;  2AJ1 A;  1NM2 A;  2KT2 A;  1IUJ A;  3MED B;  4PG6 A;  5L8R C;  2JOQ A;  4ZVT B;  3GIK A;  1NRK A;  3KJF B;  3V4M A;  2VG7 A;  4W92 B;  1UVN A;  2HHU A;  3ZTS A;  2CPZ A;  1K1Q A;  2HFN A;  4ZVQ B;  2GMH A;  2N7C A;  4Z2X A;  3OJU A;  3HVW A;  1HI8 A;  2YKO A;  5LOQ A;  3VVU A;  2DXE A;  2I2Y A;  2G2O A;  3RR8 A;  3G87 A;  1R31 A;  3Q24 A;  4RNM A;  4NLV A;  4I6Y A;  2JXG A;  3C15 A;  4M5M A;  4Y34 A;  1LV5 A;  1RKJ A;  1X8D A;  4MIW A;  3I9Z A;  5C42 A;  1S6O A;  3DRP B;  2M0G B;  1FWP A;  4BS2 A;  3PV8 A;  4OL8 A;  1KFS A;  2OUG A;  3FC9 A;  1IKY A;  2WB1 D;  2BMB A;  1W25 A;  3MPU B;  3DM2 B;  4FPR A;  5IT0 A;  2MLZ A;  1TMJ A;  4DV7 F;  4FP9 A;  1S12 A;  5KG4 A;  3AD7 C;  2MKK A;  4M94 A;  1NPK A;  5LT5 A;  4H54 A;  5MAO A;  1WDD A;  3ZNJ 1;  2E7V A;  2KRB A;  1VDH A;  3AJ2 A;  4IKA A;  3RW7 A;  4O3R A;  2B7C B;  1BAZ A;  3RZA A;  1YLX A;  3C6T B;  2AJF E;  5KFM A;  3WX4 A;  2CG4 A;  3K5L A;  2NUH A;  3D6T B;  3GR1 A;  3D3B J;  3HHN B;  3JSR A;  1C0T B;  1H7W A;  2W2O P;  3AD8 C;  2RRA A;  1NK7 A;  3K17 A;  1DTT B;  3Q8Y A;  4UUX A;  5KT6 A;  3RRK A;  5KFX A;  2WRM A;  5DDQ C;  1S9E B;  1VK3 A;  1NJI T;  2L9N A;  4OYO A;  2MKC A;  4FS1 A;  1Y4Z B;  2AZ3 A;  1JKH A;  1QAX A;  3JAM U;  3GU0 A;  3VAM A;  3AAW B;  1YDL A;  3U1L A;  5HN0 A;  1HI1 A;  1FD8 A;  1XIQ A;  3R8Y A;  2IMW P;  3F0N A;  3PKM A;  2QLW A;  4LRA A;  3JQM A;  2K06 A;  1AXQ A;  3VAJ A;  1VRQ C;  4KRW A;  1HBN B;  2FLO A;  1D9D A;  2CRL A;  2Y1L B;  2HG4 A;  2CNL B;  3DLJ A;  2JFK A;  1RCO B;  3GSI A;  5FLX Y;  4DUY J;  3PW4 A;  1VR6 A;  2V0N A;  3DHX A;  5HBM A;  3HFV A;  4BC7 A;  4ECU A;  5HMZ A;  2OIH A;  3VW4 A;  4NOH A;  4DLG A;  2HHX A;  1UCN A;  1TL7 A;  5I42 B;  3BSA A;  2I5J A;  1PBA A;  1VQ6 S;  3UN2 A;  1LWX A;  4MKB A;  2KXH A;  3AD9 C;  2CJB A;  4A8X A;  1WWH A;  3PYE A;  2HAF A;  2HAI A;  4C11 B;  2XC9 A;  2Y1I A;  4JYA F;  2DNY A;  3MM5 A;  4WKR A;  1FK9 A;  2FJE B;  2JWN A;  2VIH A;  3MXH P;  1K0T A;  1QUP A;  1HBU B;  4O0N A;  3VV2 B;  4M8L A;  3B82 A;  4AD6 A;  4DR5 J;  4LF7 J;  2JXI A;  2EFN A;  2DK2 A;  2AN7 A;  1S59 A;  4OFZ A;  1D9A A;  1ZYQ A;  2UV8 G;  1S1V A;  5KFB A;  5CYQ B;  3CCM S;  2NXE A;  4QWE A;  4DG1 A;  3CED A;  1V3Z A;  2IHR 1;  2MKS A;  2GHP A;  1E6Y B;  4PXB A;  4XO0 A;  1PSD A;  1W2I A;  5HMW A;  1JLE B;  1S1W B;  4OYB A;  1TKT A;  2B43 A;  4DN9 A;  2AGQ A;  2J7W A;  1HNZ F;  1WC4 A;  2J0Q D;  2ABY A;  2BA9 A;  4DJB A;  3H20 A;  2C28 A;  3IAS 9;  2KG1 A;  2VB6 A;  4TY8 B;  4CH0 S;  3MEG B;  5IC6 B;  5A0Y A;  3ICL A;  3NKY A;  3LO3 A;  4XK8 C;  5L1L A;  4MK7 A;  3BYP A;  3PO5 A;  3RB0 A;  4YDX A;  4QYZ K;  4MMO A;  2MZJ A;  4WZM A;  4HHU A;  2G0C A;  5KG3 A;  1UEU A;  1NLA A;  3HVT B;  2M3D A;  5IT4 A;  1SC6 A;  3Q86 A;  4ZK7 M;  5DET A;  3RAQ A;  2GJ2 A;  4AXI A;  3VGS A;  3OFG A;  2VA2 A;  1WOO A;  3NMR A;  2HHV A;  3DYA A;  3MMJ A;  5KG5 A;  3CDW A;  3R7N B;  4BDP A;  5J1E A;  1C0U B;  3DRY A;  2QA4 S;  3SSR A;  1U8W A;  2HKE A;  2ZVI A;  3PW7 A;  4G1Q B;  4GKK F;  2V8P A;  2VDI A;  3DMJ A;  2DH8 A;  3MMA B;  4PG5 A;  4UZC A;  2B56 A;  3R7S B;  3PIP Q;  2WBR A;  2BJE A;  4M5J A;  5L46 A;  1HI0 P;  3DI6 B;  1M5H A;  1VMB A;  3ISN D;  4JI1 J;  3J7A 1;  1DBD A;  4XIU A;  3GYG A;  1V5V A;  3MM9 B;  5HI7 A;  2UXB J;  4LQ3 A;  2Z2M A;  4WP8 A;  2ZJQ Q;  2MEW A;  3KLF B;  1SQF A;  2J7U A;  2K1R A;  1G4C A;  2RIL A;  3FEX B;  3FFI B;  1S57 A;  3MR7 A;  4LUB A;  1WSV A;  5THW A;  3M8Q A;  3KUH A;  3FEY B;  2QGF B;  2WBM A;  2XQC A;  3GFZ A;  1DFD A;  4PAB A;  1GMU A;  3CJS A;  1DLO A;  1IXK A;  4DV2 F;  3NEK A;  3PDN A;  1PC4 A;  2VUG A;  4QYR A;  1FX4 A;  4OMF G;  3SZ2 A;  3FQK A;  3GFX A;  3IBF B;  4I2P A;  2YQ3 A;  3EVO A;  2EC0 A;  3DLE A;  1BLU A;  3EDR B;  1LW2 B;  2LA6 A;  1H2T Z;  2AU0 A;  3O5T B;  3CUN A;  1O51 A;  2P6S A;  5ETN A;  1A0O B;  1XQI A;  3LAL A;  1TL4 A;  5E3A A;  5LL6 d;  4FYX B;  3FQL A;  1NK6 A;  1BC6 A;  1IM4 A;  1M1G A;  2AYM A;  2Z2L A;  2ZNZ A;  5CCM A;  3R5C A;  1RXO B;  3J81 U;  1JLG A;  5DQG A;  3MUT P;  5BYR A;  3LP0 A;  4PG8 A;  1X93 A;  2GVD A;  4K59 A;  1DLO B;  4CRJ A;  5HL7 Q;  4O0I A;  1EHW A;  5D78 A;  2O66 A;  3HK2 A;  1LEO A;  1ITP A;  1R0C B;  2UXC F;  2YQ0 A;  1C1C A;  3OTB A;  3FFI A;  2ZBP A;  2E1C A;  3RRH A;  1S9G B;  4LVO P;  4HVZ A;  5KFZ A;  4YY3 J;  3CCZ A;  2FZC B;  4ZCL A;  4DX8 H;  5KFI A;  1TEL A;  1QLN A;  1VS3 A;  4NLR A;  2YNG B;  2B6A A;  3AB2 B;  4DPT A;  3LW5 C;  5BR8 F;  4DUZ F;  1BQM A;  4QPT A;  3G9C A;  3ZZP A;  3A8J A;  3DKD A;  2RB7 A;  3D54 A;  2LFV A;  3DMJ B;  3HSD A;  4ZVO B;  2ZHA A;  3IWL A;  1S6P A;  3CCT A;  3EX7 B;  5E3C A;  1U1R A;  4C7Q A;  1UVJ A;  1V9O A;  3T5H A;  3AB4 B;  4OHV A;  4CI0 B;  1LQ9 A;  2QLB B;  2ZUG A;  4QWC A;  1KD1 T;  1TUV A;  3HSJ A;  4AQY J;  2H5E A;  3UI3 A;  2XM3 A;  4KFB B;  1QE1 B;  4NLP A;  4ZN1 A;  1SPB P;  4RBT A;  3ZTQ A;  4CT9 A;  2DJW A;  2M2B A;  4NLT A;  4YB5 A;  2HHH F;  4F7V A;  2Z4P A;  2YKA A;  4UZB A;  4YB1 P;  4ECR A;  2JLF A;  1NAQ A;  1R8H A;  1F5C A;  3BB5 A;  4G6V B;  4LSL B;  1KOO A;  4F3M A;  4DV6 F;  3VAF A;  5CQG A;  2IY5 B;  3Q8R B;  4IO9 Q;  3UVJ B;  2XCP A;  3U7J A;  4DUY F;  4USJ C;  2YKN B;  2YKN A;  3B4M A;  1X4D A;  1Q8K A;  4ZCK A;  4U7U K;  3GSD A;  5K8P A;  3D1Q A;  1TL3 A;  5LXY A;  4WFA Q;  1U1Q A;  1FJG J;  2CYY A;  1UVL A;  2W9B A;  3R27 A;  1FES A;  3JYT A;  3KHG A;  2UUC J;  2DPI A;  1PYT A;  2MHE A;  1JXE A;  4N41 A;  3TO8 A;  5C7P A;  2ZH6 A;  5JVH Q;  3TQ1 A;  4MIB A;  1R0A A;  4Q8E A;  3BBF A;  2KHD A;  3P3D A;  2KM8 B;  3GE9 A;  3G6E S;  4ED0 A;  4ZPA A;  2Y8Y A;  2EWH A;  4KGK A;  4HI2 A;  2GCF A;  3NGD A;  4LBI A;  4YN3 B;  3ZZY A;  4YB6 A;  1UA1 A;  4X2B A;  1OY9 A;  3PRB A;  1BGX T;  1H6K X;  2M5Y A;  4X66 F;  2Q2K A;  2BKN A;  4URQ U;  3U27 A;  1S72 S;  2ILZ A;  3EM1 A;  1RA6 A;  4K2X A;  4I68 A;  5JXS A;  3DLH A;  3FZ2 A;  5L1K A;  2HFZ A;  5IC4 B;  4PKD B;  1XNQ J;  4NLU A;  2JRS A;  4O3S A;  1N8R T;  4DQI A;  1C1B B;  2DGV A;  4N77 A;  1VQP S;  3KLH A;  3OHA A;  1I1G A;  3EGV A;  1N33 J;  5C25 A;  2CQ2 A;  1S6Q B;  4EYH B;  3V4I A;  3DLK A;  3N6L A;  5I3U A;  1H0H B;  3PR5 B;  2VG6 B;  2W25 A;  3CO0 P;  4WF9 Q;  3O6Q A;  2EFG A;  4AT1 B;  1XMO J;  3FBB A;  3NGU A;  4YR0 A;  3RRG A;  1ACM B;  1FNO A;  4JV2 A;  4ZP8 A;  2FB0 A;  1H98 A;  2B4O A;  2PI5 A;  4DCP B;  2PD1 A;  3K8W A;  5KT4 A;  3PRD A;  2ZIT A;  2D74 B;  2VBX A;  1FE4 A;  4R8U B;  5EHH A;  1S9E A;  4MAK A;  2ZH3 A;  1JLG B;  1L3U A;  1NSK L;  3CDE A;  3CJ5 A;  3S1T A;  2EFP A;  2GNK A;  3ILO A;  3MCM A;  4KAI A;  5KFW A;  4PCQ A;  1DUR A;  2PMH A;  3HUL A;  4QIE A;  2HHQ A;  3G6Y A;  2ZBC A;  3TUZ C;  4GO5 X;  1Q8I A;  1RAJ A;  3MZI A;  3GQC A;  1QTM A;  3DDN A;  4DF4 A;  3HX9 A;  2WAQ D;  4J37 A;  4NZ0 A;  3MAA A;  3HDS A;  5J2N B;  1RHQ B;  2I9S A;  1BDT A;  2C1E B;  1GXL A;  3HCX A;  3NG8 A;  3MM7 A;  1WEZ A;  3DDI A;  3R1H A;  3CMQ A;  2BJD A;  4F04 B;  3HKW A;  1WKJ A;  2ZE2 A;  1RT7 B;  2R8G A;  1VRT B;  2HBR B;  3FVY A;  2G0I A;  5KFV A;  3TP2 A;  1R7I A;  3QGH A;  2MST A;  4HAC B;  4J9R A;  3K58 A;  4NRU A;  3ZTP A;  4L76 A;  1KVI A;  3BGR B;  4WE1 B;  3SSQ A;  3O2I A;  1SJQ A;  1ZA1 B;  5LXR A;  5J1N A;  2QLX A;  4O44 B;  3GJQ B;  3CD5 A;  3MCO A;  1IKV A;  1WUU A;  1RK8 A;  2GGP B;  2MQQ A;  3DOK A;  2DR6 A;  4Q43 A;  3H25 A;  2B6A B;  4OV6 A;  4OYM A;  5GAE U;  3W9H A;  2V67 A;  1NDK A;  3KG0 A;  3PEH A;  3MAQ A;  2F8M A;  1CJT B;  1CQM A;  5B0F A;  4DV3 F;  4QWB A;  3R5A A;  3JQK A;  2AEM A;  1RT7 A;  3RB3 A;  1UP1 A;  3GCW P;  2VG5 A;  3HFZ B;  1FFS B;  2FUG 9;  4I6A A;  4J9V A;  5DS7 A;  3AXK A;  4FS2 A;  3KK3 B;  3HMJ G;  1SQG A;  4ZIV A;  4K0K J;  4Z37 A;  2RKI B;  2AD9 A;  4JI3 F;  2IBK A;  1T05 B;  1ARR A;  2RD5 C;  1TMM A;  2K6L A;  2CJK A;  3TJA A;  1LK7 A;  1AZS B;  1N0U A;  2BEF A;  4ZJL A;  1TL1 A;  5A0Y B;  5KFD A;  5EWG A;  2LDY A;  4O3Q A;  4NXM J;  4NA2 A;  3NNH A;  1TFY A;  4RUB A;  3KLI A;  5E2Q A;  5DLF A;  5D4O A;  2FGC A;  3BBB A;  4ZP9 A;  1FRL A;  1IBL J;  2DIS A;  4KH1 B;  4X66 J;  4RNH A;  3A13 A;  2VJV A;  4DR5 F;  2W9C B;  1LW2 A;  1OY6 A;  5E33 A;  1S1T A;  4KSE B;  3M8Y A;  5B0E A;  5F3Z A;  2DR5 A;  1VBY A;  1IBC B;  3THT A;  1RWV B;  1UFL A;  4I7F B;  3WIV A;  5B0C A;  4IO1 A;  4ILL A;  1B7F A;  4NLG A;  1UAW A;  3G2X A;  3Q83 A;  4R0E A;  1B0V A;  4NYO A;  1EET A;  5DG9 A;  1Y00 A;  3RBD A;  4F2S A;  2LU1 A;  2E5L J;  1RT1 A;  4CTA B;  1HPZ A;  2OSQ A;  4OX7 A;  5ETL A;  3VGV A;  4ZVE A;  1FK9 B;  2NYH A;  3VGT A;  2LVW A;  4EO8 A;  3KLV A;  1ZET A;  3QOQ A;  2NPI A;  3UQS A;  1X5T A;  3GB0 A;  4J9M A;  5LJ5 Y;  4BCA A;  2G4B A;  2ZUA A;  1RI7 A;  5EUH A;  3DLK B;  2ZZM A;  1Y9O A;  2CA9 A;  1LWC A;  1NPP A;  4AYB D;  3RBX A;  1S7I A;  4ENO A;  2XS5 A;  3FBC A;  4O4G A;  1H2V Z;  4BWJ A;  1FJE B;  4P52 A;  1JJ4 A;  4IRK A;  3C3L A;  3QWP A;  4KKO A;  4NE9 C;  2D41 A;  1RTJ B;  2GAH C;  3WX8 A;  7FDR A;  3OD2 A;  2ADC A;  3B78 A;  1DTQ A;  1U25 A;  3QBC A;  2QO3 A;  3I5A A;  3GV5 B;  5J2M A;  3MTJ A;  3IWN C;  1EZZ B;  2F8E X;  5KOW A;  5DLG A;  4J9N A;  4DFJ A;  4GVB B;  4AQY F;  2CPH A;  2LXI A;  3N4W A;  5CZX A;  1JIH A;  3DLB A;  1DQ8 A;  1ZAW A;  2Z2Z A;  1TKZ B;  2PC6 A;  3RB4 A;  2XS2 A;  3PG9 A;  2ALZ A;  3NRB A;  1YJW S;  1RWK B;  3GON A;  4HYK A;  2WVB A;  4EYI B;  2BZ2 A;  2IRU A;  4LIR A;  3JYT B;  2IJN A;  4NEZ A;  4ZHR A;  1C0T A;  1M1H A;  1NHU A;  4N8O A;  4ES3 A;  3D67 A;  2MZ1 A;  1R0B G;  4P72 A;  3K59 A;  1XBW A;  5F9N A;  2C3U A;  2JBV A;  2B5J B;  1M5P C;  4P2F A;  2KFZ A;  4WYW A;  3KG1 A;  4NI2 A;  1U1M A;  1N33 F;  2DR8 A;  1YKW A;  3BDE A;  2BJ9 A;  4ECQ A;  2M70 A;  3E01 A;  4U9R A;  3UDV A;  1ROF A;  4WTY A;  2L48 A;  2QN6 B;  4RBV A;  1YQH A;  3D7S B;  1BQX A;  1EJ7 L;  1RQ0 A;  1UMJ A;  2K1O A;  1WF2 A;  1HWK A;  1NUE A;  2H4Y B;  2GS8 A;  3M6W A;  5SUH A;  1RAC B;  3DRP A;  1K8A T;  1KON A;  3D1H A;  4J9O A;  3QFW A;  4MYU A;  2COL A;  2DH9 A;  2MZR A;  3BYR A;  1IKW A;  4MKA A;  1MRO B;  4LRD A;  3GPA A;  3PTW A;  4KGM A;  4V1A k;  5IS2 A;  4ED2 A;  4DFK A;  1TU0 B;  3DRR A;  2MKY A;  3H2U B;  3D6F B;  2JLE A;  3NOG A;  1URN A;  3LAN A;  2X1A A;  1HNX J;  2XNQ A;  1GNK A;  3HHL A;  1JLA A;  1WDT A;  2DR9 A;  1ULR A;  4AND A;  1PGZ A;  4B9U A;  2CQB A;  2G2Y A;  2OPR A;  3ET6 A;  4QJV A;  5DZ7 A;  4CO2 A;  4WFY A;  3MFH A;  3QJP A;  3SEO A;  2OEJ A;  3EE3 A;  1RYR A;  2PFD A;  2MHN A;  4KV8 B;  3CGI A;  4NML A;  4DL3 A;  4P75 A;  2KFN A;  1EAR A;  2PE8 A;  1RZM A;  1WSR A;  4Q0B A;  2M52 A;  3RTV A;  3TAP A;  3PY8 A;  2QFJ A;  4XDC A;  1EET B;  3I0R A;  2Z57 B;  3M1V B;  1O6X A;  4X64 J;  1P9Q C;  2Y0S D;  2QJ3 A;  3TUP A;  3NGK A;  2AF6 A;  2GA7 A;  1N34 F;  3H87 C;  4QU6 A;  1Q8L A;  3OTO J;  2VA3 A;  3VHQ A;  4DX7 A;  3R3T A;  4YP3 A;  4DR6 F;  1BQN A;  4KR0 B;  4QU7 A;  1SUQ A;  4O3O A;  1F3V A;  1Q4R A;  1GTE A;  4CLL A;  2M8D B;  1YJ7 A;  4ID5 A;  4JP8 A;  1NXI A;  1UFK A;  1NSA A;  2HMI A;  2VKZ G;  2OSR A;  5AXK A;  1B28 A;  3C6U B;  3JSM A;  3FCW A;  4CWB A;  4UY8 T;  3NP5 A;  2DHX A;  2GMJ A;  4I56 A;  2E7W A;  5EGY A;  3MEE A;  4GC7 A;  4ILM A;  1RAF B;  1Y11 A;  2J9D A;  2HRT A;  5KG0 A;  4DL5 A;  1B01 A;  1YJ9 S;  4NA1 A;  5E3P A;  4G1P A;  2X1F A;  2GVZ A;  2VL1 A;  4B3T F;  4LF6 F;  3CUL A;  1LFP A;  4Y65 A;  2UU9 J;  3SDE A;  3KNA A;  2XS7 A;  4U8V A;  2OEK A;  1S0N A;  3L7P A;  3MF5 A;  2PFF B;  2DIV A;  1KS2 A;  2UUT A;  2B4V A;  2G0J A;  2DRA A;  1RWW B;  4DN0 A;  1IQZ A;  5KFF A;  3QIP A;  4JOU A;  2XZW A;  2Y9H A;  2DYA A;  3A4T A;  1IQT A;  4R0J A;  1TZ0 A;  3BPS P;  5E7O B;  3UDC A;  3TA2 A;  4X65 J;  2P6T A;  2LQ5 A;  1W7W A;  2YH0 A;  5GMK a;  4ECW A;  3BGR A;  4WE1 A;  4X65 F;  4ZN3 A;  4FF2 A;  3ZXW A;  4NLO A;  3T1Y F;  2DCU B;  2VQF J;  2VOO A;  4N5S A;  2OPS A;  5J2Q A;  3DC2 A;  5AXN A;  4ELU A;  1IKW B;  1NEE A;  4F3Q A;  5AE2 A;  2VF3 A;  1VBX A;  3SI8 A;  1P1L A;  1U02 A;  5CYM A;  3MMC A;  3ADA C;  2UU9 F;  1HLW A;  1PJ7 A;  3HFK A;  3M2U A;  4FPI A;  1XNR F;  2IYI A;  3WC2 A;  4DCJ B;  3HPO A;  4C8K A;  1A9N B;  3MAA B;  3UD5 A;  2QE5 A;  2QG9 B;  3I32 A;  4C0B A;  4C3L A;  1U1K A;  1RTH A;  5D6G A;  1P8G A;  4M5I A;  4WP9 A;  3CJ0 A;  4DBQ A;  5CYJ A;  2C2R A;  2J6T A;  2DGU A;  4F4A A;  2IA6 A;  3MOJ B;  2BQU A;  1XER A;  3NNC A;  2DHG A;  1WG1 A;  3LP2 B;  4ZP7 A;  5KFO A;  3KLG A;  4LQ9 A;  5ITH A;  1U6Z A;  2YH1 A;  5D0E A;  3IN5 A;  4I1T A;  4EBE A;  4USK A;  2ASL A;  4DSJ A;  1KLM B;  2YNF B;  3J7Z 5;  2JH3 A;  4ANE A;  3DLG A;  1NB7 A;  3I0R B;  1Q5Y A;  3K5P A;  2QA1 A;  5A6P A;  2AJ4 A;  2Z56 B;  4F4X A;  4IFY B;  5F0W A;  3O44 A;  4AE5 A;  1WHX A;  1Q79 A;  5D0H A;  2O1P A;  3H98 A;  1N5V A;  3KJV B;  3FEZ A;  4LF8 J;  3KHL A;  1S76 D;  1M5K C;  2IVY A;  2YX7 A;  2BJ7 A;  3CC4 S;  2JEG A;  3PO4 A;  3QID A;  3W5Y A;  4W90 B;  3J80 U;  2C42 A;  4PXD A;  3RBE A;  5ADZ A;  3EYZ A;  1NB2 A;  2E1M C;  1OYE A;  2BE7 D;  1CJU A;  1ZS6 A;  3FCV A;  2XO7 A;  2DY1 A;  4MK9 A;  2R2S A;  2R7R A;  1NBE B;  2EG1 A;  3AH6 A;  4IOB A;  4K7Q A;  1FXR A;  4P7V A;  1ZA2 B;  2DNR A;  1R3N A;  1IN0 A;  3ELH A;  3KNG A;  4DV4 F;  2ZH8 A;  2ASD A;  1I94 F;  4FF3 A;  3W8G A;  2XMA A;  4O4G B;  3PEJ A;  1FER A;  2QL7 B;  4ZPD A;  5LSL A;  2N3L A;  4AFF A;  2OHD A;  2N82 B;  1SL2 A;  2QEX S;  2YX1 A;  3T1A A;  3KK1 B;  2K2P A;  3QRR A;  4G3I A;  4YB7 A;  1SH2 A;  4JI5 F;  3M8R A;  3K57 A;  4NAS A;  5HK4 A;  4B3M F;  2Z58 B;  5FII A;  3OL6 A;  2UXD F;  1YSJ A;  2D3U A;  1RU2 A;  1WI8 A;  4ITS A;  3TVY A;  2K5J A;  3W2W A;  4CTA A;  3E8O A;  5KFQ A;  4X4S A;  4C8Z A;  1CLF A;  1N5Y B;  5ETR A;  5HVH A;  1JKH B;  2HS0 A;  4YOE A;  4Q7A A;  3OFH A;  1FJC A;  2HS4 A;  1NJW A;  2XG8 A;  4OHZ A;  1FEH A;  2RDJ A;  2WSC C;  2WW8 A;  5IV4 A;  1LOU A;  3P4U B;  2GZO A;  4KQZ A;  1OPI A;  1MWZ A;  1REG X;  3KKF A;  3H40 A;  5IWA F;  5DM7 Q;  1PYS B;  1TL3 B;  2V94 A;  2EK6 A;  4Q2M A;  3CCV S;  4CT8 A;  1T0T V;  2VHG A;  1FDD A;  4TY9 A;  1RT3 A;  3AY0 A;  4ED8 A;  1QY7 A;  1U9P A;  2XY5 A;  1QJH A;  4P2S A;  4Y28 C;  3UVJ A;  3EWG A;  4ID8 A;  4NWB A;  4OX6 A;  4CP5 A;  1ARQ A;  2BNZ A;  4JI3 J;  1S10 A;  1VJW A;  1WOR A;  5IQQ A;  3HKZ D;  1FDN A;  2RF2 A;  2HFU A;  2V8V A;  3GXQ A;  2HQC A;  2WON B;  3BKT A;  3HD2 A;  5D4P A;  2J0S D;  5KFG A;  3PXG a;  2A2B A;  4JI1 F;  2I1R A;  3JSY A;  4DV3 J;  1NKE A;  4A8K A;  4V19 J;  2DXF A;  1BMQ B;  1O0P A;  4Q45 A;  3I56 S;  2CFX A;  4LF5 J;  3OJS A;  2HHT A;  1Q53 A;  4RNF A;  1N5T A;  2CQ3 A;  1XK8 A;  4LSZ B;  5I3P A;  4YS2 A;  2ZDP A;  5KOX A;  1L3K A;  1FWL A;  1X0F A;  2V4R A;  3LAK A;  1TP7 A;  3BGF A;  3DOK B;  2MQM A;  4ZKA A;  1JJH A;  2DGO A;  2BAN A;  4OX9 F;  1T9V A;  3GG0 A;  2VZ9 A;  1YBU A;  2F9D A;  3DNC A;  1X4E A;  4LRF A;  1U09 A;  2MYF A;  5SZT A;  3L3C A;  3DOL B;  1RKI A;  2YWK A;  3NGS A;  4WFX A;  3QAU A;  4Z7Y A;  5KFK A;  4WZQ A;  1FE0 A;  5KFY A;  1U24 A;  3ZZO A;  1HYS B;  2XMJ A;  3DLL Q;  2L9W A;  1RLC L;  2DNK A;  2QLF B;  1PYO B;  3MM7 B;  4DPU A;  7AT1 B;  3MEE B;  1F9F A;  3KUE A;  4KIA A;  4OJH A;  2BE9 B;  1EKS A;  1GMV A;  3AXM A;  1CC7 A;  4H4M B;  2Q1L A;  5DGA A;  1QTN B;  2VPZ B;  1TAU A;  1RHK B;  1HNX F;  2E5L F;  5F8H A;  2DRB A;  1SIW B;  1B7Y B;  3DXS X;  1NDP A;  3JB9 k;  4DQS A;  4IOA Q;  3VAL A;  4R25 A;  2V8G A;  1U2C A;  2YKP A;  4LJM A;  4L74 A;  2V69 A;  4QCL A;  5KFT A;  4JI8 F;  4OIX A;  3TVK A;  1EIY B;  1IBL F;  3IFE A;  2E1A A;  3NS5 A;  4OZ1 A;  5KT2 A;  1TL1 B;  4LF5 F;  3N6N A;  4R5P A;  2E9R X;  2RQ4 A;  4KT0 C;  2PT0 A;  3ZZZ A;  2CPD A;  3KXD A;  1Q16 B;  1URR A;  5T7L A;  3UO0 A;  4DZD A;  4C2M A;  5DGB A;  1KWM A;  4B3T J;  2EFV A;  4LF6 J;  1Q5V A;  1U45 A;  1HYS A;  4M5L A;  2LEP A;  4QIF A;  3KLF A;  1XC9 A;  3B54 A;  2AX0 A;  3IS9 A;  3IM9 A;  4DL0 C;  4CO3 A;  2F9J A;  2W01 A;  2KM8 C;  2A2D A;  1HNZ J;  1B99 A;  2Q6B A;  3AA9 A;  4FXW A;  1OY8 A;  4LRC A;  5KFR A;  3CCQ S;  2V4J B;  2DIU A;  3TAR A;  2RQC A;  2HVI A;  5AXM A;  2AV5 A;  2BW2 A;  2HQ3 A;  4DCO B;  2E5I A;  2YKQ A;  1RTD B;  3PJX A;  2CQH A;  1REV A;  3H2V E;  4HH1 A;  1FTR A;  1FRI A;  1V3R A;  8ATC B;  4NCB A;  3FMW A;  4HDG A;  3D1O A;  3HM9 A;  1UET A;  1XR7 A;  2ZKU A;  3QJL A;  2N4C A;  2QT7 A;  5AE3 A;  3PJW A;  2CQG A;  3P49 B;  4B9T A;  2PA3 A;  1VI7 A;  3MCN A;  5ETO A;  1D1U A;  3ENA A;  2NUU G;  3OUY B;  3WBZ A;  2K9I A;  2GQC A;  3FRZ A;  4CLU A;  3ILI A;  3AOC A;  4ELV A;  2M9K A;  1MG7 A;  5J2N A;  1KTQ A;  2JVO A;  1VGY A;  2P9G A;  1PJ6 A;  5LJ3 Y;  3NGT A;  5A2Q U;  2XMK A;  3J80 Y;  3G6V A;  1HR0 F;  4TVA B;  4CLS A;  3QO9 A;  2EK1 A;  3JTN A;  3MD1 A;  4HLB A;  4TY8 A;  4F4Y A;  1VLO A;  1L3T A;  1HW8 A;  3D9B A;  4NI2 B;  4IG0 A;  2KKH A;  1X4H A;  2EBG A;  2WVC A;  2DEI A;  2H5I B;  2CPI A;  5A8W B;  5CAA A;  5DQI A;  3M8S A;  4ZOS A;  2ERR A;  2KOE A;  4LIW A;  1MML A;  3ZZ0 A;  1SJ4 P;  3LGH A;  1KLN A;  1G1X A;  2B51 A;  3CDB A;  1NKB A;  4A46 A;  3QO9 B;  1FDA A;  3ZZT A;  4ZPW R;  1NDC A;  2H48 B;  2MJU A;  4M5K A;  5ETP A;  2EI5 A;  3TWZ A;  1FRM A;  2H51 B;  3Q2T C;  4B3R F;  1HHS A;  2HWH A;  1HBU A;  2DHS A;  2E29 A;  3R2C J;  3C14 B;  2HWI A;  2AW0 A;  2CPF A;  4NMX A;  2VBY A;  5A8R B;  3Q8S B;  3OBI A;  2BUN A;  3CPW R;  3LP1 B;  1R43 A;  1Z1Z A;  2DVI A;  5GAE I;  5IM0 B;  4FXE A;  1X5S A;  1ZM2 A;  3KHR A;  5K9F A;  2DHA A;  1JLQ B;  1XMO F;  4K4W A;  1Q95 G;  4JUZ A;  1DTQ B;  4ZLN A;  4HH0 A;  1JJ2 R;  4FVM A;  2NPF A;  3W64 A;  1RTD A;  3PFE A;  3GCX P;  3P96 A;  1F2G A;  1GAO A;  1IBM J;  2CNK B;  3RW6 A;  3AJ1 A;  3LAM A;  2HK2 A;  5DDP C;  1N32 F;  1HBN A;  2CQI A;  1RHU B;  3CJQ A;  2EKY A;  3KUG A;  2ZBQ A;  2V2Z A;  2KU7 A;  4ZPV R;  2RHQ B;  3UDL A;  5IM0 A;  4B9S A;  3X1L B;  2WSF C;  2UUW A;  3H5Y A;  4U8Y A;  1QTG A;  2DKO B;  4FXD A;  1G2E A;  1HPZ B;  3BRE A;  4Q2L A;  3OHB A;  5T7L B;  1OMS A;  4RKU C;  4DR6 J;  3TRG A;  5EWE A;  5I4M A;  3D4J A;  2RUG A;  1R0A B;  2YWE A;  1F9E B;  1HBM A;  1KLM A;  2W2N P;  3FMB A;  3LUY A;  2NSC A;  5F8M A;  2W9B B;  4DPW A;  5BYS A;  1FT8 A;  2W9C A;  2AGO A;  1QAI A;  2C2E A;  1JB0 C;  2AZ1 A;  1FCA A;  4DLE A;  3R5B A;  1S99 A;  2IM2 A;  2HVE A;  3W60 A;  1I51 B;  2QSW A;  1P6T A;  1R6Y A;  3TUI C;  1NK4 A;  4IDK B;  4Y2C A;  3H7H B;  3OR1 A;  4FYY B;  1FTC A;  3GV7 B;  5FJ4 A;  2L08 A;  1KR4 A;  3OW2 R;  4LSL A;  1JMT A;  1YJU A;  3WC0 A;  2DNG A;  1O5J A;  1TV6 B;  1NZ8 A;  4NYP A;  1IBK F;  5F9L A;  1UKU A;  3BPD A;  4QW9 A;  1GMW D;  3DN9 A;  4RL1 A;  4DFP A;  5IZH A;  3OUY A;  1OSD A;  1RT6 B;  3WQP A;  4A8M P;  1HWI A;  2BSQ E;  2OD6 A;  3BBC A;  4P74 A;  4OI1 A;  1QSL A;  1T9W A;  1ZAX A;  4F3O A;  1T11 A;  2XYG B;  3P8B B;  4K4X A;  4B9L A;  2D3O 1;  4QQB A;  4KHP J;  2XY7 A;  3MM9 A;  1N36 F;  3C66 A;  3I9V 9;  4OJ1 A;  2HPU A;  1FKA F;  2JX2 A;  2E66 A;  4K5R A;  1V6H A;  9RUB A;  1KP6 A;  4NZ7 A;  2VG7 B;  1Y5N B;  3L4B C;  3JQJ A;  2XY6 A;  4BC9 A;  1SH0 A;  3HP6 A;  4O44 A;  1MYL A;  4IFV A;  2GQ2 A;  1IVZ A;  3J81 Y;  3EXC X;  3LGM A;  3M7V A;  3TAQ A;  5LMU J;  1TK0 A;  4YR3 A;  2CAX A;  2FQQ B;  2IRX A;  2XO6 A;  1U8S A;  2VU5 A;  2IA0 A;  4F50 A;  1T3N A;  1M5O C;  1ZBT A;  3CD0 A;  3SDE B;  2G1H A;  3N9U C;  2HIY A;  2ZHO A;  1RWN B;  4PPZ A;  3CF5 Q;  4KO0 B;  1S79 A;  4ZJO A;  1FRH A;  1GH8 A;  3T41 A;  4L3K A;  2H65 B;  1VOM A;  2CQ0 A;  3OXG A;  3OLA A;  5DG7 A;  2CKW A;  4ECY A;  3EZ5 A;  2DO0 A;  4LFB J;  1BXN A;  2R7V A;  2RF2 B;  3T1H J;  3MPW A;  1UZH A;  1RHJ B;  2G9O A;  4CNZ A;  4IRC A;  4CLT A;  5U47 A;  4DL6 A;  3PR4 A;  3UE2 A;  2MTL A;  3VEA A;  3HJV A;  1FD2 A;  5LMN F;  2FJW A;  1VBK A;  4ED5 A;  2DNN A;  1S1W A;  2YKM B;  2HHW A;  3W63 A;  1LWF B;  4IOC Q;  2FJB B;  1WEL A;  2FVC A;  3M8Z A;  2GFF A;  1X4B A;  1UEK A;  4DR7 J;  1VQY A;  1Y5L B;  4C8M A;  3NBP B;  1RAE B;  4I2P B;  4PXE A;  4C98 A;  4CM2 A;  3CJK A;  3I82 A;  2BX6 A;  4JYA J;  2FHK A;  3POT B;  3EPG A;  2J0X A;  2NZ4 A;  4PXC A;  2FHJ D;  4IRD A;  1U0H A;  3DRS B;  4A8S A;  4WPA A;  3EPI A;  3IP0 A;  1DJ0 A;  1RT5 B;  3OTD A;  2HFS A;  3OQ2 A;  4OLP A;  5DJB A;  2VG6 A;  5A2Q Y;  3MUM P;  2R7S A;  4KJI A;  5M2R A;  3R1L A;  4ICL A;  3PW2 A;  3BR8 A;  4UOG A;  2XLJ A;  2A6O A;  3ZFV A;  2IFX A;  5T14 A;  1S6Q A;  1N4L A;  1JLC B;  2MZQ A;  2YNH B;  1CEZ A;  1BY9 A;  4USI A;  4U95 A;  1SH3 A;  3A3O B;  4M5G A;  2RH3 A;  2HNY B;  1WHY A;  5EWF A;  1I6J A;  2HZC A;  1DHM A;  2QIF A;  2ZM6 J;  5A8K B;  1KTV A;  3H90 A;  4ZVF A;  3IAM 9;  2DBB A;  2JSX A;  5IQ6 A;  3PYG A;  4GRS A;  3JSB A;  2Y0B B;  3CVK A;  4P9S A;  3R97 A;  4CIO A;  4RJV A;  1R27 B;  3NNE A;  2N3O A;  1N34 J;  2DGX A;  2XSF A;  1S5Z A;  3MD3 A;  2ZEJ A;  3SQG B;  4USM A;  3TYT A;  3V81 A;  4D3G A;  1H74 A;  3EGW B;  3PAC A;  3RR7 A;  2JXH A;  2C22 A;  1FHT A;  3N28 A;  1T7P A;  4XPC A;  1TFW A;  1EB0 A;  4L6V 3;  1WOP A;  1ZAV A;  2HNZ A;  2YNF A;  4X4P A;  1S0O A;  4HR2 A;  3MEG A;  1XWL A;  3DDK A;  3QGG A;  5IXU A;  3W9J A;  2HLU A;  3BSO A;  3BKU A;  3CJ4 A;  3ONQ A;  3OT9 A;  4HDH A;  2X7I A;  4K2J A;  3T6B A;  4WCE Q;  2LEC A;  1TQL A;  3DGP A;  3ENV A;  4P6Q A;  2VFS A;  4DFM A;  1YIJ S;  2ROG A;  2ADL A;  5E3Q A;  3U1M A;  2KHC A;  4TNO A;  2XLI A;  2POK A;  3VVT A;  3R2D J;  4Z7C A;  4EWT A;  1S1V B;  2JC1 A;  3W61 A;  1JJC B;  4Q5V A;  4DR1 J;  4TKT A;  1YZ6 A;  4LF9 J;  3L09 A;  3MGJ A;  3QSI A;  4L75 A;  4DR2 J;  2BQR A;  2DD8 S;  4RNO A;  2QMX A;  4C8L A;  3W2W B;  3K2Y A;  4NLY A;  2GV1 A;  4NPO A;  4JI8 J;  2W1B A;  1TVR A;  2W2P P;  1Q1K A;  2OPS B;  4A8F A;  1XJW B;  2CPY A;  2VBW A;  3CJR A;  5HAT A;  2MQL A;  3TZZ A;  3W65 A;  4DR7 F;  3RUB L;  1IJE B;  2KT3 A;  2R7O A;  2CQC A;  2EKN A;  2PMW A;  4WP3 A;  5J2M B;  4QWA A;  3OL7 A;  1UL3 A;  1TL7 B;  4I64 A;  2XGQ A;  1RT4 A;  4QR2 A;  1NK8 A;  4LBH A;  1RTJ A;  1Y10 A;  2HNY A;  2RS8 A;  2P9E A;  4DWI A;  5KG2 A;  1CJU B;  5B0B A;  2EFO A;  4DR1 F;  1FJG F;  2EEY A;  4J9K A;  3VWS A;  4C8Y A;  5J1P A;  1D0E A;  2HS3 A;  2FJV A;  2ZBI A;  3T5K A;  1QSY A;  1N32 J;  2PN6 A;  4NLD A;  4RW8 B;  4C0O C;  1JLB B;  1RLD A;  2J76 E;  1P27 B;  3CIM A;  3OL9 A;  4ZIT A;  2HBQ B;  1FEE A;  7FD1 A;  4PUO A;  1HD1 A;  4K4U A;  3E51 A;  2HFO A;  1LW0 A;  4IFY A;  1FNM A;  1F1B B;  1U0H B;  3DRS A;  3MDF A;  4RW7 B;  2ZH9 A;  4UY8 5;  5HP1 B;  3W66 A;  2AWZ A;  4URG A;  2OPP B;  1TKD A;  1ZH5 A;  3VTI A;  1ZTW A;  3MR3 A;  3CJK B;  1VIO A;  1S1T B;  3G82 A;  5C24 A;  4ZP6 A;  1VBZ A;  3FSX A;  2I6W A;  4RW9 A;  2L41 A;  3KLG B;  1SL1 A;  1X60 A;  2MGZ A;  2GML A;  2BV3 A;  2FGO A;  2C3O A;  3EVM A;  3VQT A;  3D2W A;  1SV5 B;  3HT3 A;  4HHJ A;  1OG7 A;  4KHR A;  3HJF A;  2IMO A;  3Q8U A;  1AUS L;  4YDD B;  2IVF B;  3UD3 P;  2HZV A;  3GYX B;  2XCA A;  2PGC A;  2QX0 A;  4K5S A;  1IKY B;  3Q23 A;  2JLG A;  2CAD A;  4H4M A;  1IR2 A;  1KQS R;  1C4C A;  2FJA B;  1SC4 B;  4CLY A;  1T95 A;  3FSI A;  3MMC B;  2CQ1 A;  2IJR A;  3BH6 B;  2RBF A;  2ZDO A;  2VC0 A;  3M6V A;  4P2M A;  3MR2 A;  4DV6 J;  2ASY A;  4DPX A;  4DL7 A;  3T1Y J;  2ZNY A;  4DSL A;  4NCA A;  5GVQ A;  4PQU B;  3RG6 A;  1Y5I B;  3M4X A;  3PX6 A;  1X4A A;  2YWW A;  4D8J A;  3CD7 A;  1J5O A;  2R8J A;  1XR5 A;  2VOD A;  1U2F A;  2W2M P;  2ZZT A;  3NS6 A;  3QPI A;  4FF1 A;  2DIT A;  4OYP A;  1FXL A;  3HHL B;  3JTO A;  1FKO B;  4HI1 A;  3KLE A;  2UVW A;  2D7S A;  3KFW X;  1S1X A;  4J9Q A;  5CXT A;  1SJ1 A;  1F6T A;  4ZCI A;  4QR1 A;  4JB8 B;  1J5O B;  1B64 A;  2ACM A;  2QTW A;  4J90 A;  2YX4 A;  2BRK A;  2XI2 A;  2LKZ A;  3JXO A;  4MJK A;  4DS4 A;  1TAQ A;  1XNQ F;  1RP5 A;  1VIS A;  4ZPB A;  2PMZ D;  2LA4 A;  4JV0 A;  3HI9 A;  3UNG C;  5KFU A;  2ADB A;  4PWD A;  4YUD A;  1PAU B;  2JFD A;  4DF8 A;  2UVV A;  3FDS A;  3KK2 A;  2VFV A;  4DSF A;  1I94 J;  4LFB F;  2WON A;  3GG1 A;  4M5H A;  2YPZ A;  1UJ4 A;  2QLJ B;  3MAH A;  4A8O A;  5HRO B;  1AB8 A;  2JC0 A;  2IAJ A;  1AW0 A;  4M5N A;  1RT2 B;  3CJ2 A;  2E5H A;  5ETM A;  4EU0 A;  2UXC J;  2BE2 B;  2CVI A;  1HR0 J;  1JLF A;  5IT9 Y;  3CCJ S;  1NK5 A;  1HW9 A;  4DU7 A;  1N6Q A;  4NA3 A;  2C2Z B;  2HHH J;  1P9Y A;  2HZA A;  4LF8 F;  4A8W A;  2WW4 A;  4K4S A;  2HND A;  3UNY A;  2C3M A;  1BHN A;  3AT1 B;  3I5C A;  2OML A;  1YTY A;  2ZZN A;  1FI4 A;  2OKQ A;  3OV7 A;  1I5O B;  1K1S A;  4Y2A A;  2C2D A;  4HT5 A;  3K5O A;  5K8O A;  2K3K A;  1NHV A;  1EQ0 A;  3FT7 A;  2FPH X;  4B3R J;  4ED3 A;  3F56 A;  1UJ5 A;  2JDJ A;  3MPD A;  3TVZ A;  4ELT A;  2V63 A;  5GMD A;  1NKC A;  1KQK A;  4C3M A;  1RAI B;  1HQE A;  3ISN C;  1H73 A;  1LXJ A;  2MLY A;  3V6K A;  1XMQ F;  3O3L A;  2RUS A;  3TZY A;  5I3U B;  4HV0 A;  2FC8 A;  1E6V B;  2AQ4 A;  4ECZ A;  3GJT B;  1UWA A;  4NZ6 A;  4OZ5 A;  3GMG A;  1WKK A;  5CZV A;  3TA1 A;  4U7C A;  1APS A;  3V6D B;  2W7P A;  1RTZ A;  1HBO A;  3DU6 A;  2AYE A;  2E5J A;  2IM0 A;  3TAM A;  2W8K A;  2YNH A;  3DRX A;  2QMU B;  2UXB F;  2CDR B;  1LWC B;  2MY7 A;  1F2H A;  2V68 A;  3NCR A;  3CB4 A;  3CTR A;  1NZA A;  2ZH5 A;  1Y7P A;  3EVW A;  1TVR B;  1HNI B;  3UR3 C;  4OX9 J;  2RRB A;  1S0V A;  2R9L A;  2R2U A;  1ELO A;  1F0X A;  1VQ8 S;  2K3I A;  3DLG B;  3SFU A;  4Y00 A;  1N5Q A;  4OV1 A;  3HSZ A;  3BO4 A;  5FLX U;  4TU9 A;  1MWY A;  2MZS A;  2PA8 D;  3PFO A;  4NLX A;  4EGL A;  2VOP A;  3IG1 A;  2NXU A;  1PG5 B;  4RZR A;  4FKY A;  1X5O A;  4RW4 B;  2L9D A;  3RAX A;  2RSQ A;  3C8Y A;  3PJ9 A;  3AOA A;  4DUZ J;  3JS9 A;  5GME A;  1RJJ A;  2C3Y A;  1N6Q B;  3D0I E;  1JXV A;  5DQH A;  4OLO A;  2FJD B;  3M32 B;  4DV4 J;  1IKX A;  5K5M A;  4ZVS B;  1RIS A;  1UEV A;  2XHC A;  1RT2 A;  2E1R A;  2C3P A;  2RNE A;  2DNM A;  3UW1 A;  4UQG A;  2ROP A;  2FZK B;  2HNZ B;  3J7Y U;  4NL5 A;  2GIR A;  1T05 A;  4RPF A;  1RAD B;  3OXF A;  2CWX A;  4USW A;  4FVC A;  4WK1 A;  2XYP B;  2Y1R I;  4UT4 A;  1WC0 A;  3EZU A;  3BJY A;  3PX0 A;  2AGP A;  3SQG A;  2LXF A;  2W2Q P;  3FBF A;  4C3K A;  4DR4 F;  3GIL A;  2CAJ A;  4FN5 A;  2O3D A;  2C2K B;  3D68 A;  4NLS A;  4M5D A;  4CLF A;  5IV3 A;  2R8I A;  1SKS A;  1CJT A;  2XTJ P;  3FKB A;  1JXL A;  2G2Z A;  3VAK A;  4NRT A;  4DV0 F;  2YTC A;  2ZHB A;  2FDN A;  3SIP B;  3CJT A;  1IKV B;  2GGP A;  1FKO A;  4ALZ A;  3LOU A;  4ILR A;  4RUA A;  3KLE B;  1X9S A;  3AOD A;  2AT1 B;  1Q8B A;  1WOS A;  2VV5 A;  2U1A A;  3MMB A;  1VQ7 S;  2KRR A;  2LCW A;  2PII A;  2X3G A;  2ZC3 A;  3R5G A;  4EI2 A;  3H5X A;  1S9F A;  1Z2Z A;  1G3O A;  5GAG I;  1HAR A;  2BBE A;  2KJV A;  4F4Z A;  4PRF A;  3M2R B;  1HL6 A;  1J5E F;  4ECS A;  2AHO B;  3ZTR A;  4O4R A;  2GVZ B;  2MQP A;  3VAH A;  3NO7 A;  4ZPT R;  4B9M A;  3I87 A;  4JBC A;  3EIC A;  1RT1 B;  1JNR B;  2EG2 A;  4RBU A;  3J81 j;  4J9P A;  3MPY A;  5C2G A;  1J27 A;  2HQF A;  4OHX A;  2QV6 A;  2XEX A;  3N6M A;  3SCL E;  5H9F J;  4R5P B;  3ITH B;  4KGX B;  1RAO A;  4M95 A;  1S6U A;  3FZB A;  3VGU A;  3UR0 A;  4CLP A;  4ZVP B;  1FVS A;  3V6H A;  5HJX A;  4Y2K A;  2H4W B;  2VQF F;  4IDK A;  3NWR A;  3QNW B;  3EGZ A;  4YEA A;  1VQ5 S;  1TKX A;  1TKX B;  2HW3 A;  3ENQ A;  3V6J A;  3PHE A;  3NMA A;  1VFJ A;  3TX0 A;  1HFE L;  3S6E A;  4ATN A;  3G82 B;  2ALY B;  5C24 B;  3RBZ A;  1ZZF A;  1HHQ A;  4NLW A;  1SIW A;  4ZMM A;  2A18 A;  1SJF A;  3BN4 A;  2D9P A;  3TJ8 A;  4DR4 J;  4O23 A;  2Y3Y A;  1GT8 A;  2JL9 A;  1KHW A;  5ETT A;  2NLW A;  4F25 A;  2RDI A;  2CJX B;  3G86 A;  1R8P A;  3QGP A;  4NLQ A;  3TOQ A;  3LA0 A;  3QT7 A;  5CD4 H;  5BR8 J;  4GMK A;  3I31 A;  4OQJ A;  5CCL A;  4J9L A;  3W3S A;  1QM9 A;  2RU3 A;  5B0A A;  2RVJ A;  2DHH A;  2QYC A;  2LQ9 A;  1I3O B;  2JEJ A;  3N0V A;  2VQE J;  3CSK A;  2VFR A;  2VQE F;  4JV5 J;  3KDN A;  1MW7 A;  4QIV A;  1HMV A;  2FVQ A;  3DOM A;  1RHM B;  2FC9 A;  1XMQ J;  5GAD I;  4IFV B;  5C25 B;  2J6S A;  1M1K T;  3F73 A;  1T02 A;  1SL0 A;  2BAN B;  4L3N A;  3IMQ J;  3K89 A;  2VBZ A;  3R5D A;  2CG8 A;  1C1B A;  5DZ6 A;  3PVX A;  4KGZ B;  2OGU A;  5DG8 A;  5LSO A;  1FWK A;  2XI3 A;  2EFQ A;  2ZD1 B;  3NY0 A;  2MB0 B;  1NO8 A;  4CO1 A;  4IG3 B;  2LP4 A;  4H4K C;  4USV A;  1CQN A;  4B3O A;  3DU5 A;  1X9W A;  1RWP B;  3B6B A;  1VRT A;  1WEY A;  1CJK A;  1MRO A;  1U7L A;  1H7X A;  2WB4 A;  3OFF A;  4OZ2 A;  4ZVH A;  5HVG A;  1N48 A;  1A7G E;  1RT6 A;  2FD2 A;  3GLJ A;  5EX0 A;  2DRD A;  4AXJ A;  4ERD A;  4EK2 A;  2KT5 A;  1NCL A;  4C97 A;  2AEJ A;  3JTP A;  4LF1 A;  1MNE A;  4F0M A;  3Q0A A;  4A8Y A;  3KJN B;  3PCO B;  3MM6 B;  3MM8 A;  2R8K A;  3BGL A;  1AA1 B;  2WVF A;  2XMM A;  2NSB A;  3C16 A;  4DPO A;  1Q7L B;  3FNN A;  4EMD A;  1YRT A;  4LRE A;  3OVA A;  3M9N B;  5CYQ A;  3LH2 S;  2OO4 A;  1G7C B;  1HIY A;  1YVF A;  2H54 B;  3CE8 A;  4ZCM A;  3ZO7 A;  2DEJ A;  3WZ0 A;  3HD1 A;  4RW4 A;  2O67 A;  5B0D A;  1XTZ A;  3QJJ A;  4HKQ A;  4LBP A;  1OIA A;  1QAY A;  1OHN A;  4LF4 F;  4R8U A;  3OL8 A;  4LFC J;  2KB2 A;  3CCL S;  2J6U A;  4JV5 F;  2LU2 A;  5H9F K;  5BJR A;  4LFA J;  5KFL A;  1N5Y A;  1QVF R;  1EKR A;  1VQL S;  3LJP A;  4ZVR B;  1B70 B;  4LRV A;  3V81 B;  1JQG A;  2B0G A;  1FKP A;  1FRX A;  1TKZ A;  3ETO A;  2FIU A;  2MPU A;  2RHS B;  4FNH A;  4ZA1 A;  3H2L A;  4X4N A;  4X4V A;  3G6X A;  4UW2 A;  3UFC X;  3UWT A;  3QZ8 A;  3SCI E;  3BGU A;  8RUC A;  4DR2 F;  3CME S;  1X5P A;  1N52 B;  2ZD1 A;  2B8Q A;  2I5J B;  3NXZ A;  1FX2 A;  4J5O A;  2FLL A;  5A8K A;  2HHS A;  2X1B A;  5D4N A;  4CDI A;  3Q8Q B;  1JNZ B;  1HBO B;  1MU2 A;  2RQM A;  1SCJ B;  2MKH A;  2D3O R;  4H4K A;  1OO0 B;  4WJB A;  5E5N A;  2FHO B;  4QW8 A;  4MKY A;  3GII A;  4ZS6 A;  2R42 A;  4RO0 A;  3CCE S;  1R6V A;  1GXT A;  2QL5 B;  1NND A;  2WOM B;  3HHE A;  2KZM A;  1C1C B;  1ZM9 A;  1RT5 A;  1WF0 A;  4DOZ A;  2LMI A;  3PRV A;  2ATC B;  4P73 A;  3NL0 A;  4GKJ F;  5L9N A;  1TTH B;  5ETK A;  1W2B R;  4B9V A;  3POT A;  3EXY A;  1S49 A;  1SVD A;  3ZZU A;  4A8Q A;  4I7F A;  1GMW A;  1RWU A;  1VHF A;  2IM3 A;  2IJF A;  1Q82 T;  1WEX A;  2CUY A;  4CH1 A;  2GX8 A;  3ETM A;  5RUB A;  4AUK A;  4F8R A;  3LP2 A;  3IR6 B;  4OZL A;  2Q66 A;  2OH2 A;  4JI2 F;  3K7R A;  3AQO A;  2YWH A;  3QWU A;  3KLI B;  2H3A A;  3G8T A;  4DXL A;  3C16 B;  5L1J A;  1CSJ A;  2P5V A;  1NH8 A;  4RWX A;  3JAM Y;  2KZZ A;  1YJR A;  1AZS A;  1UPM B;  2AJ2 A;  4C8O A;  3MUR P;  4ZVU B;  4Q8F A;  3QLH A;  2JEI A;  1G6B A;  1EP4 A;  4LSN B;  4EBC A;  1J5E J;  2XLK A;  3R7B B;  3D0H E;  4OJ3 A;  5E0O A;  1RAA B;  5EDW A;  1YX2 A;  1VQM S;  4CM0 A;  2BR0 A;  3C15 B;  1YJV A;  2A6M A;  4ANC A;  2XZT B;  5B08 A;  4RU9 A;  3HXM A;  2ZJP Q;  3KWM A;  4F2R A;  1KC8 T;  2BW7 A;  2ZOF A;  1SXL A;  2CZ4 A;  3DOL A;  4OYZ A;  2J8A A;  2WHO A;  3AHP A;  4Y3C A;  2ASJ A;  4C0H A;  2B4U A;  3T6J A;  2KKE A;  2YXL A;  5JVG Q;  3ILL A;  2ATL A;  1VQ4 S;  3D0G E;  1S1X B;  1FFG B;  3AJD A;  4I2Q B;  1PC5 A;  2CNO B;  4ETX A;  3MR6 A;  2MZT A;  3OTE A;  2H1O E;  4BHQ A;  1FNX H;  4DQP A;  4K50 A;  3MMA A;  5D3G B;  1BQM B;  1WTF A;  4F26 A;  3FCH A;  1MMD A;  1YRX A;  3CIZ A;  1RAB B;  2R7W A;  4G65 A;  1L3V A;  2GQQ A;  4ECV A;  4DSK A;  4FF4 A;  1N88 A;  4HHH A;  4M63 A;  1XR6 A;  3KDO A;  3W2V B;  2VC1 A;  4OYI A;  5KFN A;  2F4F A;  5KFP A;  2O5D A;  2VON A;  3IRX A;  1S1U B;  1CBK A;  2CPX A;  2MJN A;  2OAU A;  2V50 A;  1D3W A;  4LSN A;  1EP4 B;  3B4D A;  2FVS A;  2W8L A;  5GAH I;  1L5U A;  2QA4 G;  2KL8 A;  4WTO B;  2HGN A;  4LFA F;  2DH7 A;  4H4O A;  4KGV B;  3K5N A;  2JJ4 D;  2CQ4 A;  2RT3 A;  2VFT A;  3H5S A;  3R9L A;  4WKY A;  2W4C A;  3H59 A;  5JJB A;  2V4Q A;  2WZ1 A;  2B8P A;  1KDN A;  4A47 A;  2MKI A;  1TK5 A;  4WIQ A;  1BQN B;  1SJR A;  4J7C A;  4C48 A;  4NCG A;  2M88 A;  2B7B B;  3IA0 A;  4RX6 A;  5DDR C;  1E6Y A;  1VYA A;  2MGZ B;  1D9F A;  4IR1 A;  2LEB A;  5L38 A;  3WHI A;  3BO3 A;  2J8S A;  4QWD A;  8AT1 B;  2ZVS A;  3B8H A;  2BVZ A;  2K29 A;  5HLF B;  4JV1 A;  2UXD J;  3ITH A;  2C2M B;  3M6X A;  3M1V A;  3CCR S;  1AT1 B;  3MCS A;  3L7O A;  3MTK A;  1V3S A;  3Q22 A;  4RW7 A;  3UN5 A;  3OVS A;  3LWM A;  3NCQ A;  1LW0 B;  3E3X A;  5KAK A;  3D6H B;  4LRB A;  3TI0 A;  4EZ9 A;  2P8I A;  2KXF A;  3MM5 B;  1GX6 A;  4N8N A;  2K1R B;  4OZN A;  3OLB A;  4C11 A;  1H38 A;  4OZ3 A;  3P6Y C;  3NS7 B;  2XYH B;  4KV8 A;  3A3N B;  3CO9 A;  4C8N A;  2FVP A;  2KTQ A;  2WCX A;  2BJ8 A;  2HK3 A;  3L9Z A;  2NS1 B;  4ZIW A;  2LEA A;  3G96 A;  4K0K F;  3MMB B;  4TQS A;  3BKF A;  5BYQ A;  2EC2 A;  2J9C A;  1WTB A;  2DB1 A;  2I0X A;  4TLQ A;  3M9O B;  2GJF A;  4B3S F;  4IUF A;  1RT4 B;  2PO4 A;  3EZO A;  1YRU A;  3BGO P;  5KG7 A;  4ZLL A;  3OSN A;  4HTJ A;  2Q6C A;  4OI2 A;  1JLQ A;  2XHW A;  2D69 A;  4P2X A;  4YHH J;  3W62 A;  1F5A A;  4M5D B;  3NWG A;  2A10 A;  1EAY C;  3NAI A;  2KYX A;  2BAC A;  3LP1 A;  4E8U A;  4X62 J;  4L73 A;  3DFE A;  3MUV P;  3G5O A;  4X62 F;  4KH0 B;  2HQG A;  2DNH A;  1GEH A;  5G4D A;  2BQ3 A;  3IRW P;  3KOA A;  3J7Z T;  4KC5 A;  2FLN A;  4C4W A;  3U02 A;  2GC8 A;  4OYA A;  1EA4 A;  3HHL D;  4DQR A;  1U1L A;  2AX1 A;  1SBR A;  1FDB A;  2CJA A;  2X51 A;  3T9N A;  4DR3 F;  3HO1 A;  3UPF A;  2HND B;  1RWX B;  3SBM A;  2L3M A;  3M32 A;  1NJZ A;  5D8H B;  5A8W A;  4YY3 F;  1JLE A;  1DQ9 A;  2UVU A;  3DGP B;  1N5S A;  2J7K A;  2XWY A;  5DO2 A;  1AFI A;  3V5R A;  4N47 A;  4A4J A;  1UJ6 A;  4I6W A;  2RIJ A;  2DXD A;  3MM6 A;  2A2C A;  2YQ1 A;  5DM6 Q;  3BQ1 A;  4WXO A;  2Z30 B;  5F8L A;  3SCJ E;  1Q81 T;  1MNT A;  2BM1 A;  3TX8 A;  1OJ4 A;  5K8M A;  1DZ5 A;  4AL5 A;  3THV A;  4E2F B;  1RE1 B;  1ZPV A;  2E7X A;  4GVB A;  4B3O B;  4IG3 A;  2E9Z A;  3KK1 A;  4RLE A;  2AJ0 A;  5I3Q A;  2F1F A;  2LLZ A;  2DY9 A;  2QRR A;  2ZKT A;  3TAM B;  2DGQ A;  3Q8P B;  1NME B;  4AAI A;  2ILY A;  3NGR A;  4I4B A;  4MFB A;  1U26 A;  2N4D A;  4JI7 J;  1RBL A;  3ENW A;  3HHD A;  3MEK A;  1BWE A;  2FJX A;  4USH A;  2KDO A;  1PBU A;  2EBE A;  3CWJ A;  3I0S A;  1RBO B;  4K4T A;  3D28 A;  2Y1J A;  1SKW A;  2AYB A;  2U2F A;  1RU1 A;  1HNV A;  3W7B A;  3CMA S;  4YR2 A;  1UW9 A;  2KN4 A;  1P94 A;  3NNA A;  1KFD A;  2IPO B;  3BQ2 A;  4TLR A;  2R7U A;  4KY3 A;  1GTH A;  3W1Y C;  1Q86 T;  1Q16 A;  2BXJ A;  1SKU B;  2WK4 A;  2M4M A;  4UUW A;  3J7Y I;  4U96 A;  1CS4 B;  2GVD B;  2XSJ A;  4YME A;  3A8K A;  2OP5 A;  3JSM B;  2HBY B;  1T8E A;  2HYI B;  2GIQ A;  2MQN A;  2B9E A;  2W7A A;  3IBW A;  4F0K A;  2RRN A;  1X31 C;  3M8P B;  4DV0 J;  2W7O A;  3NBP A;  3T1H F;  3O1L A;  3MI7 X;  1QDU B;  3MEC A;  4JI0 F;  1SUQ B;  3ZNU A;  2NXJ A;  3ISZ A;  1T03 B;  3H42 A;  1WC5 A;  1WI6 A;  2W4P A;  3C6T A;  1C4A A;  1WG4 A;  5FD1 A;  3EMT A;  2H5J B;  3QZ7 A;  2IYG A;  2BYC A;  4AL6 A;  1JLF B;  1N36 J;  2SXL A;  2AYG A;  3DLE B;  3M8P A;  3VAG A;  3A8I A;  1U49 A;  4DZ6 A;  2F7V A;  1RAG B;  1BDV A;  5HRO A;  4K4V A;  1F60 B;  4HT7 A;  3FJ2 A;  1SIZ A;  2OFH X;  4OX8 A;  5A76 A;  1PAR A;  1NJX A;  2QC3 A;  4X4U A;  4DMZ A;  3IWX A;  3CDA A;  4I69 A;  5B09 A;  4J91 A;  2BRL A;  2ZH2 A;  5J2P A;  3TAN A;  1S1U A;  3IRX B;  5E3R A;  1S77 D;  4RU2 A;  4QIG A;  1KKH A;  5F8G A;  4EBD A;  2BJ1 A;  4JI6 F;  4ED1 A;  1WHW A;  2V34 A;  4Y0F A;  1C2P A;  4LVN P;  4JI2 J;  2Y8W A;  3BM7 A;  5KFS A;  2BOP A;  1F5B A;  1WD6 A;  2J0W A;  6FD1 A;  4BLG A;  5D3G A;  3TEH B;  2BA3 A;  1KOH A;  1WJ9 A;  1H72 C;  4F67 A;  1VC0 A;  2HHP A;  2HQD A;  4MJW A;  3D66 A;  4LF7 F;  2IM1 A;  5KG6 A;  5KFH A;  3CW2 C;  5G0R A;  1H2U X;  3RU0 A;  3QIP B;  1RTI A;  2UUB F;  2VPY B;  3C19 A;  3HHK A;  4IYQ A;  4PWU A;  4EUV A;  3DYA B;  2I8E A;  4Y6I A;  2ZJR Q;  1AFJ A;  1S48 A;  4HAC A;  4LR8 A;  3DRR B;  5KT7 A;  4K4Z A;  4DHV A;  2CZ9 A;  2X1G A;  3M30 B;  2DNQ A;  2HQI A;  3HVT A;  4G1I A;  3SSS A;  5HQM A;  1U6F A;  3Q8V A;  4KPY A;  1UWB B;  2V2Q A;  2KXN B;  4PYA A;  5CHC B;  4Q44 A;  4TYB A;  2DGW A;  2D3Z A;  1OS5 A;  1XEZ A;  3UD4 P;  2W24 A;  1X7V A;  2ZFH A;  1HHT P;  2PI4 A;  3C6U A;  3F44 A;  5D0R A;  2NR0 A;  2DGT A;  1P1T A;  1IKX B;  2BM0 A;  2GO8 A;  2YPY A;  4WWS A;  1TKT B;  2VDH A;  2XMV A;  4MYT A;  3CJ3 A;  2DO4 A;  3AOB A;  5LMU F;  1IJF B;  2D1C A;  2ROE A;  2CJQ A;  5GAD U;  4N76 A;  2AIR B;  1D8Y A;  1VRU B;  5HMY A;  4BBY A;  2HGM A;  1TUG B;  3N5F A;  4W98 A;  4DV1 J;  1WAC A;  2O01 C;  3R5J B;  4JI0 J;  3KYL A;  1QD1 A;  1T94 A;  2RE1 A;  2HVD A;  1OSC A;  4XDD A;  4F4W A;  3ULH A;  2R4F A;  1ZM3 A;  5FDL A;  5E41 A;  4ETZ A;  4LF4 J;  4PUO B;  3OR2 A;  3DGV A;  3QT6 A;  4WFZ A;  2OPQ A;  3CT9 A;  2F4V F;  2RAQ A;  3PHT A;  3I0S B;  3T9Z A;  4CO4 A;  4CYU A;  3GV8 B;  3MWB A;  3BH7 B;  1Q0N A;  1YZ7 A;  2FTR A;  2OPR B;  2XMT A;  3ET6 B;  3N79 A;  4DPY A;  4X4R A;  4V19 X;  5D4L A;  4HTI A;  4MFB B;  3GZ7 A;  1U4B A;  5KT5 A;  3KLH B;  4QOT A;  1NH7 A;  2AJQ A;  4URS A;  4NEY A;  3GFH A;  1HQU B;  4DV5 J;  2E9T A; 
#chains in the Genus database with same CATH homology
 1ARQ A;  2BNZ A;  2BJ9 A;  1IRQ A;  2HZV A;  2WVE A;  2CAX A;  2K29 A;  2KEL A;  1BDV A;  2Y3Y A;  3GXQ A;  1B28 A;  1X93 A;  3VEB A;  2NZC A;  2CAD A;  3BKT A;  2K1O A;  3QSI A;  1PAR A;  1Q5Y A;  2JXG A;  1P94 A;  1BDT A;  2PC6 A;  1QTG A;  3FT7 A;  1MYK A;  1MNT A;  1B01 A;  2K5J A;  2RBF A;  2BJ3 A;  2JXH A;  1NLA A;  1Q5V A;  2GPE A;  2K9I A;  3QOQ A;  2BSQ E;  1ARR A;  2CAJ A;  2WVD A;  2K6L A;  4FXE A;  2WVB A;  2BJ1 A;  2JXI A;  4ME7 E;  1EA4 A;  2BJ7 A;  2CPG A;  2BNW A;  3PHT A;  2WVF A;  4HV0 A;  2CA9 A;  4D8J A;  2BJ8 A;  3FMT A;  3BKU A;  2F1F A;  3H87 C;  3VEA A;  3BKF A;  2BA3 A;  2FGC A;  2H1O E;  1BAZ A;  2WVC A;  2HZA A;  1U9P A;  3VW4 A;  1MYL A;  3OD2 A;  2AY0 A;  3LGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...