2CA9A

Apo-nikr from helicobacter pylori in closed trans-conformation
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
139
structure length
132
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 33
structure length 132
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2ca9A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2ca9A02
4HV0A 2AY0A 2K5JA 1ARQA 1B28A 1MYLA 1NLAA 3BKFA 3QSIA 2BJ1A 2WVDA 1BDVA 2F1FA 1Q5YA 3FMTA 3H87C 2WVBA 2JXGA 1MYKA 4FXEA 1EA4A 2WVEA 1BDTA 2CAXA 2NZCA 2WVFA 2BA3A 2K6LA 3PHTA 1B01A 2BJ7A 2H1OE 2CAJA 2K9IA 2RBFA 2BJ3A 3BKTA 2K29A 3QOQA 1P94A 2JXIA 3LGHA 2HZVA 1U9PA 3FT7A 3VW4A 1PARA 2BSQE 3VEAA 2Y3YA 3OD2A 2FGCA 1Q5VA 2GPEA 1X93A 2BNWA 2CADA 1BAZA 2K1OA 3BKUA 2WVCA 3VEBA 2CPGA 2JXHA 2CA9A 1QTGA 3GXQA 2HZAA 1MNTA 2BJ8A 2KELA 4D8JA 2BNZA 2PC6A 1ARRA 2BJ9A 1IRQA 4ME7E
chains in the Genus database with same CATH superfamily
5BYQA 4U6PA 2CUYA 1KD1T 1TUWA 2DYAA 3C14B 2XC9A 2ZH3A 1LWCB 1O5JA 1RU2A 3EPIA 3TANA 1RTHA 2VQEJ 2VG7A 3J7YI 1HR0F 2EVZA 4C11A 2P9EA 1YGYA 3RUBL 1T03A 4DV3F 3QAUA 1RK8A 1WEZA 4NLGA 4KKOA 3BSCA 2W9BA 4ILLA 1RT3A 2F7VA 2CDRB 3MEEA 3J7Z5 2KH9A 1G4CA 3NGSA 2CZ4A 1B0VA 1HQUA 4DL4A 2RH3A 3W66A 2FUG9 1SQEA 4ZVQB 3C16B 3EJMA 4DSJA 4QWAA 4RWWA 1HW8A 2RF2B 3FCHA 1X0FA 2IMWP 1UFWA 4JYAF 4KO0A 4JI8F 2KOEA 3G9CA 3QIDA 1OY8A 5F8GA 5DG7A 2UUBF 1T11A 2UVWA 5KG0A 1X4EA 2E5HA 2R7VA 3FCVA 4F0MA 2KT3A 3G2XA 2C2OB 3HHLD 4ZVFA 2B51A 2CAXA 1PJ7A 1N6QB 1B64A 2DGTA 2DK2A 4DXLA 1FK9B 2RS2A 5HMZA 1R8PA 2XMUA 1S97A 2I0XA 4RU2A 1L3TA 2DKOB 4DL6A 1YKWA 4ZVGA 4BC7A 5EWGA 1E6VB 3C8YA 2C42A 2OFHX 1B0PA 3O6QA 2VBXA 3IN5A 3CXCR 3BSNA 1DZ5A 4FPRA 4LF4F 3NRBA 1N5SA 1UKUA 1WKKA 2D41A 2NUHA 5DRKA 5L1JA 4NYPA 4OL8A 1K0TA 1NK8A 2HQCA 5U47A 1TKTA 2LDYA 5AXLA 2YNIB 3KLFA 1CEZA 4DPTA 3IRWP 2RQMA 2GMHA 2WK4A 4DV2F 1FNOA 4OZ5A 1HQEB 4EUVA 2R3VA 1JB0C 2IA0A 3QGIA 5HSPA 3K5NA 1CS4B 1VCTA 3MM7B 1O8BA 4M95A 1FRXA 1RADB 3CJ3A 3HKZD 3D7SB 2UXBF 1S6PA 1NH8A 1V5IB 4YR0A 4KH0B 4Y34A 3FZ2A 2FPHX 3GG0A 2OSRA 8RUCA 1O51A 3I32A 4OJHA 3K5PA 2NPFA 1YJWS 2PEBA 2ILYA 1S7HA 3VAHA 1YVFA 4X62J 5HMYA 3HXMA 3Q23A 1CJVB 4EO8A 1B70B 2EEYA 3BH6B 4KH1B 3N28A 4BHQA 1NK9A 4OHYA 4OZ3A 4ED0A 4Q7AA 4K4SA 4IO1A 2JVRA 2XHWA 3VV2B 1NJWA 5KFBA 4B9UA 1RLDA 3C6UA 4I6AA 4LVNP 1KRPA 4JI7J 4NLYA 3MM5A 4M5GA 2FYXA 4ZITA 2B9WA 2BJEA 3OUYA 3Q22A 3HO1A 3GYGA 4I7FB 1XERA 2E44A 4DF4A 2JL9A 2RDIA 1ZA1B 2HS0A 1AUDA 1S76D 1UMJA 3JTOA 1DFDA 1CJKB 2VPYB 1WKJA 3MPVA 4NYZA 4WE1A 1S9EB 4CLTA 5I4MA 1K73T 3GU0A 4O3RA 4ZVRB 3D68A 3PW2A 3KLEB 3S8SA 1BAZA 3I56S 3RAXA 2FLNA 4GKKJ 2KJWA 3W8PA 4FYXB 3BN7A 1FDAA 4C3KA 4CI0B 3ZXWA 1WDTA 3NAHA 1TR0A 2VBWA 3ETMA 1RT4A 3MECA 4QR2A 4RNFA 2XY7A 1F2GA 2XSJB 2GIRA 2ZD1B 4YB7A 2FC8A 2MHEA 1HBOB 2Y1RI 3OR2A 4G3IA 5T7LA 4MKYA 2R8IA 2X1BA 4FF4A 2YPZA 2QA4G 2V68A 2AZ1A 4A47A 2YQ1A 1YJUA 3LPYA 1TU0B 1YK9A 3PDNA 1EJ7L 1U25A 2M2BA 1ZAVA 2AJ2A 2ZVSA 3HJVA 2GJ2A 2H51B 3BM7A 3FSXA 1U26A 3NEKA 5HLFB 4B3MF 2YKMA 4JI3F 2IRUA 4ZN3A 4ZMMA 4F02A 3NKYA 1XJWB 5JUMA 2DGQA 1RTIB 1FJCA 2CJYB 1URRA 4O0IA 4B3MJ 1CBKA 2MQQA 3IBFB 2FY8A 4HLBA 4IH6A 1SC4B 4KHPJ 3MPUB 1ITPA 4DPXA 1I5OB 1TKZA 1TAUA 1KP6A 3L09A 2JHEA 3DHWC 4OYMA 2OKQA 2NLWA 1U24A 3IGNA 4LRBA 3B82A 2DITA 1UW4A 5BXIA 5C2GA 4DPOA 1VBYA 1N0VC 3PVXA 2AY0A 1NZAA 5AJ3J 2IC3B 1X60A 2CPEA 3KLIB 4OX9F 1A9NB 2EFNA 2UUTA 3W2WB 5F8LA 1X5TA 3D66A 5GAGU 3E01B 4U95A 3H5UA 2OTLS 3PNIA 2K9IA 1GX5A 3KJNB 2MZJA 6FDRA 2K29A 3DLJA 3HX9A 4WYLA 4YDDB 1IBLJ 2A0FB 2E5GA 3QMQA 2DNLA 1P9YA 2B4OA 4UT4A 2Y3YA 2A6MA 2FGCA 2GS8A 3D3BJ 2HPUA 2XMTA 4AD6A 1L3UA 1S9GB 1V5VA 1NK7A 4K50A 4QYZJ 4NCGB 4DR3J 2ADLA 3VZIA 1YTYA 4F2RA 2AJQA 1NRKA 4OI1A 3R6GB 4WWSA 4FN5A 2X1AA 2FJEB 4WP3A 2GV1A 1U1KA 1FTRA 4AE5A 1S9FA 3LWMA 3PZPA 3RZAA 4ED6A 2YQ3A 4QIVA 4G1QA 5KFFA 1S1XA 1IXKA 1MMDA 5D0HA 3J7A1 3BYPA 4MH8A 3BJYA 2F8HA 3T5HA 1S1UA 1C1BA 3CJTA 4ZLNA 3M2RB 2MKIA 2G2YA 7FDRA 1VC0A 3TNVA 5KFJA 1J2VA 2HWHA 2LMIA 4CLZA 2WB1D 4KIAA 2BYCA 3G82A 1NPRA 2EXUA 2GZOA 1WHWA 3Q8VA 1M0SA 3ZNUA 4PRFA 2LCWA 1U1RA 2CA9A 2G2ZA 1LKZA 4ES3A 3TZXA 4N5SA 3FSIA 3VAKA 1TL3A 2GC8A 3MR7A 3AH6A 4DV6J 4ECTA 2HHSA 1RCOB 1UVKA 2I1RA 3MF5A 3SDEB 3V4MA 3MUVP 5C24A 3T5KA 2XHCA 1RAAB 2KFYA 1CVJA 4RUHA 5F0UA 4LR8A 1MG7A 4I1TA 4KGXB 5HVFA 1E6YA 3CCMS 2KRBA 4R25A 1UEVA 3BGLA 3GPAA 3M2VB 4O3QA 1RTHB 2XMWA 1MNEA 1T03B 3GFZA 2G1DA 4WFYA 5FDLB 2XYPB 3UDVA 3VR1A 4X65F 2VJVA 1KC8T 1AZSB 1HI1A 4LRCA 4NRUA 1DQ8A 1KBRA 3I96A 4C6AA 2Z56B 3TI0A 3KK2B 2AYEA 4DQPA 4I69A 4NLSA 3C14A 1Q95G 2QSFA 5KFIA 3OD2A 5KOXA 4H4KA 5T14A 4CH7A 2J5AA 3EMTA 4LFAJ 5AE3A 3C6TB 1ZS6A 4JV5J 2H5IB 1NK0A 4J9VA 2ZNZA 2MQPA 2PE8A 2MKHA 1BWVA 1RT6B 2UV8A 1SJ3P 3H98A 5D77A 1SUQB 4OYZA 3PW5A 3MR5A 1XR5A 3DFEA 4FVCA 1D3WA 4QOTA 2VA3A 1RWNB 2MKJA 5KG3A 3UNYA 3LW5C 1EETB 1ZM9A 2HVZA 4JI2F 1RBAA 5B0BA 3BQ2A 1Y7PA 4YOEA 1P9QC 2W2NP 1HARA 2D74B 4IFVB 3MAAB 1VIXA 2XGPA 3U27A 1AYEA 2DJWA 3A4TA 4WFAQ 4RU9A 3A8IA 2I2YA 4U96A 1U1LA 2GQCA 2D1CA 3CB4A 3FNNA 1ROFA 2HQGA 4CO5A 2CJKA 3PO4A 1Q0NA 1VRUA 3TX8A 3KKFA 3PX4A 1CG2A 1NZ8A 3CCUS 1EP4A 2CQ3A 2G2OA 3U1LA 2AV5A 5LMUF 2GO8A 4CH0S 4U7CA 2V4RA 3L7PA 5LXRA 2CQCA 5K14A 3O5TB 3KLVA 2P6TA 4OIXA 2DNYA 2ASLA 4C8LA 2WSFC 3CC7S 1FE4A 1UZDA 2FJBB 5EWFA 4A8WA 4ED8A 2J76E 1XC9A 5CYQB 5KFKA 4TXSA 5ETMA 4PXBA 3CT9A 3HVRA 2JFKA 3OTBA 3BYRA 1GEHA 1H73A 1YI2S 1NBEB 1SH3A 4LFCF 3LGMA 3R5CA 4ZK7M 4Q0BA 3J7YU 1VRTB 1KHVA 2MQNA 4WP8A 3S7RA 4R5PB 2JEFA 4LFBF 3NGRA 3OTDA 2CFXA 4DZDA 1Q81T 4L75A 1U0HA 4LFCJ 3OR1A 1YBAA 2ZM6J 5SZTA 4EYHB 5K8OA 1RWWB 3PYGA 2HQIA 4PWWA 5AXKA 1DHMA 3MEDB 4K5RA 2XM3A 2YNHB 3TJ8A 5IWAF 2CPGA 1FKPA 2YWHA 2GHVC 3OTOF 1H2UX 2BNZA 2BV3A 2NXEA 3A8EA 2XZWA 3KJQB 1I94J 1FRJA 4CM0A 2IJNA 3OVSA 3ADAC 5F8IA 4F4WA 3T1HJ 1S1WB 4JP8A 1IBKF 3MXHP 3RBEA 2MKYA 3BDPA 2G0IA 4QPXA 1UFKA 2GX8A 3F41A 4H54A 4PPDA 3RU0A 3W65A 4BC9A 4F3OA 2PFFB 5F8MA 2K6LA 5ETPA 5C42A 2F63A 2GJIA 1JKHA 1BE4A 4TVAB 3S6EA 1U2RA 3TUJC 4KHPF 4UOFA 1K1QA 2WBMA 3FBFA 2MPUA 4F7VA 1IM4A 3M4XA 1VGYA 4RBVA 1JWWA 1T9UA 3OUYB 5KFGA 5IZHA 1CC8A 1RT1B 4WFZA 2CPDA 3T1YF 3P5BP 1VC6A 4XDCA 3LWLA 2HRTA 1J5OA 2COLA 5KT6A 3OHAA 1S1WA 3KG1A 3M1VB 4LR9A 3V6HA 3MAHA 2ZD1A 4JBCA 1KDNA 2CJAA 4ZP9A 1FHTA 1UWAA 3AFGA 3MM6A 1S0VA 2GAHC 1RHJB 2FGOA 1NPPA 3FQKA 1GMVA 3G87A 3G6ES 3OL7A 3UCUP 1Z1ZA 1NDCA 1ACMB 3PHTA 1HNIB 2HMIB 2BJ3A 1OJ4A 4TYAA 1SB6A 2I38A 1D8ZA 2ABYA 3HHLA 3ZZUA 1M5VC 3I5AA 1KSPA 2R7SA 3TAQA 1T94A 2MZTA 2EBEA 5DETA 4DR3F 3AB4B 1VQPS 1A7GE 3QT5A 2CQHA 3ICLA 2F9JA 4NLQA 5MAOA 3JSMB 2MDAA 3GIIA 1Q8LA 1Q8BA 2JC0A 4A8KA 2J7KA 4P73A 3ISZA 5HLFA 5B0CA 5D3GA 3ISNC 3P6YC 5KFUA 1QDUB 2WHOA 1N88A 1JLAA 3H0PA 2QN6B 3F56A 3L7UA 4P6QA 4ZPDA 5A8KA 4LF5J 1BMQB 3FMTA 2E7VA 1WSRA 3E01A 1H98A 2LLZA 3CMAS 2ZKUA 5ETVA 1FKOA 3OQ2A 3OTEA 2YVSA 4QWEA 1QAXA 3RB3A 4JI4J 1K1SA 2JXIA 4YN3B 3MGJA 5KG2A 2BE2B 4RKUC 1SL2A 3P96A 1NHKL 2LDIA 1S6UA 3N6MA 1BQNA 3MCNA 4FF1A 1RT1A 1SBRA 7AT1B 1X4GA 4J9KA 5IT9U 4QWDA 4ES1A 4K4VA 2ZUAA 3WQPA 5HBMB 2C2DA 2HURA 1EAYC 4O0NA 1DTQA 3PY8A 4O23A 2MLXA 3ILJA 3OXGA 2E1MC 2O1PA 4WIIA 1U6BA 3BGUA 2MMYA 2BEFA 3GG1A 1RZMA 2Z0GA 3HULA 3MTJA 3K57A 1FRLA 3NNCA 2DXFA 2DY9A 1RAOA 2VPZB 2VB6A 4CO4A 2RNEA 4PXCA 5J2NA 1N5QA 1RWPB 1TK8A 1PCAA 3SI8A 2Q6CA 4IKAA 4KKOB 1IBCB 5KFQA 2WW8A 2KM8B 3KYLA 4AXIA 4P2MA 3R2DJ 3IR7A 2NR0A 2P9CA 3IXQA 3MMCA 4KRWA 1X5SA 3LTOA 3TZYA 3H90A 3ENWA 5IT9Y 4ECWA 4L3NA 2DGVA 1F3FA 3IC1A 1RHKB 1WF2A 1FX4A 1VRUB 2M9KA 2N82B 2VONA 1R6YA 1YJTA 4QCLA 1SPBP 5LL6d 1WC6A 2EI5A 4QU7A 2VHGA 2YKQA 1DY3A 1QAYA 4CWBA 3KK3A 1YRTA 8ATCB 1FA0A 5FLXY 1YG0A 4A4JA 2ZNYA 5CCLA 2DVIA 1S99A 2Z30B 4WJBA 3VGTA 1HW9A 3P49B 3TVZA 1SJRA 4IFYA 4J7CA 3SQGA 4I2QA 2KO1A 3KDNA 3G82B 1N5VA 2CNNB 2X7IA 3BKTA 3KHGA 1XEZA 4MKBA 4NYOA 1PG5B 1LWFB 3ZFVA 3AD7C 3GCXP 1N36J 4NLPA 1BQNB 2IAJB 1Q7LB 5J2QB 3E3XA 4P72A 3Q0AA 2N3LA 2J8SA 2WZ1A 3EVOA 2RRAA 1HFEL 2IM3A 3CEDA 3GCWP 1TV6B 4FNIA 5BR8J 4ANDA 2R2SA 3UO0A 4LMZA 3FC9A 3IWNC 2HWTA 4OZJA 1N4LA 2Y1LB 5HO4A 2C28A 1FXRA 3CWJA 1NK5A 2FJWA 3CD0A 3CJQA 3M8SA 1KVIA 2XB2D 1NJXA 2I5JA 2JEJA 5LT5A 4DFJA 5L46A 3MM7A 4ERDA 3IAM9 8AT1B 1ZM3A 5J2PB 2H4WB 3GYXB 1JLQB 1HPZB 3EXCX 4ILRA 4ZVHA 3AJ2A 4WPAA 4DSFA 3AT1B 3A12A 3MAAA 1QY7A 2D9PA 2DNOA 4HTIA 4KO0B 2FJAB 3W63A 2ROGA 4DV1F 4MKAA 1U1MA 1X9WA 2HHQA 1QVGR 4WFNQ 4KGZB 3U1MA 4E0DA 2BUNA 2CQPA 4PZVA 3PR4A 2UXCF 5FJ4A 3NGUA 3DLBA 1ZPWX 1HBUA 1TVRA 2AKWB 2OEKA 3CE8A 4NXNF 2EK1A 3UWTA 1HMVA 1VK8A 4F25A 2CPHA 1VMBA 2O66A 5CZXA 3UN5A 1FDDA 4Y2KA 3W9HA 1RWVB 2CZ9A 3GXQA 2W4CA 3IWXA 2HNZA 4MK7A 2AT1B 2W7AA 5CYMB 4C48A 2B7BB 3BSOA 4RW8A 2J0WA 2W2OP 4A8OA 3VAMA 1S72S 1NJZA 4RW6B 3ULHA 3NAIA 2RB7A 3N01A 5CD4H 5HL7Q 4ED2A 5EHHA 3A3PB 3PFOA 2JLFA 1V6HA 2ZOFA 2V4JA 2LU2A 1NKCA 4X2BA 2WVFA 4M8LA 3WDOA 1LW2B 4QBUA 3PYDA 4JI6J 1WKLA 5IQQA 4DN9A 5KFAA 3SBMA 1XNRJ 3D67A 4AL6A 2DNKA 2W01A 5EUHA 2KZZA 1H0HB 2IAJA 4P74A 3SDEA 1S79A 3CJKA 3VCDA 2KFZA 4JYAJ 4DL5A 3JB9k 2DD8S 4HHJA 1F1BB 1VQSA 5E3QA 3OSPA 3CCTA 1IR0A 4NX9A 3PX6A 2DH7A 1SKUB 4ZJLA 2ZE2A 4DOZA 4TU8A 2HZAA 2FJVA 2V9KA 2CQGA 2MLZA 5DM6Q 2CAJA 4KGMA 2M5YA 1UEKA 4KSEB 4LBIA 4QIEA 2HFZA 2HGNA 1S10A 5I3UB 1MW7A 3GZ7A 5IV3A 1HPZA 4Q8EA 2C2MB 1H2TZ 5HBMA 4DR7F 4KY3A 3M6XA 2VG7B 5KFTA 1RJJA 3IRXA 5KT2A 2HHUA 3HFZB 1LK5A 4DR4F 1WG4A 4DL7A 4J37A 3RBXA 2GAGC 2CXEA 1U9PA 3J81U 1RYSA 2DIVA 2MKKA 1FNXH 2RKIA 1YJRA 5CH7B 3T5JA 4WZQA 2KG1A 1D0EA 2OPPA 2C3UA 4DCJB 1LNQA 3C15B 4HDHA 4YQWA 3DRXA 3HKWA 4ECVA 3AJ1A 2XCAA 3H25A 3KG0A 2FVCA 2XI2A 1WC5A 4CO3A 2XMMA 5B0EA 3D1QA 5HJXA 4B9NA 1GAOA 2BKOA 3PFEA 2KXNB 2VDIA 4W90B 2C1EB 1RP5A 2G0CA 3CGIA 3PXGa 4X4SA 1Q5YA 2VASA 4Q2LA 4FDFA 1QTMA 3HLUA 2ZZNA 3EGZA 3ENVA 3QZ8A 1VFJA 1VOMA 1D8YA 4P52A 3UCGA 1U45A 4OHZA 1JXLA 4NMXA 4PQAA 1F9FA 2VPWB 4UZBA 2PMWA 5DLGA 3NOCA 5GVQA 3KHRA 4NXMF 2H9ZA 4IDKA 4K4ZA 1OG7A 4DSEA 2OEJA 1U09A 2GIQA 4GMKA 4PCQA 2CVEA 4HACA 2AGQA 1XMOJ 1N48A 2XLKA 2U2FA 2JOQA 3CJSA 3DKDA 4USTA 2DPJA 1N52B 3BS9A 4ED5A 2IVYA 2HIYA 1RLCL 4OYIA 3RYLA 4DFPA 1OPIA 4F0HA 4CLLA 1WC3A 1IKWB 2NYIA 2V8DA 3I5CA 4P71A 4PG6A 4CT8A 2D9OA 3HM9A 3PW4A 3CCLS 1TL1B 5HN0A 3FRZA 1B28A 2BKPA 2YWEA 3PRBA 4CM2A 4K8RA 4AYBD 4DU7A 5K20B 2YXLA 3BPDA 2BJ1A 3L7OA 1S77D 1EB0A 2HNDB 4FXWA 1JJ4A 2HHWA 4FS1A 2DHXA 2HAFA 2IJFA 3QPIA 1NUEA 2IMOA 4R8UA 3DOMB 1QAIA 3DMJA 5D4LA 1FD2A 2CIMA 3UVJB 1HHQA 1HBOA 3G6YA 3QIPA 5JVHQ 2HBYB 1RU1A 1XTZA 1U1NA 3KG4A 2QEXS 2IBKA 4X4UA 4IUFA 5LSOA 2XZTB 4Y2AA 4H4OA 5J2NB 4C98A 3FJ2A 1ZZFA 2QT7A 3TJAA 2CNLB 2YNFA 3S01A 4ECXA 1S1TB 1T9VA 2QSWA 3FCWA 3JSRA 2MSSA 1CPZA 2KHCA 3OXLA 3IP0A 5KFLA 4DHVA 3JQKA 2JRSA 2ZBRA 1RWMB 3LP2A 3N6LA 5IS2A 4OZ2A 1M5SA 2HVIA 1RAFB 1MMLA 3R5DA 1S0MA 1KQSR 3HHDA 1TKXA 3EGWB 5AT1B 4A46A 5DDQC 3G71S 1F5CA 1FERA 1PKUA 4MIAA 2DGUA 3OLBA 4X4OA 2VFSA 3SQOP 4LF9F 1T9WA 2OMOA 4Y00A 3G96A 2OPSA 3RJMB 3CDUA 1P8GA 3U7JA 3DU5A 5GADU 4B3TF 4A8FA 4NWBA 3VW4A 3K5OA 1LXNA 5H9FK 4ZPWR 1UW9A 1QSSA 3G8TA 4DR5F 2YNGA 3GLJA 3O44A 1YJ9S 4DR1F 4QIWD 4NLTA 4YR2A 2W9AA 3DC2A 3M8WA 2DTJA 1Y11A 2FHKA 2ZITA 3DRSB 4LUBA 2L3MA 2AGPA 2V2KA 1H7XA 2RDDA 2VG6A 2E5LF 3H7HB 1JJCB 3KOAA 4J91A 4DBQA 3K2YA 4HACB 1QE1B 5KG6A 2VC0A 1S7IA 4DV1J 3LANA 3PKMA 3MOZA 1HWJA 1KEKA 1G1XA 4DX5A 3AOBA 4UQTA 2JNJA 4FKXA 1U0SA 2FD2A 2KB2A 4Z37A 1D9DA 4B02A 1J5EF 2OGUA 3IR5B 2E1PA 3OT9A 2FZGB 1KNZA 3POTA 1TKTB 5HMWA 4WU3A 3DLKB 5DM7Q 1MROA 4I2QB 1GNKA 3R2CJ 1RACB 2GCFA 5C2CA 2M88A 3OPKA 3QT8A 4KPCA 4WCEQ 2H1YA 3GIKA 3V6KA 1S4FA 2PC6A 1UTAA 4DX6A 1ZPVA 1WSVA 3D6HB 1CULB 5EDWA 3RRHA 5D0RA 4YB6A 3RG6A 2DXEA 1EKSA 3NLCA 4UUXA 2VQFJ 4JI6F 3SMZA 2J8AA 4A8SA 2PI5A 4Y2MA 4A8QA 2BXJA 1U8SA 3TJ9A 2AYMA 3BGOP 3OTCA 3Q86A 4L72B 4DL3A 1LWCA 4WU2A 2KRRA 2F4VF 2F8MA 1KVJA 4AT1B 1LQ9A 2D3ZA 4OYOA 4Y0FA 3NWRA 3QRQA 1FKPB 1SIWB 1N8RT 5AXNA 3H4DA 2HZVA 2F3JA 2D3O1 2KKHA 4CZCA 2BZ2A 1E6YB 3FZBA 5L1KA 1RKJA 3PJ9A 4FBTA 3HK2A 3UN2A 2IRXA 3GJQB 2PMHA 4OFZA 4C3LA 3MEDA 4HKQA 1ZM2A 2XWXA 3QAEA 4DV6F 1FKAF 1IWGA 2Q1LA 1GQEA 3R7NB 4NLDA 2RQ4A 1HKAA 2MGZA 4ZP8A 1QTGA 2QA1A 1FT8A 2OEMA 3EDQB 3UPFA 2QE5A 3GR1A 3T9ZA 4XAKA 3GFHA 1NPKA 1NK4A 4OI2A 4OZLA 1DTQB 1X7VA 2XULA 1CJTB 4PYAA 4W4MA 4KJIA 2BVZA 2Z2LA 2ZBPA 4ZKAA 2VBYA 5G4DA 4AQYF 1JLCB 4DWIA 1JLGA 3KNAA 4E98A 2EG1A 1FEEA 1Q7YT 4EK2A 3KUHA 4RW7B 2OO4A 3R7BB 4AQYJ 1CJVA 2IM1A 3VHQA 3I82A 3QWUA 2IM2A 3E51A 4WTYA 3JYTB 2AU0A 2UUCF 2R8JA 1FO1A 1GXUA 2ZH6A 1QUPA 2CWKA 4RW8B 4ZPBA 2W24A 1SQGA 3MCMA 4PKDB 1RAHB 2ZC3A 1NDPA 5B09A 3TUPA 1GK8A 4LIWA 3PW7A 2UUAF 2BJDA 3GR0A 3M2UB 1VQMS 2K7JA 1CJTA 3LOUA 4LSZB 3R3TA 2L9NA 3TZWA 3I4HX 2VQEF 2BRKA 5A8RA 5LMNF 2XMVA 2EC0A 4LF8J 1HBNA 4DV3J 4EBEA 4USKA 2XYGB 4WK3A 4KV8B 5KFYA 1FWLA 2W2PP 3KLFB 3R8YA 3THPA 2Y8YA 3P45B 3AY0A 2HFNA 2IM0A 3CDWA 4J9UE 4LF8F 1YQHA 2L9WA 2RQKA 2YPYA 3SYZA 2V2ZA 2UXDF 5DQGA 3QRPA 5M2RA 4DX7A 1NM2A 1HNZJ 2HYIB 3CIZA 2JEGA 2AP6A 1FF2A 3EX7B 2IC3A 2HQDA 1JXVA 2B8QA 3C6TA 3OFHA 3UNGC 1S12A 3LP1B 3VGSA 3W2WA 4B9LA 2ASYA 2B9XA 4C8OA 3CIMA 5D4NA 2KT5A 1NHUA 2AJFE 4E2FB 3GILA 3V6JA 2CPJA 3ZNJ1 3NO7A 2MEWA 1B0TA 1JLCA 1DQ9A 1YBTA 1IQZA 1DQAA 2OELA 4N8OA 1UPPA 3G6XA 3CCES 3TO8A 4IOCQ 3PCOB 3CCWA 4AFFA 4B9MA 2WVEA 1GXLA 2W4PA 4FVMA 2XZDB 4QIFA 4LFBJ 1IKXA 1JX4A 1DAXA 1S9GA 2DO4A 3KK1B 2RBFA 1RTZA 2OPSB 1RQ0A 2Q79A 2RF2A 3MOJB 2JJ4D 3NBPA 2VDHA 2UV8G 4JI1F 1UVIA 2CZVC 5H9EJ 4S0MA 2AEJA 1U1PA 3CC4S 3V6DA 3TZZA 2R8KA 4YB5A 3HD2A 3UDLA 2LEBA 1N5TA 3MUMP 2R7TA 2CJBA 2D3OR 4F36A 4RW9A 1Q16A 2OD4A 2EPIA 3GFXA 1TMJA 1LEOA 1FK9A 5F3TA 2R4FA 4WYWA 3HSDA 4F04B 2HFVA 1HD1A 3L9ZA 4QR1A 1RT4B 2ZEJA 1A6LA 1TMMA 1YJVA 2V8VA 4W98A 4LF9J 3NMAA 4DS5A 1XR7A 2BE9B 3H87C 2YNHA 3CO9A 5IT4A 3G8QA 4PG5A 4B3TJ 2F8EX 4B3RF 2JDJA 1B01A 3UE2A 1RBOB 4OJGA 3IR7B 3DMJB 3MCSA 3CJ2A 4DV2J 1WOSA 1VJWA 3FGVA 4DR1J 5IM0A 1F2HA 5KFXA 5B0DA 3NGDA 2YX7A 3OW2R 1KTQA 2BW7A 3VEAA 3BGRA 5HAOA 3ILOA 4ZOSA 3QRRA 4BWMA 2ZVIA 1ZOTA 2DIUA 2ATCB 2MLYA 3CJKB 4DJBA 3ZZZA 1CLFA 1MROB 1M5OC 1KQGB 4P7VA 2XS5A 3QSYB 2WVCA 1UEUA 2Z2ZA 5AJ3F 4NLWA 4ICLA 4YB1P 4LF1A 4ZIWA 4BBYA 3I55S 2VUGA 2BJ9A 2LQ5A 2BE2A 2ZDOA 2F65A 4M5JA 1X8DA 4YDXA 5KG4A 3M32A 1N32J 1FFSB 4KR0B 3RR7A 1JLEA 3LP0A 2I5JB 4C0OC 1T9TA 4LIRA 3KJVA 4MIBA 3KJVB 3US5A 1GFWB 1F60B 1Y5NB 3G4SS 2ADBA 3MPDA 4ZPTR 1S6PB 2LECA 2DGWA 3DLGA 3UI3A 3IGVA 1LXJA 1TV6A 2C2ZB 2R42A 5GAHI 4RUAA 1TL4A 1WEYA 3DM2B 2BANB 3W64A 3ZZPA 3V6DB 3RAQA 4B3SF 1HNWJ 4GKKF 4AAIA 1TVRB 1EZZB 2KVQE 3EGVA 1REGX 1DLOB 4USWA 3W60A 4AXJA 3MPWA 1RT2A 3BZQA 1RT2B 3MDFA 4OJ3A 4F3QA 1ZZNA 2XGQA 2ALZA 1YWXA 2GHPA 3CJ8A 2YWWA 3F73A 4EFAC 4Z2XA 3M6WA 3QFWA 5JMNA 3AXKA 2R7XA 3MMBA 2MJNA 2C3YA 5GAGI 5D0GA 4DV5J 1PYOB 1RT5B 1N33J 2CQ2A 2HBQB 2FVSA 3ET6B 4JV1A 4X64F 4AL5A 3DGPB 3R5BA 3FKBA 5LM7E 3RRKA 4FF2A 2DGSA 3PRDA 4WFBQ 2HMIA 1BXNA 1OY6A 2VV5A 2ZOMA 2M52A 3SCJE 3M9OB 1WHVA 4OQJA 3C66A 2LYVA 4OHXA 3X1LB 4QYZK 2HS3A 2XMJA 3EM1A 3ITHA 3M9NB 5E0OA 3SSSA 2Y0SD 3CJ0A 1MWZA 4LRFA 4IQXA 4Q45A 3D5MA 4MJWA 1M5PC 2K7KA 2P2CB 4IH5A 2NCKL 3OBIA 1NSKL 3D6FB 2KU7A 1N54B 2YTCA 4OMFG 3F0NA 2M3DA 4URSA 4CTAB 5KFDA 4ECUA 3QIPB 3DLHA 1FJGF 1RAJA 1S59A 3GSIA 2AWZA 4E8UA 2DNQA 1XNQF 3OVBA 1VQKS 2V0NA 4KHMA 4ELUA 4X4NA 1VK3A 3MD1A 2DT9A 1BDTA 4OX8A 3OFGA 5EGYA 1S5ZA 3N5BA 4C0HA 3FEYB 2ZBIA 1W26A 4OV1A 2XWYA 3FRYA 2IBOA 1DARA 1ZAXA 3M05A 1B3TA 1M1KT 4OX9J 1U2FA 1YSJA 3H5YA 2V2QA 2O67A 1RT3B 1UPMB 4TKTA 3Q2TC 3DCAA 4I56A 4DV4J 4IO9Q 1C1CB 2LQJA 2IDLA 1QSLA 2DCUB 5D6GA 1Q5VA 5EX0A 3I9ZA 4JUZA 1G3OA 2KI2A 1OHNA 1VQ8S 2LXFA 2V8HA 4YHHF 5LMNJ 1SVDA 3MEGB 4DPYA 4TU9A 3MMJA 2GGPA 1JLBA 2N3OA 1RWKB 3ZZRA 3TARA 1NU4A 4P2SA 2NXCA 2K5JA 2R2UA 3QO9B 1HBUB 3PHEA 2A2BA 1IJEB 3GE9A 1AFIA 1WC0A 3M8QB 1R89A 2ZBCA 1HQEA 1Y0HA 4AUKA 1UA1A 2E1RA 2QIFA 3I5BA 5D78A 4LF7J 2OPRA 1JQGA 4RW4B 2OFGX 4HVZA 3D0HE 3KK1A 2V67A 2VZ9A 4YY3J 3T5LA 1AROP 3LGHA 3JSYA 3H5SA 3I4PA 5K14B 1SXLA 4CYUA 1QJHA 4FXDA 4OI3A 2W7PA 4C0BA 3KTQA 5H9FJ 3CCRS 4DQQA 2EFGA 4CLSA 6FD1A 5GAHU 2HVEA 1RDRA 2PDAA 1AB8A 2L9DA 2QL5B 5ETTA 1OPZA 1RA6A 3H2VE 2HQ3A 3IM9A 4G1QB 3D1HA 1FDBA 1IVZA 3U1NA 1ARRA 4LBPA 3DOKA 2YX1A 4DQIA 4FXVA 2B43A 4OYXA 5HVGA 2MQMA 4LSLB 5FIIA 3G6VA 1MMNA 1FESA 4G1IA 2QLXA 4ZVPB 3VGUA 3QGGA 4D3GA 5HQLA 4OYWA 4K4XA 1T95A 3DDKA 2LQBA 4RL1A 4ECQA 1VQ4S 4CCHA 2UXCJ 3RB0A 4JI1J 4DLGA 4PAAA 3TX0A 3HVTA 1K9MT 2FZCB 1QM9A 1UFLA 4R0EA 4ETZA 4LREA 2QJ3A 3N79A 3R5GA 1PC4A 3RB6A 4LFAF 1ZH5A 4JV5F 1TL3B 3DI6A 2BBEA 5IWAJ 1HBNB 2IFXA 4OZ0A 2MZRA 4OYPA 1ELOA 3OTOJ 4RZRA 4DV0F 1SL0A 1T3OA 3IG1A 3AQPA 2XTJP 2K1OA 2ATLA 2UU9J 2DISA 1PIEA 4BWJA 4DV7J 2FHJD 1SIZA 1JLBB 4H4MA 4UY8T 4TLRA 3HJFA 2BJ8A 4ZA1A 2GNKA 2QA2A 4F50A 5F3ZA 1QSYA 5J1NA 1AZSA 4GVLA 4RPFA 2B4VA 1C1CA 1WG5A 1WG1A 2UZAA 3DRRB 4I2PB 4I2PA 2QG9B 2WVDA 3HZEA 3I87A 4FYYB 4PUOA 4PUOB 2RHSB 1L5UA 5E3CA 5KTQA 5KFEA 5IV4A 1YRXA 2VKRA 3ZTSA 2UVVA 2BMBA 1X4AA 4C8YA 2RRNA 4PWDA 1OQ6A 3SFUA 1ULRA 3H42A 5KT5A 4RW6A 4I67A 1Z4UA 1WELA 4JOUA 2RRBA 4UY85 2B5JB 2IVMA 2QMUB 2HHHF 1KVKA 4B9TA 5D4OA 2HWIA 1I51B 1UJ6A 3M30B 3NS6A 3ENQA 3BGFA 3VVTA 5LMUJ 3TQ1A 4IRKA 1QVFR 4ZCMA 2QYGA 3HT0A 1H74A 4YFUA 1C2PA 1B99A 1N34J 5KG7A 2I6WA 1TKXB 4NLUA 4C8NA 3WBZA 3HT3A 2C2KB 2NXUA 1U4BA 4JI7F 4QW8A 2CQBA 5KT4A 2L48A 3MCOA 2ZWPA 3NXZA 1DJ0A 3P8BB 1XN9A 2XYHB 3L95X 3R6LB 4G65A 2PMZD 5CXTA 3CCZA 4N7TA 2W2QP 3TVKA 3SCIE 3NGKA 5F8HA 4NLVA 3J80Y 3FBCA 3ZZYA 1MWQA 4Q5VA 4DFKA 1SC1B 3UR0A 1U02A 3THVA 2RMLA 5E41A 1CQMA 2QL9B 1F5BA 1CQNA 2ZDPA 4B3OB 4OYBA 1FRKA 1M1HA 2BSQE 2MHNA 3BH7B 4P2XA 3IBCB 4ECRA 3VF0B 1RB0A 1U0HB 3WZ0A 2IYGA 3QJJA 1OYEA 4OZNA 2Y0BB 2B9EA 3ZZOA 4L3KA 5AE1A 2KFNA 2EWHA 3A1YG 4P7TA 4TYBA 4K7QA 4R8UB 5I3PA 2AGOA 5GAEI 1RTJA 2CQDA 3L3CA 3O3LA 2VPXB 3CC2S 5L1LA 1SQFA 1WTBA 3TEGA 4N76A 2HBRB 2Y9HA 2C22A 5G0RA 1PYTA 2IA6A 1A0OB 4PR6A 4LJMA 5CABA 2LKZA 5D3GB 3KLHA 4NCAA 3B54A 3BSAA 3TQEA 4JI3J 1X4HA 4I64A 1VS3A 4DUZJ 4Q2MA 1GX6A 3D1OA 4CDIA 3LO3A 5DGAA 3V81A 2JFDA 2J0XA 3PKYA 3MUTP 2ZOGA 3W2VA 4DPWA 2WTFA 4I68A 3TUIC 1UZHA 3VALA 1SKRA 5IFMA 3JS9A 2BNWA 2N4CA 4V1Ak 1GMUA 3DLEA 5L1IA 2VF3A 1N5YB 1FJGJ 2ZJQQ 3D2WA 3PIOQ 1U6FA 1KTVA 3RW6A 1X0PA 2QLWA 4Z7YA 1PAUB 3NS5A 1UA0A 3M1VA 4DR6J 4IQMA 4HHUA 4DQSA 1ARQA 1F3VA 4KYZA 5D4PA 4M5NA 3V4IB 2DPIA 2NZ4A 2DHGA 4U8VA 2Q43A 2M4MA 4DSLA 3LQVA 1VYAA 2UUBJ 3EVMA 2Z58B 4MK9A 2DNGA 4HI1A 5KFCA 1YLXA 5CYJA 2HNYA 1XMBA 1TL5A 1YRUA 3N5FA 1NK6A 1SV5B 2A18A 1NNDA 1TL1A 3LUYA 3QLHA 1HA1A 3EGNA 3NGTA 4RWXA 5THWA 4D3HA 2MGZB 2XSJA 4OLPA 2B7CB 4CO0A 5LJ3Y 1NXIA 5LJ5Y 5T7LB 4K4UA 1G2EA 2Z4PA 5IC6B 4O3NA 1NDKA 4ZVTB 3K5LA 2KVIA 1N5YA 3ILLA 4N47A 2FTRA 3GJRB 3HPOA 1UETA 1U49A 1IR2A 2RHQB 4ALZA 3FEZA 1NDLA 3PYFA 5LSLA 5GMKa 1AFJA 2R8GA 1SJQA 2BABA 3CDBA 2CNOB 2ASDA 2A10A 2FZKB 1Q16B 3AA9A 3DDNA 3B4DA 3MM6B 1IRQA 1TELA 3ZTRA 4CO1A 2HS4A 3T9NA 4NRTA 2HHPA 3IMQJ 1NSPA 4TQRA 2R8HA 3IAS9 4WE1B 4ECZA 4C8ZA 2VFRA 2H3AA 1UJ4A 4RNHA 1KQKA 3T41A 4PG8A 5F9LA 5HP1B 2AYGA 4JI4F 2CG8A 3V5RA 4CLWA 4USMA 1RSCA 1ZETA 2KN4A 2BJ7A 3FSYA 1EHWA 4NLXA 2JWNA 4J9PA 3M9MB 4DF8A 3UVJA 2AIRB 3QZ7A 4JI5F 1PSDA 2B6AB 1V3SA 4TY8B 5C25B 5CYQA 3QT6A 4DDFA 4ZPVR 5IM0B 3PV8A 5BR8F 1TL7A 4PEOA 1TK5A 4OI4A 1ZM4A 4EBCA 3BKUA 4ID8A 1TFYA 4O4RA 2CJQA 3DRYA 3EZUA 3K17A 3PG9A 4ZCIA 3C19A 1R0CB 4OLOA 2J9DE 1RT7A 4M5DA 3DN9A 4UZCA 2RILA 2XQCA 1ICEB 2QL7B 3A13A 4WXOA 4ZCLA 3W2VB 1HWKA 3BR8A 4OHWA 5L39A 4U7UK 2GVDB 1PGZA 3SSRA 2CVIA 3GJTB 3W3SA 1GXTA 1HYSA 3Q83A 1HMVB 4LBHA 4OYAA 4QIGA 1HLWA 1FRMA 1R43A 2KJVA 3EPGA 1X4FA 5GMEA 9RUBA 2BOAA 1U47A 3R97A 3Q8SB 4K5SA 4WKYA 1AUSL 3HMJG 1LOUA 4IOBA 5KFVA 1IN0A 2HBZB 1K47A 3GIMA 2AX0A 3MFIA 2KXHA 1F9HA 4PPZA 1WEXA 5E3AA 1DLOA 2J0QD 3GYNA 2AN7A 2OP5A 5HROB 2CG4A 4HH0A 1WOPA 2X1FA 1KOOA 2MY8A 2QFIA 4NA2A 4RJVA 3QNWB 1OIAA 4DZ6A 1S4EA 2D3UA 5LOQA 3J7ZT 3QGHA 4QPTA 3HHEA 4NCBA 1I1GA 3M7VA 5H1SV 3CD6S 4CP5A 2AMCB 2GQ2A 3IS9B 5IOLA 5IXUA 3RBDA 2N4DA 3OHBA 3SV4A 3MMAB 4DQRA 1OO0B 2HHHJ 2OPQB 5DJBA 3PACA 3BEGB 2YH0A 3QOQA 2VH7A 4KGKA 4O3SA 1IKYB 2OMLA 5C5JA 1N34F 1UVMA 3PIPQ 2ROEA 3HHKA 2XCPA 3OR1B 1PAEX 1RTIA 2IRYA 5HVHA 1FE0A 1VHIA 2KT2A 2XY5A 5BJRA 2H4YB 3DRPA 1B4SA 4NZ6A 2KELA 1R8CA 3DOMA 2LQ9A 3AOAA 1HHTP 1HWIA 1XIQA 4ZP7A 2WBRA 5J2MB 4J9QA 3HHLC 4G1PA 1HWUA 2EFOA 3JSBA 3PM9A 4Q8FA 2AW0A 1RE1B 1NHVA 4B9SA 2BQUA 4F26A 3DXSX 4UOCA 3VAFA 3QFHA 3B8HA 4C11B 1SI9A 4LF2A 4K59A 2ZM6F 1WNEA 2V2VA 2BOPA 3CTRA 1TFWA 2YKNB 5KFOA 2HVDA 2K3KA 3NOGA 4KPYA 3DRRA 1VQ6S 2YKOA 1S9EA 2ASJA 2GJFA 1NKBA 3HHNB 1P27B 3SZ2A 2UUAJ 2E9TA 1RWUA 3JYTA 3N4WA 4X4VA 4XTTA 1OQ3A 4HYKA 2AHOB 2A1BA 1NAQA 3TWZA 3QLHB 2JXHA 2QMXA 3VZHA 4GRSA 1B7YB 4CIOA 2HNZB 4I7FA 3CMQA 2DNPA 2WOMB 2ZHAA 3NBPB 3LF0A 4MYUA 5HK4A 4ELVA 3W9JA 1X31C 2LVWA 3M8PB 4CLKA 1HHSA 4LRVA 3MAQA 4NXMJ 4DSIA 1CJUA 2W7OA 4DN0A 1KONA 5DDPC 2VD3A 4HH1A 3FFIB 2BQ3A 2DEIA 1RT6A 1RAEB 2CWXA 1MN7A 2OHDA 3EWGA 3NS7B 1Q8KA 1RWOB 2BANA 3FT7A 3DOKB 1NJYA 1XNRF 3M2RA 1HWLA 2HZCA 1LFWA 4LSLA 4WXWA 3T1YJ 4P75A 1FRHA 3A3OB 2X1GA 4JI8J 1QE1A 4WP9A 4M5MA 2BE7D 2SXLA 3VEBA 3MFHA 5DGBA 4ZCKA 2WSCC 3W61A 3VWSA 3T1HF 4LF6F 3KFWX 4DX8H 4UQGA 2JC1A 2XLIA 1RHUB 2FHJA 3GQCA 1RBLA 2JSXA 3MEKA 3K8VA 3UR3C 4Z7CA 4NEYA 1WTFA 2DXDA 2DHAA 2B3TB 2YNIA 3SCKE 3W1YC 5DG8A 1WC1A 2CPXA 2MJUA 3J81j 3MZIA 3GIJA 1FNMA 2PSZA 2YKMB 2Z8QA 4K2XA 4MMOA 4QZVB 4K2JA 1NLKL 1TTHB 2ZHBA 2NXJA 3UDEA 4A8MP 2PA8D 3ISND 4PXDA 2J6UA 3ILIA 2VFTA 4TY8A 2UP1A 2H5JB 1HI0P 1PARA 5JJBA 2DNMA 1HNVA 1RAIB 2B9YA 2WONB 2J7UA 2HIQA 3PJWA 1TAQA 1S1VA 3U02A 4DG1A 4X65J 4NLOA 4Y28C 3HSJA 3CVKA 1G6BA 1W2IA 2NUUG 1IWAA 1JJHA 5A0YB 2RU9A 3R9LA 1FTCA 4Y3CA 1NKEA 2ZH7A 4LF5F 4RLEA 1KKHA 2W25A 3MR6A 2FHMA 4IR9A 4U9RA 3EYZA 3DDIA 2VJUA 3OL9A 3TAMA 2EKNA 4HV0A 2GFFA 2EFVA 4USJC 3AHPA 4TU7A 4J9MA 5ETOA 5DLFA 1MU2B 1RHMB 3UCZP 5AXMA 4F3MA 2AZ3A 3H59A 1GTHA 2WCXA 5L38A 4IRDA 2KZMA 5M2PA 1FVQA 1Q82T 2HNYB 2P6SA 3OFFA 1J5OB 2O3DA 2AYBA 4ILMA 1SV5A 4CLUA 2QZ8A 1S48A 4ZHRA 2DEJA 1VR6A 3G8SA 4DR2J 1VQNS 1B7FA 2G9OA 4HL9A 2R7WA 1T0TV 3QATA 5BYSA 2M8DB 2M8HA 1UP1A 4B08A 3V4IA 1VQ5S 3L4BC 1WF0A 3ZZ0A 5AE2A 2MQLA 2VG5A 5DZ6A 5RUBA 2VFVA 3FDSA 1VJQA 1IBMJ 1LW0B 1VLYA 2MKCA 3N9UC 1XMOF 3HSGA 2FDNA 4D8JA 3CCVS 3DM2A 1HD0A 1RUSA 5A76A 1IBMF 1PJ6A 2DHHA 3EICA 3TYTA 2K2PA 5IT0A 1X5OA 4X62F 4F2SA 1C1BB 3CO0P 3IWLA 1NLAA 4C8KA 2CDQA 1M5KC 3BKFA 3QWPA 3R1LA 4OZ1A 1FCAA 4L6V3 1X4BA 3UQSA 3MMAA 2FY1A 1AT1B 4B3SJ 3TA0A 1U48A 3KLGA 1SCJB 2BR0A 3GMGA 1W7WA 1JNZB 4ZVUB 4TQSA 1HNVB 3CPWR 3H5XA 3LJPA 1OS5A 4R5PA 4ZS6A 1WC4A 2RUSA 3ET6A 1ZA2B 2XO6A 1TL7B 3AJDA 5F8JA 3R5AA 4BS2A 1M1GA 2ERRA 4K0KF 3BPSP 3AAWB 3DGVA 4K4YA 3OXFA 1H6KX 2EG2A 2FHOB 2OUGA 2VQFF 4U7UD 1APSA 1UVJA 2H3EB 1F9EB 2HHTA 2YX4A 2G1HA 4K0KJ 4Y2IA 3TVYA 4EWTA 4FYDA 4Y2CA 3AD9C 3DHXA 2ZH1A 3EZOA 4QQBA 4LF4J 1O6XA 1FWKA 1E6VA 3QSIA 4EEYA 3CDEA 3TA2A 2ZC4A 2LA6A 5A8WA 1JJ2R 2MQ8A 3D3CJ 3BV8A 3DLEB 3LP1A 3KNGA 4UUWA 3KMQA 2HHVA 1SC6A 2PFDA 2XI3A 2NREA 1X4CA 1BLUA 1YZ7A 3J80U 3BO3A 1PC5A 2NPIA 2O5DA 1XK8A 4KC5A 2YKNA 2ADCA 1SC3B 4B3RJ 2ZHOA 5ITHA 3KWMA 4C8MA 1RHRB 3CJ5A 3VQSA 4FF3A 1RI7A 1FJ7A 2YNFB 3D6TB 2AX1A 3J81Y 2UXBJ 1C0TA 3Q8RB 2QYCA 1RYRA 4DLEA 1JLGB 3JAMU 4ZN1A 2KHDA 4OX7A 1N6QA 1M90T 1TKDA 2V9WA 2ZE2B 2CNKB 1SJ4P 2C3OA 1FFWB 3D54A 4IFVA 3OLAA 2AEMA 3GIRA 4FXEA 2DBBA 3FK4A 3MR2A 3MM5B 4HTJA 4X66F 3GV8B 2NSBA 4DFMA 2VG5B 4PG4A 4QJVA 4XIUA 1NCLA 4JI5J 3NNEA 2JXGA 3M30A 1F5AA 3T6BA 1J5EJ 2RD5C 2BA3A 4F4ZA 2GGPB 1W25A 4TN2A 1YIJS 2MTLA 2ZFHA 1U7LA 5D0EA 2PIIA 3SXLA 1JKHB 4KQZA 3AOCA 4JB8B 5HANA 4N77A 1FFGB 3HSZA 2VC1A 2V8PA 4A8YA 2Y1IA 2BQRA 2CPYA 3OJSA 2LQ8A 5ETLA 5F41A 3T3FA 4WTOB 3ITHB 2Q66A 4HR2A 5DS7A 2WSEC 3HP6A 1YZ6A 4M5LA 2FVQA 2DR7A 4FS2A 3CW2C 2QC3A 3OVAA 1GH8A 4J90A 1SKSA 4NZ0A 4LRDA 1HNWF 5HQMA 2ZBQA 1GMWA 1REVA 4IG0B 3R27A 4YUDA 2X3GA 3RGIA 4X4RA 4IOAQ 2ACYA 3WC2A 1CULA 1MLAA 2XMAA 1HR0J 5FD1A 2ZKTA 1KFSA 2LXIA 1FD8A 2QO3A 2DY1A 3KLHB 2UVRA 2F1FA 3M8YA 3NL0A 1JLAB 4WKRA 4W92B 3FEXB 4NOHA 3I9V9 2G13A 1X5PA 2YH1A 1WHXA 4LR7A 1VRQC 3W9IA 2C2RA 2KG0A 1NEEA 1KR4A 1VRTA 1WWHA 4Q0BB 4MTPA 1I6JA 5E3RA 1RTJB 3PEJA 3EXYA 4YR3A 5JVGQ 3FBEA 1SJ1A 2MZSA 4P9SA 1NJIT 3LALA 3EUNA 1IUJA 2RQCA 5B7WA 3DYAA 4O44B 2ZH9A 2F4VJ 1Z2LA 4NLRA 2ROPA 5IQ6A 2BDPA 3IR6B 3OSNA 3T1AA 4ANEA 2HQFA 2L08A 5K8MA 3LGNA 1HYSB 1GTEA 4FKYA 5DDRC 1KQFB 2ZJRQ 1U2CA 3FUYA 3D0GE 3DLGB 1JLFA 4YS2A 4BDPA 2JZ5A 3KK2A 2QMWA 3BR9A 4DR7J 1WDDA 2GW8A 3KDOA 4I6YA 4CLYA 2QFJA 5EX3A 1HBMB 2CYYA 2PT0A 1R0BG 5J2QA 1TP7A 2E1AA 1BDVA 2RVJA 1BWEA 1HQ2A 4MFBB 4P2FA 5IC4B 2HGLA 1CJUB 1PBUA 2R7QA 3I0SB 3NCQA 4ZPCA 1EETA 5HQ8A 1D9FA 4NASA 1XNQJ 3ZTPA 3FFIA 3HF5A 4C4WA 1NSAA 3CUNA 5KFRA 2R7UA 4DV0J 2PI4A 4UOHA 2A2DA 2NYHA 2ZZTA 4WFXA 2W8LA 2LEAA 1Y10A 3C46A 2V63A 3HFKA 2WOMA 4WF9Q 1XBWA 4V19X 3UFCX 2QLBB 1HQUB 4ECYA 2P5VA 4EBDA 1RHQB 3C15A 3M8PA 1FX2A 1XR6A 3C16A 2VOOA 2AF6A 2YWFA 2F40A 1JLQA 1S6QB 4RNMA 4UF4A 4X4PA 2R2RA 2GVZB 4KB7A 2PGCA 5J1EB 1CSJA 5K8PA 1SUQA 5A6WA 4KHRA 1HNIA 2EC2A 4NE9C 2GHWA 2DR8A 3SEOA 5KAKA 2EK6A 1T9YA 3ZO7A 1BQXA 3MI7X 3GV7B 3Q24A 1S1XB 2VFUA 4DR2F 4RW7A 1N56A 1F0XA 2DRDA 3Q2SC 2NXNA 1TKZB 3IS9A 4GO5X 3CNQP 3RW7A 4DCPB 2M70A 1RABB 2CQ4A 3TOQA 1P6TA 3H2LA 3UN3A 4M94A 3DXBA 5CAAA 2DRBA 3DYAB 2BKNA 4FYWB 4OI6A 4O44A 4ELTA 3Q8PB 4LSNB 3ZZTA 2W9CA 1BQMB 3WHIA 1R0AB 1LWFA 4FYVB 4O4GB 2ZH2A 2YNGB 2KYXA 4ED3A 1ZAWA 3OJUA 5J2MA 1S6QA 3BGRB 2PA3A 3IG1B 3MD3A 4FZVA 2W1BA 2RU3A 3HDSA 1N32F 1RAGB 3IO1A 2KM8C 5KFHA 2AQ4A 3DRPB 1T7PA 3FQLA 4MFBA 3WIVA 5HP1A 1IQTA 1OSCA 1MU2A 1HIYA 3FVYA 4P10A 3I0SA 4TNOA 1VBZA 1EIYB 2E7XA 5HI7A 4ZLPA 5GADI 2JEIA 2XNRA 1EX8A 4NZ7A 2K06A 4DCOB 1LWEB 2K8GA 4MK8A 3V2UC 4CNZA 2EKYA 4ES2A 1RA7A 5E33A 4NMLA 2HEKA 2CPZA 1C0UA 1RT7B 4M5DB 2POKA 1IKVB 2GIFA 2LU1A 3DOLA 3PJXA 2E66A 4N56A 2QV6A 3GV5B 5LSRA 4X84A 3PX0A 5I42A 5KOWA 4ZLLA 2XNQA 5KFSA 3EDRB 3DGPA 3AB2B 4GC6A 4LQ9A 1WHYA 1KLMB 5ETNA 2Y1JA 2X3DA 5HROA 3LPEA 3D28A 4GVBA 2GO9A 2IHR1 4UOGA 5A2QY 4PQUB 3R1HA 2B0GA 1XMQF 3BBCA 4M63A 4DUYJ 1MN9A 2LXUA 3C6UB 2KXFA 3JQJA 5M2UA 1VHFA 2AD9A 1T02A 2B4PA 2B56A 4IFYB 1XMQJ 2MSTA 5J2PA 2O01C 1SKWA 1XQIA 1Q1KA 4MT1A 1U6ZA 4J9SA 4C7QA 4JI2J 1LK7A 3CD5A 3OV7A 1EQ0A 3MHYA 2QRRA 2ZUGA 1OSDA 2Z2MA 3ELHA 3Q8YA 3A3NB 1C4CA 1Z2ZA 1DTTA 2JH3A 3MM8A 3K0JA 3FMBA 1OMSA 5CA5A 1Y4ZB 2DNRA 4L76A 3DRSA 1BD6A 5FLXU 3P4UB 1VC5A 3DLLQ 2VOPA 2VG6B 3HI9A 4X66J 2FB0A 3VAGA 3J7AN 4ICLB 2DGOA 4HT5A 2D69A 4I4BA 4LRAA 3PYEA 4PXEA 4K4WA 1D1UA 2KKEA 5C25A 3BB5A 2EBGA 3PRVA 4X4TA 2RUGA 5K8NA 4ZJOA 3X3UA 2CQ0A 3RRGA 4EU0A 1K8AT 2UUWA 4ZVEA 4ANCA 1KLNA 3E8OA 1D9AA 1VIOA 2Q3PA 3M2UA 2CPIA 4IRCA 3TA1A 1MSWD 2XMKA 2DGXA 4IG3A 3O1LA 4K4TA 2OTJS 1URNA 2LEPA 2QLJB 4M5IA 2HGMA 5CZVA 5HMXA 4USIA 3LP2B 4PWUA 4YHHJ 2AJ4A 1IM6A 2HFUA 2HFSA 4ZVSB 2H48B 3TR5A 3VTIA 2ZJPQ 2OLWA 1T05B 1C0TB 2V8GA 3CCQS 4RNNA 1VQYA 2Z2YB 4LVOP 1WF1A 1Y9OA 2HG4A 3TW0A 4YMEA 1UWBA 4CNYA 1TK0A 2G4BA 4PWDB 3G86A 4KE5A 4JV0A 3K5MA 2GMLA 2XS7A 3MURP 1CJKA 2M7SA 2YY3A 4H4OB 2FLLA 2R7RA 3W62A 1J27A 1R31A 5B0AA 3AD8C 1LW0A 3S1TA 3GP9A 3QT7A 3RB4A 2DH8A 1KOHA 1RWXB 3JQMA 5B0GA 3UD3P 3QJLA 4PQUA 4DU8A 1FVSA 1P1LA 2DR9A 4V19J 4OX6A 5L9XA 4F4KA 2FQQB 1IKXB 2DNNA 1EARA 5C42B 1N36F 3I0RB 2IPOB 2LP4A 2V4JB 1UCNA 2J9EA 3SCLE 1S0NA 2FJDB 1MNTA 1S0OA 2EFQA 3W5YA 1U1QA 3VGVA 1OYDA 2YQ0A 3B78A 4FNHA 4ME7E 4CQ1A 3OFEA 2K1RA 3TUZC 4CH1A 2BM0A 2RAQA 3O8WA 2GMJA 1DTTB 3MM8B 3MWBA 1H72C 4CRJA 4X4QA 3VAIA 2HVHA 3HCXA 3M6VA 2L41A 1HNXF 2DR5A 1VISA 4EZ6A 3QBCA 3HZGA 2I9SA 2V6AA 4DR6F 2AJ0A 2VU5A 1M5HA 4EO6A 1R27B 2OIHA 2WB4A 1L3KA 3M6UA 5B0FA 1CS4A 4WBFA 1V9OA 4J9LA 1GT8A 2XLJA 2RE1A 4OJ1A 3OL8A 1O0PA 2ZH4A 3GWCA 1IR1A 3MPYA 4MAKA 3VQTA 5H9EK 1HNXJ 5ETSA 3GONA 1ZBTA 3SV3A 4USVA 5KFNA 1IBLF 2ZZMA 1JK9B 3DNCA 4DV4F 2MB0B 4LF7F 2FJXA 3K89A 4DPUA 4B9VA 3BBFA 2E29A 2BM1A 2Z57B 3AODA 3EVWA 1IKVA 3DOLB 2NSCA 5GMDA 4C97A 4EI2A 4XPCA 4PABA 4J9NA 3CF5Q 4B3OA 4ZIVA 2UVUA 3K58A 2E5JA 3VVUA 3RAMA 3KJFB 3BF4A 2BA9A 3KUGA 4USUA 1VQ9S 1CC7A 3W7BA 2RKIB 1MYKA 4ZJQA 1F6TA 5EN1A 2UXDJ 2BX6A 4U67Q 2JX2A 1EKRA 2OSQA 4B17A 1JLFB 2Y8WA 2E9ZA 2C2NA 1BY9A 5FDLA 3K59A 1X9MA 4MJKA 2HHXA 3M32B 2RJZA 4UTGA 2ZH8A 3T19A 3KK3B 3CCSS 3CMES 2HK2A 4CYUB 3QJPA 3FBBA 2IIHA 5DQIA 1WORA 2MKSA 1NB2A 3O2IA 1TUVA 2CQ1A 5A0YA 1W2BR 1LWXA 4RO0A 4ED7A 2WAQD 4KBIA 2APOA 1VQOS 3BDEA 5SUHA 5ADZA 2W4DA 3K8WA 2YKAA 3P3DA 1ZTWA 1IJFB 3CD7A 1Q53A 1NO8A 2CJ9A 3QO9A 4RR5A 4RX6A 2MZQA 1GMWD 3MEEB 3ZTQA 5KG5A 3UD4P 2FLPA 2GQQA 3M8QA 5DO2A 3SSQA 2V4QA 1I3OB 3D4JA 2AEFA 1SL1A 4USHA 2E5LJ 4FBUA 2F5GA 1WJ9A 2CRLA 3GFYA 2R9LA 2JLEA 3MECB 4IR1A 4NA3A 1Y3KA 1LW2A 2ACMA 4ZDNA 1P94A 1TUGB 5B08A 2QA4S 1IKYA 3BQ0A 3E2EA 4NXNJ 3BO2A 2NQPA 4F0KA 3CJ4A 1FXDA 2FLOA 4DL2A 4EZ9A 2YBVA 4WK1A 2PD1A 2N7YA 4M5KA 1KWMA 1TZ0A 3AA8A 3DU6A 3IBWA 3KXDA 1VQ7S 5KFPA 1IBKJ 2HAIA 3M2VA 2B4UA 2HRUA 3JTNA 4H4MB 4YEAA 5CYMA 4DUYF 1YX2A 3B6BA 3UW1A 4CLPA 2MZ1A 2BACA 1C4AA 3JAMY 3D9BA 3ZTOA 1KHWA 1PILA 1RISA 3P5TL 1PYSB 3TRGA 6AT1B 1SH2A 4EMDA 4DUZF 4I0WA 3DI6B 2J6SA 3K7RA 2VBZA 4GKJJ 1T3NA 3M8ZA 5BYRA 4EYIB 3H20A 4NI2A 5KFMA 4QW9A 4ED1A 3HVTB 4GC7A 2M0GB 3MM9A 4QWCA 1U1OA 3BBBA 1H7WA 1DRZA 2C2EA 5F8NA 2CPFA 1L3VA 2RS8A 5EWEA 2HW3A 3KLIA 2E5IA 4KT0C 2GVDA 1HBMA 5GAEU 5I42B 2K3IA 1AW0A 4EGLA 2F4FA 1NB7A 2OH2A 2GPEA 2J9DA 2PN6A 2DNHA 3GJSB 3HVAA 2A3JA 3PO5A 1UL3A 5A8WB 3A8JA 1LWEA 1FKOB 4NEZA 1FJEB 3BQ1A 5E2QA 1PO6A 1UJ5A 3R7SB 3MMBB 4DSKA 4OHVA 4J9OA 1MYLA 3PW0A 2AJ1A 3I31A 1H2VZ 4UW2A 5F0WA 2NS1B 3I0RA 3PR5B 1Q79A 1EQMA 1G7CB 4NCGA 3TP2A 4C3MA 3EZ5A 3RR8A 2V94A 3LAMA 5E5NA 2FVRA 5ETRA 4F8RA 3F44A 3H40A 2OPRB 4RW4A 2H54B 4J9RA 4FP9A 1KN6A 1YITS 2P9GA 4JV2A 2XEXA 4QR0A 3CULA 3RTVA 2HSEB 2ILZA 1T8EA 2UUCJ 3NNHA 3ETOA 3NCPA 4LQ3A 4I6WA 4RBTA 4JI0F 3Q89A 1I94F 2BW2A 4XO0A 2KDOA 4HT7A 3GSDA 1S1UB 5D15A 3MEGA 3QQCD 1REVB 1NH7A 2MY7A 2VL1A 4IG0A 4DV5F 4JI0J 1N33F 3OR2B 3RBZA 4DUTA 4KFBA 3BN4A 3H2UB 3NWGA 3MMCB 2K1RB 1WI8A 4KTQA 4C9DA 2MYFA 4IH7A 3B4MA 2G0JA 5C7PA 4DI6A 5CCMA 5DG9A 3THTA 3Q8QB 4O3PA 1DBDA 2I8EA 3IA0A 1R8HA 2U1AA 2IVFB 3N6NA 2H1OE 4N8NA 7FD1A 2HFOA 1DURA 2IDEA 3AQOA 1NSQA 1YJ7A 2X51A 3JXOA 1Y5IB 3AXMA 4DEZA 3MTKA 5HATA 1R7IA 3ONQA 1YHQS 3DLKA 2B6AA 3IM8A 2HNDA 2XG8A 4C2MA 1FEHA 1VBXA 3W5ZA 2OAUA 3ENAA 1QUVA 4XK8C 3NCRA 3JSMA 3HVWA 3CDAA 1AXQA 4CTAA 5HJYA 2VICA 4ZHRB 2IYIA 1HNZF 1IKWA 4A8XA 1OWXA 4O3OA 4F67A 4ITSA 1BC6A 1LV5A 2E9RX 4F4XA 2QX0A 4IYQA 3UDCA 1UWBB 3W5XA 1JIHA 1SIWA 2QLFB 1SJFA 2YKPA 2RIJA 3NY0A 2CKWA 5L8RC 1PJ5A 5ETQA 4CLFA 4LF6J 2XS2A 4BCAA 3CCJS 2XSFA 1EA4A 3OL6A 3KMSA 4WZMA 3V81B 2H65B 1JXEA 1KFDA 2VA2A 4DL0C 1FDNA 3H8YA 5CD4A 5CQGA 1UAWA 2D7SA 4F4YA 2PO4A 3WX4A 1VI7A 3G5OA 3WC0A 4A48A 2J0SD 4ZVOB 1X93A 1H38A 3TAPA 5KFZA 1WI6A 2CQIA 2EFPA 2P8IA 2IJRA 4ZLJA 5KT3A 2XY6A 1RTDB 1NMEB 1S57A 2W2MP 4HDGA 1BHNA 3HHLB 1S6OA 1WOOA 1BUXA 2R7OA 4L74A 1Y3JA 2HLUA 4ER8A 4YY3F 4ED4A 3LA0A 1EP4B 2HLTA 5DZ7A 1RXOB 5J1PA 1UVNA 2OD6A 2KL8A 4AL7A 3N0VA 3GB0A 4DS4A 3CSKA 1R8BA 4TY9A 2QTWA 3A8KA 3HFVA 3T6JA 4KFBB 1L3SA 1FXLA 3Q8UA 1YBUA 2VIHA 3M8RA 4ATNA 1SH0A 4Q44A 5I3UA 3LAKA 4KGVB 5KFWA 1WACA 4HEA9 1YJNS 2JLGA 2LFVA 2JBVA 5KG1A 3KHHA 1BGXT 4FPIA 3KLEA 3MM9B 1MWYA 1QAJA 2WRMA 4G6VB 4Q43A 2F9DA 1H3DA 4DR5J 1VQLS 4WIQA 4N41A 2XO7A 4IG3B 4R0JA 1WUUA 4L73A 1VLOA 2KTQA 3QGPA 1Q78A 4ZP6A 5G0RB 4F4AA 2BRLA 3R5JB 3IFEA 3D6MB 4QYRA 5A6PA 2MQOA 5MLCV 5A2QU 2C3PA 1OY9A 4ID5B 1R0AA 2NZCA 4O4GA 4DMZA 2FC9A 1QLNA 1JNRB 2OPPB 3C3LA 2WW4A 3UD5A 2V34A 3NNAA 2DO0A 2DR6A 2QGFB 3GTYX 1FRIA 2J6TA 2Q2KA 1R3NA 2OI2A 4Y6IA 1BQMA 2E7WA 1PBAA 3W8GA 5E7OB 5L9NA 2B5JA 1V3ZA 2KYZA 2PEHA 3TAMB 2UU9F 2C3MA 3PTWA 5I3QA 1T9XA 4RUBA 2MXYA 1K44A 4DV7F 1R6VA 3I6PA 4HHHA 1ZYQA 4ECSA 4RNOA 1S1TA 1Q8IA 3PEHA 4PYDA 1N0UA 3IRXB 1T05A 4MIWA 2B8PA 4RW9B 3TEHB 3WIUA 4BLGA 4M5HA 2A6OA 5K9FA 2IY5B 4Y65A 1P1TA 1Y5LB 2HRYA 4GKJF 3VAJA 3CJRA 4U8YA 4CT9A 1KS2A 2ZH5A 1S49A 2RSQA 4ID5A 1V3RA 5E3PA 5JXSA 3KHLA 2WONA 3JTPA 1JMTA 1S1VB 4DG1B 3BO4A 2VODA 2ALYB 4ETXA 2H5EA 1AA1B 1RCXB 2HKEA 2HK3A 3HD1A 5DQHA 1RGVA 5KT7A 1RTDA 2GA7A 1KLMA 3QYYA 3ZC4A 4X64J 1VBKA 2J9CA 4XDDA 4GVBB 1YDLA 2RT3A 1LFPA 1HL6A 3EE3A 2ZWOA 3BREA 1FWPA 4H4KC 3SIPB 1U8WA 4RUCA 2W9BB 2R2TA 3FMWA 1QD1A 4TLQA 3NP5A 9ATCB 4ZPAA 5K5MA 4NA1A 4QWBA 4MYTA 3H4BA 4RBUA 2FVPA 2E1CA 1QTNB 2J7WA 3C2PA 4URGA 2DHSA 4CO2A 2OPQA 2DCLA 2YWGA 4ENOA 3KLGB 4OI0A 4QU6A 4HI2A 5D8HB 5LXYA 3WX8A 4IDKB 4MKVA 5DDOC 1R8AA 1WD6A 2N7CA 4KAIA 3KUEA 1RT5A 1JLEB 3LP0B 1X9SA 2LA4A 5A8KB 4DR4J 2DH9A 2WVBA 2V50A 2Q6BA 2GVZA 3LH2S 2V69A 4PG7A 2A2CA 4NI2B 4NPOA 4LT6A 5J1EA 1RKIA 4XPEA 3NG8A 1Y00A 4KV8A 2W8KA 1UVLA 2EW9A 5C24B 3NMRA 5A8RB 2OJ3A 3POTB 3D0IE 2YWKA 4YP3A 2JVOA 4GO7X 4URQU 4J5OA 2CJXB 5ETKA 2XBPA 1Q4RA 5CHCB 3MR3A 1HI8A 2DNZA 2CADA 1TQLA 2DRAA 3SQGB 1XWLA 1X4DA 4OV6A 4NL5A 1FI4A 5T41A 2FIUA 3SFGA 2VKZG 1VDHA 2V5HG 4M1KA 5F9NA 2RDJA 1K0VA 1ZTTA 4LSNA 2W9CB 1Q86T 1D09B 2DB1A 1C0UB
chains in the Genus database with same CATH topology
4HV0A 2AY0A 2K5JA 1ARQA 1B28A 1MYLA 1NLAA 3BKFA 3QSIA 2BJ1A 2WVDA 1BDVA 2F1FA 1Q5YA 3FMTA 3H87C 2WVBA 2JXGA 1MYKA 4FXEA 1EA4A 2WVEA 1BDTA 2CAXA 2NZCA 2WVFA 2BA3A 2K6LA 3PHTA 1B01A 2BJ7A 2H1OE 2CAJA 2K9IA 2RBFA 2BJ3A 3BKTA 2K29A 3QOQA 1P94A 2JXIA 3LGHA 2HZVA 1U9PA 3FT7A 3VW4A 1PARA 2BSQE 3VEAA 2Y3YA 3OD2A 2FGCA 1Q5VA 2GPEA 1X93A 2BNWA 2CADA 1BAZA 2K1OA 3BKUA 2WVCA 3VEBA 2CPGA 2JXHA 2CA9A 1QTGA 3GXQA 2HZAA 1MNTA 2BJ8A 2KELA 4D8JA 2BNZA 2PC6A 1ARRA 2BJ9A 1IRQA 4ME7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HV0 A;  2AY0 A;  2K5J A;  1ARQ A;  1B28 A;  1MYL A;  1NLA A;  3BKF A;  3QSI A;  2BJ1 A;  2WVD A;  1BDV A;  2F1F A;  1Q5Y A;  3FMT A;  3H87 C;  2WVB A;  2JXG A;  1MYK A;  4FXE A;  1EA4 A;  2WVE A;  1BDT A;  2CAX A;  2NZC A;  2WVF A;  2BA3 A;  2K6L A;  3PHT A;  1B01 A;  2BJ7 A;  2H1O E;  2CAJ A;  2K9I A;  2RBF A;  2BJ3 A;  3BKT A;  2K29 A;  3QOQ A;  1P94 A;  2JXI A;  3LGH A;  2HZV A;  1U9P A;  3FT7 A;  3VW4 A;  1PAR A;  2BSQ E;  3VEA A;  2Y3Y A;  3OD2 A;  2FGC A;  1Q5V A;  2GPE A;  1X93 A;  2BNW A;  2CAD A;  1BAZ A;  2K1O A;  3BKU A;  2WVC A;  3VEB A;  2CPG A;  2JXH A;  2CA9 A;  1QTG A;  3GXQ A;  2HZA A;  1MNT A;  2BJ8 A;  2KEL A;  4D8J A;  2BNZ A;  2PC6 A;  1ARR A;  2BJ9 A;  1IRQ A;  4ME7 E; 
#chains in the Genus database with same CATH topology
 5BYQ A;  4U6P A;  2CUY A;  1KD1 T;  1TUW A;  2DYA A;  3C14 B;  2XC9 A;  2ZH3 A;  1LWC B;  1O5J A;  1RU2 A;  3EPI A;  3TAN A;  1RTH A;  2VQE J;  2VG7 A;  3J7Y I;  1HR0 F;  2EVZ A;  4C11 A;  2P9E A;  1YGY A;  3RUB L;  1T03 A;  4DV3 F;  3QAU A;  1RK8 A;  1WEZ A;  4NLG A;  4KKO A;  3BSC A;  2W9B A;  4ILL A;  1RT3 A;  2F7V A;  2CDR B;  3MEE A;  3J7Z 5;  2KH9 A;  1G4C A;  3NGS A;  2CZ4 A;  1B0V A;  1HQU A;  4DL4 A;  2RH3 A;  3W66 A;  2FUG 9;  1SQE A;  4ZVQ B;  3C16 B;  3EJM A;  4DSJ A;  4QWA A;  4RWW A;  1HW8 A;  2RF2 B;  3FCH A;  1X0F A;  2IMW P;  1UFW A;  4JYA F;  4KO0 A;  4JI8 F;  2KOE A;  3G9C A;  3QID A;  1OY8 A;  5F8G A;  5DG7 A;  2UUB F;  1T11 A;  2UVW A;  5KG0 A;  1X4E A;  2E5H A;  2R7V A;  3FCV A;  4F0M A;  2KT3 A;  3G2X A;  2C2O B;  3HHL D;  4ZVF A;  2B51 A;  2CAX A;  1PJ7 A;  1N6Q B;  1B64 A;  2DGT A;  2DK2 A;  4DXL A;  1FK9 B;  2RS2 A;  5HMZ A;  1R8P A;  2XMU A;  1S97 A;  2I0X A;  4RU2 A;  1L3T A;  2DKO B;  4DL6 A;  1YKW A;  4ZVG A;  4BC7 A;  5EWG A;  1E6V B;  3C8Y A;  2C42 A;  2OFH X;  1B0P A;  3O6Q A;  2VBX A;  3IN5 A;  3CXC R;  3BSN A;  1DZ5 A;  4FPR A;  4LF4 F;  3NRB A;  1N5S A;  1UKU A;  1WKK A;  2D41 A;  2NUH A;  5DRK A;  5L1J A;  4NYP A;  4OL8 A;  1K0T A;  1NK8 A;  2HQC A;  5U47 A;  1TKT A;  2LDY A;  5AXL A;  2YNI B;  3KLF A;  1CEZ A;  4DPT A;  3IRW P;  2RQM A;  2GMH A;  2WK4 A;  4DV2 F;  1FNO A;  4OZ5 A;  1HQE B;  4EUV A;  2R3V A;  1JB0 C;  2IA0 A;  3QGI A;  5HSP A;  3K5N A;  1CS4 B;  1VCT A;  3MM7 B;  1O8B A;  4M95 A;  1FRX A;  1RAD B;  3CJ3 A;  3HKZ D;  3D7S B;  2UXB F;  1S6P A;  1NH8 A;  1V5I B;  4YR0 A;  4KH0 B;  4Y34 A;  3FZ2 A;  2FPH X;  3GG0 A;  2OSR A;  8RUC A;  1O51 A;  3I32 A;  4OJH A;  3K5P A;  2NPF A;  1YJW S;  2PEB A;  2ILY A;  1S7H A;  3VAH A;  1YVF A;  4X62 J;  5HMY A;  3HXM A;  3Q23 A;  1CJV B;  4EO8 A;  1B70 B;  2EEY A;  3BH6 B;  4KH1 B;  3N28 A;  4BHQ A;  1NK9 A;  4OHY A;  4OZ3 A;  4ED0 A;  4Q7A A;  4K4S A;  4IO1 A;  2JVR A;  2XHW A;  3VV2 B;  1NJW A;  5KFB A;  4B9U A;  1RLD A;  3C6U A;  4I6A A;  4LVN P;  1KRP A;  4JI7 J;  4NLY A;  3MM5 A;  4M5G A;  2FYX A;  4ZIT A;  2B9W A;  2BJE A;  3OUY A;  3Q22 A;  3HO1 A;  3GYG A;  4I7F B;  1XER A;  2E44 A;  4DF4 A;  2JL9 A;  2RDI A;  1ZA1 B;  2HS0 A;  1AUD A;  1S76 D;  1UMJ A;  3JTO A;  1DFD A;  1CJK B;  2VPY B;  1WKJ A;  3MPV A;  4NYZ A;  4WE1 A;  1S9E B;  4CLT A;  5I4M A;  1K73 T;  3GU0 A;  4O3R A;  4ZVR B;  3D68 A;  3PW2 A;  3KLE B;  3S8S A;  1BAZ A;  3I56 S;  3RAX A;  2FLN A;  4GKK J;  2KJW A;  3W8P A;  4FYX B;  3BN7 A;  1FDA A;  4C3K A;  4CI0 B;  3ZXW A;  1WDT A;  3NAH A;  1TR0 A;  2VBW A;  3ETM A;  1RT4 A;  3MEC A;  4QR2 A;  4RNF A;  2XY7 A;  1F2G A;  2XSJ B;  2GIR A;  2ZD1 B;  4YB7 A;  2FC8 A;  2MHE A;  1HBO B;  2Y1R I;  3OR2 A;  4G3I A;  5T7L A;  4MKY A;  2R8I A;  2X1B A;  4FF4 A;  2YPZ A;  2QA4 G;  2V68 A;  2AZ1 A;  4A47 A;  2YQ1 A;  1YJU A;  3LPY A;  1TU0 B;  1YK9 A;  3PDN A;  1EJ7 L;  1U25 A;  2M2B A;  1ZAV A;  2AJ2 A;  2ZVS A;  3HJV A;  2GJ2 A;  2H51 B;  3BM7 A;  3FSX A;  1U26 A;  3NEK A;  5HLF B;  4B3M F;  2YKM A;  4JI3 F;  2IRU A;  4ZN3 A;  4ZMM A;  4F02 A;  3NKY A;  1XJW B;  5JUM A;  2DGQ A;  1RTI B;  1FJC A;  2CJY B;  1URR A;  4O0I A;  4B3M J;  1CBK A;  2MQQ A;  3IBF B;  2FY8 A;  4HLB A;  4IH6 A;  1SC4 B;  4KHP J;  3MPU B;  1ITP A;  4DPX A;  1I5O B;  1TKZ A;  1TAU A;  1KP6 A;  3L09 A;  2JHE A;  3DHW C;  4OYM A;  2OKQ A;  2NLW A;  1U24 A;  3IGN A;  4LRB A;  3B82 A;  2DIT A;  1UW4 A;  5BXI A;  5C2G A;  4DPO A;  1VBY A;  1N0V C;  3PVX A;  2AY0 A;  1NZA A;  5AJ3 J;  2IC3 B;  1X60 A;  2CPE A;  3KLI B;  4OX9 F;  1A9N B;  2EFN A;  2UUT A;  3W2W B;  5F8L A;  1X5T A;  3D66 A;  5GAG U;  3E01 B;  4U95 A;  3H5U A;  2OTL S;  3PNI A;  2K9I A;  1GX5 A;  3KJN B;  2MZJ A;  6FDR A;  2K29 A;  3DLJ A;  3HX9 A;  4WYL A;  4YDD B;  1IBL J;  2A0F B;  2E5G A;  3QMQ A;  2DNL A;  1P9Y A;  2B4O A;  4UT4 A;  2Y3Y A;  2A6M A;  2FGC A;  2GS8 A;  3D3B J;  2HPU A;  2XMT A;  4AD6 A;  1L3U A;  1S9G B;  1V5V A;  1NK7 A;  4K50 A;  4QYZ J;  4NCG B;  4DR3 J;  2ADL A;  3VZI A;  1YTY A;  4F2R A;  2AJQ A;  1NRK A;  4OI1 A;  3R6G B;  4WWS A;  4FN5 A;  2X1A A;  2FJE B;  4WP3 A;  2GV1 A;  1U1K A;  1FTR A;  4AE5 A;  1S9F A;  3LWM A;  3PZP A;  3RZA A;  4ED6 A;  2YQ3 A;  4QIV A;  4G1Q A;  5KFF A;  1S1X A;  1IXK A;  1MMD A;  5D0H A;  3J7A 1;  3BYP A;  4MH8 A;  3BJY A;  2F8H A;  3T5H A;  1S1U A;  1C1B A;  3CJT A;  4ZLN A;  3M2R B;  2MKI A;  2G2Y A;  7FDR A;  1VC0 A;  3TNV A;  5KFJ A;  1J2V A;  2HWH A;  2LMI A;  4CLZ A;  2WB1 D;  4KIA A;  2BYC A;  3G82 A;  1NPR A;  2EXU A;  2GZO A;  1WHW A;  3Q8V A;  1M0S A;  3ZNU A;  4PRF A;  2LCW A;  1U1R A;  2CA9 A;  2G2Z A;  1LKZ A;  4ES3 A;  3TZX A;  4N5S A;  3FSI A;  3VAK A;  1TL3 A;  2GC8 A;  3MR7 A;  3AH6 A;  4DV6 J;  4ECT A;  2HHS A;  1RCO B;  1UVK A;  2I1R A;  3MF5 A;  3SDE B;  3V4M A;  3MUV P;  5C24 A;  3T5K A;  2XHC A;  1RAA B;  2KFY A;  1CVJ A;  4RUH A;  5F0U A;  4LR8 A;  1MG7 A;  4I1T A;  4KGX B;  5HVF A;  1E6Y A;  3CCM S;  2KRB A;  4R25 A;  1UEV A;  3BGL A;  3GPA A;  3M2V B;  4O3Q A;  1RTH B;  2XMW A;  1MNE A;  1T03 B;  3GFZ A;  2G1D A;  4WFY A;  5FDL B;  2XYP B;  3UDV A;  3VR1 A;  4X65 F;  2VJV A;  1KC8 T;  1AZS B;  1HI1 A;  4LRC A;  4NRU A;  1DQ8 A;  1KBR A;  3I96 A;  4C6A A;  2Z56 B;  3TI0 A;  3KK2 B;  2AYE A;  4DQP A;  4I69 A;  4NLS A;  3C14 A;  1Q95 G;  2QSF A;  5KFI A;  3OD2 A;  5KOX A;  4H4K A;  5T14 A;  4CH7 A;  2J5A A;  3EMT A;  4LFA J;  5AE3 A;  3C6T B;  1ZS6 A;  4JV5 J;  2H5I B;  1NK0 A;  4J9V A;  2ZNZ A;  2MQP A;  2PE8 A;  2MKH A;  1BWV A;  1RT6 B;  2UV8 A;  1SJ3 P;  3H98 A;  5D77 A;  1SUQ B;  4OYZ A;  3PW5 A;  3MR5 A;  1XR5 A;  3DFE A;  4FVC A;  1D3W A;  4QOT A;  2VA3 A;  1RWN B;  2MKJ A;  5KG3 A;  3UNY A;  3LW5 C;  1EET B;  1ZM9 A;  2HVZ A;  4JI2 F;  1RBA A;  5B0B A;  3BQ2 A;  1Y7P A;  4YOE A;  1P9Q C;  2W2N P;  1HAR A;  2D74 B;  4IFV B;  3MAA B;  1VIX A;  2XGP A;  3U27 A;  1AYE A;  2DJW A;  3A4T A;  4WFA Q;  4RU9 A;  3A8I A;  2I2Y A;  4U96 A;  1U1L A;  2GQC A;  2D1C A;  3CB4 A;  3FNN A;  1ROF A;  2HQG A;  4CO5 A;  2CJK A;  3PO4 A;  1Q0N A;  1VRU A;  3TX8 A;  3KKF A;  3PX4 A;  1CG2 A;  1NZ8 A;  3CCU S;  1EP4 A;  2CQ3 A;  2G2O A;  3U1L A;  2AV5 A;  5LMU F;  2GO8 A;  4CH0 S;  4U7C A;  2V4R A;  3L7P A;  5LXR A;  2CQC A;  5K14 A;  3O5T B;  3KLV A;  2P6T A;  4OIX A;  2DNY A;  2ASL A;  4C8L A;  2WSF C;  3CC7 S;  1FE4 A;  1UZD A;  2FJB B;  5EWF A;  4A8W A;  4ED8 A;  2J76 E;  1XC9 A;  5CYQ B;  5KFK A;  4TXS A;  5ETM A;  4PXB A;  3CT9 A;  3HVR A;  2JFK A;  3OTB A;  3BYR A;  1GEH A;  1H73 A;  1YI2 S;  1NBE B;  1SH3 A;  4LFC F;  3LGM A;  3R5C A;  4ZK7 M;  4Q0B A;  3J7Y U;  1VRT B;  1KHV A;  2MQN A;  4WP8 A;  3S7R A;  4R5P B;  2JEF A;  4LFB F;  3NGR A;  3OTD A;  2CFX A;  4DZD A;  1Q81 T;  4L75 A;  1U0H A;  4LFC J;  3OR1 A;  1YBA A;  2ZM6 J;  5SZT A;  4EYH B;  5K8O A;  1RWW B;  3PYG A;  2HQI A;  4PWW A;  5AXK A;  1DHM A;  3MED B;  4K5R A;  2XM3 A;  2YNH B;  3TJ8 A;  5IWA F;  2CPG A;  1FKP A;  2YWH A;  2GHV C;  3OTO F;  1H2U X;  2BNZ A;  2BV3 A;  2NXE A;  3A8E A;  2XZW A;  3KJQ B;  1I94 J;  1FRJ A;  4CM0 A;  2IJN A;  3OVS A;  3ADA C;  5F8I A;  4F4W A;  3T1H J;  1S1W B;  4JP8 A;  1IBK F;  3MXH P;  3RBE A;  2MKY A;  3BDP A;  2G0I A;  4QPX A;  1UFK A;  2GX8 A;  3F41 A;  4H54 A;  4PPD A;  3RU0 A;  3W65 A;  4BC9 A;  4F3O A;  2PFF B;  5F8M A;  2K6L A;  5ETP A;  5C42 A;  2F63 A;  2GJI A;  1JKH A;  1BE4 A;  4TVA B;  3S6E A;  1U2R A;  3TUJ C;  4KHP F;  4UOF A;  1K1Q A;  2WBM A;  3FBF A;  2MPU A;  4F7V A;  1IM4 A;  3M4X A;  1VGY A;  4RBV A;  1JWW A;  1T9U A;  3OUY B;  5KFG A;  5IZH A;  1CC8 A;  1RT1 B;  4WFZ A;  2CPD A;  3T1Y F;  3P5B P;  1VC6 A;  4XDC A;  3LWL A;  2HRT A;  1J5O A;  2COL A;  5KT6 A;  3OHA A;  1S1W A;  3KG1 A;  3M1V B;  4LR9 A;  3V6H A;  3MAH A;  2ZD1 A;  4JBC A;  1KDN A;  2CJA A;  4ZP9 A;  1FHT A;  1UWA A;  3AFG A;  3MM6 A;  1S0V A;  2GAH C;  1RHJ B;  2FGO A;  1NPP A;  3FQK A;  1GMV A;  3G87 A;  3G6E S;  3OL7 A;  3UCU P;  1Z1Z A;  1NDC A;  1ACM B;  3PHT A;  1HNI B;  2HMI B;  2BJ3 A;  1OJ4 A;  4TYA A;  1SB6 A;  2I38 A;  1D8Z A;  2ABY A;  3HHL A;  3ZZU A;  1M5V C;  3I5A A;  1KSP A;  2R7S A;  3TAQ A;  1T94 A;  2MZT A;  2EBE A;  5DET A;  4DR3 F;  3AB4 B;  1VQP S;  1A7G E;  3QT5 A;  2CQH A;  3ICL A;  2F9J A;  4NLQ A;  5MAO A;  3JSM B;  2MDA A;  3GII A;  1Q8L A;  1Q8B A;  2JC0 A;  4A8K A;  2J7K A;  4P73 A;  3ISZ A;  5HLF A;  5B0C A;  5D3G A;  3ISN C;  3P6Y C;  5KFU A;  1QDU B;  2WHO A;  1N88 A;  1JLA A;  3H0P A;  2QN6 B;  3F56 A;  3L7U A;  4P6Q A;  4ZPD A;  5A8K A;  4LF5 J;  1BMQ B;  3FMT A;  2E7V A;  1WSR A;  3E01 A;  1H98 A;  2LLZ A;  3CMA S;  2ZKU A;  5ETV A;  1FKO A;  3OQ2 A;  3OTE A;  2YVS A;  4QWE A;  1QAX A;  3RB3 A;  4JI4 J;  1K1S A;  2JXI A;  4YN3 B;  3MGJ A;  5KG2 A;  2BE2 B;  4RKU C;  1SL2 A;  3P96 A;  1NHK L;  2LDI A;  1S6U A;  3N6M A;  1BQN A;  3MCN A;  4FF1 A;  1RT1 A;  1SBR A;  7AT1 B;  1X4G A;  4J9K A;  5IT9 U;  4QWD A;  4ES1 A;  4K4V A;  2ZUA A;  3WQP A;  5HBM B;  2C2D A;  2HUR A;  1EAY C;  4O0N A;  1DTQ A;  3PY8 A;  4O23 A;  2MLX A;  3ILJ A;  3OXG A;  2E1M C;  2O1P A;  4WII A;  1U6B A;  3BGU A;  2MMY A;  2BEF A;  3GG1 A;  1RZM A;  2Z0G A;  3HUL A;  3MTJ A;  3K57 A;  1FRL A;  3NNC A;  2DXF A;  2DY9 A;  1RAO A;  2VPZ B;  2VB6 A;  4CO4 A;  2RNE A;  4PXC A;  5J2N A;  1N5Q A;  1RWP B;  1TK8 A;  1PCA A;  3SI8 A;  2Q6C A;  4IKA A;  4KKO B;  1IBC B;  5KFQ A;  2WW8 A;  2KM8 B;  3KYL A;  4AXI A;  4P2M A;  3R2D J;  3IR7 A;  2NR0 A;  2P9C A;  3IXQ A;  3MMC A;  4KRW A;  1X5S A;  3LTO A;  3TZY A;  3H90 A;  3ENW A;  5IT9 Y;  4ECW A;  4L3N A;  2DGV A;  1F3F A;  3IC1 A;  1RHK B;  1WF2 A;  1FX4 A;  1VRU B;  2M9K A;  2N82 B;  2VON A;  1R6Y A;  1YJT A;  4QCL A;  1SPB P;  5LL6 d;  1WC6 A;  2EI5 A;  4QU7 A;  2VHG A;  2YKQ A;  1DY3 A;  1QAY A;  4CWB A;  3KK3 A;  1YRT A;  8ATC B;  1FA0 A;  5FLX Y;  1YG0 A;  4A4J A;  2ZNY A;  5CCL A;  2DVI A;  1S99 A;  2Z30 B;  4WJB A;  3VGT A;  1HW9 A;  3P49 B;  3TVZ A;  1SJR A;  4IFY A;  4J7C A;  3SQG A;  4I2Q A;  2KO1 A;  3KDN A;  3G82 B;  1N5V A;  2CNN B;  2X7I A;  3BKT A;  3KHG A;  1XEZ A;  4MKB A;  4NYO A;  1PG5 B;  1LWF B;  3ZFV A;  3AD7 C;  3GCX P;  1N36 J;  4NLP A;  1BQN B;  2IAJ B;  1Q7L B;  5J2Q B;  3E3X A;  4P72 A;  3Q0A A;  2N3L A;  2J8S A;  2WZ1 A;  3EVO A;  2RRA A;  1HFE L;  2IM3 A;  3CED A;  3GCW P;  1TV6 B;  4FNI A;  5BR8 J;  4AND A;  2R2S A;  3UO0 A;  4LMZ A;  3FC9 A;  3IWN C;  2HWT A;  4OZJ A;  1N4L A;  2Y1L B;  5HO4 A;  2C28 A;  1FXR A;  3CWJ A;  1NK5 A;  2FJW A;  3CD0 A;  3CJQ A;  3M8S A;  1KVI A;  2XB2 D;  1NJX A;  2I5J A;  2JEJ A;  5LT5 A;  4DFJ A;  5L46 A;  3MM7 A;  4ERD A;  3IAM 9;  8AT1 B;  1ZM3 A;  5J2P B;  2H4W B;  3GYX B;  1JLQ B;  1HPZ B;  3EXC X;  4ILR A;  4ZVH A;  3AJ2 A;  4WPA A;  4DSF A;  3AT1 B;  3A12 A;  3MAA A;  1QY7 A;  2D9P A;  2DNO A;  4HTI A;  4KO0 B;  2FJA B;  3W63 A;  2ROG A;  4DV1 F;  4MKA A;  1U1M A;  1X9W A;  2HHQ A;  1QVG R;  4WFN Q;  4KGZ B;  3U1M A;  4E0D A;  2BUN A;  2CQP A;  4PZV A;  3PR4 A;  2UXC F;  5FJ4 A;  3NGU A;  3DLB A;  1ZPW X;  1HBU A;  1TVR A;  2AKW B;  2OEK A;  3CE8 A;  4NXN F;  2EK1 A;  3UWT A;  1HMV A;  1VK8 A;  4F25 A;  2CPH A;  1VMB A;  2O66 A;  5CZX A;  3UN5 A;  1FDD A;  4Y2K A;  3W9H A;  1RWV B;  2CZ9 A;  3GXQ A;  2W4C A;  3IWX A;  2HNZ A;  4MK7 A;  2AT1 B;  2W7A A;  5CYM B;  4C48 A;  2B7B B;  3BSO A;  4RW8 A;  2J0W A;  2W2O P;  4A8O A;  3VAM A;  1S72 S;  1NJZ A;  4RW6 B;  3ULH A;  3NAI A;  2RB7 A;  3N01 A;  5CD4 H;  5HL7 Q;  4ED2 A;  5EHH A;  3A3P B;  3PFO A;  2JLF A;  1V6H A;  2ZOF A;  2V4J A;  2LU2 A;  1NKC A;  4X2B A;  2WVF A;  4M8L A;  3WDO A;  1LW2 B;  4QBU A;  3PYD A;  4JI6 J;  1WKL A;  5IQQ A;  4DN9 A;  5KFA A;  3SBM A;  1XNR J;  3D67 A;  4AL6 A;  2DNK A;  2W01 A;  5EUH A;  2KZZ A;  1H0H B;  2IAJ A;  4P74 A;  3SDE A;  1S79 A;  3CJK A;  3VCD A;  2KFZ A;  4JYA J;  4DL5 A;  3JB9 k;  2DD8 S;  4HHJ A;  1F1B B;  1VQS A;  5E3Q A;  3OSP A;  3CCT A;  1IR0 A;  4NX9 A;  3PX6 A;  2DH7 A;  1SKU B;  4ZJL A;  2ZE2 A;  4DOZ A;  4TU8 A;  2HZA A;  2FJV A;  2V9K A;  2CQG A;  2MLZ A;  5DM6 Q;  2CAJ A;  4KGM A;  2M5Y A;  1UEK A;  4KSE B;  4LBI A;  4QIE A;  2HFZ A;  2HGN A;  1S10 A;  5I3U B;  1MW7 A;  3GZ7 A;  5IV3 A;  1HPZ A;  4Q8E A;  2C2M B;  1H2T Z;  5HBM A;  4DR7 F;  4KY3 A;  3M6X A;  2VG7 B;  5KFT A;  1RJJ A;  3IRX A;  5KT2 A;  2HHU A;  3HFZ B;  1LK5 A;  4DR4 F;  1WG4 A;  4DL7 A;  4J37 A;  3RBX A;  2GAG C;  2CXE A;  1U9P A;  3J81 U;  1RYS A;  2DIV A;  2MKK A;  1FNX H;  2RKI A;  1YJR A;  5CH7 B;  3T5J A;  4WZQ A;  2KG1 A;  1D0E A;  2OPP A;  2C3U A;  4DCJ B;  1LNQ A;  3C15 B;  4HDH A;  4YQW A;  3DRX A;  3HKW A;  4ECV A;  3AJ1 A;  2XCA A;  3H25 A;  3KG0 A;  2FVC A;  2XI2 A;  1WC5 A;  4CO3 A;  2XMM A;  5B0E A;  3D1Q A;  5HJX A;  4B9N A;  1GAO A;  2BKO A;  3PFE A;  2KXN B;  2VDI A;  4W90 B;  2C1E B;  1RP5 A;  2G0C A;  3CGI A;  3PXG a;  4X4S A;  1Q5Y A;  2VAS A;  4Q2L A;  4FDF A;  1QTM A;  3HLU A;  2ZZN A;  3EGZ A;  3ENV A;  3QZ8 A;  1VFJ A;  1VOM A;  1D8Y A;  4P52 A;  3UCG A;  1U45 A;  4OHZ A;  1JXL A;  4NMX A;  4PQA A;  1F9F A;  2VPW B;  4UZB A;  2PMW A;  5DLG A;  3NOC A;  5GVQ A;  3KHR A;  4NXM F;  2H9Z A;  4IDK A;  4K4Z A;  1OG7 A;  4DSE A;  2OEJ A;  1U09 A;  2GIQ A;  4GMK A;  4PCQ A;  2CVE A;  4HAC A;  2AGQ A;  1XMO J;  1N48 A;  2XLK A;  2U2F A;  2JOQ A;  3CJS A;  3DKD A;  4UST A;  2DPJ A;  1N52 B;  3BS9 A;  4ED5 A;  2IVY A;  2HIY A;  1RLC L;  4OYI A;  3RYL A;  4DFP A;  1OPI A;  4F0H A;  4CLL A;  1WC3 A;  1IKW B;  2NYI A;  2V8D A;  3I5C A;  4P71 A;  4PG6 A;  4CT8 A;  2D9O A;  3HM9 A;  3PW4 A;  3CCL S;  1TL1 B;  5HN0 A;  3FRZ A;  1B28 A;  2BKP A;  2YWE A;  3PRB A;  4CM2 A;  4K8R A;  4AYB D;  4DU7 A;  5K20 B;  2YXL A;  3BPD A;  2BJ1 A;  3L7O A;  1S77 D;  1EB0 A;  2HND B;  4FXW A;  1JJ4 A;  2HHW A;  4FS1 A;  2DHX A;  2HAF A;  2IJF A;  3QPI A;  1NUE A;  2IMO A;  4R8U A;  3DOM B;  1QAI A;  3DMJ A;  5D4L A;  1FD2 A;  2CIM A;  3UVJ B;  1HHQ A;  1HBO A;  3G6Y A;  3QIP A;  5JVH Q;  2HBY B;  1RU1 A;  1XTZ A;  1U1N A;  3KG4 A;  2QEX S;  2IBK A;  4X4U A;  4IUF A;  5LSO A;  2XZT B;  4Y2A A;  4H4O A;  5J2N B;  4C98 A;  3FJ2 A;  1ZZF A;  2QT7 A;  3TJA A;  2CNL B;  2YNF A;  3S01 A;  4ECX A;  1S1T B;  1T9V A;  2QSW A;  3FCW A;  3JSR A;  2MSS A;  1CPZ A;  2KHC A;  3OXL A;  3IP0 A;  5KFL A;  4DHV A;  3JQK A;  2JRS A;  2ZBR A;  1RWM B;  3LP2 A;  3N6L A;  5IS2 A;  4OZ2 A;  1M5S A;  2HVI A;  1RAF B;  1MML A;  3R5D A;  1S0M A;  1KQS R;  3HHD A;  1TKX A;  3EGW B;  5AT1 B;  4A46 A;  5DDQ C;  3G71 S;  1F5C A;  1FER A;  1PKU A;  4MIA A;  2DGU A;  3OLB A;  4X4O A;  2VFS A;  3SQO P;  4LF9 F;  1T9W A;  2OMO A;  4Y00 A;  3G96 A;  2OPS A;  3RJM B;  3CDU A;  1P8G A;  3U7J A;  3DU5 A;  5GAD U;  4B3T F;  4A8F A;  4NWB A;  3VW4 A;  3K5O A;  1LXN A;  5H9F K;  4ZPW R;  1UW9 A;  1QSS A;  3G8T A;  4DR5 F;  2YNG A;  3GLJ A;  3O44 A;  1YJ9 S;  4DR1 F;  4QIW D;  4NLT A;  4YR2 A;  2W9A A;  3DC2 A;  3M8W A;  2DTJ A;  1Y11 A;  2FHK A;  2ZIT A;  3DRS B;  4LUB A;  2L3M A;  2AGP A;  2V2K A;  1H7X A;  2RDD A;  2VG6 A;  2E5L F;  3H7H B;  1JJC B;  3KOA A;  4J91 A;  4DBQ A;  3K2Y A;  4HAC B;  1QE1 B;  5KG6 A;  2VC0 A;  1S7I A;  4DV1 J;  3LAN A;  3PKM A;  3MOZ A;  1HWJ A;  1KEK A;  1G1X A;  4DX5 A;  3AOB A;  4UQT A;  2JNJ A;  4FKX A;  1U0S A;  2FD2 A;  2KB2 A;  4Z37 A;  1D9D A;  4B02 A;  1J5E F;  2OGU A;  3IR5 B;  2E1P A;  3OT9 A;  2FZG B;  1KNZ A;  3POT A;  1TKT B;  5HMW A;  4WU3 A;  3DLK B;  5DM7 Q;  1MRO A;  4I2Q B;  1GNK A;  3R2C J;  1RAC B;  2GCF A;  5C2C A;  2M88 A;  3OPK A;  3QT8 A;  4KPC A;  4WCE Q;  2H1Y A;  3GIK A;  3V6K A;  1S4F A;  2PC6 A;  1UTA A;  4DX6 A;  1ZPV A;  1WSV A;  3D6H B;  1CUL B;  5EDW A;  3RRH A;  5D0R A;  4YB6 A;  3RG6 A;  2DXE A;  1EKS A;  3NLC A;  4UUX A;  2VQF J;  4JI6 F;  3SMZ A;  2J8A A;  4A8S A;  2PI5 A;  4Y2M A;  4A8Q A;  2BXJ A;  1U8S A;  3TJ9 A;  2AYM A;  3BGO P;  3OTC A;  3Q86 A;  4L72 B;  4DL3 A;  1LWC A;  4WU2 A;  2KRR A;  2F4V F;  2F8M A;  1KVJ A;  4AT1 B;  1LQ9 A;  2D3Z A;  4OYO A;  4Y0F A;  3NWR A;  3QRQ A;  1FKP B;  1SIW B;  1N8R T;  5AXN A;  3H4D A;  2HZV A;  2F3J A;  2D3O 1;  2KKH A;  4CZC A;  2BZ2 A;  1E6Y B;  3FZB A;  5L1K A;  1RKJ A;  3PJ9 A;  4FBT A;  3HK2 A;  3UN2 A;  2IRX A;  3GJQ B;  2PMH A;  4OFZ A;  4C3L A;  3MED A;  4HKQ A;  1ZM2 A;  2XWX A;  3QAE A;  4DV6 F;  1FKA F;  1IWG A;  2Q1L A;  1GQE A;  3R7N B;  4NLD A;  2RQ4 A;  1HKA A;  2MGZ A;  4ZP8 A;  1QTG A;  2QA1 A;  1FT8 A;  2OEM A;  3EDQ B;  3UPF A;  2QE5 A;  3GR1 A;  3T9Z A;  4XAK A;  3GFH A;  1NPK A;  1NK4 A;  4OI2 A;  4OZL A;  1DTQ B;  1X7V A;  2XUL A;  1CJT B;  4PYA A;  4W4M A;  4KJI A;  2BVZ A;  2Z2L A;  2ZBP A;  4ZKA A;  2VBY A;  5G4D A;  4AQY F;  1JLC B;  4DWI A;  1JLG A;  3KNA A;  4E98 A;  2EG1 A;  1FEE A;  1Q7Y T;  4EK2 A;  3KUH A;  4RW7 B;  2OO4 A;  3R7B B;  4AQY J;  1CJV A;  2IM1 A;  3VHQ A;  3I82 A;  3QWU A;  2IM2 A;  3E51 A;  4WTY A;  3JYT B;  2AU0 A;  2UUC F;  2R8J A;  1FO1 A;  1GXU A;  2ZH6 A;  1QUP A;  2CWK A;  4RW8 B;  4ZPB A;  2W24 A;  1SQG A;  3MCM A;  4PKD B;  1RAH B;  2ZC3 A;  1NDP A;  5B09 A;  3TUP A;  1GK8 A;  4LIW A;  3PW7 A;  2UUA F;  2BJD A;  3GR0 A;  3M2U B;  1VQM S;  2K7J A;  1CJT A;  3LOU A;  4LSZ B;  3R3T A;  2L9N A;  3TZW A;  3I4H X;  2VQE F;  2BRK A;  5A8R A;  5LMN F;  2XMV A;  2EC0 A;  4LF8 J;  1HBN A;  4DV3 J;  4EBE A;  4USK A;  2XYG B;  4WK3 A;  4KV8 B;  5KFY A;  1FWL A;  2W2P P;  3KLF B;  3R8Y A;  3THP A;  2Y8Y A;  3P45 B;  3AY0 A;  2HFN A;  2IM0 A;  3CDW A;  4J9U E;  4LF8 F;  1YQH A;  2L9W A;  2RQK A;  2YPY A;  3SYZ A;  2V2Z A;  2UXD F;  5DQG A;  3QRP A;  5M2R A;  4DX7 A;  1NM2 A;  1HNZ J;  2HYI B;  3CIZ A;  2JEG A;  2AP6 A;  1FF2 A;  3EX7 B;  2IC3 A;  2HQD A;  1JXV A;  2B8Q A;  3C6T A;  3OFH A;  3UNG C;  1S12 A;  3LP1 B;  3VGS A;  3W2W A;  4B9L A;  2ASY A;  2B9X A;  4C8O A;  3CIM A;  5D4N A;  2KT5 A;  1NHU A;  2AJF E;  4E2F B;  3GIL A;  3V6J A;  2CPJ A;  3ZNJ 1;  3NO7 A;  2MEW A;  1B0T A;  1JLC A;  1DQ9 A;  1YBT A;  1IQZ A;  1DQA A;  2OEL A;  4N8O A;  1UPP A;  3G6X A;  3CCE S;  3TO8 A;  4IOC Q;  3PCO B;  3CCW A;  4AFF A;  4B9M A;  2WVE A;  1GXL A;  2W4P A;  4FVM A;  2XZD B;  4QIF A;  4LFB J;  1IKX A;  1JX4 A;  1DAX A;  1S9G A;  2DO4 A;  3KK1 B;  2RBF A;  1RTZ A;  2OPS B;  1RQ0 A;  2Q79 A;  2RF2 A;  3MOJ B;  2JJ4 D;  3NBP A;  2VDH A;  2UV8 G;  4JI1 F;  1UVI A;  2CZV C;  5H9E J;  4S0M A;  2AEJ A;  1U1P A;  3CC4 S;  3V6D A;  3TZZ A;  2R8K A;  4YB5 A;  3HD2 A;  3UDL A;  2LEB A;  1N5T A;  3MUM P;  2R7T A;  2CJB A;  2D3O R;  4F36 A;  4RW9 A;  1Q16 A;  2OD4 A;  2EPI A;  3GFX A;  1TMJ A;  1LEO A;  1FK9 A;  5F3T A;  2R4F A;  4WYW A;  3HSD A;  4F04 B;  2HFV A;  1HD1 A;  3L9Z A;  4QR1 A;  1RT4 B;  2ZEJ A;  1A6L A;  1TMM A;  1YJV A;  2V8V A;  4W98 A;  4LF9 J;  3NMA A;  4DS5 A;  1XR7 A;  2BE9 B;  3H87 C;  2YNH A;  3CO9 A;  5IT4 A;  3G8Q A;  4PG5 A;  4B3T J;  2F8E X;  4B3R F;  2JDJ A;  1B01 A;  3UE2 A;  1RBO B;  4OJG A;  3IR7 B;  3DMJ B;  3MCS A;  3CJ2 A;  4DV2 J;  1WOS A;  1VJW A;  3FGV A;  4DR1 J;  5IM0 A;  1F2H A;  5KFX A;  5B0D A;  3NGD A;  2YX7 A;  3OW2 R;  1KTQ A;  2BW7 A;  3VEA A;  3BGR A;  5HAO A;  3ILO A;  4ZOS A;  3QRR A;  4BWM A;  2ZVI A;  1ZOT A;  2DIU A;  2ATC B;  2MLY A;  3CJK B;  4DJB A;  3ZZZ A;  1CLF A;  1MRO B;  1M5O C;  1KQG B;  4P7V A;  2XS5 A;  3QSY B;  2WVC A;  1UEU A;  2Z2Z A;  5AJ3 F;  4NLW A;  4ICL A;  4YB1 P;  4LF1 A;  4ZIW A;  4BBY A;  3I55 S;  2VUG A;  2BJ9 A;  2LQ5 A;  2BE2 A;  2ZDO A;  2F65 A;  4M5J A;  1X8D A;  4YDX A;  5KG4 A;  3M32 A;  1N32 J;  1FFS B;  4KR0 B;  3RR7 A;  1JLE A;  3LP0 A;  2I5J B;  4C0O C;  1T9T A;  4LIR A;  3KJV A;  4MIB A;  3KJV B;  3US5 A;  1GFW B;  1F60 B;  1Y5N B;  3G4S S;  2ADB A;  3MPD A;  4ZPT R;  1S6P B;  2LEC A;  2DGW A;  3DLG A;  3UI3 A;  3IGV A;  1LXJ A;  1TV6 A;  2C2Z B;  2R42 A;  5GAH I;  4RUA A;  1TL4 A;  1WEY A;  3DM2 B;  2BAN B;  3W64 A;  3ZZP A;  3V6D B;  3RAQ A;  4B3S F;  1HNW J;  4GKK F;  4AAI A;  1TVR B;  1EZZ B;  2KVQ E;  3EGV A;  1REG X;  1DLO B;  4USW A;  3W60 A;  4AXJ A;  3MPW A;  1RT2 A;  3BZQ A;  1RT2 B;  3MDF A;  4OJ3 A;  4F3Q A;  1ZZN A;  2XGQ A;  2ALZ A;  1YWX A;  2GHP A;  3CJ8 A;  2YWW A;  3F73 A;  4EFA C;  4Z2X A;  3M6W A;  3QFW A;  5JMN A;  3AXK A;  2R7X A;  3MMB A;  2MJN A;  2C3Y A;  5GAG I;  5D0G A;  4DV5 J;  1PYO B;  1RT5 B;  1N33 J;  2CQ2 A;  2HBQ B;  2FVS A;  3ET6 B;  4JV1 A;  4X64 F;  4AL5 A;  3DGP B;  3R5B A;  3FKB A;  5LM7 E;  3RRK A;  4FF2 A;  2DGS A;  3PRD A;  4WFB Q;  2HMI A;  1BXN A;  1OY6 A;  2VV5 A;  2ZOM A;  2M52 A;  3SCJ E;  3M9O B;  1WHV A;  4OQJ A;  3C66 A;  2LYV A;  4OHX A;  3X1L B;  4QYZ K;  2HS3 A;  2XMJ A;  3EM1 A;  3ITH A;  3M9N B;  5E0O A;  3SSS A;  2Y0S D;  3CJ0 A;  1MWZ A;  4LRF A;  4IQX A;  4Q45 A;  3D5M A;  4MJW A;  1M5P C;  2K7K A;  2P2C B;  4IH5 A;  2NCK L;  3OBI A;  1NSK L;  3D6F B;  2KU7 A;  1N54 B;  2YTC A;  4OMF G;  3F0N A;  2M3D A;  4URS A;  4CTA B;  5KFD A;  4ECU A;  3QIP B;  3DLH A;  1FJG F;  1RAJ A;  1S59 A;  3GSI A;  2AWZ A;  4E8U A;  2DNQ A;  1XNQ F;  3OVB A;  1VQK S;  2V0N A;  4KHM A;  4ELU A;  4X4N A;  1VK3 A;  3MD1 A;  2DT9 A;  1BDT A;  4OX8 A;  3OFG A;  5EGY A;  1S5Z A;  3N5B A;  4C0H A;  3FEY B;  2ZBI A;  1W26 A;  4OV1 A;  2XWY A;  3FRY A;  2IBO A;  1DAR A;  1ZAX A;  3M05 A;  1B3T A;  1M1K T;  4OX9 J;  1U2F A;  1YSJ A;  3H5Y A;  2V2Q A;  2O67 A;  1RT3 B;  1UPM B;  4TKT A;  3Q2T C;  3DCA A;  4I56 A;  4DV4 J;  4IO9 Q;  1C1C B;  2LQJ A;  2IDL A;  1QSL A;  2DCU B;  5D6G A;  1Q5V A;  5EX0 A;  3I9Z A;  4JUZ A;  1G3O A;  2KI2 A;  1OHN A;  1VQ8 S;  2LXF A;  2V8H A;  4YHH F;  5LMN J;  1SVD A;  3MEG B;  4DPY A;  4TU9 A;  3MMJ A;  2GGP A;  1JLB A;  2N3O A;  1RWK B;  3ZZR A;  3TAR A;  1NU4 A;  4P2S A;  2NXC A;  2K5J A;  2R2U A;  3QO9 B;  1HBU B;  3PHE A;  2A2B A;  1IJE B;  3GE9 A;  1AFI A;  1WC0 A;  3M8Q B;  1R89 A;  2ZBC A;  1HQE A;  1Y0H A;  4AUK A;  1UA1 A;  2E1R A;  2QIF A;  3I5B A;  5D78 A;  4LF7 J;  2OPR A;  1JQG A;  4RW4 B;  2OFG X;  4HVZ A;  3D0H E;  3KK1 A;  2V67 A;  2VZ9 A;  4YY3 J;  3T5L A;  1ARO P;  3LGH A;  3JSY A;  3H5S A;  3I4P A;  5K14 B;  1SXL A;  4CYU A;  1QJH A;  4FXD A;  4OI3 A;  2W7P A;  4C0B A;  3KTQ A;  5H9F J;  3CCR S;  4DQQ A;  2EFG A;  4CLS A;  6FD1 A;  5GAH U;  2HVE A;  1RDR A;  2PDA A;  1AB8 A;  2L9D A;  2QL5 B;  5ETT A;  1OPZ A;  1RA6 A;  3H2V E;  2HQ3 A;  3IM9 A;  4G1Q B;  3D1H A;  1FDB A;  1IVZ A;  3U1N A;  1ARR A;  4LBP A;  3DOK A;  2YX1 A;  4DQI A;  4FXV A;  2B43 A;  4OYX A;  5HVG A;  2MQM A;  4LSL B;  5FII A;  3G6V A;  1MMN A;  1FES A;  4G1I A;  2QLX A;  4ZVP B;  3VGU A;  3QGG A;  4D3G A;  5HQL A;  4OYW A;  4K4X A;  1T95 A;  3DDK A;  2LQB A;  4RL1 A;  4ECQ A;  1VQ4 S;  4CCH A;  2UXC J;  3RB0 A;  4JI1 J;  4DLG A;  4PAA A;  3TX0 A;  3HVT A;  1K9M T;  2FZC B;  1QM9 A;  1UFL A;  4R0E A;  4ETZ A;  4LRE A;  2QJ3 A;  3N79 A;  3R5G A;  1PC4 A;  3RB6 A;  4LFA F;  1ZH5 A;  4JV5 F;  1TL3 B;  3DI6 A;  2BBE A;  5IWA J;  1HBN B;  2IFX A;  4OZ0 A;  2MZR A;  4OYP A;  1ELO A;  3OTO J;  4RZR A;  4DV0 F;  1SL0 A;  1T3O A;  3IG1 A;  3AQP A;  2XTJ P;  2K1O A;  2ATL A;  2UU9 J;  2DIS A;  1PIE A;  4BWJ A;  4DV7 J;  2FHJ D;  1SIZ A;  1JLB B;  4H4M A;  4UY8 T;  4TLR A;  3HJF A;  2BJ8 A;  4ZA1 A;  2GNK A;  2QA2 A;  4F50 A;  5F3Z A;  1QSY A;  5J1N A;  1AZS A;  4GVL A;  4RPF A;  2B4V A;  1C1C A;  1WG5 A;  1WG1 A;  2UZA A;  3DRR B;  4I2P B;  4I2P A;  2QG9 B;  2WVD A;  3HZE A;  3I87 A;  4FYY B;  4PUO A;  4PUO B;  2RHS B;  1L5U A;  5E3C A;  5KTQ A;  5KFE A;  5IV4 A;  1YRX A;  2VKR A;  3ZTS A;  2UVV A;  2BMB A;  1X4A A;  4C8Y A;  2RRN A;  4PWD A;  1OQ6 A;  3SFU A;  1ULR A;  3H42 A;  5KT5 A;  4RW6 A;  4I67 A;  1Z4U A;  1WEL A;  4JOU A;  2RRB A;  4UY8 5;  2B5J B;  2IVM A;  2QMU B;  2HHH F;  1KVK A;  4B9T A;  5D4O A;  2HWI A;  1I51 B;  1UJ6 A;  3M30 B;  3NS6 A;  3ENQ A;  3BGF A;  3VVT A;  5LMU J;  3TQ1 A;  4IRK A;  1QVF R;  4ZCM A;  2QYG A;  3HT0 A;  1H74 A;  4YFU A;  1C2P A;  1B99 A;  1N34 J;  5KG7 A;  2I6W A;  1TKX B;  4NLU A;  4C8N A;  3WBZ A;  3HT3 A;  2C2K B;  2NXU A;  1U4B A;  4JI7 F;  4QW8 A;  2CQB A;  5KT4 A;  2L48 A;  3MCO A;  2ZWP A;  3NXZ A;  1DJ0 A;  3P8B B;  1XN9 A;  2XYH B;  3L95 X;  3R6L B;  4G65 A;  2PMZ D;  5CXT A;  3CCZ A;  4N7T A;  2W2Q P;  3TVK A;  3SCI E;  3NGK A;  5F8H A;  4NLV A;  3J80 Y;  3FBC A;  3ZZY A;  1MWQ A;  4Q5V A;  4DFK A;  1SC1 B;  3UR0 A;  1U02 A;  3THV A;  2RML A;  5E41 A;  1CQM A;  2QL9 B;  1F5B A;  1CQN A;  2ZDP A;  4B3O B;  4OYB A;  1FRK A;  1M1H A;  2BSQ E;  2MHN A;  3BH7 B;  4P2X A;  3IBC B;  4ECR A;  3VF0 B;  1RB0 A;  1U0H B;  3WZ0 A;  2IYG A;  3QJJ A;  1OYE A;  4OZN A;  2Y0B B;  2B9E A;  3ZZO A;  4L3K A;  5AE1 A;  2KFN A;  2EWH A;  3A1Y G;  4P7T A;  4TYB A;  4K7Q A;  4R8U B;  5I3P A;  2AGO A;  5GAE I;  1RTJ A;  2CQD A;  3L3C A;  3O3L A;  2VPX B;  3CC2 S;  5L1L A;  1SQF A;  1WTB A;  3TEG A;  4N76 A;  2HBR B;  2Y9H A;  2C22 A;  5G0R A;  1PYT A;  2IA6 A;  1A0O B;  4PR6 A;  4LJM A;  5CAB A;  2LKZ A;  5D3G B;  3KLH A;  4NCA A;  3B54 A;  3BSA A;  3TQE A;  4JI3 J;  1X4H A;  4I64 A;  1VS3 A;  4DUZ J;  4Q2M A;  1GX6 A;  3D1O A;  4CDI A;  3LO3 A;  5DGA A;  3V81 A;  2JFD A;  2J0X A;  3PKY A;  3MUT P;  2ZOG A;  3W2V A;  4DPW A;  2WTF A;  4I68 A;  3TUI C;  1UZH A;  3VAL A;  1SKR A;  5IFM A;  3JS9 A;  2BNW A;  2N4C A;  4V1A k;  1GMU A;  3DLE A;  5L1I A;  2VF3 A;  1N5Y B;  1FJG J;  2ZJQ Q;  3D2W A;  3PIO Q;  1U6F A;  1KTV A;  3RW6 A;  1X0P A;  2QLW A;  4Z7Y A;  1PAU B;  3NS5 A;  1UA0 A;  3M1V A;  4DR6 J;  4IQM A;  4HHU A;  4DQS A;  1ARQ A;  1F3V A;  4KYZ A;  5D4P A;  4M5N A;  3V4I B;  2DPI A;  2NZ4 A;  2DHG A;  4U8V A;  2Q43 A;  2M4M A;  4DSL A;  3LQV A;  1VYA A;  2UUB J;  3EVM A;  2Z58 B;  4MK9 A;  2DNG A;  4HI1 A;  5KFC A;  1YLX A;  5CYJ A;  2HNY A;  1XMB A;  1TL5 A;  1YRU A;  3N5F A;  1NK6 A;  1SV5 B;  2A18 A;  1NND A;  1TL1 A;  3LUY A;  3QLH A;  1HA1 A;  3EGN A;  3NGT A;  4RWX A;  5THW A;  4D3H A;  2MGZ B;  2XSJ A;  4OLP A;  2B7C B;  4CO0 A;  5LJ3 Y;  1NXI A;  5LJ5 Y;  5T7L B;  4K4U A;  1G2E A;  2Z4P A;  5IC6 B;  4O3N A;  1NDK A;  4ZVT B;  3K5L A;  2KVI A;  1N5Y A;  3ILL A;  4N47 A;  2FTR A;  3GJR B;  3HPO A;  1UET A;  1U49 A;  1IR2 A;  2RHQ B;  4ALZ A;  3FEZ A;  1NDL A;  3PYF A;  5LSL A;  5GMK a;  1AFJ A;  2R8G A;  1SJQ A;  2BAB A;  3CDB A;  2CNO B;  2ASD A;  2A10 A;  2FZK B;  1Q16 B;  3AA9 A;  3DDN A;  3B4D A;  3MM6 B;  1IRQ A;  1TEL A;  3ZTR A;  4CO1 A;  2HS4 A;  3T9N A;  4NRT A;  2HHP A;  3IMQ J;  1NSP A;  4TQR A;  2R8H A;  3IAS 9;  4WE1 B;  4ECZ A;  4C8Z A;  2VFR A;  2H3A A;  1UJ4 A;  4RNH A;  1KQK A;  3T41 A;  4PG8 A;  5F9L A;  5HP1 B;  2AYG A;  4JI4 F;  2CG8 A;  3V5R A;  4CLW A;  4USM A;  1RSC A;  1ZET A;  2KN4 A;  2BJ7 A;  3FSY A;  1EHW A;  4NLX A;  2JWN A;  4J9P A;  3M9M B;  4DF8 A;  3UVJ A;  2AIR B;  3QZ7 A;  4JI5 F;  1PSD A;  2B6A B;  1V3S A;  4TY8 B;  5C25 B;  5CYQ A;  3QT6 A;  4DDF A;  4ZPV R;  5IM0 B;  3PV8 A;  5BR8 F;  1TL7 A;  4PEO A;  1TK5 A;  4OI4 A;  1ZM4 A;  4EBC A;  3BKU A;  4ID8 A;  1TFY A;  4O4R A;  2CJQ A;  3DRY A;  3EZU A;  3K17 A;  3PG9 A;  4ZCI A;  3C19 A;  1R0C B;  4OLO A;  2J9D E;  1RT7 A;  4M5D A;  3DN9 A;  4UZC A;  2RIL A;  2XQC A;  1ICE B;  2QL7 B;  3A13 A;  4WXO A;  4ZCL A;  3W2V B;  1HWK A;  3BR8 A;  4OHW A;  5L39 A;  4U7U K;  2GVD B;  1PGZ A;  3SSR A;  2CVI A;  3GJT B;  3W3S A;  1GXT A;  1HYS A;  3Q83 A;  1HMV B;  4LBH A;  4OYA A;  4QIG A;  1HLW A;  1FRM A;  1R43 A;  2KJV A;  3EPG A;  1X4F A;  5GME A;  9RUB A;  2BOA A;  1U47 A;  3R97 A;  3Q8S B;  4K5S A;  4WKY A;  1AUS L;  3HMJ G;  1LOU A;  4IOB A;  5KFV A;  1IN0 A;  2HBZ B;  1K47 A;  3GIM A;  2AX0 A;  3MFI A;  2KXH A;  1F9H A;  4PPZ A;  1WEX A;  5E3A A;  1DLO A;  2J0Q D;  3GYN A;  2AN7 A;  2OP5 A;  5HRO B;  2CG4 A;  4HH0 A;  1WOP A;  2X1F A;  1KOO A;  2MY8 A;  2QFI A;  4NA2 A;  4RJV A;  3QNW B;  1OIA A;  4DZ6 A;  1S4E A;  2D3U A;  5LOQ A;  3J7Z T;  3QGH A;  4QPT A;  3HHE A;  4NCB A;  1I1G A;  3M7V A;  5H1S V;  3CD6 S;  4CP5 A;  2AMC B;  2GQ2 A;  3IS9 B;  5IOL A;  5IXU A;  3RBD A;  2N4D A;  3OHB A;  3SV4 A;  3MMA B;  4DQR A;  1OO0 B;  2HHH J;  2OPQ B;  5DJB A;  3PAC A;  3BEG B;  2YH0 A;  3QOQ A;  2VH7 A;  4KGK A;  4O3S A;  1IKY B;  2OML A;  5C5J A;  1N34 F;  1UVM A;  3PIP Q;  2ROE A;  3HHK A;  2XCP A;  3OR1 B;  1PAE X;  1RTI A;  2IRY A;  5HVH A;  1FE0 A;  1VHI A;  2KT2 A;  2XY5 A;  5BJR A;  2H4Y B;  3DRP A;  1B4S A;  4NZ6 A;  2KEL A;  1R8C A;  3DOM A;  2LQ9 A;  3AOA A;  1HHT P;  1HWI A;  1XIQ A;  4ZP7 A;  2WBR A;  5J2M B;  4J9Q A;  3HHL C;  4G1P A;  1HWU A;  2EFO A;  3JSB A;  3PM9 A;  4Q8F A;  2AW0 A;  1RE1 B;  1NHV A;  4B9S A;  2BQU A;  4F26 A;  3DXS X;  4UOC A;  3VAF A;  3QFH A;  3B8H A;  4C11 B;  1SI9 A;  4LF2 A;  4K59 A;  2ZM6 F;  1WNE A;  2V2V A;  2BOP A;  3CTR A;  1TFW A;  2YKN B;  5KFO A;  2HVD A;  2K3K A;  3NOG A;  4KPY A;  3DRR A;  1VQ6 S;  2YKO A;  1S9E A;  2ASJ A;  2GJF A;  1NKB A;  3HHN B;  1P27 B;  3SZ2 A;  2UUA J;  2E9T A;  1RWU A;  3JYT A;  3N4W A;  4X4V A;  4XTT A;  1OQ3 A;  4HYK A;  2AHO B;  2A1B A;  1NAQ A;  3TWZ A;  3QLH B;  2JXH A;  2QMX A;  3VZH A;  4GRS A;  1B7Y B;  4CIO A;  2HNZ B;  4I7F A;  3CMQ A;  2DNP A;  2WOM B;  2ZHA A;  3NBP B;  3LF0 A;  4MYU A;  5HK4 A;  4ELV A;  3W9J A;  1X31 C;  2LVW A;  3M8P B;  4CLK A;  1HHS A;  4LRV A;  3MAQ A;  4NXM J;  4DSI A;  1CJU A;  2W7O A;  4DN0 A;  1KON A;  5DDP C;  2VD3 A;  4HH1 A;  3FFI B;  2BQ3 A;  2DEI A;  1RT6 A;  1RAE B;  2CWX A;  1MN7 A;  2OHD A;  3EWG A;  3NS7 B;  1Q8K A;  1RWO B;  2BAN A;  3FT7 A;  3DOK B;  1NJY A;  1XNR F;  3M2R A;  1HWL A;  2HZC A;  1LFW A;  4LSL A;  4WXW A;  3T1Y J;  4P75 A;  1FRH A;  3A3O B;  2X1G A;  4JI8 J;  1QE1 A;  4WP9 A;  4M5M A;  2BE7 D;  2SXL A;  3VEB A;  3MFH A;  5DGB A;  4ZCK A;  2WSC C;  3W61 A;  3VWS A;  3T1H F;  4LF6 F;  3KFW X;  4DX8 H;  4UQG A;  2JC1 A;  2XLI A;  1RHU B;  2FHJ A;  3GQC A;  1RBL A;  2JSX A;  3MEK A;  3K8V A;  3UR3 C;  4Z7C A;  4NEY A;  1WTF A;  2DXD A;  2DHA A;  2B3T B;  2YNI A;  3SCK E;  3W1Y C;  5DG8 A;  1WC1 A;  2CPX A;  2MJU A;  3J81 j;  3MZI A;  3GIJ A;  1FNM A;  2PSZ A;  2YKM B;  2Z8Q A;  4K2X A;  4MMO A;  4QZV B;  4K2J A;  1NLK L;  1TTH B;  2ZHB A;  2NXJ A;  3UDE A;  4A8M P;  2PA8 D;  3ISN D;  4PXD A;  2J6U A;  3ILI A;  2VFT A;  4TY8 A;  2UP1 A;  2H5J B;  1HI0 P;  1PAR A;  5JJB A;  2DNM A;  1HNV A;  1RAI B;  2B9Y A;  2WON B;  2J7U A;  2HIQ A;  3PJW A;  1TAQ A;  1S1V A;  3U02 A;  4DG1 A;  4X65 J;  4NLO A;  4Y28 C;  3HSJ A;  3CVK A;  1G6B A;  1W2I A;  2NUU G;  1IWA A;  1JJH A;  5A0Y B;  2RU9 A;  3R9L A;  1FTC A;  4Y3C A;  1NKE A;  2ZH7 A;  4LF5 F;  4RLE A;  1KKH A;  2W25 A;  3MR6 A;  2FHM A;  4IR9 A;  4U9R A;  3EYZ A;  3DDI A;  2VJU A;  3OL9 A;  3TAM A;  2EKN A;  4HV0 A;  2GFF A;  2EFV A;  4USJ C;  3AHP A;  4TU7 A;  4J9M A;  5ETO A;  5DLF A;  1MU2 B;  1RHM B;  3UCZ P;  5AXM A;  4F3M A;  2AZ3 A;  3H59 A;  1GTH A;  2WCX A;  5L38 A;  4IRD A;  2KZM A;  5M2P A;  1FVQ A;  1Q82 T;  2HNY B;  2P6S A;  3OFF A;  1J5O B;  2O3D A;  2AYB A;  4ILM A;  1SV5 A;  4CLU A;  2QZ8 A;  1S48 A;  4ZHR A;  2DEJ A;  1VR6 A;  3G8S A;  4DR2 J;  1VQN S;  1B7F A;  2G9O A;  4HL9 A;  2R7W A;  1T0T V;  3QAT A;  5BYS A;  2M8D B;  2M8H A;  1UP1 A;  4B08 A;  3V4I A;  1VQ5 S;  3L4B C;  1WF0 A;  3ZZ0 A;  5AE2 A;  2MQL A;  2VG5 A;  5DZ6 A;  5RUB A;  2VFV A;  3FDS A;  1VJQ A;  1IBM J;  1LW0 B;  1VLY A;  2MKC A;  3N9U C;  1XMO F;  3HSG A;  2FDN A;  4D8J A;  3CCV S;  3DM2 A;  1HD0 A;  1RUS A;  5A76 A;  1IBM F;  1PJ6 A;  2DHH A;  3EIC A;  3TYT A;  2K2P A;  5IT0 A;  1X5O A;  4X62 F;  4F2S A;  1C1B B;  3CO0 P;  3IWL A;  1NLA A;  4C8K A;  2CDQ A;  1M5K C;  3BKF A;  3QWP A;  3R1L A;  4OZ1 A;  1FCA A;  4L6V 3;  1X4B A;  3UQS A;  3MMA A;  2FY1 A;  1AT1 B;  4B3S J;  3TA0 A;  1U48 A;  3KLG A;  1SCJ B;  2BR0 A;  3GMG A;  1W7W A;  1JNZ B;  4ZVU B;  4TQS A;  1HNV B;  3CPW R;  3H5X A;  3LJP A;  1OS5 A;  4R5P A;  4ZS6 A;  1WC4 A;  2RUS A;  3ET6 A;  1ZA2 B;  2XO6 A;  1TL7 B;  3AJD A;  5F8J A;  3R5A A;  4BS2 A;  1M1G A;  2ERR A;  4K0K F;  3BPS P;  3AAW B;  3DGV A;  4K4Y A;  3OXF A;  1H6K X;  2EG2 A;  2FHO B;  2OUG A;  2VQF F;  4U7U D;  1APS A;  1UVJ A;  2H3E B;  1F9E B;  2HHT A;  2YX4 A;  2G1H A;  4K0K J;  4Y2I A;  3TVY A;  4EWT A;  4FYD A;  4Y2C A;  3AD9 C;  3DHX A;  2ZH1 A;  3EZO A;  4QQB A;  4LF4 J;  1O6X A;  1FWK A;  1E6V A;  3QSI A;  4EEY A;  3CDE A;  3TA2 A;  2ZC4 A;  2LA6 A;  5A8W A;  1JJ2 R;  2MQ8 A;  3D3C J;  3BV8 A;  3DLE B;  3LP1 A;  3KNG A;  4UUW A;  3KMQ A;  2HHV A;  1SC6 A;  2PFD A;  2XI3 A;  2NRE A;  1X4C A;  1BLU A;  1YZ7 A;  3J80 U;  3BO3 A;  1PC5 A;  2NPI A;  2O5D A;  1XK8 A;  4KC5 A;  2YKN A;  2ADC A;  1SC3 B;  4B3R J;  2ZHO A;  5ITH A;  3KWM A;  4C8M A;  1RHR B;  3CJ5 A;  3VQS A;  4FF3 A;  1RI7 A;  1FJ7 A;  2YNF B;  3D6T B;  2AX1 A;  3J81 Y;  2UXB J;  1C0T A;  3Q8R B;  2QYC A;  1RYR A;  4DLE A;  1JLG B;  3JAM U;  4ZN1 A;  2KHD A;  4OX7 A;  1N6Q A;  1M90 T;  1TKD A;  2V9W A;  2ZE2 B;  2CNK B;  1SJ4 P;  2C3O A;  1FFW B;  3D54 A;  4IFV A;  3OLA A;  2AEM A;  3GIR A;  4FXE A;  2DBB A;  3FK4 A;  3MR2 A;  3MM5 B;  4HTJ A;  4X66 F;  3GV8 B;  2NSB A;  4DFM A;  2VG5 B;  4PG4 A;  4QJV A;  4XIU A;  1NCL A;  4JI5 J;  3NNE A;  2JXG A;  3M30 A;  1F5A A;  3T6B A;  1J5E J;  2RD5 C;  2BA3 A;  4F4Z A;  2GGP B;  1W25 A;  4TN2 A;  1YIJ S;  2MTL A;  2ZFH A;  1U7L A;  5D0E A;  2PII A;  3SXL A;  1JKH B;  4KQZ A;  3AOC A;  4JB8 B;  5HAN A;  4N77 A;  1FFG B;  3HSZ A;  2VC1 A;  2V8P A;  4A8Y A;  2Y1I A;  2BQR A;  2CPY A;  3OJS A;  2LQ8 A;  5ETL A;  5F41 A;  3T3F A;  4WTO B;  3ITH B;  2Q66 A;  4HR2 A;  5DS7 A;  2WSE C;  3HP6 A;  1YZ6 A;  4M5L A;  2FVQ A;  2DR7 A;  4FS2 A;  3CW2 C;  2QC3 A;  3OVA A;  1GH8 A;  4J90 A;  1SKS A;  4NZ0 A;  4LRD A;  1HNW F;  5HQM A;  2ZBQ A;  1GMW A;  1REV A;  4IG0 B;  3R27 A;  4YUD A;  2X3G A;  3RGI A;  4X4R A;  4IOA Q;  2ACY A;  3WC2 A;  1CUL A;  1MLA A;  2XMA A;  1HR0 J;  5FD1 A;  2ZKT A;  1KFS A;  2LXI A;  1FD8 A;  2QO3 A;  2DY1 A;  3KLH B;  2UVR A;  2F1F A;  3M8Y A;  3NL0 A;  1JLA B;  4WKR A;  4W92 B;  3FEX B;  4NOH A;  3I9V 9;  2G13 A;  1X5P A;  2YH1 A;  1WHX A;  4LR7 A;  1VRQ C;  3W9I A;  2C2R A;  2KG0 A;  1NEE A;  1KR4 A;  1VRT A;  1WWH A;  4Q0B B;  4MTP A;  1I6J A;  5E3R A;  1RTJ B;  3PEJ A;  3EXY A;  4YR3 A;  5JVG Q;  3FBE A;  1SJ1 A;  2MZS A;  4P9S A;  1NJI T;  3LAL A;  3EUN A;  1IUJ A;  2RQC A;  5B7W A;  3DYA A;  4O44 B;  2ZH9 A;  2F4V J;  1Z2L A;  4NLR A;  2ROP A;  5IQ6 A;  2BDP A;  3IR6 B;  3OSN A;  3T1A A;  4ANE A;  2HQF A;  2L08 A;  5K8M A;  3LGN A;  1HYS B;  1GTE A;  4FKY A;  5DDR C;  1KQF B;  2ZJR Q;  1U2C A;  3FUY A;  3D0G E;  3DLG B;  1JLF A;  4YS2 A;  4BDP A;  2JZ5 A;  3KK2 A;  2QMW A;  3BR9 A;  4DR7 J;  1WDD A;  2GW8 A;  3KDO A;  4I6Y A;  4CLY A;  2QFJ A;  5EX3 A;  1HBM B;  2CYY A;  2PT0 A;  1R0B G;  5J2Q A;  1TP7 A;  2E1A A;  1BDV A;  2RVJ A;  1BWE A;  1HQ2 A;  4MFB B;  4P2F A;  5IC4 B;  2HGL A;  1CJU B;  1PBU A;  2R7Q A;  3I0S B;  3NCQ A;  4ZPC A;  1EET A;  5HQ8 A;  1D9F A;  4NAS A;  1XNQ J;  3ZTP A;  3FFI A;  3HF5 A;  4C4W A;  1NSA A;  3CUN A;  5KFR A;  2R7U A;  4DV0 J;  2PI4 A;  4UOH A;  2A2D A;  2NYH A;  2ZZT A;  4WFX A;  2W8L A;  2LEA A;  1Y10 A;  3C46 A;  2V63 A;  3HFK A;  2WOM A;  4WF9 Q;  1XBW A;  4V19 X;  3UFC X;  2QLB B;  1HQU B;  4ECY A;  2P5V A;  4EBD A;  1RHQ B;  3C15 A;  3M8P A;  1FX2 A;  1XR6 A;  3C16 A;  2VOO A;  2AF6 A;  2YWF A;  2F40 A;  1JLQ A;  1S6Q B;  4RNM A;  4UF4 A;  4X4P A;  2R2R A;  2GVZ B;  4KB7 A;  2PGC A;  5J1E B;  1CSJ A;  5K8P A;  1SUQ A;  5A6W A;  4KHR A;  1HNI A;  2EC2 A;  4NE9 C;  2GHW A;  2DR8 A;  3SEO A;  5KAK A;  2EK6 A;  1T9Y A;  3ZO7 A;  1BQX A;  3MI7 X;  3GV7 B;  3Q24 A;  1S1X B;  2VFU A;  4DR2 F;  4RW7 A;  1N56 A;  1F0X A;  2DRD A;  3Q2S C;  2NXN A;  1TKZ B;  3IS9 A;  4GO5 X;  3CNQ P;  3RW7 A;  4DCP B;  2M70 A;  1RAB B;  2CQ4 A;  3TOQ A;  1P6T A;  3H2L A;  3UN3 A;  4M94 A;  3DXB A;  5CAA A;  2DRB A;  3DYA B;  2BKN A;  4FYW B;  4OI6 A;  4O44 A;  4ELT A;  3Q8P B;  4LSN B;  3ZZT A;  2W9C A;  1BQM B;  3WHI A;  1R0A B;  1LWF A;  4FYV B;  4O4G B;  2ZH2 A;  2YNG B;  2KYX A;  4ED3 A;  1ZAW A;  3OJU A;  5J2M A;  1S6Q A;  3BGR B;  2PA3 A;  3IG1 B;  3MD3 A;  4FZV A;  2W1B A;  2RU3 A;  3HDS A;  1N32 F;  1RAG B;  3IO1 A;  2KM8 C;  5KFH A;  2AQ4 A;  3DRP B;  1T7P A;  3FQL A;  4MFB A;  3WIV A;  5HP1 A;  1IQT A;  1OSC A;  1MU2 A;  1HIY A;  3FVY A;  4P10 A;  3I0S A;  4TNO A;  1VBZ A;  1EIY B;  2E7X A;  5HI7 A;  4ZLP A;  5GAD I;  2JEI A;  2XNR A;  1EX8 A;  4NZ7 A;  2K06 A;  4DCO B;  1LWE B;  2K8G A;  4MK8 A;  3V2U C;  4CNZ A;  2EKY A;  4ES2 A;  1RA7 A;  5E33 A;  4NML A;  2HEK A;  2CPZ A;  1C0U A;  1RT7 B;  4M5D B;  2POK A;  1IKV B;  2GIF A;  2LU1 A;  3DOL A;  3PJX A;  2E66 A;  4N56 A;  2QV6 A;  3GV5 B;  5LSR A;  4X84 A;  3PX0 A;  5I42 A;  5KOW A;  4ZLL A;  2XNQ A;  5KFS A;  3EDR B;  3DGP A;  3AB2 B;  4GC6 A;  4LQ9 A;  1WHY A;  1KLM B;  5ETN A;  2Y1J A;  2X3D A;  5HRO A;  3LPE A;  3D28 A;  4GVB A;  2GO9 A;  2IHR 1;  4UOG A;  5A2Q Y;  4PQU B;  3R1H A;  2B0G A;  1XMQ F;  3BBC A;  4M63 A;  4DUY J;  1MN9 A;  2LXU A;  3C6U B;  2KXF A;  3JQJ A;  5M2U A;  1VHF A;  2AD9 A;  1T02 A;  2B4P A;  2B56 A;  4IFY B;  1XMQ J;  2MST A;  5J2P A;  2O01 C;  1SKW A;  1XQI A;  1Q1K A;  4MT1 A;  1U6Z A;  4J9S A;  4C7Q A;  4JI2 J;  1LK7 A;  3CD5 A;  3OV7 A;  1EQ0 A;  3MHY A;  2QRR A;  2ZUG A;  1OSD A;  2Z2M A;  3ELH A;  3Q8Y A;  3A3N B;  1C4C A;  1Z2Z A;  1DTT A;  2JH3 A;  3MM8 A;  3K0J A;  3FMB A;  1OMS A;  5CA5 A;  1Y4Z B;  2DNR A;  4L76 A;  3DRS A;  1BD6 A;  5FLX U;  3P4U B;  1VC5 A;  3DLL Q;  2VOP A;  2VG6 B;  3HI9 A;  4X66 J;  2FB0 A;  3VAG A;  3J7A N;  4ICL B;  2DGO A;  4HT5 A;  2D69 A;  4I4B A;  4LRA A;  3PYE A;  4PXE A;  4K4W A;  1D1U A;  2KKE A;  5C25 A;  3BB5 A;  2EBG A;  3PRV A;  4X4T A;  2RUG A;  5K8N A;  4ZJO A;  3X3U A;  2CQ0 A;  3RRG A;  4EU0 A;  1K8A T;  2UUW A;  4ZVE A;  4ANC A;  1KLN A;  3E8O A;  1D9A A;  1VIO A;  2Q3P A;  3M2U A;  2CPI A;  4IRC A;  3TA1 A;  1MSW D;  2XMK A;  2DGX A;  4IG3 A;  3O1L A;  4K4T A;  2OTJ S;  1URN A;  2LEP A;  2QLJ B;  4M5I A;  2HGM A;  5CZV A;  5HMX A;  4USI A;  3LP2 B;  4PWU A;  4YHH J;  2AJ4 A;  1IM6 A;  2HFU A;  2HFS A;  4ZVS B;  2H48 B;  3TR5 A;  3VTI A;  2ZJP Q;  2OLW A;  1T05 B;  1C0T B;  2V8G A;  3CCQ S;  4RNN A;  1VQY A;  2Z2Y B;  4LVO P;  1WF1 A;  1Y9O A;  2HG4 A;  3TW0 A;  4YME A;  1UWB A;  4CNY A;  1TK0 A;  2G4B A;  4PWD B;  3G86 A;  4KE5 A;  4JV0 A;  3K5M A;  2GML A;  2XS7 A;  3MUR P;  1CJK A;  2M7S A;  2YY3 A;  4H4O B;  2FLL A;  2R7R A;  3W62 A;  1J27 A;  1R31 A;  5B0A A;  3AD8 C;  1LW0 A;  3S1T A;  3GP9 A;  3QT7 A;  3RB4 A;  2DH8 A;  1KOH A;  1RWX B;  3JQM A;  5B0G A;  3UD3 P;  3QJL A;  4PQU A;  4DU8 A;  1FVS A;  1P1L A;  2DR9 A;  4V19 J;  4OX6 A;  5L9X A;  4F4K A;  2FQQ B;  1IKX B;  2DNN A;  1EAR A;  5C42 B;  1N36 F;  3I0R B;  2IPO B;  2LP4 A;  2V4J B;  1UCN A;  2J9E A;  3SCL E;  1S0N A;  2FJD B;  1MNT A;  1S0O A;  2EFQ A;  3W5Y A;  1U1Q A;  3VGV A;  1OYD A;  2YQ0 A;  3B78 A;  4FNH A;  4ME7 E;  4CQ1 A;  3OFE A;  2K1R A;  3TUZ C;  4CH1 A;  2BM0 A;  2RAQ A;  3O8W A;  2GMJ A;  1DTT B;  3MM8 B;  3MWB A;  1H72 C;  4CRJ A;  4X4Q A;  3VAI A;  2HVH A;  3HCX A;  3M6V A;  2L41 A;  1HNX F;  2DR5 A;  1VIS A;  4EZ6 A;  3QBC A;  3HZG A;  2I9S A;  2V6A A;  4DR6 F;  2AJ0 A;  2VU5 A;  1M5H A;  4EO6 A;  1R27 B;  2OIH A;  2WB4 A;  1L3K A;  3M6U A;  5B0F A;  1CS4 A;  4WBF A;  1V9O A;  4J9L A;  1GT8 A;  2XLJ A;  2RE1 A;  4OJ1 A;  3OL8 A;  1O0P A;  2ZH4 A;  3GWC A;  1IR1 A;  3MPY A;  4MAK A;  3VQT A;  5H9E K;  1HNX J;  5ETS A;  3GON A;  1ZBT A;  3SV3 A;  4USV A;  5KFN A;  1IBL F;  2ZZM A;  1JK9 B;  3DNC A;  4DV4 F;  2MB0 B;  4LF7 F;  2FJX A;  3K89 A;  4DPU A;  4B9V A;  3BBF A;  2E29 A;  2BM1 A;  2Z57 B;  3AOD A;  3EVW A;  1IKV A;  3DOL B;  2NSC A;  5GMD A;  4C97 A;  4EI2 A;  4XPC A;  4PAB A;  4J9N A;  3CF5 Q;  4B3O A;  4ZIV A;  2UVU A;  3K58 A;  2E5J A;  3VVU A;  3RAM A;  3KJF B;  3BF4 A;  2BA9 A;  3KUG A;  4USU A;  1VQ9 S;  1CC7 A;  3W7B A;  2RKI B;  1MYK A;  4ZJQ A;  1F6T A;  5EN1 A;  2UXD J;  2BX6 A;  4U67 Q;  2JX2 A;  1EKR A;  2OSQ A;  4B17 A;  1JLF B;  2Y8W A;  2E9Z A;  2C2N A;  1BY9 A;  5FDL A;  3K59 A;  1X9M A;  4MJK A;  2HHX A;  3M32 B;  2RJZ A;  4UTG A;  2ZH8 A;  3T19 A;  3KK3 B;  3CCS S;  3CME S;  2HK2 A;  4CYU B;  3QJP A;  3FBB A;  2IIH A;  5DQI A;  1WOR A;  2MKS A;  1NB2 A;  3O2I A;  1TUV A;  2CQ1 A;  5A0Y A;  1W2B R;  1LWX A;  4RO0 A;  4ED7 A;  2WAQ D;  4KBI A;  2APO A;  1VQO S;  3BDE A;  5SUH A;  5ADZ A;  2W4D A;  3K8W A;  2YKA A;  3P3D A;  1ZTW A;  1IJF B;  3CD7 A;  1Q53 A;  1NO8 A;  2CJ9 A;  3QO9 A;  4RR5 A;  4RX6 A;  2MZQ A;  1GMW D;  3MEE B;  3ZTQ A;  5KG5 A;  3UD4 P;  2FLP A;  2GQQ A;  3M8Q A;  5DO2 A;  3SSQ A;  2V4Q A;  1I3O B;  3D4J A;  2AEF A;  1SL1 A;  4USH A;  2E5L J;  4FBU A;  2F5G A;  1WJ9 A;  2CRL A;  3GFY A;  2R9L A;  2JLE A;  3MEC B;  4IR1 A;  4NA3 A;  1Y3K A;  1LW2 A;  2ACM A;  4ZDN A;  1P94 A;  1TUG B;  5B08 A;  2QA4 S;  1IKY A;  3BQ0 A;  3E2E A;  4NXN J;  3BO2 A;  2NQP A;  4F0K A;  3CJ4 A;  1FXD A;  2FLO A;  4DL2 A;  4EZ9 A;  2YBV A;  4WK1 A;  2PD1 A;  2N7Y A;  4M5K A;  1KWM A;  1TZ0 A;  3AA8 A;  3DU6 A;  3IBW A;  3KXD A;  1VQ7 S;  5KFP A;  1IBK J;  2HAI A;  3M2V A;  2B4U A;  2HRU A;  3JTN A;  4H4M B;  4YEA A;  5CYM A;  4DUY F;  1YX2 A;  3B6B A;  3UW1 A;  4CLP A;  2MZ1 A;  2BAC A;  1C4A A;  3JAM Y;  3D9B A;  3ZTO A;  1KHW A;  1PIL A;  1RIS A;  3P5T L;  1PYS B;  3TRG A;  6AT1 B;  1SH2 A;  4EMD A;  4DUZ F;  4I0W A;  3DI6 B;  2J6S A;  3K7R A;  2VBZ A;  4GKJ J;  1T3N A;  3M8Z A;  5BYR A;  4EYI B;  3H20 A;  4NI2 A;  5KFM A;  4QW9 A;  4ED1 A;  3HVT B;  4GC7 A;  2M0G B;  3MM9 A;  4QWC A;  1U1O A;  3BBB A;  1H7W A;  1DRZ A;  2C2E A;  5F8N A;  2CPF A;  1L3V A;  2RS8 A;  5EWE A;  2HW3 A;  3KLI A;  2E5I A;  4KT0 C;  2GVD A;  1HBM A;  5GAE U;  5I42 B;  2K3I A;  1AW0 A;  4EGL A;  2F4F A;  1NB7 A;  2OH2 A;  2GPE A;  2J9D A;  2PN6 A;  2DNH A;  3GJS B;  3HVA A;  2A3J A;  3PO5 A;  1UL3 A;  5A8W B;  3A8J A;  1LWE A;  1FKO B;  4NEZ A;  1FJE B;  3BQ1 A;  5E2Q A;  1PO6 A;  1UJ5 A;  3R7S B;  3MMB B;  4DSK A;  4OHV A;  4J9O A;  1MYL A;  3PW0 A;  2AJ1 A;  3I31 A;  1H2V Z;  4UW2 A;  5F0W A;  2NS1 B;  3I0R A;  3PR5 B;  1Q79 A;  1EQM A;  1G7C B;  4NCG A;  3TP2 A;  4C3M A;  3EZ5 A;  3RR8 A;  2V94 A;  3LAM A;  5E5N A;  2FVR A;  5ETR A;  4F8R A;  3F44 A;  3H40 A;  2OPR B;  4RW4 A;  2H54 B;  4J9R A;  4FP9 A;  1KN6 A;  1YIT S;  2P9G A;  4JV2 A;  2XEX A;  4QR0 A;  3CUL A;  3RTV A;  2HSE B;  2ILZ A;  1T8E A;  2UUC J;  3NNH A;  3ETO A;  3NCP A;  4LQ3 A;  4I6W A;  4RBT A;  4JI0 F;  3Q89 A;  1I94 F;  2BW2 A;  4XO0 A;  2KDO A;  4HT7 A;  3GSD A;  1S1U B;  5D15 A;  3MEG A;  3QQC D;  1REV B;  1NH7 A;  2MY7 A;  2VL1 A;  4IG0 A;  4DV5 F;  4JI0 J;  1N33 F;  3OR2 B;  3RBZ A;  4DUT A;  4KFB A;  3BN4 A;  3H2U B;  3NWG A;  3MMC B;  2K1R B;  1WI8 A;  4KTQ A;  4C9D A;  2MYF A;  4IH7 A;  3B4M A;  2G0J A;  5C7P A;  4DI6 A;  5CCM A;  5DG9 A;  3THT A;  3Q8Q B;  4O3P A;  1DBD A;  2I8E A;  3IA0 A;  1R8H A;  2U1A A;  2IVF B;  3N6N A;  2H1O E;  4N8N A;  7FD1 A;  2HFO A;  1DUR A;  2IDE A;  3AQO A;  1NSQ A;  1YJ7 A;  2X51 A;  3JXO A;  1Y5I B;  3AXM A;  4DEZ A;  3MTK A;  5HAT A;  1R7I A;  3ONQ A;  1YHQ S;  3DLK A;  2B6A A;  3IM8 A;  2HND A;  2XG8 A;  4C2M A;  1FEH A;  1VBX A;  3W5Z A;  2OAU A;  3ENA A;  1QUV A;  4XK8 C;  3NCR A;  3JSM A;  3HVW A;  3CDA A;  1AXQ A;  4CTA A;  5HJY A;  2VIC A;  4ZHR B;  2IYI A;  1HNZ F;  1IKW A;  4A8X A;  1OWX A;  4O3O A;  4F67 A;  4ITS A;  1BC6 A;  1LV5 A;  2E9R X;  4F4X A;  2QX0 A;  4IYQ A;  3UDC A;  1UWB B;  3W5X A;  1JIH A;  1SIW A;  2QLF B;  1SJF A;  2YKP A;  2RIJ A;  3NY0 A;  2CKW A;  5L8R C;  1PJ5 A;  5ETQ A;  4CLF A;  4LF6 J;  2XS2 A;  4BCA A;  3CCJ S;  2XSF A;  1EA4 A;  3OL6 A;  3KMS A;  4WZM A;  3V81 B;  2H65 B;  1JXE A;  1KFD A;  2VA2 A;  4DL0 C;  1FDN A;  3H8Y A;  5CD4 A;  5CQG A;  1UAW A;  2D7S A;  4F4Y A;  2PO4 A;  3WX4 A;  1VI7 A;  3G5O A;  3WC0 A;  4A48 A;  2J0S D;  4ZVO B;  1X93 A;  1H38 A;  3TAP A;  5KFZ A;  1WI6 A;  2CQI A;  2EFP A;  2P8I A;  2IJR A;  4ZLJ A;  5KT3 A;  2XY6 A;  1RTD B;  1NME B;  1S57 A;  2W2M P;  4HDG A;  1BHN A;  3HHL B;  1S6O A;  1WOO A;  1BUX A;  2R7O A;  4L74 A;  1Y3J A;  2HLU A;  4ER8 A;  4YY3 F;  4ED4 A;  3LA0 A;  1EP4 B;  2HLT A;  5DZ7 A;  1RXO B;  5J1P A;  1UVN A;  2OD6 A;  2KL8 A;  4AL7 A;  3N0V A;  3GB0 A;  4DS4 A;  3CSK A;  1R8B A;  4TY9 A;  2QTW A;  3A8K A;  3HFV A;  3T6J A;  4KFB B;  1L3S A;  1FXL A;  3Q8U A;  1YBU A;  2VIH A;  3M8R A;  4ATN A;  1SH0 A;  4Q44 A;  5I3U A;  3LAK A;  4KGV B;  5KFW A;  1WAC A;  4HEA 9;  1YJN S;  2JLG A;  2LFV A;  2JBV A;  5KG1 A;  3KHH A;  1BGX T;  4FPI A;  3KLE A;  3MM9 B;  1MWY A;  1QAJ A;  2WRM A;  4G6V B;  4Q43 A;  2F9D A;  1H3D A;  4DR5 J;  1VQL S;  4WIQ A;  4N41 A;  2XO7 A;  4IG3 B;  4R0J A;  1WUU A;  4L73 A;  1VLO A;  2KTQ A;  3QGP A;  1Q78 A;  4ZP6 A;  5G0R B;  4F4A A;  2BRL A;  3R5J B;  3IFE A;  3D6M B;  4QYR A;  5A6P A;  2MQO A;  5MLC V;  5A2Q U;  2C3P A;  1OY9 A;  4ID5 B;  1R0A A;  2NZC A;  4O4G A;  4DMZ A;  2FC9 A;  1QLN A;  1JNR B;  2OPP B;  3C3L A;  2WW4 A;  3UD5 A;  2V34 A;  3NNA A;  2DO0 A;  2DR6 A;  2QGF B;  3GTY X;  1FRI A;  2J6T A;  2Q2K A;  1R3N A;  2OI2 A;  4Y6I A;  1BQM A;  2E7W A;  1PBA A;  3W8G A;  5E7O B;  5L9N A;  2B5J A;  1V3Z A;  2KYZ A;  2PEH A;  3TAM B;  2UU9 F;  2C3M A;  3PTW A;  5I3Q A;  1T9X A;  4RUB A;  2MXY A;  1K44 A;  4DV7 F;  1R6V A;  3I6P A;  4HHH A;  1ZYQ A;  4ECS A;  4RNO A;  1S1T A;  1Q8I A;  3PEH A;  4PYD A;  1N0U A;  3IRX B;  1T05 A;  4MIW A;  2B8P A;  4RW9 B;  3TEH B;  3WIU A;  4BLG A;  4M5H A;  2A6O A;  5K9F A;  2IY5 B;  4Y65 A;  1P1T A;  1Y5L B;  2HRY A;  4GKJ F;  3VAJ A;  3CJR A;  4U8Y A;  4CT9 A;  1KS2 A;  2ZH5 A;  1S49 A;  2RSQ A;  4ID5 A;  1V3R A;  5E3P A;  5JXS A;  3KHL A;  2WON A;  3JTP A;  1JMT A;  1S1V B;  4DG1 B;  3BO4 A;  2VOD A;  2ALY B;  4ETX A;  2H5E A;  1AA1 B;  1RCX B;  2HKE A;  2HK3 A;  3HD1 A;  5DQH A;  1RGV A;  5KT7 A;  1RTD A;  2GA7 A;  1KLM A;  3QYY A;  3ZC4 A;  4X64 J;  1VBK A;  2J9C A;  4XDD A;  4GVB B;  1YDL A;  2RT3 A;  1LFP A;  1HL6 A;  3EE3 A;  2ZWO A;  3BRE A;  1FWP A;  4H4K C;  3SIP B;  1U8W A;  4RUC A;  2W9B B;  2R2T A;  3FMW A;  1QD1 A;  4TLQ A;  3NP5 A;  9ATC B;  4ZPA A;  5K5M A;  4NA1 A;  4QWB A;  4MYT A;  3H4B A;  4RBU A;  2FVP A;  2E1C A;  1QTN B;  2J7W A;  3C2P A;  4URG A;  2DHS A;  4CO2 A;  2OPQ A;  2DCL A;  2YWG A;  4ENO A;  3KLG B;  4OI0 A;  4QU6 A;  4HI2 A;  5D8H B;  5LXY A;  3WX8 A;  4IDK B;  4MKV A;  5DDO C;  1R8A A;  1WD6 A;  2N7C A;  4KAI A;  3KUE A;  1RT5 A;  1JLE B;  3LP0 B;  1X9S A;  2LA4 A;  5A8K B;  4DR4 J;  2DH9 A;  2WVB A;  2V50 A;  2Q6B A;  2GVZ A;  3LH2 S;  2V69 A;  4PG7 A;  2A2C A;  4NI2 B;  4NPO A;  4LT6 A;  5J1E A;  1RKI A;  4XPE A;  3NG8 A;  1Y00 A;  4KV8 A;  2W8K A;  1UVL A;  2EW9 A;  5C24 B;  3NMR A;  5A8R B;  2OJ3 A;  3POT B;  3D0I E;  2YWK A;  4YP3 A;  2JVO A;  4GO7 X;  4URQ U;  4J5O A;  2CJX B;  5ETK A;  2XBP A;  1Q4R A;  5CHC B;  3MR3 A;  1HI8 A;  2DNZ A;  2CAD A;  1TQL A;  2DRA A;  3SQG B;  1XWL A;  1X4D A;  4OV6 A;  4NL5 A;  1FI4 A;  5T41 A;  2FIU A;  3SFG A;  2VKZ G;  1VDH A;  2V5H G;  4M1K A;  5F9N A;  2RDJ A;  1K0V A;  1ZTT A;  4LSN A;  2W9C B;  1Q86 T;  1D09 B;  2DB1 A;  1C0U B; 
#chains in the Genus database with same CATH homology
 4HV0 A;  2AY0 A;  2K5J A;  1ARQ A;  1B28 A;  1MYL A;  1NLA A;  3BKF A;  3QSI A;  2BJ1 A;  2WVD A;  1BDV A;  2F1F A;  1Q5Y A;  3FMT A;  3H87 C;  2WVB A;  2JXG A;  1MYK A;  4FXE A;  1EA4 A;  2WVE A;  1BDT A;  2CAX A;  2NZC A;  2WVF A;  2BA3 A;  2K6L A;  3PHT A;  1B01 A;  2BJ7 A;  2H1O E;  2CAJ A;  2K9I A;  2RBF A;  2BJ3 A;  3BKT A;  2K29 A;  3QOQ A;  1P94 A;  2JXI A;  3LGH A;  2HZV A;  1U9P A;  3FT7 A;  3VW4 A;  1PAR A;  2BSQ E;  3VEA A;  2Y3Y A;  3OD2 A;  2FGC A;  1Q5V A;  2GPE A;  1X93 A;  2BNW A;  2CAD A;  1BAZ A;  2K1O A;  3BKU A;  2WVC A;  3VEB A;  2CPG A;  2JXH A;  2CA9 A;  1QTG A;  3GXQ A;  2HZA A;  1MNT A;  2BJ8 A;  2KEL A;  4D8J A;  2BNZ A;  2PC6 A;  1ARR A;  2BJ9 A;  1IRQ A;  4ME7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...