2CADA

Nikr from helicobacter pylori in closed trans-conformation and nickel bound to 2f, 2x and 2i sites.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
131
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
molecule tags Transcriptional regulation
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 35
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2cadA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2cadA02
2CPGA 2WVBA 4ME7E 3QSIA 2CAJA 2FGCA 2WVDA 3VEBA 2BJ1A 2K29A 2H1OE 2KELA 3BKUA 1MNTA 2K9IA 1PARA 1BAZA 2CADA 3FT7A 3VW4A 1BDVA 2NZCA 2BA3A 2BJ3A 2K5JA 2WVCA 4FXEA 3OD2A 2BNZA 2RBFA 2HZVA 2WVFA 2JXIA 3QOQA 1Q5YA 1P94A 2K6LA 1BDTA 2PC6A 2CA9A 1Q5VA 1MYLA 2BJ8A 3PHTA 1X93A 2GPEA 4D8JA 1B01A 3BKTA 2BSQE 2AY0A 2JXHA 2BJ9A 3LGHA 3GXQA 4HV0A 1ARQA 2WVEA 1EA4A 3BKFA 2JXGA 1B28A 3VEAA 2Y3YA 1ARRA 2K1OA 1MYKA 1NLAA 1QTGA 3H87C 2CAXA 3FMTA 1U9PA 2BNWA 2F1FA 2HZAA 1IRQA 2BJ7A
chains in the Genus database with same CATH superfamily
4R8UA 2ZH6A 2C2RA 2GCFA 3SI8A 3EGVA 1A6LA 4LIWA 1L3VA 2E5GA 3EDRB 2OD6A 2OEKA 5HANA 3DM2B 3K89A 1JQGA 1SQEA 3BGRB 2DHGA 2RQCA 1NK8A 4IR1A 5M2PA 2J7KA 2EKYA 2O66A 3B6BA 2FJEB 4NLRA 4E0DA 3HVWA 1HNXF 3CMES 1F1BB 3PHEA 3TZWA 5DS7A 4PKDB 1TUGB 2E44A 2ZE2B 2WBRA 4B3SJ 2NXEA 3MMCA 3CPWR 3PX0A 4NE9C 3FGVA 1TQLA 5ETSA 5DO2A 4O3OA 3AFGA 4M5JA 1KHWA 1V3RA 2V4RA 4WFBQ 5J2NB 2GIQA 2V94A 1SKUB 4CYUA 4B9TA 4OJ1A 5D0HA 3FMTA 3ZZUA 4EZ6A 3DLEA 5DM6Q 1U2CA 2ZKTA 2DRAA 4C8MA 1YBUA 3CDEA 3WIUA 4I56A 3PYDA 4Q8FA 3SV4A 1N88A 2IAJB 1XMOJ 1NKEA 3BGRA 4A8WA 1Q8LA 2B5JA 2V34A 5KG6A 1U8WA 4OJGA 2K9IA 1FRKA 1BC6A 4ID5A 2XHWA 2CPHA 1R6YA 3FMWA 4F3QA 1S0NA 5KT2A 4RW9A 5HK4A 3HM9A 2CZVC 5EGYA 1R0AB 4ECTA 1HLWA 1R6VA 2CQGA 3AXMA 5MAOA 1Y00A 2DEJA 3CC4S 5E3PA 1XMQJ 4ZMMA 1DTTB 1R0CB 2QE5A 4NWBA 4OZ2A 5K8NA 1KNZA 3M1VA 2CVIA 4WFXA 2CPFA 3ZZ0A 4AXIA 5IV4A 2GGPA 2OFGX 3E01B 2R2RA 1D1UA 1K73T 1T8EA 1DLOB 1S1VA 4ZCKA 1LWEA 1WTFA 3DGVA 5K9FA 3J7A1 1M0SA 1YSJA 1YIJS 2LEBA 2CNNB 2F40A 2OIHA 3QPIA 1RKIA 2AV5A 4Y6IA 5IM0A 4M63A 3RW7A 3AT1B 3F41A 3OFFA 1RT1B 1RWWB 3BB5A 3DLLQ 1RT3A 3UN3A 1FRLA 3FFIA 1KHVA 1OQ3A 1KQKA 3HT3A 3N6NA 2HRTA 5B0CA 1VOMA 4X4TA 4UT4A 1IN0A 2HWTA 4PQUA 1C4AA 2C3YA 3GYGA 1C1CA 4PYDA 3IR7A 3P3DA 1X0FA 3NAIA 2U2FA 3T6JA 1DBDA 2HAIA 2YX4A 1MWZA 2HFSA 1Q8BA 3TEGA 4A48A 5BR8J 5AT1B 3EZ5A 1OYEA 3DRPB 1CC8A 4DLGA 2H54B 5KT4A 2JC1A 1JJHA 5IC4B 2DR5A 3FBFA 2ZITA 3EE3A 4HT7A 1N6QA 2PSZA 2QSFA 4XTTA 4IFVA 2K1OA 1H0HB 2ZZTA 3GSDA 1F60B 3SSSA 2JVRA 5FLXU 1PGZA 3KFWX 2XCAA 2BM0A 3DDIA 4KO0A 4OX9F 3KK2A 2VHGA 2K06A 2ZEJA 3BGUA 3IFEA 5B0GA 1QM9A 2J5AA 2VPXB 3PTWA 2DGQA 3G5OA 2L41A 4XPEA 2WAQD 3GIRA 4V19X 2E7XA 4MIWA 2IBKA 1Z2LA 3NP5A 2ZVSA 2N4DA 1Y0HA 1WC4A 1VK3A 2QYGA 2ZBRA 4MMOA 3OHAA 1S0MA 3VGUA 3LW5C 4QOTA 1FE0A 3G8QA 1ULRA 3MI7X 4I7FA 4MAKA 4QU6A 4F4XA 1HQ2A 4OMFG 2E1AA 4UUWA 3LA0A 1BY9A 4DFMA 4YB1P 1CLFA 1WWHA 1OS5A 1NXIA 2B5JB 3NCRA 2GO9A 3RAMA 3FBBA 2V4JB 3A12A 2RILA 3QAUA 2ZM6F 3GLJA 4J9SA 3GSIA 4IH7A 1CJUB 4NZ0A 3BKFA 1RAGB 2DNKA 2RQMA 1IKYB 2G1HA 2R7WA 1VMBA 4OI2A 2CFXA 2LKZA 2DNNA 4MT1A 4TY9A 2V8DA 3RRKA 1D3WA 4YR3A 2CAJA 2B51A 2RQ4A 4HACB 1ZZNA 3OTEA 3IR6B 1HBOB 2H48B 3MAHA 3MM8B 4UOCA 3UR3C 1UVIA 4OHVA 2FJDB 5KTQA 3QBCA 1DY3A 1DLOA 1S1VB 4CZCA 1VQLS 2FC8A 3B4DA 4O3RA 1BDVA 2MGZB 4DV1J 4USJC 2IPOB 3BM7A 3KMQA 1RI7A 1X4EA 4MH8A 3RGIA 1NAQA 2W8LA 1IQTA 3I4PA 5J1EA 4DFPA 1S6PA 4XAKA 2RJZA 3FCVA 3CDBA 1Z1ZA 2VB6A 3FFIB 3FRZA 3Q83A 7FD1A 4X4QA 1YJTA 1XTZA 3MWBA 2QLXA 3RZAA 3RTVA 1F5CA 1ELOA 1XMQF 4KHPF 3PEJA 4RNFA 4ER8A 3ZXWA 3BBFA 2CUYA 2B4OA 2HLTA 3HHEA 1WF1A 1M1HA 1NDCA 4Y2AA 1C0TA 3QWPA 4IFYA 4RW6B 2NXNA 4OJ3A 3CB4A 3VALA 4JV0A 3PYEA 4C6AA 1U8SA 5HN0A 2KELA 5EHHA 5L1IA 1RHKB 2BE9B 2GAGC 4DWIA 1SJFA 1UP1A 3UCGA 1UFWA 2HZCA 2GFFA 2IM0A 2K1RB 2NUUG 5LJ5Y 4DV4F 4UY8T 3K5LA 5L8RC 1NLKL 2YQ1A 3W7BA 1ZAXA 3A8IA 2SXLA 1RU2A 3CJKB 2GC8A 3R2CJ 1D9DA 2WCXA 2KJVA 1N4LA 2MKCA 2J6UA 1YI2S 2J8SA 2AWZA 5KFYA 3BSOA 1SQFA 3FEZA 2C3OA 4LREA 1DJ0A 2DNOA 2WB1D 3O5TB 3LAKA 2EVZA 1F2GA 5HO4A 4U7UD 4F0HA 3RB3A 2C3MA 3HSGA 4CI0B 1SC3B 5GVQA 1RHQB 3PFEA 2X1AA 1UCNA 1T9UA 2MTLA 3IRXA 1RHUB 3DLGB 3KWMA 3L4BC 3OPKA 4KQZA 5HL7Q 4USWA 3PW2A 1KD1T 4DR1J 3GZ7A 1JXEA 3UVJA 3V6JA 4RUHA 3TZXA 2DHXA 1U1MA 1G4CA 5E3AA 4PXBA 5E33A 2WSFC 3HFZB 1NJIT 1VJWA 2CQ3A 2VC0A 5B0BA 1CJKA 1U49A 2HYIB 3VGVA 4PG8A 1YWXA 5EDWA 2HFUA 4IG0A 4JBCA 1JLAB 4QW8A 1VC6A 3RBXA 2JXIA 2H1YA 3NGKA 3T1AA 3DNCA 4A8KA 1A9NB 4J9VA 1HNVA 1RWPB 1RJJA 1UJ5A 1LW2A 3N28A 2BW2A 5I4MA 5HLFB 3QNWB 1U6FA 3FCWA 3KNGA 3GJQB 1YJUA 3FSYA 4DSKA 4F2SA 1YQHA 4I7FB 1MU2B 4MK7A 1YZ6A 2KXFA 1B0PA 3LO3A 4HDGA 1NHVA 1H7XA 1BHNA 1DARA 3AD9C 5LSLA 1GX6A 5KFXA 3CWJA 4PABA 4QIWD 4V19J 2O67A 5HMWA 4DSEA 4EMDA 4TQSA 4Y28C 1B4SA 3E8OA 1C1BA 3I0SA 4ZVPB 3U27A 5KFCA 4GC6A 4H4MA 4O44B 4JYAF 3ENAA 2OMLA 2MKKA 3C2PA 2XMWA 1X7VA 3DOKB 4LF5F 4KKOB 4R5PA 2W4PA 1K8AT 2IHR1 2J9CA 2K3IA 3P5BP 2FY8A 4J9QA 4ES1A 1QAXA 1X4CA 1PAEX 1U1LA 5ETMA 1NK4A 3QT7A 2BQ3A 2KJWA 2GX8A 2XYHB 5AE2A 2CQCA 3GE9A 5G4DA 4FS2A 3EVWA 4DR6J 1N0VC 3NCPA 2ZHBA 1FKAF 4Q2MA 4ED8A 3IAM9 4PPDA 2B4VA 1WI8A 2WVBA 2YNHB 3CDUA 4LSLB 2ZBPA 4DV7J 2CYYA 1UPMB 3MEEA 2YNFB 1IBKF 1PO6A 2OTJS 1KN6A 1XMOF 4FBTA 3GU0A 4ZP8A 3LTOA 4URSA 2Z0GA 3NOCA 4IFVB 4Q5VA 3OUYA 3I6PA 4LSZB 3VVUA 2XZDB 3DHWC 4KH0B 3ZTSA 1S1XA 2D7SA 2XM3A 3UCZP 4I1TA 1IBLF 3QO9A 2LQJA 1TAQA 1TK0A 1B7FA 2WK4A 4Q7AA 4X66F 2P8IA 4JI7J 2V2KA 3WBZA 3FZ2A 3K7RA 3MEKA 2ZH8A 3TAPA 4ZITA 1P1LA 3IR5B 3MM7B 4DFJA 1V5IB 3TVZA 3P6YC 1JLAA 3BF4A 3CCMS 1FERA 2N82B 5E2QA 1WJ9A 3GJTB 2UXBF 4WK3A 4R0EA 1HBMA 3U7JA 3MEEB 3KHGA 4X4PA 4N41A 1IBCB 1F3VA 2CQIA 2DNLA 3HHLB 1ZA2B 4CT8A 5DG7A 1NBEB 4P2XA 3C19A 5HSPA 3TQEA 2GMJA 1NJZA 3SCLE 1O8BA 2FJBB 5KFNA 1BE4A 3EM1A 2BNZA 4U95A 4MTPA 2HGLA 4IH5A 3VAMA 1CQMA 4IRKA 1FEEA 4P6QA 4QIVA 1RTDA 1S72S 2L08A 3D4JA 3TVYA 4DJBA 1FKOB 2X7IA 2K3KA 2ASDA 2B8PA 5KG3A 4C9DA 3TAQA 4P74A 1NK6A 2KKEA 3AJDA 2CWKA 3DI6B 5F0UA 1NB7A 2LP4A 2X1GA 2FLNA 3QJLA 5HP1B 1Q7LB 1PJ5A 2XSFA 3CIZA 4N77A 3ZTPA 1TK5A 2FPHX 3W2VB 1Q86T 4DV6F 3Q8RB 4OYAA 1NSQA 2NCKL 4JV1A 3C46A 3FSIA 2QV6A 1RT7B 4J37A 4RO0A 4DCOB 1U6ZA 3KUGA 4LQ9A 4UF4A 3KOAA 1OMSA 1WEZA 1MW7A 1WF0A 3CCSS 4G1QB 3TYTA 5J2NA 3D1QA 2W9AA 1S7IA 4IO1A 3BO4A 3NGTA 2XLKA 3QOQA 1RTDB 4C8KA 3MPVA 3UI3A 5CCLA 3E2EA 5T7LB 2CA9A 5HBMA 1NDKA 2E29A 5DQGA 3C15A 5CYQA 3DRYA 1UWAA 3D3CJ 4CNYA 3DOLB 1JLGA 3ET6B 3HD2A 3H4DA 3T5KA 2VFVA 5KAKA 1NZAA 2K2PA 5LXRA 1Q0NA 3TQ1A 4F0KA 2Q6BA 4AT1B 5IS2A 3DU6A 4K7QA 2OKQA 3G8TA 3MUTP 1Q16B 1LV5A 4DU8A 3OL8A 2VBYA 3NRBA 3RAQA 3M1VB 3WZ0A 1RBLA 1U09A 3ONQA 3VCDA 2V8VA 2UVVA 2DYAA 4NPOA 3OR2A 3TX8A 2IRUA 3HXMA 3BR8A 4DQRA 2JWNA 3RJMB 1IBLJ 4MKVA 1IVZA 1R89A 4TYAA 5CYMB 1VBYA 3LP2A 2XY6A 4I2PA 2VJUA 4MJKA 1JNRB 2DNPA 2PN6A 1C4CA 1TL7A 2G0CA 3RAXA 5K5MA 1X5OA 1S10A 1B0VA 2ZZNA 1SIWB 4OV1A 3O3LA 4ZVHA 3W5YA 1VIOA 4G1IA 3VAGA 3NS6A 3H20A 2EFNA 4NLOA 5E7OB 4XIUA 3UPFA 1OY6A 3MMJA 4PG7A 4O3SA 1OYDA 3D6TB 5BYSA 4AL5A 4AD6A 1RQ0A 2XGPA 1YJNS 1SKSA 2GVDA 5F41A 1Q82T 1VQKS 4LSNB 2WOMA 4LR7A 1RWUA 2FLPA 3MCOA 2CPYA 3P45B 4KB7A 3KHRA 3VAKA 2K7KA 1HNWJ 3R5AA 4F04B 3MD1A 3T9NA 1MU2A 2A3JA 2KZMA 3OVSA 4ZPWR 2VG5B 1IXKA 1GAOA 3RYLA 1VIXA 1Y5IB 4O4GB 2NSBA 2M9KA 3QWUA 2OSRA 4HL9A 4K2XA 4WIIA 3UNGC 2ZJRQ 4RW4B 4A8QA 2DITA 3GR1A 2EFVA 3B8HA 2B6AA 3Q22A 3L7UA 2D69A 4CO1A 5SUHA 4JUZA 2F4FA 2JLEA 3HP6A 3QZ8A 3SSQA 5L46A 4IR9A 3GYXB 3OXFA 1RTHB 5K8OA 1T05A 2IBOA 3UN5A 2YQ3A 3VGSA 2GVDB 3PV8A 1WC5A 2IFXA 4DSIA 1U2RA 2OHDA 1Y3JA 2YWHA 3Q8VA 3HFKA 1MNTA 3JYTB 4DQSA 2E1RA 2YKMA 4B3RF 3A8EA 3U1LA 3NMRA 2M52A 2BOPA 3EZOA 2KTQA 3QJJA 1UVJA 1VRTA 3KLGA 3JAMY 3OXGA 1HD1A 1ZOTA 5BJRA 1PIEA 2GQCA 2RQKA 3DLJA 2QA4S 3G82A 2R2UA 1MYLA 1OSDA 1EP4A 3PJWA 4YB5A 5MLCV 1T95A 2JVOA 5ETTA 3DOLA 3C6TB 3ET6A 5LMUJ 2HFNA 4WF9Q 4CYUB 2XLJA 2OTLS 4YFUA 3ISND 2WTFA 1WORA 1NH8A 3H5UA 3SIPB 2AYMA 1KEKA 5LJ3Y 2MQQA 4DV0F 1YJ9S 2VG5A 3HT0A 4L75A 2W2PP 4ZJQA 4WCEQ 4JV5J 3UQSA 2W01A 3SV3A 2DNRA 2LA4A 1WHYA 1GXTA 2L3MA 1VBZA 2CQDA 2YX7A 4YOEA 2IC3B 3POTA 3G6YA 4ECUA 2VOOA 2HBYB 4WP8A 1GH8A 4A8YA 2W2NP 1M5VC 2ZD1A 2Y0BB 3ITHA 2OPPA 1RLCL 3DDKA 4DN9A 1EP4B 1YRXA 2MPUA 5KFFA 3PR4A 4RR5A 3R1HA 4JI1J 2YNIB 2NQPA 4NI2B 4FKXA 3PNIA 2BOAA 4NMLA 3S7RA 3W1YC 4CT9A 2HNDB 1U0SA 2BNWA 2Y3YA 2BZ2A 1VRTB 2ZUAA 4UZCA 2R9LA 1UVMA 5E41A 3MR5A 3P8BB 1HR0J 2UUBJ 4QCLA 4W98A 3W66A 4D3GA 2DCUB 4GVLA 3SBMA 1YBAA 2R7TA 1TL5A 1UEUA 3IXQA 4OZNA 4U9RA 2DNQA 2M88A 4DX7A 2AEMA 2KRRA 4OQJA 2XMVA 3C6TA 2Q2KA 2IVYA 3SCKE 4C3LA 4WFNQ 4J9MA 3R1LA 2MSSA 4OYMA 1RAIB 1R8HA 3AJ1A 2CQBA 4PEOA 2B9YA 4DZ6A 5I3UB 4DR7J 1WEXA 5K8MA 4MJWA 4O0NA 4P71A 1YJRA 3QGPA 3V2UC 4Q45A 2Y1JA 3U1NA 2DR9A 5HATA 5DETA 2X1BA 4WKYA 5I42B 5H9EJ 1X4FA 2EFGA 2KH9A 3QRPA 2KT3A 5F8MA 2KT2A 1F6TA 1KTQA 2DH9A 3E51A 3ETMA 5E3CA 3IBWA 5C2GA 4UQTA 1VFJA 2D1CA 2DD8S 1U48A 2UUAJ 2HPUA 3EYZA 2HURA 4ED1A 1Q16A 1FCAA 4JI6F 2HAFA 3MR2A 4TVAB 1N5YB 3QGIA 2FUG9 4NLXA 4B3RJ 3GR0A 2HNYB 5THWA 1X5SA 2HRUA 3QT5A 3MAQA 1G7CB 2VDHA 3IN5A 1K47A 1SH3A 3IWLA 2N3OA 2VFUA 4C3MA 2E5LJ 3I9ZA 5CZVA 4FYWB 3IG1A 1ZS6A 8RUCA 5D3GB 5EX3A 3JAMU 3DHXA 1N6QB 3H2VE 4OI1A 4N76A 1LWCA 3D0IE 2GIFA 3B78A 4NEZA 4FKYA 2KVIA 2QG9B 4KHRA 1S97A 4LRAA 1B99A 5I3QA 2CQ0A 2PI4A 3SQGB 1TUVA 3VGTA 3OV7A 2BANB 4QWBA 2JJ4D 4HT5A 1UJ6A 1FT8A 2ALYB 3R5DA 4K2JA 1RB0A 4QR1A 4EI2A 2RDJA 1U02A 2A2BA 1YZ7A 3CSKA 2DPIA 1JKHA 3IS9B 3UDVA 1V3SA 1FNMA 1TKZA 5CXTA 4LF4J 3UE2A 3M8QB 1UA0A 5J2QA 3CD6S 1FK9A 2FGCA 2VFTA 2DNGA 2IA6A 2FQQB 1RAHB 3W9JA 2OP5A 2QMUB 3PKMA 3NWGA 1SUQB 4NLYA 1Y4ZB 1UW9A 4NASA 5C5JA 1DHMA 3QRRA 4Y2CA 4LRFA 2Q79A 2KXHA 4FVCA 1RWNB 4IYQA 2FD2A 3TARA 1FVQA 4KPCA 4O0IA 4JI3F 1SL2A 4OZ5A 3J81j 3SQGA 1QAJA 4PWWA 2UUAF 1T9XA 4ZJLA 2KOEA 1TL3A 4PWUA 1GK8A 4LIRA 2CJXB 4WZMA 2DJWA 1BWVA 2RHSB 3W5XA 5D3GA 1T3OA 2CPEA 2KZZA 3R7NB 5J2QB 1IJEB 1W7WA 3FCHA 3HI9A 4EZ9A 1IKXA 4EYIB 1V3ZA 4OI0A 4YR0A 1FFWB 1T9VA 2HSEB 1S12A 2P9EA 3I5BA 3LWLA 4G1PA 3T9ZA 4GKKJ 4QJVA 1PJ6A 3CO9A 4BHQA 1YHQS 3FT7A 4DR4F 3RBDA 1IKWA 1M5SA 4WBFA 3OL7A 4PXCA 5FLXY 2D74B 2QYCA 3US5A 3T3FA 3NOGA 2BW7A 4JP8A 1TUWA 4NXNJ 1S76D 1OY9A 3HHKA 2N7CA 3J80Y 3RBEA 3RR7A 4FBUA 1RT5A 2B4UA 4ED2A 2VZ9A 4WJBA 3CJ5A 2AX1A 2OPQA 4DCPB 3BPSP 2CZ9A 5D4LA 5HVHA 2V2QA 1FFGB 3LUYA 2QO3A 3GWCA 3MURP 3MR3A 3H4BA 3VAFA 2J0QD 4RBTA 4M1KA 3CC7S 1DTQA 4N56A 3MCNA 2VJVA 4Z37A 1EETB 2YKNA 4OZ1A 1H7WA 3QJPA 4M5KA 1AW0A 1B3TA 2BJ1A 1EKSA 3BPDA 5DZ6A 1SL1A 1N33J 4X4UA 4LR8A 4DV5F 3W3SA 2QLJB 1UKUA 4PYAA 5J1PA 2C2ZB 3D66A 4EBCA 3SQOP 1HL6A 2HGNA 3GIIA 2AJ2A 4I2QB 4M5DA 3KKFA 2FHJD 3CJTA 1P1TA 1OIAA 1RT5B 4XDDA 3BV8A 2EK6A 5KOXA 3TW0A 2BDPA 4K4YA 5F9LA 5KFEA 2CZ4A 4CLKA 4CTAA 1J5EF 2YQ0A 1H73A 2UU9F 1EKRA 2C3UA 2X51A 4DR2F 5D77A 1TAUA 2Z58B 1Z4UA 1D09B 4DHVA 1EETA 1U0HA 2FYXA 5IT9Y 2JEGA 1IM6A 2HZAA 4IRDA 1VJQA 2Z56B 4X4OA 2Q43A 2R42A 3Q8YA 1RABB 3QSIA 1RHMB 3N0VA 4J5OA 3VEBA 3SDEB 2BANA 1MMLA 3PRVA 3OLAA 1KWMA 4C8LA 2HK3A 2MZQA 4Y65A 3PXGa 2V63A 2FVPA 1SIZA 4NI2A 2OJ3A 5HLFA 1Q79A 3KJNB 3WHIA 4ELVA 2GHWA 2JLFA 3D0HE 3CMAS 1WOOA 3C16B 1S1XB 5LT5A 4K4XA 3C6UB 1KLMA 1RACB 4UUXA 3V6DA 2F65A 1OO0B 2I6WA 3CJ4A 4QR2A 5DDRC 3BQ1A 1DFDA 1HARA 4CDIA 3OHBA 4K4ZA 4FYYB 4ILLA 3PCOB 1FTCA 1NLAA 1QTGA 1Y10A 3CCZA 4L76A 2J6SA 4BWMA 2F4VF 5ETQA 2P5VA 3NKYA 5K14B 3G96A 2K8GA 3MM8A 2BBEA 1IJFB 3NO7A 3O2IA 4OIXA 5A6WA 4U8YA 2RE1A 4PPZA 1H6KX 1YJ7A 2HVEA 2D3ZA 1I5OB 1WHXA 2MLYA 3PO5A 4YHHF 2NS1B 2MHNA 2YWKA 4B9NA 3MEDA 1X4AA 2ZJPQ 4ERDA 2BA3A 1W26A 4G65A 2BR0A 1BXNA 1KBRA 1JWWA 2MQOA 1RLDA 1WDDA 2XSJA 2W2QP 4ECXA 1ZAWA 2YBVA 3IC1A 1MN9A 3M6VA 3ISZA 4L3KA 3SCJE 2A6OA 2UUCF 1P94A 1BDTA 2FHJA 3HHNB 2CDRB 2FZCB 3QIPA 3LH2S 2HNZA 3CTRA 2EBEA 2J76E 2RSQA 4KC5A 4C2MA 2V4QA 3NNCA 2HQFA 1VQ9S 3LGHA 1QD1A 3D54A 1KKHA 3LF0A 3H90A 4DDFA 2CIMA 4KV8B 3J7ZT 2JXGA 1M5HA 1AUDA 2V8HA 2VBWA 1RADB 2MZ1A 4DL5A 2WVCA 3G6XA 1YJWS 1B70B 3BSAA 3K17A 1N5VA 5EWFA 2HHHJ 2EG1A 3ZNJ1 4B3OA 2UXBJ 1AB8A 4USIA 2BQRA 2AEJA 2VFRA 3SFUA 1AROP 2GIRA 1PKUA 2WONA 5CQGA 4ECSA 2G2YA 3NG8A 1DURA 4DX6A 5HJYA 4L72B 1G2EA 1PYOB 2H3EB 2H4WB 2R8IA 3OD2A 4RW8B 4ZN3A 5KT5A 1R0BG 1RTIA 1S9GA 1LWXA 2DGSA 2V2VA 2HHUA 3DRPA 2ZNYA 1XEZA 4DU7A 5AJ3F 2DPJA 2FVQA 2W24A 1U24A 4I2PB 1XR5A 4DPYA 4MFBB 1V9OA 1RGVA 1FO1A 1RT2B 3GXQA 3R9LA 2C2DA 2MY7A 4WP9A 3NS7B 4NLDA 5KG4A 4LF2A 4YUDA 2EWHA 2ATCB 3I56S 5HROA 1I94J 4PG5A 1UVLA 4C7QA 1WEYA 1CEZA 1KONA 4WPAA 4AE5A 4RLEA 2I0XA 4AAIA 2BJ7A 2QA2A 3H2UB 3K8WA 3TUJC 5IWAF 1N8RT 2VA3A 1BLUA 4DZDA 1PYSB 5D15A 4UZBA 2EBGA 2R8JA 4W92B 2HBQB 3KUEA 5DLFA 1RT7A 1C0UA 4P2FA 5HVFA 1MMNA 2IMOA 1VQ7S 1SXLA 3GONA 1V5VA 4YY3F 4RNMA 2PMHA 1YITS 1KVKA 2DKOB 1U0HB 5AE3A 4IQXA 1BUXA 1KS2A 5C42B 3DLKB 1GX5A 2VQEJ 3KDNA 4LJMA 2DISA 2KL8A 3AA8A 3ZTQA 4DX8H 3OVAA 2R2TA 3GV5B 5HP1A 1Q4RA 2IY5B 2QIFA 3QMQA 2AZ1A 3C16A 4E2FB 2E9RX 2B3TB 2D3OR 1EAYC 3M2VA 2KG0A 2GVZB 3QZ7A 3UN2A 1PBAA 2EI5A 4W4MA 3AHPA 3CVKA 1LK7A 3KG4A 2DXDA 2KRBA 4HV0A 1N0UA 3NS5A 1FI4A 2YKQA 4NA3A 2IC3A 1JLEA 3POTB 2P6TA 1S4FA 3ZNUA 4ZCMA 5HROB 1RT4B 1MN7A 5BR8F 2CG4A 3MPWA 3J80U 4DPUA 3AD7C 3R7BB 5E3QA 2EG2A 3C14A 3ZZTA 3MPUB 1ZM4A 3HD1A 1N5SA 2BEFA 3L95X 1RKJA 1VC5A 4DSJA 1VQMS 3G86A 4ZVTB 2YPYA 4JI2J 5GAGU 4ZPCA 4KV8A 3Q8QB 1VRQC 1JLGB 1N52B 1IM4A 3W9HA 4EBDA 1DTQB 2NZCA 4U67Q 2L48A 1RK8A 1D0EA 1XQIA 2RF2B 4DMZA 3RW6A 2FZGB 4LVOP 2NYIA 4YHHJ 4QYZJ 1RWOB 3EVMA 5KFTA 3WQPA 2DY1A 2GPEA 1R8PA 2KI2A 3MMCB 4CWBA 2GJFA 1SC6A 5AXMA 4EU0A 2F3JA 4C11A 5AXNA 3PDNA 3MEDB 2HVHA 4QIFA 2WHOA 1JLEB 2BRLA 1E6YB 4M5NA 2W7PA 1D9FA 1EHWA 3NNEA 2YWEA 3OR2B 1KVIA 1K44A 1KQFB 1NB2A 5B7WA 3N5BA 4IO9Q 2DIVA 1MMDA 1VLYA 3AOCA 1VC0A 2NXJA 4MYUA 4DQIA 1VRUB 5KFSA 1S1WA 2VDIA 5M2UA 3FRYA 3HVRA 4LF9J 1TV6B 2YXLA 5A6PA 3C8YA 4Z7YA 1VQ4S 4EEYA 2CPJA 4NLGA 3N6LA 3M30A 3KLHA 4RKUC 2KT5A 3A4TA 9ATCB 1VQOS 1ROFA 3WX4A 4I0WA 1DTTA 3PYFA 1WNEA 4RWXA 1WKLA 2CJYB 1JLBA 3HHLC 3BQ2A 4NXNF 4OHYA 4NLUA 1HPZB 4NLTA 3QFHA 2JXHA 1TR0A 2CQHA 5HAOA 1TVRB 4A8XA 4H4OA 2EC0A 3DLKA 1I6JA 5L1KA 3FSXA 4LVNP 4WXWA 3CMQA 4CRJA 4M94A 1RHJB 1XERA 3GMGA 3KG0A 5CAAA 2GHVC 2ZH4A 4PWDA 1WUUA 1GEHA 1S1WB 3CCTA 4DPOA 3WC2A 4JYAJ 3JTPA 4X4SA 1SC1B 1SVDA 2V0NA 4AYBD 1PBUA 5L39A 4K50A 1ZETA 1NHKL 2JFKA 3CDAA 4CNZA 5KFJA 3BGFA 5LMNJ 1U1QA 4DCJB 5GMKa 3OJUA 3VTIA 2DGTA 2DRDA 5KFDA 2O3DA 3KLEB 3LP0B 4CLZA 5A2QU 3HJFA 2WBMA 3BKTA 2VV5A 2ZH1A 1VGYA 4ZP9A 4U6PA 1AYEA 3SXLA 1J5EJ 1EB0A 3AY0A 1B28A 2UU9J 1S0OA 1N5QA 2UXDF 4JI2F 2J0XA 4DR2J 4D3HA 1AFIA 2IYGA 4GC7A 3FQKA 4TU9A 1FA0A 2XI2A 3H40A 4B08A 4GKJJ 1Q78A 1TL7B 1J27A 3R8YA 2A2CA 5JVHQ 3MDFA 2EC2A 4LSNA 2RMLA 3M2RA 1E6YA 2F9JA 3L7OA 4RBVA 4L6V3 4UQGA 4DR1F 1HW9A 1RT4A 5KG2A 1PILA 2IRYA 4J9NA 2CPZA 4RU9A 3P96A 3UO0A 4IH6A 1Q5YA 1TKTB 2H65B 2HMIA 4WKRA 2Y8YA 1FHTA 1JLCA 3JQKA 5KOWA 3OFEA 3CJ3A 3QT8A 2KHDA 2VBZA 3UW1A 2KFZA 4PZVA 2PA8D 2JSXA 3O8WA 4JOUA 1Q53A 3EZUA 4ZLNA 2D9PA 2FC9A 4F3MA 1HA1A 1LXJA 4ETZA 3K0JA 5KFPA 1WELA 2UXCJ 4JI4F 1QY7A 1N33F 1H3DA 4J9RA 4O4GA 2AJFE 2F8HA 4LRBA 4X64F 1RU1A 1NJYA 1N5YA 1J5OB 4EYHB 3GG1A 5F8LA 1WKJA 3DRRA 4DV3F 2MB0B 4B9MA 4LFCJ 2E9TA 4N7TA 1XNQJ 2XHCA 3PM9A 1QE1A 3D28A 3VW4A 3QATA 3OFGA 1U1PA 1D8ZA 3LPYA 2IM2A 4JI8J 2M0GB 3DKDA 2RDDA 3IG1B 5GMDA 5L9NA 2ZWPA 1REVA 4X4RA 3PX4A 1WTBA 2R7OA 3EX7B 4DR7F 2YKPA 2HQ3A 3IWXA 4WYWA 3W2WB 4B9UA 3A8JA 1YK9A 3HFVA 4MKBA 2BE2B 4BS2A 2LCWA 4RW4A 2G2ZA 2COLA 4LF5J 2VKRA 3HO1A 2PFDA 1P9QC 3NCQA 3KDOA 2ZH7A 1Y7PA 5C2CA 4TQRA 5DDOC 2Z2LA 5G0RA 1WHWA 4P75A 1HBMB 1JLBB 2NXUA 3Q8SB 1JMTA 1ZAVA 4CO2A 2WW8A 4ES2A 2C3PA 3D9BA 1GTHA 4DF8A 2HQCA 3D6HB 4YEAA 2KG1A 4I67A 3MTKA 3QLHB 4LF7F 2R7XA 5D0EA 3ULHA 2Y8WA 1FX2A 3FUYA 3IA0A 1RAJA 5LSRA 4KIAA 4IRCA 1X9WA 5ETLA 4TKTA 2Y1LB 4HKQA 1HI8A 4RW9B 2RBFA 2V2ZA 3TA2A 4IDKA 2LQ8A 1JLFA 1S48A 3QAEA 3CJKA 5KFGA 3PYGA 4ES3A 2CVEA 1GMUA 3Q8PB 3G82B 4U8VA 2ASJA 2OLWA 2UXDJ 2HHVA 4EBEA 1RBAA 1FKOA 4OYIA 3MXHP 2BYCA 2JH3A 1NPPA 1REGX 1AZSB 1JJ2R 1CG2A 1NKBA 1HWJA 2B9EA 1VDHA 2MGZA 1X4GA 4LR9A 3CXCR 4P72A 1QDUB 3WC0A 4X66J 4ZIVA 3AD8C 1UEKA 3BH6B 5HBMB 4K4UA 4CP5A 1FRXA 5A0YB 3DGPA 2K29A 1VHIA 2AX0A 4FF3A 1J2VA 2XMMA 1YDLA 3AAWB 4M5LA 5LL6d 5A2QY 1BGXT 1I1GA 1N32F 4KR0B 3WIVA 1Y5NB 2QLFB 4YDXA 3FBEA 4KH1B 4XDCA 4BCAA 1CJKB 1TKZB 2V9KA 3HLUA 1G3OA 4ED3A 2NYHA 3CEDA 5C24A 3NBPA 1OPIA 3R6LB 4MK8A 4PG6A 2W9CA 3U1MA 2R8HA 1XJWB 4H4OB 3MM6B 1TMJA 2GS8A 1FXDA 1ZYQA 3KUHA 4CH0S 2HVZA 1YGYA 4WP3A 4YB7A 4USMA 2YKOA 1BQNB 3PJXA 5DZ7A 1MYKA 3AB2B 3G87A 4LFCF 2B9XA 1DAXA 3R5JB 1RE1B 4Y0FA 3CCLS 4B9SA 1Q81T 4RJVA 4JI6J 3NEKA 2HVIA 3KJQB 1W2IA 3I87A 5I3PA 2IYIA 4ZCIA 1F9EB 3H59A 4JI4J 1CQNA 4ZN1A 4ZLLA 3DOKA 1GMWD 3HSJA 1S4EA 2ADLA 4ZVQB 2FVSA 3K5NA 1UETA 2E5IA 2PEBA 2A18A 3MECA 4P52A 5E0OA 3ZC4A 4A4JA 1F2HA 3MMBA 3NNHA 5CD4A 5KG1A 5K20B 4FPRA 2HS3A 3X3UA 1FE4A 2BJ9A 4I68A 4XPCA 4WFYA 2HNDA 2HBZB 2MYFA 4L73A 2P6SA 1TK8A 2XS2A 4EUVA 4G1QA 2MKSA 2OFHX 2Z57B 1Q95G 1YRTA 1SPBP 3A8KA 2FTRA 2ZBIA 3I5AA 2ZC4A 5DJBA 1X31C 3E3XA 1CSJA 5CYJA 4ZPAA 2FY1A 4CO5A 3BSNA 3RBZA 4YP3A 1HBOA 4KPYA 4USHA 5JMNA 3Q23A 3HKZD 1B64A 1S49A 2VPYB 4N5SA 3CJ8A 1JKHB 4MIAA 5GAHU 5IOLA 4FXEA 2JHEA 1HQEA 1U2FA 1FESA 2GQ2A 3DYAA 3ISNC 4J9KA 1HYSB 3FK4A 4H4KA 3PY8A 4JI5J 2CJQA 2HHTA 1EARA 4CO0A 4NLPA 2XY7A 5IZHA 1NK7A 1NCLA 3PW4A 4FYXB 5ETNA 7AT1B 1JX4A 4LF8F 2MQPA 2CXEA 4OX8A 3MM9B 4AXJA 1R0AA 4QIEA 1NMEB 4NMXA 3D6FB 3H8YA 4CLUA 3BR9A 2HNYA 2XWYA 2AGPA 1N32J 4UY85 1RHRB 1Y11A 2ROEA 5IQQA 3RB6A 3BKUA 4ID8A 4ZVSB 4R0JA 1WI6A 4USUA 1UPPA 3ZZRA 2UXCF 4B9VA 3V81B 4LFAF 3HZGA 1OG7A 3LWMA 4K4TA 3T41A 2DR6A 4PCQA 1GXUA 3VQSA 3GIKA 1DQAA 1RAFB 2DXEA 4OYXA 5KFMA 2BKPA 4WU3A 1HNWF 2M7SA 2BJ8A 1UMJA 2MEWA 4M95A 4D8JA 1KOOA 3TX0A 5DQHA 1HD0A 1RAAB 4RNHA 4X65J 3PX6A 2B4PA 2J6TA 3MM6A 4GRSA 4KGVB 3TJ8A 5BYRA 4OI3A 4ZCLA 5GAGI 1FD8A 2J0WA 4IOCQ 3IR7B 2AYBA 3CNQP 2VL1A 1B0TA 5KFAA 4I6YA 2CPIA 3MFHA 1LWCB 2V8GA 2RF2A 3AB4B 4QYRA 2HQIA 3TO8A 4UOGA 2FJXA 1S7HA 3NNAA 4ZJOA 1QTNB 3JSMA 5J2MB 2J7WA 4RUCA 3NGSA 4C11B 2C28A 3K8VA 1KQGB 2NR0A 3OTCA 1NUEA 1H2VZ 3G4SS 2MQMA 4MIBA 5B0FA 1OHNA 1LWEB 1RTHA 1T05B 2AGOA 4KGMA 1UA1A 4NCAA 1FWKA 1RTJA 5DLGA 5KT3A 3BO2A 2QFIA 2FVRA 3OTBA 1VHFA 2YTCA 2AY0A 3HX9A 4FF4A 3FMBA 3LQVA 1RT6A 5GADU 4F36A 2MZJA 4CLWA 4FVMA 4KGXB 4KHMA 5T14A 2PMWA 2ZM6J 3GJRB 4K8RA 3H87C 3HJVA 2ZOFA 2GW8A 4YDDB 2K7JA 2UUWA 2XSJB 4NLQA 1N56A 3P4UB 2E5LF 2VODA 1S59A 3KK2B 2HHHF 4MKYA 4B3OB 1SJ4P 4F4AA 2V4JA 4RU2A 3FKBA 2QGFB 4QIGA 2YY3A 5LXYA 1C0UB 3NGUA 4TU8A 4DV3J 3I96A 4I6AA 4DL2A 2X3GA 2I1RA 3PEHA 3W65A 5CHCB 2LQBA 1MWYA 1F5AA 1X8DA 2O5DA 2RDIA 2AHOB 2V6AA 2UUTA 3MPDA 4NOHA 2YWGA 1X4DA 3PACA 1L3KA 1R3NA 3SSRA 4FNHA 1RAOA 2AJ1A 2M4MA 3FDSA 4FPIA 4HHUA 5HQLA 1I51B 3LAMA 5EWGA 3UCUP 1U1OA 1M90T 1VQYA 2I5JA 3ZZYA 2QL7B 4OJHA 1E6VA 1RBOB 3DMJB 5HJXA 3T1HJ 1NK9A 5D8HB 2VBXA 4FN5A 3TI0A 1TFYA 1FTRA 1WSVA 2MZSA 2HQDA 3MEGB 2ZD1B 3FZBA 4DL4A 4DUYF 3CD5A 1APSA 2AJ4A 3HCXA 1NPKA 1LWFB 3BBBA 3ELHA 2J8AA 3DM2A 4N8NA 2NPFA 4C98A 3PIOQ 1HR0F 2UUBF 2NZ4A 4C4WA 2V8PA 9RUBA 2OPSB 4P10A 3MD3A 4ETXA 2GMLA 3PW5A 4CH1A 1RT2A 2GJ2A 4YR2A 3R5GA 4ED4A 4CQ1A 5HQ8A 3ZTOA 2VF3A 4GMKA 2G0JA 3EICA 3LGNA 1WSRA 3D2WA 5F8NA 5L38A 3I32A 2D3O1 4W90B 2NUHA 2WVFA 3FJ2A 3OXLA 4F4YA 1ZPWX 1QSSA 1H72C 2LEAA 2IDEA 2ZC3A 1KLMB 3KJFB 5U47A 2HKEA 3NGDA 1FDDA 1RT3B 4V1Ak 2RS2A 3IBCB 1FWLA 2GMHA 4CLSA 1RWMB 3I0SB 1YG0A 4DR3J 1F0XA 4DV6J 1JJCB 1RWKB 1FD2A 2H5EA 5SZTA 3C14B 3FEYB 3LALA 4HEA9 2KFYA 3PZPA 5F8JA 2W7AA 4WK1A 3I55S 5CYMA 1IWAA 3CUNA 1DQ9A 1RYSA 1FDBA 2HFZA 1A7GE 2JX2A 1YX2A 4NYPA 4U7UK 4B3TF 3GFHA 4CM0A 3RB0A 1SIWA 2DXFA 5F0WA 4DR5F 4OFZA 1XWLA 1VBXA 3I0RA 3G6VA 3J7YU 3KJVB 1HNZJ 1BQXA 2F8MA 1WDTA 3IP0A 4OZ3A 3W60A 3CCWA 3EGZA 2W1BA 3TP2A 5LMNF 2BSQE 4OYPA 2JZ5A 5T41A 4OZLA 2E1MC 5ETRA 1ARQA 3UD5A 1Q8KA 3CULA 1BWEA 3MCSA 3BO3A 3RG6A 2LEPA 4BC9A 1VBKA 5EWEA 3IWNC 1RYRA 1FJCA 4NXMJ 4LF9F 3I31A 2OD4A 4RX6A 3TNVA 3KK3A 3HF5A 2H9ZA 3JXOA 5RUBA 4UW2A 4DF4A 1XC9A 2W4CA 2XO7A 5H9FK 1PC5A 2CJBA 3D5MA 3G2XA 2KYZA 5IWAJ 1U26A 2DR7A 5GADI 4X62F 1NPRA 1NHUA 2HHPA 3IAS9 4KTQA 4NCBA 4TY8A 4Q8EA 4PQUB 2VONA 2Z30B 2F63A 4I4BA 4J9PA 2K5JA 1SQGA 1WC6A 1DQ8A 4KYZA 3G8SA 3VAIA 3RR8A 4F7VA 1U47A 2W7OA 4P2SA 4E8UA 1HBUB 1RA6A 1GMVA 1VQSA 4JB8B 2YNHA 5D0RA 2HNZB 4ATNA 4O23A 4Z2XA 1H74A 5A8WB 2NREA 2RS8A 3KNAA 2ZH9A 1TVRA 3CD7A 1QSLA 2YNGB 3O6QA 1FX4A 2CDQA 4BLGA 4EWTA 4ZPTR 4EO8A 1KVJA 4IG3B 3KK3B 2B0GA 2DBBA 5L9XA 4Y34A 4DL6A 1D8YA 3J7YI 3HHLD 2HIQA 2Q6CA 2H5IB 2VFSA 2Y9HA 4LFBF 1SH2A 1BD6A 2H3AA 2JDJA 4GVBA 4OI4A 4URGA 2XCPA 5DG8A 4WFAQ 1SB6A 3BREA 3I5CA 2G1DA 4PG4A 5J2MA 1ZTTA 1TKDA 5DGBA 5I3UA 2BKOA 3W5ZA 3Q24A 3BH7B 3D67A 2HGMA 2QLBB 2RRNA 1HQUB 3MPYA 4A8OA 3CW2C 2G4BA 2BABA 2CG8A 4F4KA 4HI1A 2HG4A 4HLBA 1S99A 2CKWA 4J9OA 1Y5LB 2MXYA 4J9LA 2DCLA 4QW9A 5KFVA 2BJEA 2RRBA 3LP2B 3W2WA 4TNOA 1VCTA 2DH7A 1YVFA 3F44A 2POKA 3R6GB 4GO7X 3VAHA 4UTGA 3OFHA 4TY8B 4TU7A 1XNRJ 4USVA 1MROB 1K1QA 1ARRA 8AT1B 3R5BA 3TUPA 3GIMA 1HMVB 2IVFB 2J7UA 3H0PA 3M6UA 4HACA 2FHOB 2MHEA 3PRDA 4CLFA 3DXBA 2G13A 2XS7A 3MR6A 2LXUA 4KFBB 3R97A 1LXNA 2HEKA 1RWXB 3TA1A 2EFQA 3JTOA 2P9CA 3KLIA 3M2UB 4TXSA 4LFAJ 2QMXA 2VQFJ 3CC2S 1WF2A 3B54A 4LRVA 1U45A 2ZVIA 4DV2J 3OTDA 3KJVA 3LJPA 2V68A 2F8EX 3DLGA 4IDKB 3KLVA 3T6BA 3BS9A 4M8LA 1S1UA 2VA2A 1FRHA 1HNIA 2QL5B 1HHQA 3EXYA 1X9SA 4HH1A 1AUSL 3GB0A 2JBVA 2V67A 2KN4A 3IO1A 5KFUA 4M5DB 3MEGA 4EO6A 2LMIA 4IG0B 3Q89A 1WACA 4WYLA 2BA9A 5ETVA 2HHQA 4C8NA 4ZVOB 3RRHA 2IJNA 1VRUA 2IDLA 3MCMA 4QQBA 3NXZA 1HWUA 2QA1A 3A3OB 4QPTA 1SUQA 3Q2SC 2DTJA 2ACYA 4WXOA 1YBTA 1LQ9A 1MROA 1VI7A 1VR6A 4FNIA 2AJQA 4DOZA 4L74A 4DV1F 1NSPA 3W8GA 4ENOA 5DGAA 2ZHOA 4FDFA 1Q5VA 5EN1A 5KFLA 2MQNA 1MG7A 4FXVA 2UV8A 2R4FA 2P9GA 3QYYA 2AT1B 2QL9B 3BN4A 6FD1A 2FB0A 3OQ2A 5KT6A 3H5YA 1TP7A 4LFBJ 1LK5A 2WZ1A 1HWIA 1HI1A 2RT3A 4I6WA 4ZP6A 1I3OB 1RTIB 1S9GB 1SV5B 1XMBA 5F8IA 1HKAA 2AIRB 3Q86A 3ZZZA 4F8RA 3NMAA 3S6EA 3UD4P 2VQEF 3CCUS 2CQ2A 5A76A 1X5TA 3QLHA 4YS2A 2IRXA 4DUZJ 2VH7A 3GJSB 3GQCA 3N4WA 4O3PA 3BGLA 1LKZA 4WZQA 5HQMA 2A10A 3OT9A 3GV7B 1Q7YT 3KMSA 4RBUA 1VQNS 2R7UA 4DEZA 3M8WA 1OWXA 2CNLB 2E9ZA 1TKTA 1LW2B 3GCWP 2OPPB 2UV8G 4B3MJ 1X93A 4C97A 3EXCX 2APOA 1CBKA 2MQ8A 1RCOB 2XZTB 3OUYB 3M9MB 3M30B 3QIDA 1ZM9A 3MR7A 4AQYJ 3T1HF 2A1BA 3CDWA 1IRQA 1N5TA 1KTVA 1YKWA 3GCXP 2FZKB 1NSKL 4DQQA 4U7CA 1HNXJ 1JLFB 4NA2A 4KY3A 2LXFA 5B0EA 3GFYA 1K1SA 1HPZA 1T0TV 2L9NA 2VG7B 3K5OA 4J91A 3DRRB 2DNYA 5D0GA 5L1LA 3D6MB 3DC2A 4LBPA 4ELTA 2EXUA 3MM7A 4RWWA 4ZVEA 3VF0B 2AEFA 2Z4PA 4WTYA 1RP5A 3N5FA 4F4WA 1KC8T 4ALZA 4B3SF 1XNQF 4NZ7A 2XMJA 2HZVA 2M3DA 4J9UE 3AODA 5HMYA 2RU9A 5KFQA 3HMJG 3HSDA 3W64A 3MECB 1CJVB 3DN9A 2YNGA 2GAHC 2M70A 4M5IA 4OX7A 3KYLA 1GQEA 2Z2ZA 2ZWOA 5AJ3J 1WC3A 4Y2MA 1T03B 4U96A 4RL1A 5DQIA 5CH7B 5IT0A 4DQPA 2AYGA 2XZWA 1FJGJ 4F25A 2ZUGA 2ZNZA 3NWRA 4HI2A 2OSQA 5ETPA 3A3NB 1R31A 4LSLA 3VZHA 3J81Y 1M5KC 4R8UB 2ZDPA 5T7LA 2DRBA 2AP6A 2J9DE 3F73A 3ICLA 3AQPA 3BYPA 1QAIA 4LT6A 2XTJP 4AL6A 4KSEB 1H38A 5IQ6A 3W9IA 4BWJA 3OL6A 2YH0A 1WHVA 4IG3A 1VQ5S 2XB2D 1CVJA 2AYEA 2VC1A 4DPTA 5G0RB 1JXLA 4DPWA 4TN2A 2JEJA 2B7BB 2PEHA 4K5SA 1PYTA 1FJEB 5B09A 4NYOA 3PG9A 4NA1A 3CGIA 2HIYA 2QJ3A 4OYOA 1FDNA 3QGHA 4WWSA 5FDLB 5GMEA 4F67A 1S6PB 2XQCA 4ZVFA 1WD6A 2O01C 5KFBA 4RNOA 2BE2A 3QFWA 2HS4A 1S57A 1MWQA 2VASA 1F9FA 3TUZC 4XO0A 2W2MP 4ED5A 2E1CA 4DUYJ 1OSCA 5LMUF 2OGUA 1N34J 5A8RA 3ADAC 2DK2A 4LRCA 3VZIA 4DBQA 2BRKA 1BQMA 3T5HA 4X65F 4C8ZA 1GMWA 1X4HA 1R43A 1U7LA 3THVA 2DHAA 3MOJB 3DGPB 4JV5F 4P9SA 3G9CA 4DFKA 2HW3A 1WG5A 3DCAA 3KXDA 2WSEC 2YKMB 5FD1A 3JYTA 4JI5F 1TFWA 4F0MA 1GT8A 2GA7A 1T03A 2AMCB 1T02A 2KM8C 2AD9A 2HLUA 2R7QA 1TTHB 1PAUB 3CCRS 4LF8J 1XNRF 5B0AA 1UL3A 4PR6A 1TELA 1I94F 4B3MF 2EW9A 4DN0A 1SC4B 3H42A 3BQ0A 2RKIB 4AQYF 2R8KA 2GV1A 3KLFA 2CWXA 2BVZA 4RW7B 1OJ4A 3OW2R 5IC6B 5HMXA 2VQFF 3TOQA 2Y1IA 5FJ4A 3MM9A 1EA4A 3GTYX 3TAMA 4DV2F 2PA3A 3V6KA 4ELUA 4OL8A 3S1TA 1X0PA 2N3LA 3GIJA 4FF2A 4CLTA 2HHXA 3M6XA 2ACMA 3H5SA 2JEFA 2HFOA 1FF2A 3LP0A 5KFRA 1NU4A 1U1KA 4YB6A 1ZTWA 1O5JA 2MKYA 2OI2A 2HQGA 2AKWB 2RD5C 1AXQA 2U1AA 3M05A 1CULB 1FKPB 4NYZA 1L5UA 1KFSA 4LF6J 2B6AB 3L7PA 4EFAC 5BXIA 4DSFA 4LRDA 2GJIA 1FRIA 3N6MA 4RW8A 3O1LA 3MHYA 2OMOA 2YPZA 4A47A 2IIHA 2AF6A 1W2BR 1AT1B 2UVRA 2PC6A 3C15B 2PGCA 2CPDA 2LQ9A 3IBFB 4HTIA 1O6XA 5CYQB 1RTJB 3M8SA 4A8FA 2LECA 1QTMA 4ICLB 2RUGA 2M5YA 2OPQB 4AFFA 3M7VA 3CCVS 1IKVB 4Q0BB 1FJGF 1HBNA 4TLRA 1H2TZ 4L3NA 3M32B 3QGGA 4Y00A 3KLGB 3DXSX 2LDIA 1RCXB 4Y2IA 4ZKAA 1QVFR 3W62A 2DNMA 4BC7A 4KAIA 1S6OA 5J2PB 2PO4A 1UTAA 2MZTA 4JI8F 2F5GA 5DDQC 3W8PA 1SL0A 1DZ5A 1JB0C 1LWFA 6AT1B 2AJ0A 2KM8B 3CCJS 2FJWA 4QBUA 4H4MB 4O44A 2ZJQQ 4URQU 1C1BB 2L9DA 4ECVA 3OVBA 1YJVA 2RU3A 3OTOF 3BBCA 3H25A 2FHKA 2V5HG 4LBIA 3VQTA 2M8DB 2E1PA 1PJ7A 2CRLA 2MDAA 5CCMA 2VUGA 3TZYA 2XLIA 1IBMJ 1JLCB 2DHHA 4QR0A 2XMTA 2KXNB 1GTEA 2RNEA 1T9WA 3A1YG 3IRWP 1LOUA 4K4WA 4F2RA 2BX6A 2KB2A 2BXJA 1RSCA 2BACA 2I9SA 2MLZA 2WONB 2IJRA 5DRKA 4WTOB 5KG5A 2OH2A 1Q1KA 1TU0B 2QZ8A 3TR5A 4ITSA 3S01A 4G3IA 1JIHA 3V5RA 1KQSR 2HRYA 3PW7A 1V6HA 4A46A 1YTYA 1IWGA 1ACMB 5FIIA 3NBPB 3VR1A 1HBUA 2C2MB 2MJNA 4OHXA 4NRUA 5CD4H 3SDEA 2YH1A 1VQPS 2CNKB 3QRQA 2MSTA 5IFMA 4C48A 3AA9A 1P6TA 2YWWA 3MMAB 4TYBA 5F8GA 3MF5A 2CQPA 4OX9J 2DGUA 4HH0A 3V4IA 1XN9A 3DLHA 5AE1A 1JNZB 4J90A 5B0DA 3IRXB 1CJVA 1CULA 1FKPA 3CE8A 4B3TJ 1B01A 4ZA1A 5KFWA 1KOHA 3W2VA 5C25A 4M5MA 4DR5J 1NEEA 2G0IA 3DLBA 4KGKA 3ENVA 3ZTRA 2PI5A 4RPFA 1C1CB 2IMWP 2HHSA 3MOZA 3D7SB 2MY8A 4NCGB 4JI0F 1TL1B 1U9PA 2EFPA 2N4CA 4NEYA 3ZZPA 2ABYA 4WE1B 4E98A 4ZK7M 3T19A 3PVXA 2Y0SD 5IM0B 5CZXA 1ZH5A 2R8GA 2RUSA 1TL3B 2DY9A 5BYQA 3OR1B 2I5JB 1BAZA 4IUFA 1QAYA 2C2NA 2K1RA 5D78A 4OHWA 5LSOA 2E5JA 2MJUA 1NK0A 1M1KT 4Q2LA 2ZDOA 3HSZA 3BGOP 2JL9A 1CC7A 4FZVA 4DR3F 4FS1A 1EIYB 4LF6F 1WG1A 3CJ2A 1Z2ZA 1YLXA 4FYDA 1VYAA 2VIHA 1A0OB 3M8PB 3DRSB 4NLSA 4CLYA 3KK1B 2E5HA 2Z2MA 2DH8A 1HW8A 1RUSA 2D9OA 2LXIA 3OJSA 2JNJA 3GV8B 4Q44A 2HS0A 1SCJB 3LP1A 1ITPA 5LOQA 2MKJA 4P2MA 5H9FJ 2W9BB 3T1YJ 4WE1A 1JLQA 1ZZFA 5HMZA 2F9DA 5D4OA 3MUVP 2IAJA 4GVBB 1L3UA 1QUVA 2LU2A 2XMKA 4OYZA 1SJ1A 4H54A 3EJMA 3UVJB 5B08A 1SBRA 2PD1A 1NNDA 1ZA1B 3HKWA 2ZHAA 1EZZB 3FBCA 5GAHI 1D9AA 4H4KC 3CCES 2PMZD 2HWIA 4ANDA 3R2DJ 5IXUA 1UJ4A 4O3NA 4NXMF 4JV2A 3DRSA 1H98A 3KK1A 4X2BA 2WOMB 1W25A 2VG6B 2YNIA 2J0SD 2OUGA 3OTOJ 5AXKA 3EVOA 2MKIA 3V81A 1HWKA 2Z8QA 4X4VA 2UVUA 3DMJA 1CJUA 2C1EB 2X3DA 2NXCA 2W8KA 1IBKJ 2ZZMA 4ZPBA 4HTJA 1CJTB 1CS4A 1XK8A 2A2DA 4OLPA 4CIOA 4DV7F 2CPGA 4KGZB 3I82A 3ZO7A 5JVGQ 4YMEA 5GAEI 2H1OE 3THPA 2QSWA 4DLEA 3M8PA 3ILJA 4AL7A 1P8GA 3D3BJ 3M8RA 5D4PA 1UWBB 5HVGA 1F3FA 1VQ8S 2P2CB 4C3KA 3K57A 2D41A 4ZDNA 1TL1A 1T94A 2QLWA 3IS9A 4ZVGA 2R7RA 2BJ3A 2ATLA 3FNNA 4I2QA 4UOHA 2EPIA 5L1JA 3B82A 3H7HB 2XBPA 1WKKA 3EGWB 4HDHA 1VLOA 1IR0A 2ZE2A 4JI0J 1FRJA 2EKNA 3MMBB 3GP9A 2H5JB 2PT0A 2DB1A 4ZOSA 1M5OC 4HHJA 4ZLJA 1JK9B 4CTAB 4X4NA 4ID5B 2HVDA 4NL5A 4Z7CA 2QA4G 4KBIA 4ANCA 5KFZA 4JI1F 1SKRA 1UFLA 2FHMA 5CABA 1HI0P 1CJTA 1CS4B 2H4YB 1VQ6S 4DR4J 3C3LA 4RNNA 2E66A 3AQOA 3GYNA 4QZVB 3SFGA 2NPIA 4RUAA 3PIPQ 2XC9A 3FEXB 5J2PA 1N34F 1QSYA 4KJIA 1HIYA 2H51B 4IFYB 4RW6A 2LLZA 1UWBA 2VG6A 2C42A 3P49B 3HPOA 1IKVA 4Q0BA 1NDLA 5ETOA 2R7VA 2G2OA 8ATCB 1BQNA 1QE1B 2OEJA 1QVGR 2ROGA 3I4HX 3EGNA 1Y9OA 3G71S 1KSPA 2KFNA 5GAEU 4QWEA 5AXLA 3HDSA 4DX5A 3HZEA 5E3RA 3PO4A 2ADBA 3T5LA 3T1YF 4DG1B 4P73A 1KRPA 1RAEB 1HNZF 4LMZA 4ED7A 3V6DB 3N79A 2LA6A 1GXLA 2LDYA 3AJ2A 2BUNA 3B4MA 4DL7A 1BMQB 2IJFA 2XS5A 3AOAA 4LF1A 2A0FB 2F1FA 1IBMF 2XI3A 2W9BA 4HR2A 5F3TA 2XMUA 5KG0A 3K59A 3TA0A 2AGQA 2FLLA 1EQMA 5K8PA 3W63A 3LANA 4ZHRB 1SH0A 3TWZA 3FQLA 4ANEA 3HVAA 3Q0AA 1C2PA 1FFSB 1NRKA 2I8EA 4N8OA 3S8SA 2ERRA 2YVSA 1RWVB 3TANA 1FDAA 3T5JA 1N48A 1PG5B 1JLQB 2Q1LA 4K59A 2QT7A 3CD0A 4KO0B 1WOSA 3CCQS 3SYZA 3I0RB 4OLOA 3EPGA 2YKAA 4ZP7A 5H1SV 3QIPB 4RUBA 4ZIWA 2RIJA 4DG1A 2KU7A 3BYRA 1X9MA 4LF4F 1HNVB 3GILA 2CJAA 3KG1A 4KHPJ 2OO4A 2KYXA 1NZ8A 1RXOB 3IMQJ 4FXWA 4I64A 1PSDA 5A8KB 4GKJF 1T11A 2CNOB 1C0TB 5A0YA 3K2YA 4ECRA 1K0VA 2PIIA 2ASYA 2FJAB 3HULA 4ZHRA 2VPZB 3VAJA 3ENWA 3JSYA 4MFBA 4PXEA 4F4ZA 2IM3A 1URRA 2VG7A 1NO8A 4BDPA 2BE7D 1RDRA 1S6QB 2QN6B 1GNKA 4OX6A 2QRRA 4UOFA 1OQ6A 2DEIA 3UDLA 2BMBA 4DXLA 3CF5Q 2CJKA 2UUCJ 4PRFA 2ZH5A 2C2EA 2ZKUA 3QT6A 2ALZA 5C24B 3PFOA 2D3UA 5IT9U 2JLGA 1RA7A 4IOAQ 1VK8A 2DO4A 2WB4A 4LUBA 3KLEA 4OV6A 1DRZA 2JOQA 2GGPB 3E01A 3IM9A 2BM1A 3BDEA 4NLVA 4IKAA 2QTWA 4ZPDA 3MM5B 4YN3B 4X62J 3BJYA 2C22A 2QEXS 2XEXA 1X60A 2M8HA 1FWPA 3AH6A 3AOBA 5EUHA 3CT9A 3MGJA 5A8KA 3M9OB 4X64J 7FDRA 5FDLA 4ED0A 6FDRA 3HK2A 1ZPVA 3M2VB 3L9ZA 1RT1A 4OI6A 2V9WA 4USKA 5F3ZA 2NSCA 2FIUA 3BSCA 2KKHA 5KT7A 1UZDA 4PXDA 3KLFB 3V6HA 4HVZA 1E6VB 1NDPA 5E5NA 1UAWA 4B9LA 2DVIA 4WIQA 3D1OA 2XY5A 2AU0A 3TZZA 3M8ZA 3IGNA 4CLLA 1MSWD 2MQLA 2AN7A 2V50A 4G6VB 3HVTA 1U25A 2GNKA 3EMTA 3LPEA 3D68A 1QUPA 2O1PA 3LOUA 4MYTA 4OZ0A 1LNQA 1UVKA 4J7CA 2J9EA 3M8YA 4KT0C 2MMYA 4MK9A 1S6QA 5KFKA 3J81U 2XNQA 1R8BA 2FJVA 2XMAA 3R3TA 3PR5B 2UZAA 5D4NA 2AW0A 2ILYA 3OL9A 3PKYA 4ZVUB 1FEHA 2HWHA 2DGXA 3BN7A 4OZJA 1S0VA 1P9YA 1R8CA 5A8WA 3JQJA 2HHWA 3HHLA 3ILOA 1RT6B 1XR7A 1PARA 2DGOA 3AXKA 4KFBA 4DS4A 4CO3A 3LGMA 2XULA 3MAAA 2MKHA 4TLQA 5KG7A 2HBRB 4BBYA 1T3NA 1K0TA 1VISA 1SKWA 2XNRA 1GFWB 3TJAA 5DM7Q 5H9EK 2PDAA 2RVJA 5JXSA 5J1EB 2DR8A 1REVB 4LF7J 2AZ3A 3JSRA 1IUJA 2FGOA 3GG0A 3WDOA 1U1RA 1S9FA 4DV0J 2BQUA 3MUMP 1M1GA 2GHPA 1S1UB 1TMMA 5HI7A 3A13A 3OLBA 1S9EA 3GFXA 2XYGB 3OSNA 1TKXB 3NY0A 1QLNA 3NLCA 2ZOGA 3VV2B 3RUBL 4RZRA 2I2YA 3UD3P 2X1FA 2R2SA 1P27B 3SEOA 4X84A 5K14A 3UFCX 1WG4A 4QU7A 2R3VA 2WVDA 1BQMB 3HVTB 2B56A 4PUOA 3F56A 5DG9A 1KP6A 1TV6A 4K4SA 3ZFVA 1OY8A 4NLWA 3L3CA 4DL3A 2ASLA 5IT4A 2QX0A 3DU5A 3H98A 2A6MA 2MLXA 4IQMA 3O44A 4CH7A 3NL0A 1X4BA 4EK2A 1HMVA 2YX1A 4KRWA 2DHSA 5D6GA 2DGWA 2HFVA 4QWDA 1N36J 2RH3A 3P5TL 2K6LA 2VU5A 1R8AA 2RHQB 3SZ2A 1S77D 4K5RA 3BEGB 4C8OA 1WOPA 2LFVA 2ZBQA 1S9EB 3QSYB 4Q43A 2UP1A 1IQZA 5F8HA 2BV3A 5C42A 2EEYA 3VEAA 1F9HA 2JEIA 5A8RB 2WSCC 2HK2A 3CIMA 4KKOA 1FNXH 2DIUA 2XG8A 1NJWA 4PWDB 3UDEA 2OELA 4M5HA 2KVQE 3DOMA 4PUOB 1XIQA 2F4VJ 3QQCD 4QPXA 3WX8A 2OEMA 2IA0A 2GQQA 1F5BA 3KHHA 4FF1A 2CADA 2QFJA 1FXLA 1PC4A 1SJQA 5ADZA 4ECQA 3EUNA 3D1HA 5IV3A 3UWTA 4B17A 1AFJA 1L3SA 3FC9A 3VWSA 2FVCA 1R7IA 1SI9A 2C2KB 2WW4A 1S1TA 4HHHA 2R7SA 1J5OA 2W9CB 1IR1A 2Y1RI 3FVYA 4DPXA 3G6ES 3CJ0A 1UZHA 2MZRA 2OAUA 2AQ4A 1UEVA 1XBWA 3JS9A 1T9TA 3KHLA 4A8SA 4K0KF 1IR2A 3DFEA 3OR1A 3TAMB 1HQUA 4QWAA 1SV5A 2IVMA 2ZOMA 4Y3CA 1U6BA 2LQ5A 2CJ9A 1JXVA 4OYWA 2WVEA 4ME7E 3TEHB 1QJHA 3L09A 3IM8A 2YKNB 2VPWB 4LBHA 1NM2A 1O0PA 2L9WA 2DO0A 2XWXA 3Q2TC 3UNYA 3SCIE 3PRBA 1FRMA 1LFWA 1TKXA 3PJ9A 3U02A 1NK5A 1N54B 1UVNA 3NGRA 4ZPVR 2ADCA 4MKAA 4A8MP 4R5PB 2QMWA 3OSPA 3HHDA 1FNOA 3CJQA 4ECYA 1TZ0A 2EK1A 2GVZA 3MFIA 4JI7F 1FVSA 1ZM3A 2ILZA 5I42A 4F02A 2CPXA 4PQAA 3MM5A 4Y2KA 4CO4A 1S79A 3J7AN 3MAAB 4YQWA 2VOPA 3ETOA 3KLIB 1AA1B 1HHSA 1MNEA 3K5PA 1T9YA 3M2UA 3A3PB 4AUKA 3I9V9 4IOBA 4LQ3A 2VD3A 2W2OP 4NCGA 4B02A 5KFIA 1OPZA 3UDCA 5CA5A 4HYKA 2B7CB 2NLWA 1T7PA 3DLEB 2J9DA 1S1TB 1G6BA 2YNFA 1WC1A 3K5MA 1HNIB 3RU0A 3R7SB 2C2OB 3BZQA 1FXRA 4DI6A 1N36F 1LEOA 2OPSA 4ZVRB 4NX9A 2DT9A 4C0BA 4JI3J 3OBIA 4P7TA 1HBNB 1S5ZA 1UFKA 4YY3J 1JJ4A 4R25A 3X1LB 3V4IB 4DV4J 3IGVA 5KFOA 4C8YA 3F0NA 3DOMB 1HQEB 3THTA 3JSBA 4I69A 1IKXB 1KDNA 1YRUA 2YWFA 3SMZA 3RB4A 3C6UA 3PHTA 2LYVA 4DUTA 3BDPA 2Q66A 3CJSA 3JB9k 3H2LA 5JJBA 2UVWA 1LW0A 1ZM2A 2B43A 2KDOA 2M2BA 3VHQA 5JUMA 1U4BA 2FDNA 4GKKF 2VKZG 2CAXA 4PAAA 4CCHA 4ED6A 3CJRA 2DNHA 5J1NA 2XO6A 4KE5A 4ECWA 4OYBA 3RRGA 4ILMA 3NAHA 2JRSA 3M8QA 5EX0A 5KFHA 2ZH2A 4NRTA 3ZZOA 3EWGA 1MLAA 1NSAA 2F7VA 1B7YB 3H5XA 2CQ1A 1KFDA 4USTA 4DL0C 4FXDA 4XK8C 3UR0A 1CPZA 1Y3KA 3TUIC 3W61A 3Q8UA 4F3OA 1FJ7A 2PFFB 4K0KJ 1ICEB 5C7PA 3QO9B 4F50A 2Q3PA 2BKNA 3ITHB 1H2UX 2XYPB 2RKIA 3TJ9A 4NZ6A 2ZFHA 1SJRA 3ILLA 1X5PA 1LW0B 2RAQA 2IM1A 3DDNA 4ECZA 1URNA 1L3TA 2E7VA 4N47A 1RTZA 3MMAA 4DV5J 3MTJA 2GZOA 2ZBCA 4FYVB 5C25B 1NH7A 2RB7A 3R5CA 2LVWA 2ROPA 4ICLA 1ZBTA 1EX8A 1TL4A 3M9NB 2B8QA 3J7Z5 4QYZK 4CLPA 3JSMB 1UW4A 4WFZA 2EFOA 5DDPC 3M4XA 3JTNA 4F26A 2I38A 2XGQA 3K58A 1Q8IA 4ZLPA 1IKYA 3TVKA 2ZH3A 2W25A 2KHCA 4ZS6A 1HWLA 4P7VA 2DNZA 4OHZA 1KLNA 1VS3A 3DRXA 1PCAA 4C0HA 1EJ7L 4EGLA 4S0MA 4QWCA 1G1XA 5ETKA 3M6WA 1RISA 2V69A 3N9UC 3MZIA 1RZMA 3DI6A 2DGVA 3JQMA 1IKWB 4O3QA 4ILRA 4CM2A 2CQ4A 2OPRA 1NJXA 3PW0A 1K9MT 1HHTP 4K4VA 5F9NA 1XR6A 2N7YA 2Z2YB 1M5PC 4DR6F 2RRAA 3R27A 4RW7A 4GO5X 3GPAA 3N01A 3CO0P 2E7WA 2JC0A 3M2RB 4WU2A 1AZSA 3ENQA 3C66A 2WRMA 1SJ3P 3KTQA 3EDQB 2BJDA 2GO8A 4DS5A 1WC0A 3LP1B 2G9OA 4M5GA 4O4RA 4DUZF 4DSLA 1S6UA 1EQ0A 1HFEL 3EPIA 3GFZA 3TRGA 1U1NA 2HMIB 2W4DA 4FP9A 2B9WA 4C0OC 1FK9B 2VICA 1O51A 3V4MA 2FLOA 5LM7E 3M32A 2LU1A 3VVTA 1R27B 1LFPA 3KLHB 2PE8A 3ILIA 2OPRB 5ITHA 2KO1A 5M2RA 3DYAB 1HYSA 3D0GE 1NKCA 1KR4A 2JFDA 2QC3A
chains in the Genus database with same CATH topology
2CPGA 2WVBA 4ME7E 3QSIA 2CAJA 2FGCA 2WVDA 3VEBA 2BJ1A 2K29A 2H1OE 2KELA 3BKUA 1MNTA 2K9IA 1PARA 1BAZA 2CADA 3FT7A 3VW4A 1BDVA 2NZCA 2BA3A 2BJ3A 2K5JA 2WVCA 4FXEA 3OD2A 2BNZA 2RBFA 2HZVA 2WVFA 2JXIA 3QOQA 1Q5YA 1P94A 2K6LA 1BDTA 2PC6A 2CA9A 1Q5VA 1MYLA 2BJ8A 3PHTA 1X93A 2GPEA 4D8JA 1B01A 3BKTA 2BSQE 2AY0A 2JXHA 2BJ9A 3LGHA 3GXQA 4HV0A 1ARQA 2WVEA 1EA4A 3BKFA 2JXGA 1B28A 3VEAA 2Y3YA 1ARRA 2K1OA 1MYKA 1NLAA 1QTGA 3H87C 2CAXA 3FMTA 1U9PA 2BNWA 2F1FA 2HZAA 1IRQA 2BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPG A;  2WVB A;  4ME7 E;  3QSI A;  2CAJ A;  2FGC A;  2WVD A;  3VEB A;  2BJ1 A;  2K29 A;  2H1O E;  2KEL A;  3BKU A;  1MNT A;  2K9I A;  1PAR A;  1BAZ A;  2CAD A;  3FT7 A;  3VW4 A;  1BDV A;  2NZC A;  2BA3 A;  2BJ3 A;  2K5J A;  2WVC A;  4FXE A;  3OD2 A;  2BNZ A;  2RBF A;  2HZV A;  2WVF A;  2JXI A;  3QOQ A;  1Q5Y A;  1P94 A;  2K6L A;  1BDT A;  2PC6 A;  2CA9 A;  1Q5V A;  1MYL A;  2BJ8 A;  3PHT A;  1X93 A;  2GPE A;  4D8J A;  1B01 A;  3BKT A;  2BSQ E;  2AY0 A;  2JXH A;  2BJ9 A;  3LGH A;  3GXQ A;  4HV0 A;  1ARQ A;  2WVE A;  1EA4 A;  3BKF A;  2JXG A;  1B28 A;  3VEA A;  2Y3Y A;  1ARR A;  2K1O A;  1MYK A;  1NLA A;  1QTG A;  3H87 C;  2CAX A;  3FMT A;  1U9P A;  2BNW A;  2F1F A;  2HZA A;  1IRQ A;  2BJ7 A; 
#chains in the Genus database with same CATH topology
 4R8U A;  2ZH6 A;  2C2R A;  2GCF A;  3SI8 A;  3EGV A;  1A6L A;  4LIW A;  1L3V A;  2E5G A;  3EDR B;  2OD6 A;  2OEK A;  5HAN A;  3DM2 B;  3K89 A;  1JQG A;  1SQE A;  3BGR B;  2DHG A;  2RQC A;  1NK8 A;  4IR1 A;  5M2P A;  2J7K A;  2EKY A;  2O66 A;  3B6B A;  2FJE B;  4NLR A;  4E0D A;  3HVW A;  1HNX F;  3CME S;  1F1B B;  3PHE A;  3TZW A;  5DS7 A;  4PKD B;  1TUG B;  2E44 A;  2ZE2 B;  2WBR A;  4B3S J;  2NXE A;  3MMC A;  3CPW R;  3PX0 A;  4NE9 C;  3FGV A;  1TQL A;  5ETS A;  5DO2 A;  4O3O A;  3AFG A;  4M5J A;  1KHW A;  1V3R A;  2V4R A;  4WFB Q;  5J2N B;  2GIQ A;  2V94 A;  1SKU B;  4CYU A;  4B9T A;  4OJ1 A;  5D0H A;  3FMT A;  3ZZU A;  4EZ6 A;  3DLE A;  5DM6 Q;  1U2C A;  2ZKT A;  2DRA A;  4C8M A;  1YBU A;  3CDE A;  3WIU A;  4I56 A;  3PYD A;  4Q8F A;  3SV4 A;  1N88 A;  2IAJ B;  1XMO J;  1NKE A;  3BGR A;  4A8W A;  1Q8L A;  2B5J A;  2V34 A;  5KG6 A;  1U8W A;  4OJG A;  2K9I A;  1FRK A;  1BC6 A;  4ID5 A;  2XHW A;  2CPH A;  1R6Y A;  3FMW A;  4F3Q A;  1S0N A;  5KT2 A;  4RW9 A;  5HK4 A;  3HM9 A;  2CZV C;  5EGY A;  1R0A B;  4ECT A;  1HLW A;  1R6V A;  2CQG A;  3AXM A;  5MAO A;  1Y00 A;  2DEJ A;  3CC4 S;  5E3P A;  1XMQ J;  4ZMM A;  1DTT B;  1R0C B;  2QE5 A;  4NWB A;  4OZ2 A;  5K8N A;  1KNZ A;  3M1V A;  2CVI A;  4WFX A;  2CPF A;  3ZZ0 A;  4AXI A;  5IV4 A;  2GGP A;  2OFG X;  3E01 B;  2R2R A;  1D1U A;  1K73 T;  1T8E A;  1DLO B;  1S1V A;  4ZCK A;  1LWE A;  1WTF A;  3DGV A;  5K9F A;  3J7A 1;  1M0S A;  1YSJ A;  1YIJ S;  2LEB A;  2CNN B;  2F40 A;  2OIH A;  3QPI A;  1RKI A;  2AV5 A;  4Y6I A;  5IM0 A;  4M63 A;  3RW7 A;  3AT1 B;  3F41 A;  3OFF A;  1RT1 B;  1RWW B;  3BB5 A;  3DLL Q;  1RT3 A;  3UN3 A;  1FRL A;  3FFI A;  1KHV A;  1OQ3 A;  1KQK A;  3HT3 A;  3N6N A;  2HRT A;  5B0C A;  1VOM A;  4X4T A;  4UT4 A;  1IN0 A;  2HWT A;  4PQU A;  1C4A A;  2C3Y A;  3GYG A;  1C1C A;  4PYD A;  3IR7 A;  3P3D A;  1X0F A;  3NAI A;  2U2F A;  3T6J A;  1DBD A;  2HAI A;  2YX4 A;  1MWZ A;  2HFS A;  1Q8B A;  3TEG A;  4A48 A;  5BR8 J;  5AT1 B;  3EZ5 A;  1OYE A;  3DRP B;  1CC8 A;  4DLG A;  2H54 B;  5KT4 A;  2JC1 A;  1JJH A;  5IC4 B;  2DR5 A;  3FBF A;  2ZIT A;  3EE3 A;  4HT7 A;  1N6Q A;  2PSZ A;  2QSF A;  4XTT A;  4IFV A;  2K1O A;  1H0H B;  2ZZT A;  3GSD A;  1F60 B;  3SSS A;  2JVR A;  5FLX U;  1PGZ A;  3KFW X;  2XCA A;  2BM0 A;  3DDI A;  4KO0 A;  4OX9 F;  3KK2 A;  2VHG A;  2K06 A;  2ZEJ A;  3BGU A;  3IFE A;  5B0G A;  1QM9 A;  2J5A A;  2VPX B;  3PTW A;  2DGQ A;  3G5O A;  2L41 A;  4XPE A;  2WAQ D;  3GIR A;  4V19 X;  2E7X A;  4MIW A;  2IBK A;  1Z2L A;  3NP5 A;  2ZVS A;  2N4D A;  1Y0H A;  1WC4 A;  1VK3 A;  2QYG A;  2ZBR A;  4MMO A;  3OHA A;  1S0M A;  3VGU A;  3LW5 C;  4QOT A;  1FE0 A;  3G8Q A;  1ULR A;  3MI7 X;  4I7F A;  4MAK A;  4QU6 A;  4F4X A;  1HQ2 A;  4OMF G;  2E1A A;  4UUW A;  3LA0 A;  1BY9 A;  4DFM A;  4YB1 P;  1CLF A;  1WWH A;  1OS5 A;  1NXI A;  2B5J B;  3NCR A;  2GO9 A;  3RAM A;  3FBB A;  2V4J B;  3A12 A;  2RIL A;  3QAU A;  2ZM6 F;  3GLJ A;  4J9S A;  3GSI A;  4IH7 A;  1CJU B;  4NZ0 A;  3BKF A;  1RAG B;  2DNK A;  2RQM A;  1IKY B;  2G1H A;  2R7W A;  1VMB A;  4OI2 A;  2CFX A;  2LKZ A;  2DNN A;  4MT1 A;  4TY9 A;  2V8D A;  3RRK A;  1D3W A;  4YR3 A;  2CAJ A;  2B51 A;  2RQ4 A;  4HAC B;  1ZZN A;  3OTE A;  3IR6 B;  1HBO B;  2H48 B;  3MAH A;  3MM8 B;  4UOC A;  3UR3 C;  1UVI A;  4OHV A;  2FJD B;  5KTQ A;  3QBC A;  1DY3 A;  1DLO A;  1S1V B;  4CZC A;  1VQL S;  2FC8 A;  3B4D A;  4O3R A;  1BDV A;  2MGZ B;  4DV1 J;  4USJ C;  2IPO B;  3BM7 A;  3KMQ A;  1RI7 A;  1X4E A;  4MH8 A;  3RGI A;  1NAQ A;  2W8L A;  1IQT A;  3I4P A;  5J1E A;  4DFP A;  1S6P A;  4XAK A;  2RJZ A;  3FCV A;  3CDB A;  1Z1Z A;  2VB6 A;  3FFI B;  3FRZ A;  3Q83 A;  7FD1 A;  4X4Q A;  1YJT A;  1XTZ A;  3MWB A;  2QLX A;  3RZA A;  3RTV A;  1F5C A;  1ELO A;  1XMQ F;  4KHP F;  3PEJ A;  4RNF A;  4ER8 A;  3ZXW A;  3BBF A;  2CUY A;  2B4O A;  2HLT A;  3HHE A;  1WF1 A;  1M1H A;  1NDC A;  4Y2A A;  1C0T A;  3QWP A;  4IFY A;  4RW6 B;  2NXN A;  4OJ3 A;  3CB4 A;  3VAL A;  4JV0 A;  3PYE A;  4C6A A;  1U8S A;  5HN0 A;  2KEL A;  5EHH A;  5L1I A;  1RHK B;  2BE9 B;  2GAG C;  4DWI A;  1SJF A;  1UP1 A;  3UCG A;  1UFW A;  2HZC A;  2GFF A;  2IM0 A;  2K1R B;  2NUU G;  5LJ5 Y;  4DV4 F;  4UY8 T;  3K5L A;  5L8R C;  1NLK L;  2YQ1 A;  3W7B A;  1ZAX A;  3A8I A;  2SXL A;  1RU2 A;  3CJK B;  2GC8 A;  3R2C J;  1D9D A;  2WCX A;  2KJV A;  1N4L A;  2MKC A;  2J6U A;  1YI2 S;  2J8S A;  2AWZ A;  5KFY A;  3BSO A;  1SQF A;  3FEZ A;  2C3O A;  4LRE A;  1DJ0 A;  2DNO A;  2WB1 D;  3O5T B;  3LAK A;  2EVZ A;  1F2G A;  5HO4 A;  4U7U D;  4F0H A;  3RB3 A;  2C3M A;  3HSG A;  4CI0 B;  1SC3 B;  5GVQ A;  1RHQ B;  3PFE A;  2X1A A;  1UCN A;  1T9U A;  2MTL A;  3IRX A;  1RHU B;  3DLG B;  3KWM A;  3L4B C;  3OPK A;  4KQZ A;  5HL7 Q;  4USW A;  3PW2 A;  1KD1 T;  4DR1 J;  3GZ7 A;  1JXE A;  3UVJ A;  3V6J A;  4RUH A;  3TZX A;  2DHX A;  1U1M A;  1G4C A;  5E3A A;  4PXB A;  5E33 A;  2WSF C;  3HFZ B;  1NJI T;  1VJW A;  2CQ3 A;  2VC0 A;  5B0B A;  1CJK A;  1U49 A;  2HYI B;  3VGV A;  4PG8 A;  1YWX A;  5EDW A;  2HFU A;  4IG0 A;  4JBC A;  1JLA B;  4QW8 A;  1VC6 A;  3RBX A;  2JXI A;  2H1Y A;  3NGK A;  3T1A A;  3DNC A;  4A8K A;  1A9N B;  4J9V A;  1HNV A;  1RWP B;  1RJJ A;  1UJ5 A;  1LW2 A;  3N28 A;  2BW2 A;  5I4M A;  5HLF B;  3QNW B;  1U6F A;  3FCW A;  3KNG A;  3GJQ B;  1YJU A;  3FSY A;  4DSK A;  4F2S A;  1YQH A;  4I7F B;  1MU2 B;  4MK7 A;  1YZ6 A;  2KXF A;  1B0P A;  3LO3 A;  4HDG A;  1NHV A;  1H7X A;  1BHN A;  1DAR A;  3AD9 C;  5LSL A;  1GX6 A;  5KFX A;  3CWJ A;  4PAB A;  4QIW D;  4V19 J;  2O67 A;  5HMW A;  4DSE A;  4EMD A;  4TQS A;  4Y28 C;  1B4S A;  3E8O A;  1C1B A;  3I0S A;  4ZVP B;  3U27 A;  5KFC A;  4GC6 A;  4H4M A;  4O44 B;  4JYA F;  3ENA A;  2OML A;  2MKK A;  3C2P A;  2XMW A;  1X7V A;  3DOK B;  4LF5 F;  4KKO B;  4R5P A;  2W4P A;  1K8A T;  2IHR 1;  2J9C A;  2K3I A;  3P5B P;  2FY8 A;  4J9Q A;  4ES1 A;  1QAX A;  1X4C A;  1PAE X;  1U1L A;  5ETM A;  1NK4 A;  3QT7 A;  2BQ3 A;  2KJW A;  2GX8 A;  2XYH B;  5AE2 A;  2CQC A;  3GE9 A;  5G4D A;  4FS2 A;  3EVW A;  4DR6 J;  1N0V C;  3NCP A;  2ZHB A;  1FKA F;  4Q2M A;  4ED8 A;  3IAM 9;  4PPD A;  2B4V A;  1WI8 A;  2WVB A;  2YNH B;  3CDU A;  4LSL B;  2ZBP A;  4DV7 J;  2CYY A;  1UPM B;  3MEE A;  2YNF B;  1IBK F;  1PO6 A;  2OTJ S;  1KN6 A;  1XMO F;  4FBT A;  3GU0 A;  4ZP8 A;  3LTO A;  4URS A;  2Z0G A;  3NOC A;  4IFV B;  4Q5V A;  3OUY A;  3I6P A;  4LSZ B;  3VVU A;  2XZD B;  3DHW C;  4KH0 B;  3ZTS A;  1S1X A;  2D7S A;  2XM3 A;  3UCZ P;  4I1T A;  1IBL F;  3QO9 A;  2LQJ A;  1TAQ A;  1TK0 A;  1B7F A;  2WK4 A;  4Q7A A;  4X66 F;  2P8I A;  4JI7 J;  2V2K A;  3WBZ A;  3FZ2 A;  3K7R A;  3MEK A;  2ZH8 A;  3TAP A;  4ZIT A;  1P1L A;  3IR5 B;  3MM7 B;  4DFJ A;  1V5I B;  3TVZ A;  3P6Y C;  1JLA A;  3BF4 A;  3CCM S;  1FER A;  2N82 B;  5E2Q A;  1WJ9 A;  3GJT B;  2UXB F;  4WK3 A;  4R0E A;  1HBM A;  3U7J A;  3MEE B;  3KHG A;  4X4P A;  4N41 A;  1IBC B;  1F3V A;  2CQI A;  2DNL A;  3HHL B;  1ZA2 B;  4CT8 A;  5DG7 A;  1NBE B;  4P2X A;  3C19 A;  5HSP A;  3TQE A;  2GMJ A;  1NJZ A;  3SCL E;  1O8B A;  2FJB B;  5KFN A;  1BE4 A;  3EM1 A;  2BNZ A;  4U95 A;  4MTP A;  2HGL A;  4IH5 A;  3VAM A;  1CQM A;  4IRK A;  1FEE A;  4P6Q A;  4QIV A;  1RTD A;  1S72 S;  2L08 A;  3D4J A;  3TVY A;  4DJB A;  1FKO B;  2X7I A;  2K3K A;  2ASD A;  2B8P A;  5KG3 A;  4C9D A;  3TAQ A;  4P74 A;  1NK6 A;  2KKE A;  3AJD A;  2CWK A;  3DI6 B;  5F0U A;  1NB7 A;  2LP4 A;  2X1G A;  2FLN A;  3QJL A;  5HP1 B;  1Q7L B;  1PJ5 A;  2XSF A;  3CIZ A;  4N77 A;  3ZTP A;  1TK5 A;  2FPH X;  3W2V B;  1Q86 T;  4DV6 F;  3Q8R B;  4OYA A;  1NSQ A;  2NCK L;  4JV1 A;  3C46 A;  3FSI A;  2QV6 A;  1RT7 B;  4J37 A;  4RO0 A;  4DCO B;  1U6Z A;  3KUG A;  4LQ9 A;  4UF4 A;  3KOA A;  1OMS A;  1WEZ A;  1MW7 A;  1WF0 A;  3CCS S;  4G1Q B;  3TYT A;  5J2N A;  3D1Q A;  2W9A A;  1S7I A;  4IO1 A;  3BO4 A;  3NGT A;  2XLK A;  3QOQ A;  1RTD B;  4C8K A;  3MPV A;  3UI3 A;  5CCL A;  3E2E A;  5T7L B;  2CA9 A;  5HBM A;  1NDK A;  2E29 A;  5DQG A;  3C15 A;  5CYQ A;  3DRY A;  1UWA A;  3D3C J;  4CNY A;  3DOL B;  1JLG A;  3ET6 B;  3HD2 A;  3H4D A;  3T5K A;  2VFV A;  5KAK A;  1NZA A;  2K2P A;  5LXR A;  1Q0N A;  3TQ1 A;  4F0K A;  2Q6B A;  4AT1 B;  5IS2 A;  3DU6 A;  4K7Q A;  2OKQ A;  3G8T A;  3MUT P;  1Q16 B;  1LV5 A;  4DU8 A;  3OL8 A;  2VBY A;  3NRB A;  3RAQ A;  3M1V B;  3WZ0 A;  1RBL A;  1U09 A;  3ONQ A;  3VCD A;  2V8V A;  2UVV A;  2DYA A;  4NPO A;  3OR2 A;  3TX8 A;  2IRU A;  3HXM A;  3BR8 A;  4DQR A;  2JWN A;  3RJM B;  1IBL J;  4MKV A;  1IVZ A;  1R89 A;  4TYA A;  5CYM B;  1VBY A;  3LP2 A;  2XY6 A;  4I2P A;  2VJU A;  4MJK A;  1JNR B;  2DNP A;  2PN6 A;  1C4C A;  1TL7 A;  2G0C A;  3RAX A;  5K5M A;  1X5O A;  1S10 A;  1B0V A;  2ZZN A;  1SIW B;  4OV1 A;  3O3L A;  4ZVH A;  3W5Y A;  1VIO A;  4G1I A;  3VAG A;  3NS6 A;  3H20 A;  2EFN A;  4NLO A;  5E7O B;  4XIU A;  3UPF A;  1OY6 A;  3MMJ A;  4PG7 A;  4O3S A;  1OYD A;  3D6T B;  5BYS A;  4AL5 A;  4AD6 A;  1RQ0 A;  2XGP A;  1YJN S;  1SKS A;  2GVD A;  5F41 A;  1Q82 T;  1VQK S;  4LSN B;  2WOM A;  4LR7 A;  1RWU A;  2FLP A;  3MCO A;  2CPY A;  3P45 B;  4KB7 A;  3KHR A;  3VAK A;  2K7K A;  1HNW J;  3R5A A;  4F04 B;  3MD1 A;  3T9N A;  1MU2 A;  2A3J A;  2KZM A;  3OVS A;  4ZPW R;  2VG5 B;  1IXK A;  1GAO A;  3RYL A;  1VIX A;  1Y5I B;  4O4G B;  2NSB A;  2M9K A;  3QWU A;  2OSR A;  4HL9 A;  4K2X A;  4WII A;  3UNG C;  2ZJR Q;  4RW4 B;  4A8Q A;  2DIT A;  3GR1 A;  2EFV A;  3B8H A;  2B6A A;  3Q22 A;  3L7U A;  2D69 A;  4CO1 A;  5SUH A;  4JUZ A;  2F4F A;  2JLE A;  3HP6 A;  3QZ8 A;  3SSQ A;  5L46 A;  4IR9 A;  3GYX B;  3OXF A;  1RTH B;  5K8O A;  1T05 A;  2IBO A;  3UN5 A;  2YQ3 A;  3VGS A;  2GVD B;  3PV8 A;  1WC5 A;  2IFX A;  4DSI A;  1U2R A;  2OHD A;  1Y3J A;  2YWH A;  3Q8V A;  3HFK A;  1MNT A;  3JYT B;  4DQS A;  2E1R A;  2YKM A;  4B3R F;  3A8E A;  3U1L A;  3NMR A;  2M52 A;  2BOP A;  3EZO A;  2KTQ A;  3QJJ A;  1UVJ A;  1VRT A;  3KLG A;  3JAM Y;  3OXG A;  1HD1 A;  1ZOT A;  5BJR A;  1PIE A;  2GQC A;  2RQK A;  3DLJ A;  2QA4 S;  3G82 A;  2R2U A;  1MYL A;  1OSD A;  1EP4 A;  3PJW A;  4YB5 A;  5MLC V;  1T95 A;  2JVO A;  5ETT A;  3DOL A;  3C6T B;  3ET6 A;  5LMU J;  2HFN A;  4WF9 Q;  4CYU B;  2XLJ A;  2OTL S;  4YFU A;  3ISN D;  2WTF A;  1WOR A;  1NH8 A;  3H5U A;  3SIP B;  2AYM A;  1KEK A;  5LJ3 Y;  2MQQ A;  4DV0 F;  1YJ9 S;  2VG5 A;  3HT0 A;  4L75 A;  2W2P P;  4ZJQ A;  4WCE Q;  4JV5 J;  3UQS A;  2W01 A;  3SV3 A;  2DNR A;  2LA4 A;  1WHY A;  1GXT A;  2L3M A;  1VBZ A;  2CQD A;  2YX7 A;  4YOE A;  2IC3 B;  3POT A;  3G6Y A;  4ECU A;  2VOO A;  2HBY B;  4WP8 A;  1GH8 A;  4A8Y A;  2W2N P;  1M5V C;  2ZD1 A;  2Y0B B;  3ITH A;  2OPP A;  1RLC L;  3DDK A;  4DN9 A;  1EP4 B;  1YRX A;  2MPU A;  5KFF A;  3PR4 A;  4RR5 A;  3R1H A;  4JI1 J;  2YNI B;  2NQP A;  4NI2 B;  4FKX A;  3PNI A;  2BOA A;  4NML A;  3S7R A;  3W1Y C;  4CT9 A;  2HND B;  1U0S A;  2BNW A;  2Y3Y A;  2BZ2 A;  1VRT B;  2ZUA A;  4UZC A;  2R9L A;  1UVM A;  5E41 A;  3MR5 A;  3P8B B;  1HR0 J;  2UUB J;  4QCL A;  4W98 A;  3W66 A;  4D3G A;  2DCU B;  4GVL A;  3SBM A;  1YBA A;  2R7T A;  1TL5 A;  1UEU A;  3IXQ A;  4OZN A;  4U9R A;  2DNQ A;  2M88 A;  4DX7 A;  2AEM A;  2KRR A;  4OQJ A;  2XMV A;  3C6T A;  2Q2K A;  2IVY A;  3SCK E;  4C3L A;  4WFN Q;  4J9M A;  3R1L A;  2MSS A;  4OYM A;  1RAI B;  1R8H A;  3AJ1 A;  2CQB A;  4PEO A;  2B9Y A;  4DZ6 A;  5I3U B;  4DR7 J;  1WEX A;  5K8M A;  4MJW A;  4O0N A;  4P71 A;  1YJR A;  3QGP A;  3V2U C;  4Q45 A;  2Y1J A;  3U1N A;  2DR9 A;  5HAT A;  5DET A;  2X1B A;  4WKY A;  5I42 B;  5H9E J;  1X4F A;  2EFG A;  2KH9 A;  3QRP A;  2KT3 A;  5F8M A;  2KT2 A;  1F6T A;  1KTQ A;  2DH9 A;  3E51 A;  3ETM A;  5E3C A;  3IBW A;  5C2G A;  4UQT A;  1VFJ A;  2D1C A;  2DD8 S;  1U48 A;  2UUA J;  2HPU A;  3EYZ A;  2HUR A;  4ED1 A;  1Q16 A;  1FCA A;  4JI6 F;  2HAF A;  3MR2 A;  4TVA B;  1N5Y B;  3QGI A;  2FUG 9;  4NLX A;  4B3R J;  3GR0 A;  2HNY B;  5THW A;  1X5S A;  2HRU A;  3QT5 A;  3MAQ A;  1G7C B;  2VDH A;  3IN5 A;  1K47 A;  1SH3 A;  3IWL A;  2N3O A;  2VFU A;  4C3M A;  2E5L J;  3I9Z A;  5CZV A;  4FYW B;  3IG1 A;  1ZS6 A;  8RUC A;  5D3G B;  5EX3 A;  3JAM U;  3DHX A;  1N6Q B;  3H2V E;  4OI1 A;  4N76 A;  1LWC A;  3D0I E;  2GIF A;  3B78 A;  4NEZ A;  4FKY A;  2KVI A;  2QG9 B;  4KHR A;  1S97 A;  4LRA A;  1B99 A;  5I3Q A;  2CQ0 A;  2PI4 A;  3SQG B;  1TUV A;  3VGT A;  3OV7 A;  2BAN B;  4QWB A;  2JJ4 D;  4HT5 A;  1UJ6 A;  1FT8 A;  2ALY B;  3R5D A;  4K2J A;  1RB0 A;  4QR1 A;  4EI2 A;  2RDJ A;  1U02 A;  2A2B A;  1YZ7 A;  3CSK A;  2DPI A;  1JKH A;  3IS9 B;  3UDV A;  1V3S A;  1FNM A;  1TKZ A;  5CXT A;  4LF4 J;  3UE2 A;  3M8Q B;  1UA0 A;  5J2Q A;  3CD6 S;  1FK9 A;  2FGC A;  2VFT A;  2DNG A;  2IA6 A;  2FQQ B;  1RAH B;  3W9J A;  2OP5 A;  2QMU B;  3PKM A;  3NWG A;  1SUQ B;  4NLY A;  1Y4Z B;  1UW9 A;  4NAS A;  5C5J A;  1DHM A;  3QRR A;  4Y2C A;  4LRF A;  2Q79 A;  2KXH A;  4FVC A;  1RWN B;  4IYQ A;  2FD2 A;  3TAR A;  1FVQ A;  4KPC A;  4O0I A;  4JI3 F;  1SL2 A;  4OZ5 A;  3J81 j;  3SQG A;  1QAJ A;  4PWW A;  2UUA F;  1T9X A;  4ZJL A;  2KOE A;  1TL3 A;  4PWU A;  1GK8 A;  4LIR A;  2CJX B;  4WZM A;  2DJW A;  1BWV A;  2RHS B;  3W5X A;  5D3G A;  1T3O A;  2CPE A;  2KZZ A;  3R7N B;  5J2Q B;  1IJE B;  1W7W A;  3FCH A;  3HI9 A;  4EZ9 A;  1IKX A;  4EYI B;  1V3Z A;  4OI0 A;  4YR0 A;  1FFW B;  1T9V A;  2HSE B;  1S12 A;  2P9E A;  3I5B A;  3LWL A;  4G1P A;  3T9Z A;  4GKK J;  4QJV A;  1PJ6 A;  3CO9 A;  4BHQ A;  1YHQ S;  3FT7 A;  4DR4 F;  3RBD A;  1IKW A;  1M5S A;  4WBF A;  3OL7 A;  4PXC A;  5FLX Y;  2D74 B;  2QYC A;  3US5 A;  3T3F A;  3NOG A;  2BW7 A;  4JP8 A;  1TUW A;  4NXN J;  1S76 D;  1OY9 A;  3HHK A;  2N7C A;  3J80 Y;  3RBE A;  3RR7 A;  4FBU A;  1RT5 A;  2B4U A;  4ED2 A;  2VZ9 A;  4WJB A;  3CJ5 A;  2AX1 A;  2OPQ A;  4DCP B;  3BPS P;  2CZ9 A;  5D4L A;  5HVH A;  2V2Q A;  1FFG B;  3LUY A;  2QO3 A;  3GWC A;  3MUR P;  3MR3 A;  3H4B A;  3VAF A;  2J0Q D;  4RBT A;  4M1K A;  3CC7 S;  1DTQ A;  4N56 A;  3MCN A;  2VJV A;  4Z37 A;  1EET B;  2YKN A;  4OZ1 A;  1H7W A;  3QJP A;  4M5K A;  1AW0 A;  1B3T A;  2BJ1 A;  1EKS A;  3BPD A;  5DZ6 A;  1SL1 A;  1N33 J;  4X4U A;  4LR8 A;  4DV5 F;  3W3S A;  2QLJ B;  1UKU A;  4PYA A;  5J1P A;  2C2Z B;  3D66 A;  4EBC A;  3SQO P;  1HL6 A;  2HGN A;  3GII A;  2AJ2 A;  4I2Q B;  4M5D A;  3KKF A;  2FHJ D;  3CJT A;  1P1T A;  1OIA A;  1RT5 B;  4XDD A;  3BV8 A;  2EK6 A;  5KOX A;  3TW0 A;  2BDP A;  4K4Y A;  5F9L A;  5KFE A;  2CZ4 A;  4CLK A;  4CTA A;  1J5E F;  2YQ0 A;  1H73 A;  2UU9 F;  1EKR A;  2C3U A;  2X51 A;  4DR2 F;  5D77 A;  1TAU A;  2Z58 B;  1Z4U A;  1D09 B;  4DHV A;  1EET A;  1U0H A;  2FYX A;  5IT9 Y;  2JEG A;  1IM6 A;  2HZA A;  4IRD A;  1VJQ A;  2Z56 B;  4X4O A;  2Q43 A;  2R42 A;  3Q8Y A;  1RAB B;  3QSI A;  1RHM B;  3N0V A;  4J5O A;  3VEB A;  3SDE B;  2BAN A;  1MML A;  3PRV A;  3OLA A;  1KWM A;  4C8L A;  2HK3 A;  2MZQ A;  4Y65 A;  3PXG a;  2V63 A;  2FVP A;  1SIZ A;  4NI2 A;  2OJ3 A;  5HLF A;  1Q79 A;  3KJN B;  3WHI A;  4ELV A;  2GHW A;  2JLF A;  3D0H E;  3CMA S;  1WOO A;  3C16 B;  1S1X B;  5LT5 A;  4K4X A;  3C6U B;  1KLM A;  1RAC B;  4UUX A;  3V6D A;  2F65 A;  1OO0 B;  2I6W A;  3CJ4 A;  4QR2 A;  5DDR C;  3BQ1 A;  1DFD A;  1HAR A;  4CDI A;  3OHB A;  4K4Z A;  4FYY B;  4ILL A;  3PCO B;  1FTC A;  1NLA A;  1QTG A;  1Y10 A;  3CCZ A;  4L76 A;  2J6S A;  4BWM A;  2F4V F;  5ETQ A;  2P5V A;  3NKY A;  5K14 B;  3G96 A;  2K8G A;  3MM8 A;  2BBE A;  1IJF B;  3NO7 A;  3O2I A;  4OIX A;  5A6W A;  4U8Y A;  2RE1 A;  4PPZ A;  1H6K X;  1YJ7 A;  2HVE A;  2D3Z A;  1I5O B;  1WHX A;  2MLY A;  3PO5 A;  4YHH F;  2NS1 B;  2MHN A;  2YWK A;  4B9N A;  3MED A;  1X4A A;  2ZJP Q;  4ERD A;  2BA3 A;  1W26 A;  4G65 A;  2BR0 A;  1BXN A;  1KBR A;  1JWW A;  2MQO A;  1RLD A;  1WDD A;  2XSJ A;  2W2Q P;  4ECX A;  1ZAW A;  2YBV A;  3IC1 A;  1MN9 A;  3M6V A;  3ISZ A;  4L3K A;  3SCJ E;  2A6O A;  2UUC F;  1P94 A;  1BDT A;  2FHJ A;  3HHN B;  2CDR B;  2FZC B;  3QIP A;  3LH2 S;  2HNZ A;  3CTR A;  2EBE A;  2J76 E;  2RSQ A;  4KC5 A;  4C2M A;  2V4Q A;  3NNC A;  2HQF A;  1VQ9 S;  3LGH A;  1QD1 A;  3D54 A;  1KKH A;  3LF0 A;  3H90 A;  4DDF A;  2CIM A;  4KV8 B;  3J7Z T;  2JXG A;  1M5H A;  1AUD A;  2V8H A;  2VBW A;  1RAD B;  2MZ1 A;  4DL5 A;  2WVC A;  3G6X A;  1YJW S;  1B70 B;  3BSA A;  3K17 A;  1N5V A;  5EWF A;  2HHH J;  2EG1 A;  3ZNJ 1;  4B3O A;  2UXB J;  1AB8 A;  4USI A;  2BQR A;  2AEJ A;  2VFR A;  3SFU A;  1ARO P;  2GIR A;  1PKU A;  2WON A;  5CQG A;  4ECS A;  2G2Y A;  3NG8 A;  1DUR A;  4DX6 A;  5HJY A;  4L72 B;  1G2E A;  1PYO B;  2H3E B;  2H4W B;  2R8I A;  3OD2 A;  4RW8 B;  4ZN3 A;  5KT5 A;  1R0B G;  1RTI A;  1S9G A;  1LWX A;  2DGS A;  2V2V A;  2HHU A;  3DRP A;  2ZNY A;  1XEZ A;  4DU7 A;  5AJ3 F;  2DPJ A;  2FVQ A;  2W24 A;  1U24 A;  4I2P B;  1XR5 A;  4DPY A;  4MFB B;  1V9O A;  1RGV A;  1FO1 A;  1RT2 B;  3GXQ A;  3R9L A;  2C2D A;  2MY7 A;  4WP9 A;  3NS7 B;  4NLD A;  5KG4 A;  4LF2 A;  4YUD A;  2EWH A;  2ATC B;  3I56 S;  5HRO A;  1I94 J;  4PG5 A;  1UVL A;  4C7Q A;  1WEY A;  1CEZ A;  1KON A;  4WPA A;  4AE5 A;  4RLE A;  2I0X A;  4AAI A;  2BJ7 A;  2QA2 A;  3H2U B;  3K8W A;  3TUJ C;  5IWA F;  1N8R T;  2VA3 A;  1BLU A;  4DZD A;  1PYS B;  5D15 A;  4UZB A;  2EBG A;  2R8J A;  4W92 B;  2HBQ B;  3KUE A;  5DLF A;  1RT7 A;  1C0U A;  4P2F A;  5HVF A;  1MMN A;  2IMO A;  1VQ7 S;  1SXL A;  3GON A;  1V5V A;  4YY3 F;  4RNM A;  2PMH A;  1YIT S;  1KVK A;  2DKO B;  1U0H B;  5AE3 A;  4IQX A;  1BUX A;  1KS2 A;  5C42 B;  3DLK B;  1GX5 A;  2VQE J;  3KDN A;  4LJM A;  2DIS A;  2KL8 A;  3AA8 A;  3ZTQ A;  4DX8 H;  3OVA A;  2R2T A;  3GV5 B;  5HP1 A;  1Q4R A;  2IY5 B;  2QIF A;  3QMQ A;  2AZ1 A;  3C16 A;  4E2F B;  2E9R X;  2B3T B;  2D3O R;  1EAY C;  3M2V A;  2KG0 A;  2GVZ B;  3QZ7 A;  3UN2 A;  1PBA A;  2EI5 A;  4W4M A;  3AHP A;  3CVK A;  1LK7 A;  3KG4 A;  2DXD A;  2KRB A;  4HV0 A;  1N0U A;  3NS5 A;  1FI4 A;  2YKQ A;  4NA3 A;  2IC3 A;  1JLE A;  3POT B;  2P6T A;  1S4F A;  3ZNU A;  4ZCM A;  5HRO B;  1RT4 B;  1MN7 A;  5BR8 F;  2CG4 A;  3MPW A;  3J80 U;  4DPU A;  3AD7 C;  3R7B B;  5E3Q A;  2EG2 A;  3C14 A;  3ZZT A;  3MPU B;  1ZM4 A;  3HD1 A;  1N5S A;  2BEF A;  3L95 X;  1RKJ A;  1VC5 A;  4DSJ A;  1VQM S;  3G86 A;  4ZVT B;  2YPY A;  4JI2 J;  5GAG U;  4ZPC A;  4KV8 A;  3Q8Q B;  1VRQ C;  1JLG B;  1N52 B;  1IM4 A;  3W9H A;  4EBD A;  1DTQ B;  2NZC A;  4U67 Q;  2L48 A;  1RK8 A;  1D0E A;  1XQI A;  2RF2 B;  4DMZ A;  3RW6 A;  2FZG B;  4LVO P;  2NYI A;  4YHH J;  4QYZ J;  1RWO B;  3EVM A;  5KFT A;  3WQP A;  2DY1 A;  2GPE A;  1R8P A;  2KI2 A;  3MMC B;  4CWB A;  2GJF A;  1SC6 A;  5AXM A;  4EU0 A;  2F3J A;  4C11 A;  5AXN A;  3PDN A;  3MED B;  2HVH A;  4QIF A;  2WHO A;  1JLE B;  2BRL A;  1E6Y B;  4M5N A;  2W7P A;  1D9F A;  1EHW A;  3NNE A;  2YWE A;  3OR2 B;  1KVI A;  1K44 A;  1KQF B;  1NB2 A;  5B7W A;  3N5B A;  4IO9 Q;  2DIV A;  1MMD A;  1VLY A;  3AOC A;  1VC0 A;  2NXJ A;  4MYU A;  4DQI A;  1VRU B;  5KFS A;  1S1W A;  2VDI A;  5M2U A;  3FRY A;  3HVR A;  4LF9 J;  1TV6 B;  2YXL A;  5A6P A;  3C8Y A;  4Z7Y A;  1VQ4 S;  4EEY A;  2CPJ A;  4NLG A;  3N6L A;  3M30 A;  3KLH A;  4RKU C;  2KT5 A;  3A4T A;  9ATC B;  1VQO S;  1ROF A;  3WX4 A;  4I0W A;  1DTT A;  3PYF A;  1WNE A;  4RWX A;  1WKL A;  2CJY B;  1JLB A;  3HHL C;  3BQ2 A;  4NXN F;  4OHY A;  4NLU A;  1HPZ B;  4NLT A;  3QFH A;  2JXH A;  1TR0 A;  2CQH A;  5HAO A;  1TVR B;  4A8X A;  4H4O A;  2EC0 A;  3DLK A;  1I6J A;  5L1K A;  3FSX A;  4LVN P;  4WXW A;  3CMQ A;  4CRJ A;  4M94 A;  1RHJ B;  1XER A;  3GMG A;  3KG0 A;  5CAA A;  2GHV C;  2ZH4 A;  4PWD A;  1WUU A;  1GEH A;  1S1W B;  3CCT A;  4DPO A;  3WC2 A;  4JYA J;  3JTP A;  4X4S A;  1SC1 B;  1SVD A;  2V0N A;  4AYB D;  1PBU A;  5L39 A;  4K50 A;  1ZET A;  1NHK L;  2JFK A;  3CDA A;  4CNZ A;  5KFJ A;  3BGF A;  5LMN J;  1U1Q A;  4DCJ B;  5GMK a;  3OJU A;  3VTI A;  2DGT A;  2DRD A;  5KFD A;  2O3D A;  3KLE B;  3LP0 B;  4CLZ A;  5A2Q U;  3HJF A;  2WBM A;  3BKT A;  2VV5 A;  2ZH1 A;  1VGY A;  4ZP9 A;  4U6P A;  1AYE A;  3SXL A;  1J5E J;  1EB0 A;  3AY0 A;  1B28 A;  2UU9 J;  1S0O A;  1N5Q A;  2UXD F;  4JI2 F;  2J0X A;  4DR2 J;  4D3H A;  1AFI A;  2IYG A;  4GC7 A;  3FQK A;  4TU9 A;  1FA0 A;  2XI2 A;  3H40 A;  4B08 A;  4GKJ J;  1Q78 A;  1TL7 B;  1J27 A;  3R8Y A;  2A2C A;  5JVH Q;  3MDF A;  2EC2 A;  4LSN A;  2RML A;  3M2R A;  1E6Y A;  2F9J A;  3L7O A;  4RBV A;  4L6V 3;  4UQG A;  4DR1 F;  1HW9 A;  1RT4 A;  5KG2 A;  1PIL A;  2IRY A;  4J9N A;  2CPZ A;  4RU9 A;  3P96 A;  3UO0 A;  4IH6 A;  1Q5Y A;  1TKT B;  2H65 B;  2HMI A;  4WKR A;  2Y8Y A;  1FHT A;  1JLC A;  3JQK A;  5KOW A;  3OFE A;  3CJ3 A;  3QT8 A;  2KHD A;  2VBZ A;  3UW1 A;  2KFZ A;  4PZV A;  2PA8 D;  2JSX A;  3O8W A;  4JOU A;  1Q53 A;  3EZU A;  4ZLN A;  2D9P A;  2FC9 A;  4F3M A;  1HA1 A;  1LXJ A;  4ETZ A;  3K0J A;  5KFP A;  1WEL A;  2UXC J;  4JI4 F;  1QY7 A;  1N33 F;  1H3D A;  4J9R A;  4O4G A;  2AJF E;  2F8H A;  4LRB A;  4X64 F;  1RU1 A;  1NJY A;  1N5Y A;  1J5O B;  4EYH B;  3GG1 A;  5F8L A;  1WKJ A;  3DRR A;  4DV3 F;  2MB0 B;  4B9M A;  4LFC J;  2E9T A;  4N7T A;  1XNQ J;  2XHC A;  3PM9 A;  1QE1 A;  3D28 A;  3VW4 A;  3QAT A;  3OFG A;  1U1P A;  1D8Z A;  3LPY A;  2IM2 A;  4JI8 J;  2M0G B;  3DKD A;  2RDD A;  3IG1 B;  5GMD A;  5L9N A;  2ZWP A;  1REV A;  4X4R A;  3PX4 A;  1WTB A;  2R7O A;  3EX7 B;  4DR7 F;  2YKP A;  2HQ3 A;  3IWX A;  4WYW A;  3W2W B;  4B9U A;  3A8J A;  1YK9 A;  3HFV A;  4MKB A;  2BE2 B;  4BS2 A;  2LCW A;  4RW4 A;  2G2Z A;  2COL A;  4LF5 J;  2VKR A;  3HO1 A;  2PFD A;  1P9Q C;  3NCQ A;  3KDO A;  2ZH7 A;  1Y7P A;  5C2C A;  4TQR A;  5DDO C;  2Z2L A;  5G0R A;  1WHW A;  4P75 A;  1HBM B;  1JLB B;  2NXU A;  3Q8S B;  1JMT A;  1ZAV A;  4CO2 A;  2WW8 A;  4ES2 A;  2C3P A;  3D9B A;  1GTH A;  4DF8 A;  2HQC A;  3D6H B;  4YEA A;  2KG1 A;  4I67 A;  3MTK A;  3QLH B;  4LF7 F;  2R7X A;  5D0E A;  3ULH A;  2Y8W A;  1FX2 A;  3FUY A;  3IA0 A;  1RAJ A;  5LSR A;  4KIA A;  4IRC A;  1X9W A;  5ETL A;  4TKT A;  2Y1L B;  4HKQ A;  1HI8 A;  4RW9 B;  2RBF A;  2V2Z A;  3TA2 A;  4IDK A;  2LQ8 A;  1JLF A;  1S48 A;  3QAE A;  3CJK A;  5KFG A;  3PYG A;  4ES3 A;  2CVE A;  1GMU A;  3Q8P B;  3G82 B;  4U8V A;  2ASJ A;  2OLW A;  2UXD J;  2HHV A;  4EBE A;  1RBA A;  1FKO A;  4OYI A;  3MXH P;  2BYC A;  2JH3 A;  1NPP A;  1REG X;  1AZS B;  1JJ2 R;  1CG2 A;  1NKB A;  1HWJ A;  2B9E A;  1VDH A;  2MGZ A;  1X4G A;  4LR9 A;  3CXC R;  4P72 A;  1QDU B;  3WC0 A;  4X66 J;  4ZIV A;  3AD8 C;  1UEK A;  3BH6 B;  5HBM B;  4K4U A;  4CP5 A;  1FRX A;  5A0Y B;  3DGP A;  2K29 A;  1VHI A;  2AX0 A;  4FF3 A;  1J2V A;  2XMM A;  1YDL A;  3AAW B;  4M5L A;  5LL6 d;  5A2Q Y;  1BGX T;  1I1G A;  1N32 F;  4KR0 B;  3WIV A;  1Y5N B;  2QLF B;  4YDX A;  3FBE A;  4KH1 B;  4XDC A;  4BCA A;  1CJK B;  1TKZ B;  2V9K A;  3HLU A;  1G3O A;  4ED3 A;  2NYH A;  3CED A;  5C24 A;  3NBP A;  1OPI A;  3R6L B;  4MK8 A;  4PG6 A;  2W9C A;  3U1M A;  2R8H A;  1XJW B;  4H4O B;  3MM6 B;  1TMJ A;  2GS8 A;  1FXD A;  1ZYQ A;  3KUH A;  4CH0 S;  2HVZ A;  1YGY A;  4WP3 A;  4YB7 A;  4USM A;  2YKO A;  1BQN B;  3PJX A;  5DZ7 A;  1MYK A;  3AB2 B;  3G87 A;  4LFC F;  2B9X A;  1DAX A;  3R5J B;  1RE1 B;  4Y0F A;  3CCL S;  4B9S A;  1Q81 T;  4RJV A;  4JI6 J;  3NEK A;  2HVI A;  3KJQ B;  1W2I A;  3I87 A;  5I3P A;  2IYI A;  4ZCI A;  1F9E B;  3H59 A;  4JI4 J;  1CQN A;  4ZN1 A;  4ZLL A;  3DOK A;  1GMW D;  3HSJ A;  1S4E A;  2ADL A;  4ZVQ B;  2FVS A;  3K5N A;  1UET A;  2E5I A;  2PEB A;  2A18 A;  3MEC A;  4P52 A;  5E0O A;  3ZC4 A;  4A4J A;  1F2H A;  3MMB A;  3NNH A;  5CD4 A;  5KG1 A;  5K20 B;  4FPR A;  2HS3 A;  3X3U A;  1FE4 A;  2BJ9 A;  4I68 A;  4XPC A;  4WFY A;  2HND A;  2HBZ B;  2MYF A;  4L73 A;  2P6S A;  1TK8 A;  2XS2 A;  4EUV A;  4G1Q A;  2MKS A;  2OFH X;  2Z57 B;  1Q95 G;  1YRT A;  1SPB P;  3A8K A;  2FTR A;  2ZBI A;  3I5A A;  2ZC4 A;  5DJB A;  1X31 C;  3E3X A;  1CSJ A;  5CYJ A;  4ZPA A;  2FY1 A;  4CO5 A;  3BSN A;  3RBZ A;  4YP3 A;  1HBO A;  4KPY A;  4USH A;  5JMN A;  3Q23 A;  3HKZ D;  1B64 A;  1S49 A;  2VPY B;  4N5S A;  3CJ8 A;  1JKH B;  4MIA A;  5GAH U;  5IOL A;  4FXE A;  2JHE A;  1HQE A;  1U2F A;  1FES A;  2GQ2 A;  3DYA A;  3ISN C;  4J9K A;  1HYS B;  3FK4 A;  4H4K A;  3PY8 A;  4JI5 J;  2CJQ A;  2HHT A;  1EAR A;  4CO0 A;  4NLP A;  2XY7 A;  5IZH A;  1NK7 A;  1NCL A;  3PW4 A;  4FYX B;  5ETN A;  7AT1 B;  1JX4 A;  4LF8 F;  2MQP A;  2CXE A;  4OX8 A;  3MM9 B;  4AXJ A;  1R0A A;  4QIE A;  1NME B;  4NMX A;  3D6F B;  3H8Y A;  4CLU A;  3BR9 A;  2HNY A;  2XWY A;  2AGP A;  1N32 J;  4UY8 5;  1RHR B;  1Y11 A;  2ROE A;  5IQQ A;  3RB6 A;  3BKU A;  4ID8 A;  4ZVS B;  4R0J A;  1WI6 A;  4USU A;  1UPP A;  3ZZR A;  2UXC F;  4B9V A;  3V81 B;  4LFA F;  3HZG A;  1OG7 A;  3LWM A;  4K4T A;  3T41 A;  2DR6 A;  4PCQ A;  1GXU A;  3VQS A;  3GIK A;  1DQA A;  1RAF B;  2DXE A;  4OYX A;  5KFM A;  2BKP A;  4WU3 A;  1HNW F;  2M7S A;  2BJ8 A;  1UMJ A;  2MEW A;  4M95 A;  4D8J A;  1KOO A;  3TX0 A;  5DQH A;  1HD0 A;  1RAA B;  4RNH A;  4X65 J;  3PX6 A;  2B4P A;  2J6T A;  3MM6 A;  4GRS A;  4KGV B;  3TJ8 A;  5BYR A;  4OI3 A;  4ZCL A;  5GAG I;  1FD8 A;  2J0W A;  4IOC Q;  3IR7 B;  2AYB A;  3CNQ P;  2VL1 A;  1B0T A;  5KFA A;  4I6Y A;  2CPI A;  3MFH A;  1LWC B;  2V8G A;  2RF2 A;  3AB4 B;  4QYR A;  2HQI A;  3TO8 A;  4UOG A;  2FJX A;  1S7H A;  3NNA A;  4ZJO A;  1QTN B;  3JSM A;  5J2M B;  2J7W A;  4RUC A;  3NGS A;  4C11 B;  2C28 A;  3K8V A;  1KQG B;  2NR0 A;  3OTC A;  1NUE A;  1H2V Z;  3G4S S;  2MQM A;  4MIB A;  5B0F A;  1OHN A;  1LWE B;  1RTH A;  1T05 B;  2AGO A;  4KGM A;  1UA1 A;  4NCA A;  1FWK A;  1RTJ A;  5DLG A;  5KT3 A;  3BO2 A;  2QFI A;  2FVR A;  3OTB A;  1VHF A;  2YTC A;  2AY0 A;  3HX9 A;  4FF4 A;  3FMB A;  3LQV A;  1RT6 A;  5GAD U;  4F36 A;  2MZJ A;  4CLW A;  4FVM A;  4KGX B;  4KHM A;  5T14 A;  2PMW A;  2ZM6 J;  3GJR B;  4K8R A;  3H87 C;  3HJV A;  2ZOF A;  2GW8 A;  4YDD B;  2K7J A;  2UUW A;  2XSJ B;  4NLQ A;  1N56 A;  3P4U B;  2E5L F;  2VOD A;  1S59 A;  3KK2 B;  2HHH F;  4MKY A;  4B3O B;  1SJ4 P;  4F4A A;  2V4J A;  4RU2 A;  3FKB A;  2QGF B;  4QIG A;  2YY3 A;  5LXY A;  1C0U B;  3NGU A;  4TU8 A;  4DV3 J;  3I96 A;  4I6A A;  4DL2 A;  2X3G A;  2I1R A;  3PEH A;  3W65 A;  5CHC B;  2LQB A;  1MWY A;  1F5A A;  1X8D A;  2O5D A;  2RDI A;  2AHO B;  2V6A A;  2UUT A;  3MPD A;  4NOH A;  2YWG A;  1X4D A;  3PAC A;  1L3K A;  1R3N A;  3SSR A;  4FNH A;  1RAO A;  2AJ1 A;  2M4M A;  3FDS A;  4FPI A;  4HHU A;  5HQL A;  1I51 B;  3LAM A;  5EWG A;  3UCU P;  1U1O A;  1M90 T;  1VQY A;  2I5J A;  3ZZY A;  2QL7 B;  4OJH A;  1E6V A;  1RBO B;  3DMJ B;  5HJX A;  3T1H J;  1NK9 A;  5D8H B;  2VBX A;  4FN5 A;  3TI0 A;  1TFY A;  1FTR A;  1WSV A;  2MZS A;  2HQD A;  3MEG B;  2ZD1 B;  3FZB A;  4DL4 A;  4DUY F;  3CD5 A;  1APS A;  2AJ4 A;  3HCX A;  1NPK A;  1LWF B;  3BBB A;  3ELH A;  2J8A A;  3DM2 A;  4N8N A;  2NPF A;  4C98 A;  3PIO Q;  1HR0 F;  2UUB F;  2NZ4 A;  4C4W A;  2V8P A;  9RUB A;  2OPS B;  4P10 A;  3MD3 A;  4ETX A;  2GML A;  3PW5 A;  4CH1 A;  1RT2 A;  2GJ2 A;  4YR2 A;  3R5G A;  4ED4 A;  4CQ1 A;  5HQ8 A;  3ZTO A;  2VF3 A;  4GMK A;  2G0J A;  3EIC A;  3LGN A;  1WSR A;  3D2W A;  5F8N A;  5L38 A;  3I32 A;  2D3O 1;  4W90 B;  2NUH A;  2WVF A;  3FJ2 A;  3OXL A;  4F4Y A;  1ZPW X;  1QSS A;  1H72 C;  2LEA A;  2IDE A;  2ZC3 A;  1KLM B;  3KJF B;  5U47 A;  2HKE A;  3NGD A;  1FDD A;  1RT3 B;  4V1A k;  2RS2 A;  3IBC B;  1FWL A;  2GMH A;  4CLS A;  1RWM B;  3I0S B;  1YG0 A;  4DR3 J;  1F0X A;  4DV6 J;  1JJC B;  1RWK B;  1FD2 A;  2H5E A;  5SZT A;  3C14 B;  3FEY B;  3LAL A;  4HEA 9;  2KFY A;  3PZP A;  5F8J A;  2W7A A;  4WK1 A;  3I55 S;  5CYM A;  1IWA A;  3CUN A;  1DQ9 A;  1RYS A;  1FDB A;  2HFZ A;  1A7G E;  2JX2 A;  1YX2 A;  4NYP A;  4U7U K;  4B3T F;  3GFH A;  4CM0 A;  3RB0 A;  1SIW A;  2DXF A;  5F0W A;  4DR5 F;  4OFZ A;  1XWL A;  1VBX A;  3I0R A;  3G6V A;  3J7Y U;  3KJV B;  1HNZ J;  1BQX A;  2F8M A;  1WDT A;  3IP0 A;  4OZ3 A;  3W60 A;  3CCW A;  3EGZ A;  2W1B A;  3TP2 A;  5LMN F;  2BSQ E;  4OYP A;  2JZ5 A;  5T41 A;  4OZL A;  2E1M C;  5ETR A;  1ARQ A;  3UD5 A;  1Q8K A;  3CUL A;  1BWE A;  3MCS A;  3BO3 A;  3RG6 A;  2LEP A;  4BC9 A;  1VBK A;  5EWE A;  3IWN C;  1RYR A;  1FJC A;  4NXM J;  4LF9 F;  3I31 A;  2OD4 A;  4RX6 A;  3TNV A;  3KK3 A;  3HF5 A;  2H9Z A;  3JXO A;  5RUB A;  4UW2 A;  4DF4 A;  1XC9 A;  2W4C A;  2XO7 A;  5H9F K;  1PC5 A;  2CJB A;  3D5M A;  3G2X A;  2KYZ A;  5IWA J;  1U26 A;  2DR7 A;  5GAD I;  4X62 F;  1NPR A;  1NHU A;  2HHP A;  3IAS 9;  4KTQ A;  4NCB A;  4TY8 A;  4Q8E A;  4PQU B;  2VON A;  2Z30 B;  2F63 A;  4I4B A;  4J9P A;  2K5J A;  1SQG A;  1WC6 A;  1DQ8 A;  4KYZ A;  3G8S A;  3VAI A;  3RR8 A;  4F7V A;  1U47 A;  2W7O A;  4P2S A;  4E8U A;  1HBU B;  1RA6 A;  1GMV A;  1VQS A;  4JB8 B;  2YNH A;  5D0R A;  2HNZ B;  4ATN A;  4O23 A;  4Z2X A;  1H74 A;  5A8W B;  2NRE A;  2RS8 A;  3KNA A;  2ZH9 A;  1TVR A;  3CD7 A;  1QSL A;  2YNG B;  3O6Q A;  1FX4 A;  2CDQ A;  4BLG A;  4EWT A;  4ZPT R;  4EO8 A;  1KVJ A;  4IG3 B;  3KK3 B;  2B0G A;  2DBB A;  5L9X A;  4Y34 A;  4DL6 A;  1D8Y A;  3J7Y I;  3HHL D;  2HIQ A;  2Q6C A;  2H5I B;  2VFS A;  2Y9H A;  4LFB F;  1SH2 A;  1BD6 A;  2H3A A;  2JDJ A;  4GVB A;  4OI4 A;  4URG A;  2XCP A;  5DG8 A;  4WFA Q;  1SB6 A;  3BRE A;  3I5C A;  2G1D A;  4PG4 A;  5J2M A;  1ZTT A;  1TKD A;  5DGB A;  5I3U A;  2BKO A;  3W5Z A;  3Q24 A;  3BH7 B;  3D67 A;  2HGM A;  2QLB B;  2RRN A;  1HQU B;  3MPY A;  4A8O A;  3CW2 C;  2G4B A;  2BAB A;  2CG8 A;  4F4K A;  4HI1 A;  2HG4 A;  4HLB A;  1S99 A;  2CKW A;  4J9O A;  1Y5L B;  2MXY A;  4J9L A;  2DCL A;  4QW9 A;  5KFV A;  2BJE A;  2RRB A;  3LP2 B;  3W2W A;  4TNO A;  1VCT A;  2DH7 A;  1YVF A;  3F44 A;  2POK A;  3R6G B;  4GO7 X;  3VAH A;  4UTG A;  3OFH A;  4TY8 B;  4TU7 A;  1XNR J;  4USV A;  1MRO B;  1K1Q A;  1ARR A;  8AT1 B;  3R5B A;  3TUP A;  3GIM A;  1HMV B;  2IVF B;  2J7U A;  3H0P A;  3M6U A;  4HAC A;  2FHO B;  2MHE A;  3PRD A;  4CLF A;  3DXB A;  2G13 A;  2XS7 A;  3MR6 A;  2LXU A;  4KFB B;  3R97 A;  1LXN A;  2HEK A;  1RWX B;  3TA1 A;  2EFQ A;  3JTO A;  2P9C A;  3KLI A;  3M2U B;  4TXS A;  4LFA J;  2QMX A;  2VQF J;  3CC2 S;  1WF2 A;  3B54 A;  4LRV A;  1U45 A;  2ZVI A;  4DV2 J;  3OTD A;  3KJV A;  3LJP A;  2V68 A;  2F8E X;  3DLG A;  4IDK B;  3KLV A;  3T6B A;  3BS9 A;  4M8L A;  1S1U A;  2VA2 A;  1FRH A;  1HNI A;  2QL5 B;  1HHQ A;  3EXY A;  1X9S A;  4HH1 A;  1AUS L;  3GB0 A;  2JBV A;  2V67 A;  2KN4 A;  3IO1 A;  5KFU A;  4M5D B;  3MEG A;  4EO6 A;  2LMI A;  4IG0 B;  3Q89 A;  1WAC A;  4WYL A;  2BA9 A;  5ETV A;  2HHQ A;  4C8N A;  4ZVO B;  3RRH A;  2IJN A;  1VRU A;  2IDL A;  3MCM A;  4QQB A;  3NXZ A;  1HWU A;  2QA1 A;  3A3O B;  4QPT A;  1SUQ A;  3Q2S C;  2DTJ A;  2ACY A;  4WXO A;  1YBT A;  1LQ9 A;  1MRO A;  1VI7 A;  1VR6 A;  4FNI A;  2AJQ A;  4DOZ A;  4L74 A;  4DV1 F;  1NSP A;  3W8G A;  4ENO A;  5DGA A;  2ZHO A;  4FDF A;  1Q5V A;  5EN1 A;  5KFL A;  2MQN A;  1MG7 A;  4FXV A;  2UV8 A;  2R4F A;  2P9G A;  3QYY A;  2AT1 B;  2QL9 B;  3BN4 A;  6FD1 A;  2FB0 A;  3OQ2 A;  5KT6 A;  3H5Y A;  1TP7 A;  4LFB J;  1LK5 A;  2WZ1 A;  1HWI A;  1HI1 A;  2RT3 A;  4I6W A;  4ZP6 A;  1I3O B;  1RTI B;  1S9G B;  1SV5 B;  1XMB A;  5F8I A;  1HKA A;  2AIR B;  3Q86 A;  3ZZZ A;  4F8R A;  3NMA A;  3S6E A;  3UD4 P;  2VQE F;  3CCU S;  2CQ2 A;  5A76 A;  1X5T A;  3QLH A;  4YS2 A;  2IRX A;  4DUZ J;  2VH7 A;  3GJS B;  3GQC A;  3N4W A;  4O3P A;  3BGL A;  1LKZ A;  4WZQ A;  5HQM A;  2A10 A;  3OT9 A;  3GV7 B;  1Q7Y T;  3KMS A;  4RBU A;  1VQN S;  2R7U A;  4DEZ A;  3M8W A;  1OWX A;  2CNL B;  2E9Z A;  1TKT A;  1LW2 B;  3GCW P;  2OPP B;  2UV8 G;  4B3M J;  1X93 A;  4C97 A;  3EXC X;  2APO A;  1CBK A;  2MQ8 A;  1RCO B;  2XZT B;  3OUY B;  3M9M B;  3M30 B;  3QID A;  1ZM9 A;  3MR7 A;  4AQY J;  3T1H F;  2A1B A;  3CDW A;  1IRQ A;  1N5T A;  1KTV A;  1YKW A;  3GCX P;  2FZK B;  1NSK L;  4DQQ A;  4U7C A;  1HNX J;  1JLF B;  4NA2 A;  4KY3 A;  2LXF A;  5B0E A;  3GFY A;  1K1S A;  1HPZ A;  1T0T V;  2L9N A;  2VG7 B;  3K5O A;  4J91 A;  3DRR B;  2DNY A;  5D0G A;  5L1L A;  3D6M B;  3DC2 A;  4LBP A;  4ELT A;  2EXU A;  3MM7 A;  4RWW A;  4ZVE A;  3VF0 B;  2AEF A;  2Z4P A;  4WTY A;  1RP5 A;  3N5F A;  4F4W A;  1KC8 T;  4ALZ A;  4B3S F;  1XNQ F;  4NZ7 A;  2XMJ A;  2HZV A;  2M3D A;  4J9U E;  3AOD A;  5HMY A;  2RU9 A;  5KFQ A;  3HMJ G;  3HSD A;  3W64 A;  3MEC B;  1CJV B;  3DN9 A;  2YNG A;  2GAH C;  2M70 A;  4M5I A;  4OX7 A;  3KYL A;  1GQE A;  2Z2Z A;  2ZWO A;  5AJ3 J;  1WC3 A;  4Y2M A;  1T03 B;  4U96 A;  4RL1 A;  5DQI A;  5CH7 B;  5IT0 A;  4DQP A;  2AYG A;  2XZW A;  1FJG J;  4F25 A;  2ZUG A;  2ZNZ A;  3NWR A;  4HI2 A;  2OSQ A;  5ETP A;  3A3N B;  1R31 A;  4LSL A;  3VZH A;  3J81 Y;  1M5K C;  4R8U B;  2ZDP A;  5T7L A;  2DRB A;  2AP6 A;  2J9D E;  3F73 A;  3ICL A;  3AQP A;  3BYP A;  1QAI A;  4LT6 A;  2XTJ P;  4AL6 A;  4KSE B;  1H38 A;  5IQ6 A;  3W9I A;  4BWJ A;  3OL6 A;  2YH0 A;  1WHV A;  4IG3 A;  1VQ5 S;  2XB2 D;  1CVJ A;  2AYE A;  2VC1 A;  4DPT A;  5G0R B;  1JXL A;  4DPW A;  4TN2 A;  2JEJ A;  2B7B B;  2PEH A;  4K5S A;  1PYT A;  1FJE B;  5B09 A;  4NYO A;  3PG9 A;  4NA1 A;  3CGI A;  2HIY A;  2QJ3 A;  4OYO A;  1FDN A;  3QGH A;  4WWS A;  5FDL B;  5GME A;  4F67 A;  1S6P B;  2XQC A;  4ZVF A;  1WD6 A;  2O01 C;  5KFB A;  4RNO A;  2BE2 A;  3QFW A;  2HS4 A;  1S57 A;  1MWQ A;  2VAS A;  1F9F A;  3TUZ C;  4XO0 A;  2W2M P;  4ED5 A;  2E1C A;  4DUY J;  1OSC A;  5LMU F;  2OGU A;  1N34 J;  5A8R A;  3ADA C;  2DK2 A;  4LRC A;  3VZI A;  4DBQ A;  2BRK A;  1BQM A;  3T5H A;  4X65 F;  4C8Z A;  1GMW A;  1X4H A;  1R43 A;  1U7L A;  3THV A;  2DHA A;  3MOJ B;  3DGP B;  4JV5 F;  4P9S A;  3G9C A;  4DFK A;  2HW3 A;  1WG5 A;  3DCA A;  3KXD A;  2WSE C;  2YKM B;  5FD1 A;  3JYT A;  4JI5 F;  1TFW A;  4F0M A;  1GT8 A;  2GA7 A;  1T03 A;  2AMC B;  1T02 A;  2KM8 C;  2AD9 A;  2HLU A;  2R7Q A;  1TTH B;  1PAU B;  3CCR S;  4LF8 J;  1XNR F;  5B0A A;  1UL3 A;  4PR6 A;  1TEL A;  1I94 F;  4B3M F;  2EW9 A;  4DN0 A;  1SC4 B;  3H42 A;  3BQ0 A;  2RKI B;  4AQY F;  2R8K A;  2GV1 A;  3KLF A;  2CWX A;  2BVZ A;  4RW7 B;  1OJ4 A;  3OW2 R;  5IC6 B;  5HMX A;  2VQF F;  3TOQ A;  2Y1I A;  5FJ4 A;  3MM9 A;  1EA4 A;  3GTY X;  3TAM A;  4DV2 F;  2PA3 A;  3V6K A;  4ELU A;  4OL8 A;  3S1T A;  1X0P A;  2N3L A;  3GIJ A;  4FF2 A;  4CLT A;  2HHX A;  3M6X A;  2ACM A;  3H5S A;  2JEF A;  2HFO A;  1FF2 A;  3LP0 A;  5KFR A;  1NU4 A;  1U1K A;  4YB6 A;  1ZTW A;  1O5J A;  2MKY A;  2OI2 A;  2HQG A;  2AKW B;  2RD5 C;  1AXQ A;  2U1A A;  3M05 A;  1CUL B;  1FKP B;  4NYZ A;  1L5U A;  1KFS A;  4LF6 J;  2B6A B;  3L7P A;  4EFA C;  5BXI A;  4DSF A;  4LRD A;  2GJI A;  1FRI A;  3N6M A;  4RW8 A;  3O1L A;  3MHY A;  2OMO A;  2YPZ A;  4A47 A;  2IIH A;  2AF6 A;  1W2B R;  1AT1 B;  2UVR A;  2PC6 A;  3C15 B;  2PGC A;  2CPD A;  2LQ9 A;  3IBF B;  4HTI A;  1O6X A;  5CYQ B;  1RTJ B;  3M8S A;  4A8F A;  2LEC A;  1QTM A;  4ICL B;  2RUG A;  2M5Y A;  2OPQ B;  4AFF A;  3M7V A;  3CCV S;  1IKV B;  4Q0B B;  1FJG F;  1HBN A;  4TLR A;  1H2T Z;  4L3N A;  3M32 B;  3QGG A;  4Y00 A;  3KLG B;  3DXS X;  2LDI A;  1RCX B;  4Y2I A;  4ZKA A;  1QVF R;  3W62 A;  2DNM A;  4BC7 A;  4KAI A;  1S6O A;  5J2P B;  2PO4 A;  1UTA A;  2MZT A;  4JI8 F;  2F5G A;  5DDQ C;  3W8P A;  1SL0 A;  1DZ5 A;  1JB0 C;  1LWF A;  6AT1 B;  2AJ0 A;  2KM8 B;  3CCJ S;  2FJW A;  4QBU A;  4H4M B;  4O44 A;  2ZJQ Q;  4URQ U;  1C1B B;  2L9D A;  4ECV A;  3OVB A;  1YJV A;  2RU3 A;  3OTO F;  3BBC A;  3H25 A;  2FHK A;  2V5H G;  4LBI A;  3VQT A;  2M8D B;  2E1P A;  1PJ7 A;  2CRL A;  2MDA A;  5CCM A;  2VUG A;  3TZY A;  2XLI A;  1IBM J;  1JLC B;  2DHH A;  4QR0 A;  2XMT A;  2KXN B;  1GTE A;  2RNE A;  1T9W A;  3A1Y G;  3IRW P;  1LOU A;  4K4W A;  4F2R A;  2BX6 A;  2KB2 A;  2BXJ A;  1RSC A;  2BAC A;  2I9S A;  2MLZ A;  2WON B;  2IJR A;  5DRK A;  4WTO B;  5KG5 A;  2OH2 A;  1Q1K A;  1TU0 B;  2QZ8 A;  3TR5 A;  4ITS A;  3S01 A;  4G3I A;  1JIH A;  3V5R A;  1KQS R;  2HRY A;  3PW7 A;  1V6H A;  4A46 A;  1YTY A;  1IWG A;  1ACM B;  5FII A;  3NBP B;  3VR1 A;  1HBU A;  2C2M B;  2MJN A;  4OHX A;  4NRU A;  5CD4 H;  3SDE A;  2YH1 A;  1VQP S;  2CNK B;  3QRQ A;  2MST A;  5IFM A;  4C48 A;  3AA9 A;  1P6T A;  2YWW A;  3MMA B;  4TYB A;  5F8G A;  3MF5 A;  2CQP A;  4OX9 J;  2DGU A;  4HH0 A;  3V4I A;  1XN9 A;  3DLH A;  5AE1 A;  1JNZ B;  4J90 A;  5B0D A;  3IRX B;  1CJV A;  1CUL A;  1FKP A;  3CE8 A;  4B3T J;  1B01 A;  4ZA1 A;  5KFW A;  1KOH A;  3W2V A;  5C25 A;  4M5M A;  4DR5 J;  1NEE A;  2G0I A;  3DLB A;  4KGK A;  3ENV A;  3ZTR A;  2PI5 A;  4RPF A;  1C1C B;  2IMW P;  2HHS A;  3MOZ A;  3D7S B;  2MY8 A;  4NCG B;  4JI0 F;  1TL1 B;  1U9P A;  2EFP A;  2N4C A;  4NEY A;  3ZZP A;  2ABY A;  4WE1 B;  4E98 A;  4ZK7 M;  3T19 A;  3PVX A;  2Y0S D;  5IM0 B;  5CZX A;  1ZH5 A;  2R8G A;  2RUS A;  1TL3 B;  2DY9 A;  5BYQ A;  3OR1 B;  2I5J B;  1BAZ A;  4IUF A;  1QAY A;  2C2N A;  2K1R A;  5D78 A;  4OHW A;  5LSO A;  2E5J A;  2MJU A;  1NK0 A;  1M1K T;  4Q2L A;  2ZDO A;  3HSZ A;  3BGO P;  2JL9 A;  1CC7 A;  4FZV A;  4DR3 F;  4FS1 A;  1EIY B;  4LF6 F;  1WG1 A;  3CJ2 A;  1Z2Z A;  1YLX A;  4FYD A;  1VYA A;  2VIH A;  1A0O B;  3M8P B;  3DRS B;  4NLS A;  4CLY A;  3KK1 B;  2E5H A;  2Z2M A;  2DH8 A;  1HW8 A;  1RUS A;  2D9O A;  2LXI A;  3OJS A;  2JNJ A;  3GV8 B;  4Q44 A;  2HS0 A;  1SCJ B;  3LP1 A;  1ITP A;  5LOQ A;  2MKJ A;  4P2M A;  5H9F J;  2W9B B;  3T1Y J;  4WE1 A;  1JLQ A;  1ZZF A;  5HMZ A;  2F9D A;  5D4O A;  3MUV P;  2IAJ A;  4GVB B;  1L3U A;  1QUV A;  2LU2 A;  2XMK A;  4OYZ A;  1SJ1 A;  4H54 A;  3EJM A;  3UVJ B;  5B08 A;  1SBR A;  2PD1 A;  1NND A;  1ZA1 B;  3HKW A;  2ZHA A;  1EZZ B;  3FBC A;  5GAH I;  1D9A A;  4H4K C;  3CCE S;  2PMZ D;  2HWI A;  4AND A;  3R2D J;  5IXU A;  1UJ4 A;  4O3N A;  4NXM F;  4JV2 A;  3DRS A;  1H98 A;  3KK1 A;  4X2B A;  2WOM B;  1W25 A;  2VG6 B;  2YNI A;  2J0S D;  2OUG A;  3OTO J;  5AXK A;  3EVO A;  2MKI A;  3V81 A;  1HWK A;  2Z8Q A;  4X4V A;  2UVU A;  3DMJ A;  1CJU A;  2C1E B;  2X3D A;  2NXC A;  2W8K A;  1IBK J;  2ZZM A;  4ZPB A;  4HTJ A;  1CJT B;  1CS4 A;  1XK8 A;  2A2D A;  4OLP A;  4CIO A;  4DV7 F;  2CPG A;  4KGZ B;  3I82 A;  3ZO7 A;  5JVG Q;  4YME A;  5GAE I;  2H1O E;  3THP A;  2QSW A;  4DLE A;  3M8P A;  3ILJ A;  4AL7 A;  1P8G A;  3D3B J;  3M8R A;  5D4P A;  1UWB B;  5HVG A;  1F3F A;  1VQ8 S;  2P2C B;  4C3K A;  3K57 A;  2D41 A;  4ZDN A;  1TL1 A;  1T94 A;  2QLW A;  3IS9 A;  4ZVG A;  2R7R A;  2BJ3 A;  2ATL A;  3FNN A;  4I2Q A;  4UOH A;  2EPI A;  5L1J A;  3B82 A;  3H7H B;  2XBP A;  1WKK A;  3EGW B;  4HDH A;  1VLO A;  1IR0 A;  2ZE2 A;  4JI0 J;  1FRJ A;  2EKN A;  3MMB B;  3GP9 A;  2H5J B;  2PT0 A;  2DB1 A;  4ZOS A;  1M5O C;  4HHJ A;  4ZLJ A;  1JK9 B;  4CTA B;  4X4N A;  4ID5 B;  2HVD A;  4NL5 A;  4Z7C A;  2QA4 G;  4KBI A;  4ANC A;  5KFZ A;  4JI1 F;  1SKR A;  1UFL A;  2FHM A;  5CAB A;  1HI0 P;  1CJT A;  1CS4 B;  2H4Y B;  1VQ6 S;  4DR4 J;  3C3L A;  4RNN A;  2E66 A;  3AQO A;  3GYN A;  4QZV B;  3SFG A;  2NPI A;  4RUA A;  3PIP Q;  2XC9 A;  3FEX B;  5J2P A;  1N34 F;  1QSY A;  4KJI A;  1HIY A;  2H51 B;  4IFY B;  4RW6 A;  2LLZ A;  1UWB A;  2VG6 A;  2C42 A;  3P49 B;  3HPO A;  1IKV A;  4Q0B A;  1NDL A;  5ETO A;  2R7V A;  2G2O A;  8ATC B;  1BQN A;  1QE1 B;  2OEJ A;  1QVG R;  2ROG A;  3I4H X;  3EGN A;  1Y9O A;  3G71 S;  1KSP A;  2KFN A;  5GAE U;  4QWE A;  5AXL A;  3HDS A;  4DX5 A;  3HZE A;  5E3R A;  3PO4 A;  2ADB A;  3T5L A;  3T1Y F;  4DG1 B;  4P73 A;  1KRP A;  1RAE B;  1HNZ F;  4LMZ A;  4ED7 A;  3V6D B;  3N79 A;  2LA6 A;  1GXL A;  2LDY A;  3AJ2 A;  2BUN A;  3B4M A;  4DL7 A;  1BMQ B;  2IJF A;  2XS5 A;  3AOA A;  4LF1 A;  2A0F B;  2F1F A;  1IBM F;  2XI3 A;  2W9B A;  4HR2 A;  5F3T A;  2XMU A;  5KG0 A;  3K59 A;  3TA0 A;  2AGQ A;  2FLL A;  1EQM A;  5K8P A;  3W63 A;  3LAN A;  4ZHR B;  1SH0 A;  3TWZ A;  3FQL A;  4ANE A;  3HVA A;  3Q0A A;  1C2P A;  1FFS B;  1NRK A;  2I8E A;  4N8O A;  3S8S A;  2ERR A;  2YVS A;  1RWV B;  3TAN A;  1FDA A;  3T5J A;  1N48 A;  1PG5 B;  1JLQ B;  2Q1L A;  4K59 A;  2QT7 A;  3CD0 A;  4KO0 B;  1WOS A;  3CCQ S;  3SYZ A;  3I0R B;  4OLO A;  3EPG A;  2YKA A;  4ZP7 A;  5H1S V;  3QIP B;  4RUB A;  4ZIW A;  2RIJ A;  4DG1 A;  2KU7 A;  3BYR A;  1X9M A;  4LF4 F;  1HNV B;  3GIL A;  2CJA A;  3KG1 A;  4KHP J;  2OO4 A;  2KYX A;  1NZ8 A;  1RXO B;  3IMQ J;  4FXW A;  4I64 A;  1PSD A;  5A8K B;  4GKJ F;  1T11 A;  2CNO B;  1C0T B;  5A0Y A;  3K2Y A;  4ECR A;  1K0V A;  2PII A;  2ASY A;  2FJA B;  3HUL A;  4ZHR A;  2VPZ B;  3VAJ A;  3ENW A;  3JSY A;  4MFB A;  4PXE A;  4F4Z A;  2IM3 A;  1URR A;  2VG7 A;  1NO8 A;  4BDP A;  2BE7 D;  1RDR A;  1S6Q B;  2QN6 B;  1GNK A;  4OX6 A;  2QRR A;  4UOF A;  1OQ6 A;  2DEI A;  3UDL A;  2BMB A;  4DXL A;  3CF5 Q;  2CJK A;  2UUC J;  4PRF A;  2ZH5 A;  2C2E A;  2ZKU A;  3QT6 A;  2ALZ A;  5C24 B;  3PFO A;  2D3U A;  5IT9 U;  2JLG A;  1RA7 A;  4IOA Q;  1VK8 A;  2DO4 A;  2WB4 A;  4LUB A;  3KLE A;  4OV6 A;  1DRZ A;  2JOQ A;  2GGP B;  3E01 A;  3IM9 A;  2BM1 A;  3BDE A;  4NLV A;  4IKA A;  2QTW A;  4ZPD A;  3MM5 B;  4YN3 B;  4X62 J;  3BJY A;  2C22 A;  2QEX S;  2XEX A;  1X60 A;  2M8H A;  1FWP A;  3AH6 A;  3AOB A;  5EUH A;  3CT9 A;  3MGJ A;  5A8K A;  3M9O B;  4X64 J;  7FDR A;  5FDL A;  4ED0 A;  6FDR A;  3HK2 A;  1ZPV A;  3M2V B;  3L9Z A;  1RT1 A;  4OI6 A;  2V9W A;  4USK A;  5F3Z A;  2NSC A;  2FIU A;  3BSC A;  2KKH A;  5KT7 A;  1UZD A;  4PXD A;  3KLF B;  3V6H A;  4HVZ A;  1E6V B;  1NDP A;  5E5N A;  1UAW A;  4B9L A;  2DVI A;  4WIQ A;  3D1O A;  2XY5 A;  2AU0 A;  3TZZ A;  3M8Z A;  3IGN A;  4CLL A;  1MSW D;  2MQL A;  2AN7 A;  2V50 A;  4G6V B;  3HVT A;  1U25 A;  2GNK A;  3EMT A;  3LPE A;  3D68 A;  1QUP A;  2O1P A;  3LOU A;  4MYT A;  4OZ0 A;  1LNQ A;  1UVK A;  4J7C A;  2J9E A;  3M8Y A;  4KT0 C;  2MMY A;  4MK9 A;  1S6Q A;  5KFK A;  3J81 U;  2XNQ A;  1R8B A;  2FJV A;  2XMA A;  3R3T A;  3PR5 B;  2UZA A;  5D4N A;  2AW0 A;  2ILY A;  3OL9 A;  3PKY A;  4ZVU B;  1FEH A;  2HWH A;  2DGX A;  3BN7 A;  4OZJ A;  1S0V A;  1P9Y A;  1R8C A;  5A8W A;  3JQJ A;  2HHW A;  3HHL A;  3ILO A;  1RT6 B;  1XR7 A;  1PAR A;  2DGO A;  3AXK A;  4KFB A;  4DS4 A;  4CO3 A;  3LGM A;  2XUL A;  3MAA A;  2MKH A;  4TLQ A;  5KG7 A;  2HBR B;  4BBY A;  1T3N A;  1K0T A;  1VIS A;  1SKW A;  2XNR A;  1GFW B;  3TJA A;  5DM7 Q;  5H9E K;  2PDA A;  2RVJ A;  5JXS A;  5J1E B;  2DR8 A;  1REV B;  4LF7 J;  2AZ3 A;  3JSR A;  1IUJ A;  2FGO A;  3GG0 A;  3WDO A;  1U1R A;  1S9F A;  4DV0 J;  2BQU A;  3MUM P;  1M1G A;  2GHP A;  1S1U B;  1TMM A;  5HI7 A;  3A13 A;  3OLB A;  1S9E A;  3GFX A;  2XYG B;  3OSN A;  1TKX B;  3NY0 A;  1QLN A;  3NLC A;  2ZOG A;  3VV2 B;  3RUB L;  4RZR A;  2I2Y A;  3UD3 P;  2X1F A;  2R2S A;  1P27 B;  3SEO A;  4X84 A;  5K14 A;  3UFC X;  1WG4 A;  4QU7 A;  2R3V A;  2WVD A;  1BQM B;  3HVT B;  2B56 A;  4PUO A;  3F56 A;  5DG9 A;  1KP6 A;  1TV6 A;  4K4S A;  3ZFV A;  1OY8 A;  4NLW A;  3L3C A;  4DL3 A;  2ASL A;  5IT4 A;  2QX0 A;  3DU5 A;  3H98 A;  2A6M A;  2MLX A;  4IQM A;  3O44 A;  4CH7 A;  3NL0 A;  1X4B A;  4EK2 A;  1HMV A;  2YX1 A;  4KRW A;  2DHS A;  5D6G A;  2DGW A;  2HFV A;  4QWD A;  1N36 J;  2RH3 A;  3P5T L;  2K6L A;  2VU5 A;  1R8A A;  2RHQ B;  3SZ2 A;  1S77 D;  4K5R A;  3BEG B;  4C8O A;  1WOP A;  2LFV A;  2ZBQ A;  1S9E B;  3QSY B;  4Q43 A;  2UP1 A;  1IQZ A;  5F8H A;  2BV3 A;  5C42 A;  2EEY A;  3VEA A;  1F9H A;  2JEI A;  5A8R B;  2WSC C;  2HK2 A;  3CIM A;  4KKO A;  1FNX H;  2DIU A;  2XG8 A;  1NJW A;  4PWD B;  3UDE A;  2OEL A;  4M5H A;  2KVQ E;  3DOM A;  4PUO B;  1XIQ A;  2F4V J;  3QQC D;  4QPX A;  3WX8 A;  2OEM A;  2IA0 A;  2GQQ A;  1F5B A;  3KHH A;  4FF1 A;  2CAD A;  2QFJ A;  1FXL A;  1PC4 A;  1SJQ A;  5ADZ A;  4ECQ A;  3EUN A;  3D1H A;  5IV3 A;  3UWT A;  4B17 A;  1AFJ A;  1L3S A;  3FC9 A;  3VWS A;  2FVC A;  1R7I A;  1SI9 A;  2C2K B;  2WW4 A;  1S1T A;  4HHH A;  2R7S A;  1J5O A;  2W9C B;  1IR1 A;  2Y1R I;  3FVY A;  4DPX A;  3G6E S;  3CJ0 A;  1UZH A;  2MZR A;  2OAU A;  2AQ4 A;  1UEV A;  1XBW A;  3JS9 A;  1T9T A;  3KHL A;  4A8S A;  4K0K F;  1IR2 A;  3DFE A;  3OR1 A;  3TAM B;  1HQU A;  4QWA A;  1SV5 A;  2IVM A;  2ZOM A;  4Y3C A;  1U6B A;  2LQ5 A;  2CJ9 A;  1JXV A;  4OYW A;  2WVE A;  4ME7 E;  3TEH B;  1QJH A;  3L09 A;  3IM8 A;  2YKN B;  2VPW B;  4LBH A;  1NM2 A;  1O0P A;  2L9W A;  2DO0 A;  2XWX A;  3Q2T C;  3UNY A;  3SCI E;  3PRB A;  1FRM A;  1LFW A;  1TKX A;  3PJ9 A;  3U02 A;  1NK5 A;  1N54 B;  1UVN A;  3NGR A;  4ZPV R;  2ADC A;  4MKA A;  4A8M P;  4R5P B;  2QMW A;  3OSP A;  3HHD A;  1FNO A;  3CJQ A;  4ECY A;  1TZ0 A;  2EK1 A;  2GVZ A;  3MFI A;  4JI7 F;  1FVS A;  1ZM3 A;  2ILZ A;  5I42 A;  4F02 A;  2CPX A;  4PQA A;  3MM5 A;  4Y2K A;  4CO4 A;  1S79 A;  3J7A N;  3MAA B;  4YQW A;  2VOP A;  3ETO A;  3KLI B;  1AA1 B;  1HHS A;  1MNE A;  3K5P A;  1T9Y A;  3M2U A;  3A3P B;  4AUK A;  3I9V 9;  4IOB A;  4LQ3 A;  2VD3 A;  2W2O P;  4NCG A;  4B02 A;  5KFI A;  1OPZ A;  3UDC A;  5CA5 A;  4HYK A;  2B7C B;  2NLW A;  1T7P A;  3DLE B;  2J9D A;  1S1T B;  1G6B A;  2YNF A;  1WC1 A;  3K5M A;  1HNI B;  3RU0 A;  3R7S B;  2C2O B;  3BZQ A;  1FXR A;  4DI6 A;  1N36 F;  1LEO A;  2OPS A;  4ZVR B;  4NX9 A;  2DT9 A;  4C0B A;  4JI3 J;  3OBI A;  4P7T A;  1HBN B;  1S5Z A;  1UFK A;  4YY3 J;  1JJ4 A;  4R25 A;  3X1L B;  3V4I B;  4DV4 J;  3IGV A;  5KFO A;  4C8Y A;  3F0N A;  3DOM B;  1HQE B;  3THT A;  3JSB A;  4I69 A;  1IKX B;  1KDN A;  1YRU A;  2YWF A;  3SMZ A;  3RB4 A;  3C6U A;  3PHT A;  2LYV A;  4DUT A;  3BDP A;  2Q66 A;  3CJS A;  3JB9 k;  3H2L A;  5JJB A;  2UVW A;  1LW0 A;  1ZM2 A;  2B43 A;  2KDO A;  2M2B A;  3VHQ A;  5JUM A;  1U4B A;  2FDN A;  4GKK F;  2VKZ G;  2CAX A;  4PAA A;  4CCH A;  4ED6 A;  3CJR A;  2DNH A;  5J1N A;  2XO6 A;  4KE5 A;  4ECW A;  4OYB A;  3RRG A;  4ILM A;  3NAH A;  2JRS A;  3M8Q A;  5EX0 A;  5KFH A;  2ZH2 A;  4NRT A;  3ZZO A;  3EWG A;  1MLA A;  1NSA A;  2F7V A;  1B7Y B;  3H5X A;  2CQ1 A;  1KFD A;  4UST A;  4DL0 C;  4FXD A;  4XK8 C;  3UR0 A;  1CPZ A;  1Y3K A;  3TUI C;  3W61 A;  3Q8U A;  4F3O A;  1FJ7 A;  2PFF B;  4K0K J;  1ICE B;  5C7P A;  3QO9 B;  4F50 A;  2Q3P A;  2BKN A;  3ITH B;  1H2U X;  2XYP B;  2RKI A;  3TJ9 A;  4NZ6 A;  2ZFH A;  1SJR A;  3ILL A;  1X5P A;  1LW0 B;  2RAQ A;  2IM1 A;  3DDN A;  4ECZ A;  1URN A;  1L3T A;  2E7V A;  4N47 A;  1RTZ A;  3MMA A;  4DV5 J;  3MTJ A;  2GZO A;  2ZBC A;  4FYV B;  5C25 B;  1NH7 A;  2RB7 A;  3R5C A;  2LVW A;  2ROP A;  4ICL A;  1ZBT A;  1EX8 A;  1TL4 A;  3M9N B;  2B8Q A;  3J7Z 5;  4QYZ K;  4CLP A;  3JSM B;  1UW4 A;  4WFZ A;  2EFO A;  5DDP C;  3M4X A;  3JTN A;  4F26 A;  2I38 A;  2XGQ A;  3K58 A;  1Q8I A;  4ZLP A;  1IKY A;  3TVK A;  2ZH3 A;  2W25 A;  2KHC A;  4ZS6 A;  1HWL A;  4P7V A;  2DNZ A;  4OHZ A;  1KLN A;  1VS3 A;  3DRX A;  1PCA A;  4C0H A;  1EJ7 L;  4EGL A;  4S0M A;  4QWC A;  1G1X A;  5ETK A;  3M6W A;  1RIS A;  2V69 A;  3N9U C;  3MZI A;  1RZM A;  3DI6 A;  2DGV A;  3JQM A;  1IKW B;  4O3Q A;  4ILR A;  4CM2 A;  2CQ4 A;  2OPR A;  1NJX A;  3PW0 A;  1K9M T;  1HHT P;  4K4V A;  5F9N A;  1XR6 A;  2N7Y A;  2Z2Y B;  1M5P C;  4DR6 F;  2RRA A;  3R27 A;  4RW7 A;  4GO5 X;  3GPA A;  3N01 A;  3CO0 P;  2E7W A;  2JC0 A;  3M2R B;  4WU2 A;  1AZS A;  3ENQ A;  3C66 A;  2WRM A;  1SJ3 P;  3KTQ A;  3EDQ B;  2BJD A;  2GO8 A;  4DS5 A;  1WC0 A;  3LP1 B;  2G9O A;  4M5G A;  4O4R A;  4DUZ F;  4DSL A;  1S6U A;  1EQ0 A;  1HFE L;  3EPI A;  3GFZ A;  3TRG A;  1U1N A;  2HMI B;  2W4D A;  4FP9 A;  2B9W A;  4C0O C;  1FK9 B;  2VIC A;  1O51 A;  3V4M A;  2FLO A;  5LM7 E;  3M32 A;  2LU1 A;  3VVT A;  1R27 B;  1LFP A;  3KLH B;  2PE8 A;  3ILI A;  2OPR B;  5ITH A;  2KO1 A;  5M2R A;  3DYA B;  1HYS A;  3D0G E;  1NKC A;  1KR4 A;  2JFD A;  2QC3 A; 
#chains in the Genus database with same CATH homology
 2CPG A;  2WVB A;  4ME7 E;  3QSI A;  2CAJ A;  2FGC A;  2WVD A;  3VEB A;  2BJ1 A;  2K29 A;  2H1O E;  2KEL A;  3BKU A;  1MNT A;  2K9I A;  1PAR A;  1BAZ A;  2CAD A;  3FT7 A;  3VW4 A;  1BDV A;  2NZC A;  2BA3 A;  2BJ3 A;  2K5J A;  2WVC A;  4FXE A;  3OD2 A;  2BNZ A;  2RBF A;  2HZV A;  2WVF A;  2JXI A;  3QOQ A;  1Q5Y A;  1P94 A;  2K6L A;  1BDT A;  2PC6 A;  2CA9 A;  1Q5V A;  1MYL A;  2BJ8 A;  3PHT A;  1X93 A;  2GPE A;  4D8J A;  1B01 A;  3BKT A;  2BSQ E;  2AY0 A;  2JXH A;  2BJ9 A;  3LGH A;  3GXQ A;  4HV0 A;  1ARQ A;  2WVE A;  1EA4 A;  3BKF A;  2JXG A;  1B28 A;  3VEA A;  2Y3Y A;  1ARR A;  2K1O A;  1MYK A;  1NLA A;  1QTG A;  3H87 C;  2CAX A;  3FMT A;  1U9P A;  2BNW A;  2F1F A;  2HZA A;  1IRQ A;  2BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...