2CADA

Nikr from helicobacter pylori in closed trans-conformation and nickel bound to 2f, 2x and 2i sites.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
131
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
molecule tags Transcriptional regulation
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 35
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2cadA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2cadA02
2BJ3A 4FXEA 2WVEA 1MNTA 1MYLA 2CPGA 3VEAA 3VW4A 1Q5YA 3QSIA 2BNZA 2JXGA 3BKUA 2BJ7A 4D8JA 2K29A 3H87C 1PARA 3FT7A 2CAXA 1ARQA 1NLAA 3OD2A 1B28A 2Y3YA 2K9IA 2CA9A 2F1FA 3BKFA 3LGHA 1ARRA 3QOQA 1EA4A 2K1OA 1BDVA 1MYKA 1QTGA 2RBFA 3VEBA 2WVFA 1B01A 2BA3A 1BAZA 2K6LA 2CADA 3GXQA 1BDTA 2WVCA 2JXIA 2BNWA 1P94A 2AY0A 2HZAA 2BJ9A 2NZCA 2KELA 2WVBA 2FGCA 2WVDA 1U9PA 2BSQE 2PC6A 4HV0A 2HZVA 2CAJA 1X93A 2K5JA 1IRQA 1Q5VA 2BJ1A 2BJ8A 2GPEA 2H1OE 3FMTA 4ME7E 3BKTA 2JXHA 3PHTA
chains in the Genus database with same CATH superfamily
5M2UA 4HL9A 5E5NA 2MY7A 5D4NA 4LSLA 2Q6CA 3GV8B 4EYHB 4ZIWA 3T5JA 1HIYA 1HI8A 5F9NA 1R0AB 3B6BA 3LPEA 3BKUA 4I2QA 4C0HA 3ENAA 2ZUGA 2GO8A 3M1VB 1TV6B 2V67A 1JNZB 3MF5A 4QWBA 1VRUB 4TNOA 1ZTWA 4OZ1A 4JI2J 2HW3A 4NE9C 3ILJA 2MKJA 2XSJA 1Q81T 2KXHA 3Q22A 4MKVA 2AYBA 4DEZA 2MQMA 5E0OA 1C0TB 3M8PB 3W66A 3V6JA 2CPYA 4LIRA 3I9ZA 3H20A 4I67A 4ZPVR 1RHKB 3BBFA 3MM6B 1RHUB 1U9PA 1OQ6A 2C3UA 2BYCA 2IM2A 5HK4A 4ZCMA 4DL3A 1IKWB 2MZ1A 3PHEA 4AFFA 5KOXA 3VALA 1G6BA 1RHMB 1S0MA 1AROP 3TX8A 4JI5F 3AJ2A 3QBCA 3BR9A 2VUGA 4XK8C 3FBFA 2V9WA 1AYEA 2DRDA 2OHDA 3SEOA 1S9EA 1EZZB 2Z2ZA 2DGWA 4QIEA 1S1VA 2AZ3A 1HHTP 5HVGA 4DR6F 1BXNA 4MK9A 3BO3A 2F4VJ 2K3KA 4C9DA 5I4MA 2ZHAA 1VC6A 2HWHA 1OSCA 3BO4A 4Q8EA 1BDVA 4LF2A 2XMTA 4HHHA 3R7SB 3HZEA 3VWSA 1Y9OA 5ITHA 2WSEC 3L09A 1S10A 3BGLA 2RDJA 3RRGA 1Q78A 3JTPA 1X4FA 2CIMA 1PCAA 2BE2B 3BH6B 4C7QA 4EBEA 5KFJA 4DL6A 1FKPA 2F3JA 3A1YG 2MJUA 4O0NA 3N79A 3R7NB 1C0UA 2V8VA 5G4DA 3MGJA 2DISA 5ETVA 1RAEB 4NLUA 1WSVA 2H48B 2VIHA 3HVWA 1K44A 4I68A 1BLUA 2GHWA 2VBWA 2HHHJ 1NK0A 4Q8FA 3KJQB 2HG4A 1RWMB 3HX9A 3TOQA 4UY8T 4GC7A 1M1HA 4PABA 1RBOB 2J7UA 4QZVB 5G0RB 3FEZA 1UJ6A 2CPZA 3UW1A 3MR5A 1LV5A 1IBKJ 2VFUA 2UUCJ 4LBIA 2BE9B 2YH1A 1X0FA 2YY3A 3DI6B 3EDRB 5B09A 4U6PA 1UA0A 4AL7A 4P2MA 2DGTA 2RRBA 4QJVA 2OTJS 1VLYA 2RU9A 1MWYA 3HSGA 2OPSB 3NG8A 5E3RA 2A10A 4M94A 1RT7B 2AP6A 3A4TA 1LFWA 1IBLF 1ITPA 2Y1RI 4H4OB 2XMWA 2NXEA 2C3PA 1KQKA 3IWNC 2WVBA 2PC6A 2Z4PA 1C2PA 3PTWA 3W5ZA 3LA0A 1NH8A 3M2VB 2AJ1A 2ZBQA 4BCAA 4QPXA 4QWDA 5B0BA 1S57A 2YXLA 2VKRA 1HPZB 1RABB 3V6KA 3HFVA 1NSQA 3QPIA 4EK2A 2ASJA 4C4WA 4OHVA 3UDVA 4WF9Q 1FRLA 1NCLA 4RX6A 1S9GB 3A13A 4TVAB 3SV3A 1IKVB 4K4TA 1P9YA 2AEFA 3OTBA 3WDOA 4OI4A 1K47A 1H7XA 1XR6A 3AH6A 1IR1A 4R8UB 1B28A 5LXRA 3X1LB 4C8YA 5HQLA 4Q44A 1FNMA 2B0GA 3HSJA 3DOKA 3SCLE 1CJUB 3ZO7A 3VEBA 3AY0A 3CCTA 1B01A 1W7WA 5LSOA 3TA2A 3PJXA 4EFAC 2CG8A 4RUCA 5DQIA 1BQXA 3L7PA 1FWKA 3RR7A 2QA4S 1NB2A 4FN5A 3UI3A 3KUGA 3OSNA 3GIRA 4EZ9A 1X93A 1H3DA 5LSRA 2YH0A 3QIPA 2YKOA 3BR8A 2BQRA 2V50A 3T19A 5GAGU 5IS2A 1N32J 3CC2S 3M2VA 1ZM4A 5DGBA 1TVRB 3MD3A 1HARA 2AYMA 3OR2A 4CP5A 4I6YA 2AEJA 1O5JA 2ZITA 3H5UA 4R25A 2KM8C 1CS4A 1A7GE 3CEDA 3W2WB 2CJQA 1TL1A 3GJRB 1LWCB 5DS7A 4CLSA 1U8SA 1U1QA 2W9BB 4F02A 2ROGA 4QW8A 1BY9A 1VHIA 2A2CA 2MLZA 4Z2XA 1D0EA 3DRRB 2UXCF 4ZOSA 2K1RB 1VS3A 2AJ2A 4USHA 5AXKA 5CCLA 3QGHA 1K1SA 1S6QB 2RHQB 2V4JB 2NXNA 2ZVIA 3M8QA 1GAOA 1L3SA 3OVSA 5A0YA 1UWBB 3P45B 8ATCB 3LF0A 4NZ6A 4Q0BB 3GYGA 3DLHA 1TUGB 4IH7A 4O4RA 4QIGA 3JAMY 4ZLPA 1KQGB 2VG7B 5KTQA 1C1BB 3X3UA 5IT0A 1FKPB 4L76A 1H73A 1VMBA 1P27B 3SIPB 1M5OC 1TKZB 4RW6B 3HK2A 3OPKA 2DIUA 1FDBA 3OV7A 5J1EB 2X3DA 4C98A 4P6QA 1KS2A 5DRKA 1KQFB 4QWCA 3CCJS 2OMLA 1YLXA 3DC2A 1BAZA 1U49A 1XTZA 1YJRA 1U1OA 3C19A 4CLPA 2E7WA 4WFZA 3SI8A 3MAQA 2QMUB 5B0GA 4NLPA 1Q0NA 2W8LA 3RYLA 2ZVSA 2NQPA 4Y0FA 1RWPB 4TYAA 3DRXA 1BQNB 1NHUA 1WACA 3EM1A 4LF1A 3JSMB 4A8MP 2GQQA 1ZOTA 3HJVA 2I0XA 2CJBA 3M30A 4OZLA 2JC1A 1KKHA 4B9TA 1T9UA 4ALZA 1EQMA 4KQZA 2PO4A 4ATNA 3OL8A 1WC3A 1YZ7A 4RUHA 3KMQA 3BSNA 5HI7A 2MB0B 4DPUA 4NYOA 3V2UC 4L72B 4FBUA 1LW0B 1H2TZ 2C2KB 2D1CA 2OSQA 1PC4A 4LT6A 4M5NA 1S4FA 3R97A 3H25A 4DR1J 2KOEA 2FHOB 1Z4UA 3C6UB 4OYBA 4B3TF 3U02A 3A8JA 1CVJA 1XBWA 4KH0B 4GVBB 4I2QB 3CJ3A 3QGIA 4GVLA 3GCWP 3QWPA 3R5GA 1TL3A 4NA1A 2QL7B 1H2UX 3RAMA 3IA0A 2UXDF 3HDSA 5HL7Q 1MLAA 5A76A 3UE2A 2VICA 4AQYF 3G82A 1S77D 2HIQA 1TMJA 4OHXA 1UETA 2WBRA 4O4GA 4G1QB 4KC5A 4K50A 2E7VA 3M05A 3UWTA 3W2WA 2HWIA 5T41A 2E5JA 5KG6A 1UVNA 5J1NA 4X2BA 4JV0A 3CCVS 1RWUA 4TQSA 4O4GB 1SIWB 4XDCA 2LECA 4DU7A 5KFKA 3Q23A 3GJTB 3LUYA 2AJQA 3BS9A 2LP4A 2V0NA 2YKMA 3LWMA 3ZNUA 4MFBA 1REVA 4UUXA 4A47A 2CPJA 3U27A 3JAMU 4DQPA 2HVHA 4ZJQA 2IJNA 2DKOB 2VG5A 3W8PA 3EZOA 2HYIB 2UUAJ 4FZVA 3R2DJ 2DCUB 4KRWA 5CCMA 1EJ7L 3TQ1A 1HLWA 2V2VA 4FBTA 1TFYA 4L6V3 3P4UB 2XY6A 2RQ4A 3NCRA 2ZM6J 3MXHP 2D3OR 3BYRA 2DR9A 3CD7A 3G96A 5J2MA 1N56A 2CNLB 4H4KC 1HKAA 5HO4A 3OSPA 2FJWA 2HNZB 4NLDA 3IG1A 1Q79A 3V81A 1K8AT 3JTNA 3MM7B 4YS2A 3GSDA 3JTOA 3RZAA 4UT4A 3H2LA 2AMCB 4DX6A 4F0HA 1CJVB 1K0VA 4ECSA 1IBMJ 5D0GA 3O2IA 5LL6d 1VRTB 2CZVC 2ROPA 2HS4A 5LOQA 1HPZA 2CDRB 3CIZA 3AXMA 4DXLA 2Y8YA 4WPAA 4DX8H 3DXSX 4RWWA 3IRXB 1LK5A 2OPRA 1TKTA 2L48A 2QZ8A 1VFJA 2ZKTA 4DV3J 4A8XA 5IV3A 2BJ8A 2A1BA 2GMLA 2J7KA 2ZZNA 4P73A 4GKJF 3MR6A 4B08A 2G2YA 4GMKA 2HWTA 3U1MA 1RISA 5DQGA 4CWBA 4A8KA 2CPGA 1IR2A 4K4UA 3DLGA 1NDCA 1X4BA 4LQ3A 2OPSA 5HP1B 4JI6J 4O3RA 4WZQA 4QIVA 2YNFB 4DV5J 2B4UA 2NUHA 4JI4F 3DLEA 1NK4A 2XYHB 5L1IA 4LF8F 2MHNA 4ZS6A 1RAOA 1R8BA 1SJ4P 4PQUB 1Y11A 2OMOA 1RCOB 2KRRA 3GG1A 4EEYA 2W2MP 4M8LA 4L74A 1U4BA 3D4JA 1FXDA 1UFKA 2G1HA 1HI1A 2NZCA 2XMKA 4NLRA 5A0YB 3CJTA 3KK3B 3SV4A 1KOHA 3T1HJ 3NGRA 3UNYA 3FRYA 4F4WA 2PI4A 4Q45A 3FCVA 4X66F 3B4DA 2V2QA 4EGLA 4TU8A 1WKLA 1HD0A 1IXKA 1R8PA 3PW0A 1S1TB 1YIJS 4M5JA 2WZ1A 4ZIVA 1E6YA 4PCQA 5J2NA 1OPIA 4Y00A 2RIJA 2XHCA 2DGUA 1RT3B 1MU2A 2QMXA 3FUYA 5ETLA 3UN3A 3OXLA 3OW2R 2RSQA 2X1BA 2XMVA 4K4VA 1N5QA 3D2WA 2QRRA 4BS2A 4I2PB 3ZTOA 1LXJA 2ILYA 4OYZA 1ARRA 4ANCA 1TVRA 3SCJE 2DR7A 2LU1A 4M63A 4OJ3A 2AGQA 1EB0A 1RHRB 2FHJD 3CD5A 2FVCA 1D8ZA 3HM9A 2A2DA 3H5SA 3DM2B 1N52B 4NL5A 4J9MA 2BJ9A 1MNEA 1SC6A 1N5SA 5KT3A 2WVDA 2WBMA 3PG9A 3JS9A 5AXNA 1I6JA 4ZPAA 3ZXWA 2B9WA 3DGPB 1PAUB 4MTPA 3EGWB 3PKYA 2XS2A 5T7LA 3AA8A 1T8EA 3PW7A 4NLYA 2MKKA 1PYSB 3FFIA 2QLJB 4TXSA 4Q43A 2QTWA 5C25B 3Q24A 2I1RA 1IJFB 3CCSS 1N34J 2MZSA 1SH0A 1R3NA 3ETMA 1CC8A 2XZDB 3GPAA 1YWXA 2CJXB 3I5AA 3O8WA 4NEYA 4OJ1A 1T0TV 5D0RA 3E01A 1C1CB 2B9YA 3O3LA 4ZCIA 1NJIT 4PWDB 2AX1A 2HGMA 4PG8A 4USKA 4USUA 1UTAA 5D4LA 4DG1B 5E3QA 4KV8B 1O6XA 2G1DA 2K6LA 3GXQA 1H74A 2IHR1 3OBIA 4WFXA 5D0EA 1XMOJ 1FK9B 1FI4A 2XM3A 4WKRA 3V5RA 2B5JA 3MDFA 5HMYA 2M3DA 4IOAQ 3V4IB 1X7VA 4JI3J 2OI2A 4J9NA 5FD1A 1T95A 1HNIA 4USWA 3NP5A 2IC3B 1RWVB 1XERA 3F44A 3NS6A 1FRIA 3QAEA 3RW7A 3HHLB 5J1PA 1KTVA 2DGVA 2RUGA 3KLEA 1VCTA 2IJFA 1OS5A 3G6XA 2ADBA 1S1UA 2HFSA 4NCGB 1YHQS 5HROB 2VOPA 3VGTA 2YNFA 3LOUA 3IS9B 4AAIA 5ETOA 1TMMA 3TWZA 2HMIB 4JI0F 3ZZUA 5KFIA 3U1NA 3QOQA 3FMWA 2K1OA 2ASLA 4NRTA 2CQ4A 2V2ZA 1Y4ZB 3GMGA 4DMZA 1NUEA 1ZA1B 2G0JA 2E5HA 1Q4RA 3QFWA 1S0VA 2OEMA 2GQCA 2ZZMA 2AY0A 3A3OB 2IM3A 3MEGB 5EWFA 2XY7A 1L3UA 4CDIA 2YWHA 4I6AA 2ATCB 1HR0F 2UXDJ 4WFYA 1FK9A 1PBUA 4P75A 1TP7A 4ZP9A 4HI2A 2Q6BA 3D5MA 4UOCA 4NLWA 1KP6A 3L95X 4LSZB 2NUUG 1ZS6A 4UTGA 2KFYA 4KV8A 2JFDA 3M6XA 4FP9A 1AB8A 1J2VA 2IYGA 2CZ9A 3ET6A 3HF5A 4RU2A 4LF4F 2HVIA 3BGFA 2YWFA 4DR1F 1HNVB 1XK8A 3L3CA 2W7AA 4KO0A 1FNOA 3PEJA 1RT1B 1U0SA 4TN2A 2OSRA 3SSSA 3DHWC 4LF6J 4OV6A 4OZ2A 5F8HA 1CJTA 2XLJA 1VQSA 2VQFJ 2FVSA 3HMJG 3G5OA 1LWEA 2LXFA 4JBCA 4DUTA 5HMZA 4P9SA 2EKYA 5L39A 3VAGA 1NKCA 2XI3A 4DPYA 1YBAA 3GCXP 2DNRA 3BDEA 3SFGA 4DDFA 1HA1A 3CC4S 2ZBIA 4J37A 4NX9A 1HBUA 3RB4A 3MMCA 1DBDA 3IWLA 2CUYA 1FRJA 3PR4A 1F2GA 3MAAB 2ZUAA 4MKAA 2BOAA 3HT0A 1EX8A 2DVIA 1RT2B 2YVSA 4CI0B 1J5EF 2B6AB 5CZXA 3R1LA 4C8OA 2QYGA 2KB2A 5KT4A 2G4BA 4B3TJ 3ILLA 1F9FA 3QSIA 4OJHA 1YBTA 4M5DB 4G1QA 1VRUA 3W7BA 4DPOA 5DZ7A 5KG1A 4RLEA 4F25A 5KFHA 1NK7A 1S97A 2AWZA 1G2EA 1DLOB 3R6GB 4MT1A 2GAGC 4IFVB 2RQKA 2C2MB 1S1TA 2V34A 1VOMA 2Q3PA 3AD9C 5D8HB 4RW7B 2BANA 3DCAA 1NLKL 3KUHA 3OUYB 2IIHA 4K5SA 2HFNA 3I4PA 3PFOA 1WF0A 4BBYA 5IZHA 2ZH1A 5GAHU 2FGCA 2EG2A 3D3BJ 1N5TA 3OTCA 1NZ8A 1MMLA 3CSKA 3ENWA 5L9XA 2CNKB 4RPFA 4W92B 2OPPB 4Z7YA 5A8RA 2OIHA 2OKQA 2WHOA 5AJ3F 1WC6A 3NLCA 1XNQF 2UXCJ 1GK8A 2PA8D 3M6VA 4PZVA 4AXJA 1Q7YT 1FVSA 4X4VA 1UZHA 1T11A 4DR4J 4E2FB 4J9UE 2XULA 4ECRA 4IFYB 1VQLS 3AD8C 2AYEA 4DN0A 1IBLJ 3OVBA 1QAXA 2PGCA 4YFUA 4A8FA 1VC0A 3KXDA 1WEYA 1JLCA 2IVMA 3C14B 4ZP7A 3G71S 1VQ4S 4IRDA 4Y2MA 3D67A 4FKYA 3MEDA 2Y9HA 2NREA 3FBEA 4FDFA 1WI6A 1EKRA 4E0DA 2HSEB 3DLKA 3H42A 5B08A 3J7Z5 1N33J 3W2VB 2WVCA 2P8IA 2YWEA 4X4SA 4WFAQ 4CH7A 5L1LA 2B3TB 5EN1A 3PCOB 2DRAA 4DSFA 3Q8YA 3EZ5A 1CJTB 4Q5VA 1GMWD 5DM6Q 4C8ZA 2UZAA 4M5KA 3TA0A 1RCXB 1RU2A 3IGNA 5L38A 1ZAXA 2RD5C 1XNQJ 3M8RA 3PZPA 4OIXA 2J0XA 3K8WA 4EBDA 1FJGJ 3LQVA 5I3UB 2E1AA 3ELHA 3MCMA 2NLWA 4RW6A 5DO2A 1KWMA 3PY8A 3MTJA 5DG7A 1GMWA 1RTIB 1T9VA 4JP8A 2W9CA 2KG1A 3IXQA 1M1GA 2K29A 2NSCA 4FPRA 3NWGA 4PG4A 4Q7AA 4OYXA 5JXSA 3T6JA 5JMNA 4XIUA 4IOCQ 2IPOB 2P9CA 4FF1A 2FY1A 1KSPA 2DXDA 1MYKA 4J9RA 4K2JA 4DLEA 4DL2A 4Q0BA 1N33F 3PYEA 3EZUA 3ZTQA 4TLQA 1L3VA 1TK8A 4YB1P 2MKIA 5HLFA 3MMAA 1SH3A 8AT1B 3NNHA 3CJRA 1Q82T 3QO9B 2D9OA 1VISA 1FX4A 2HKEA 1ZM9A 2HVEA 1TL7B 3A12A 1JLCB 2PFDA 3CJ8A 2GAHC 3HLUA 3SMZA 3WZ0A 4CO5A 3HZGA 3TVKA 1U1NA 3FDSA 3M9OB 4JI7F 3FMTA 2XS7A 4ME7E 1VRQC 1RACB 3DNCA 3IS9A 4IH6A 4OYAA 4OZ0A 3OR1B 5GADU 1U25A 4UZBA 2BJEA 1CSJA 3BN7A 1TTHB 2QA2A 4IYQA 5ETMA 4A8YA 1B3TA 3MZIA 4RUBA 4V19X 3C66A 5KG3A 1SBRA 2NXJA 4CLKA 1XC9A 2QE5A 2HBZB 2U2FA 5A8RB 2ACYA 3K5OA 2HVZA 4JI2F 1R0BG 2HQIA 3KFWX 3PFEA 1SC1B 2IMOA 4TY9A 2F9JA 3CPWR 3DLBA 2NSBA 3ENQA 4WXOA 3KLHB 3H40A 1L3TA 4DS4A 2VONA 3DGVA 2IYIA 3IR6B 1FFWB 4QYRA 1N88A 2Z56B 3OLBA 1HBNA 1WOPA 4DX5A 2RDIA 4N8OA 3VAKA 1C4AA 2KRBA 2HHPA 3PYGA 3TO8A 5IT4A 5IC6B 4ZPBA 1A0OB 2XI2A 4J9QA 4DV1J 1Y0HA 2JEIA 1S48A 2MGZB 4X64J 4NXNF 1S7IA 3CJKB 3TX0A 4U8YA 4KHPF 1NDLA 4OX8A 2CYYA 4HACA 4FXEA 2EI5A 1MN7A 2CJYB 4R8UA 2J9DA 2WCXA 5KFMA 4WE1B 3L7OA 4WP8A 2AKWB 2HK3A 2I38A 4ED0A 2CVEA 3PVXA 5LM7E 4DR6J 1HD1A 5JJBA 5L1KA 5E3CA 1EA4A 1E6VB 2MQ8A 3MEKA 4DUZF 1M5PC 1FD8A 1HQUB 2F8EX 1QE1B 2MHEA 2O01C 3IBFB 1UVKA 3N6MA 2ZJPQ 3PR5B 3QSYB 3IWXA 3T5HA 1AW0A 4ZK7M 3M8ZA 3IMQJ 3N0VA 1R6YA 3D1OA 3KG1A 1GXLA 4I2PA 1MG7A 4PWUA 3ZZPA 5JVGQ 2BQUA 4ILLA 4A48A 1NB7A 1SVDA 1X4GA 5M2PA 4DV1F 3AJ1A 2J0SD 1UA1A 3W3SA 3AODA 4ZJOA 5J1EA 2CQ2A 3UCZP 2N3LA 5GADI 3UD3P 3T41A 1FJ7A 2B7BB 2DNNA 3BF4A 3RR8A 3CJ4A 1M5HA 3MCNA 2JXGA 2GNKA 2VV5A 3CDAA 4J9KA 2GA7A 2ACMA 2KT3A 2VG7A 4J5OA 2GFFA 2HRYA 4B9LA 4FYXB 2ZH3A 2CA9A 1BQMA 1EP4A 1OG7A 5ETQA 5LSLA 2ZFHA 3HULA 4DUYF 4KHMA 2V63A 2POKA 3BN4A 1CG2A 4H4KA 1GMUA 4ZCKA 4OZ5A 1GXTA 4ILRA 3ZZRA 9RUBA 5K8PA 3P96A 3C8YA 5IM0A 3I5BA 4HTIA 4F4XA 3K5NA 2KHDA 4FS1A 4ELTA 1H0HB 1FDAA 1U1RA 1HI0P 3VGUA 3MOZA 5EWGA 2C2RA 3KMSA 3DOLB 1TL1B 2JNJA 2HEKA 4NCGA 3IO1A 2UUBF 2Q79A 4FNHA 1PYOB 3C15B 1PSDA 3EXYA 4IG0B 2EFPA 3OR2B 1NXIA 3I0SB 3M6WA 1BUXA 1SH2A 2V4RA 3CDBA 5M2RA 3KK1A 4NLTA 3MFIA 3IRXA 3KWMA 2HMIA 4FF3A 3QFHA 3EX7B 2YQ0A 1IKWA 4P2XA 1BDTA 1EETB 1P94A 3CTRA 1G3OA 4CZCA 2JHEA 2DHAA 3Q8QB 4WFBQ 2DGOA 4ZLJA 2J6SA 4B9NA 4KY3A 1HWIA 2D41A 3JB9k 4LFAF 1YDLA 3OL9A 3H2VE 4NI2B 1JLAB 2V8HA 1JLAA 3QLHB 3QT7A 4F26A 3NGTA 2Z30B 4YDDB 5DDRC 1RTZA 3NNAA 3KLVA 3P49B 3WHIA 2VOOA 2F65A 2YKPA 1W26A 3I5CA 4LRFA 4NZ0A 2CPEA 1IKXA 2GVZB 5KG5A 4PUOA 3P6YC 1NSPA 2LEPA 2OPQA 2GW8A 3EXCX 4RNNA 1FTRA 2CQCA 4QW9A 2ERRA 3UN2A 1JXEA 1KHWA 4P10A 2BA3A 4LRBA 2EFQA 5KOWA 3Q8SB 1PBAA 3TJ8A 3GG0A 3KK1B 4X84A 2HQ3A 4JI4J 2XMJA 2E7XA 1U6ZA 1HHQA 1MSWD 3VGSA 1RSCA 3NOCA 1VQMS 3J81j 1HWJA 1R7IA 3IRWP 2R7SA 2BJ1A 1Y3JA 3C6TB 1R27B 3GONA 3AOCA 2D3UA 4C11A 3V6DA 2FVRA 1AUSL 4ANEA 3PHTA 4S0MA 5C24A 1T7PA 4DFJA 2OJ3A 2R8IA 3M9NB 1WJ9A 3ZC4A 2C3YA 2GHPA 5IM0B 2F63A 1RAAB 4F3OA 2YWWA 2C2EA 2YBVA 4F36A 1JKHA 3LW5C 3TR5A 4IH5A 4RNMA 1SC3B 4DLGA 3PYDA 1QTGA 2KI2A 2JEFA 2WVFA 1VIXA 5D3GB 1VHFA 4LRVA 2BW2A 3GV7B 2RAQA 3M32B 4XAKA 5C2GA 1UVMA 5IOLA 1RP5A 3NY0A 3BM7A 4DSLA 4KHPJ 3CCQS 2KYZA 4HT5A 1S1XA 3UCGA 2MJNA 3JQKA 1NRKA 2QV6A 3SXLA 5CYMB 4ZLLA 2KVQE 1EETA 1UCNA 2MTLA 3OXGA 3KYLA 3RBEA 2GJ2A 4CNZA 2R7WA 4M5IA 1YJ9S 3P5TL 4NLSA 4XDDA 1MNTA 3AAWB 1BQNA 2BX6A 1JMTA 3JSMA 1CC7A 4HYKA 3RB6A 3C2PA 5ADZA 2LQ9A 4CLWA 2KXFA 2V2KA 3CULA 1I3OB 3EWGA 9ATCB 3EYZA 3RTVA 1KLNA 4B3RJ 5KFPA 3THTA 3ZZZA 3UD5A 3I0SA 1SCJB 4DR5F 4YUDA 1T02A 3LP2A 4P74A 3RBZA 3FEYB 3MEDB 4FNIA 2EK6A 1FTCA 1NH7A 4ED4A 4YB7A 2EVZA 1LOUA 5EHHA 4I7FA 1KFDA 3I96A 4HR2A 2OGUA 1TKZA 3ZTRA 4C3MA 4ENOA 5B0DA 2ZH5A 2ZWPA 1LK7A 2QSFA 5D78A 4LF7J 1FKAF 4K0KF 1QSLA 1UEKA 2K3IA 2DIVA 5F8IA 3OFEA 5AJ3J 3MUTP 2JSXA 4NXMJ 1T9WA 2HRTA 5HAOA 1ZA2B 3LP1B 1KN6A 2IBOA 1Q8KA 4DI6A 2AV5A 3OTEA 1NK5A 1FFGB 4ZMMA 5KFYA 2W2OP 1EP4B 2ZH4A 2KFNA 2RS2A 1NSKL 1FD2A 5CAAA 5KFUA 2RKIA 4WP9A 4RUAA 2YNHA 3J7ZT 3W9HA 4CO4A 3W9IA 3MPYA 5CH7B 1DTTA 4RW7A 1OQ3A 3TUZC 1REVB 5KT5A 1UAWA 4K4ZA 5KFFA 2MXYA 3TI0A 1JJ4A 3H5XA 1R6VA 2VC1A 4RWXA 3QZ7A 5E33A 4A8OA 1AXQA 1Q8BA 1WG1A 3H0PA 4OI2A 4ZVSB 5KT2A 2DH9A 3OHAA 1KFSA 1PGZA 2MSSA 4F4AA 5F8LA 3TANA 3M4XA 1RZMA 2H1OE 1ZAWA 3U1LA 1P9QC 2FLLA 2NZ4A 1BHNA 2H65B 2J7WA 3PDNA 1N6QA 4B3MJ 1OWXA 1YX2A 3GFXA 4F0MA 4AYBD 4B9MA 4F3MA 2E9ZA 2WAQD 5I3QA 2OUGA 4MK8A 2RF2A 1QLNA 4K5RA 1N8RT 5ETPA 2PE8A 4DR5J 1U1LA 1VQ5S 1VQNS 2ASDA 2XBPA 2FY8A 3MR2A 2D3O1 4DJBA 2AU0A 2C1EB 3H2UB 3HSZA 5C42B 2XYPB 5ETRA 3RBDA 4F4KA 4PUOB 1HBOB 3HVTB 2FPHX 3D0HE 3Q8RB 3VHQA 1FXRA 4ZN3A 3TJ9A 1TKXA 1QAJA 1TAQA 3NWRA 2GZOA 4HACB 3EMTA 2D9PA 1UFLA 1X4CA 2MGZA 3TUPA 2WONA 2GHVC 2CKWA 2E5IA 2B8QA 2R8JA 2JJ4D 2M0GB 5CYJA 1RTIA 2W9CB 1B0TA 3B78A 1N34F 1UMJA 2ZWOA 3G8SA 5BYQA 3VZIA 4L75A 2R42A 1U1KA 1ZBTA 3IAS9 2MKYA 3I32A 5KFOA 2JXHA 2Z8QA 5KFAA 3KLHA 4DV4F 1WEZA 3M30B 3ITHA 2E5LF 4LQ9A 1SQFA 3HVRA 2PA3A 3N9UC 2JC0A 3M2RA 4WXWA 1L5UA 3A8KA 1J5OB 1VBKA 4FKXA 5K8MA 2WTFA 4J9OA 3W2VA 3OL7A 2K9IA 4DUZJ 2ZOMA 3N4WA 2YPZA 1KHVA 1AFIA 5EX0A 3D6MB 3QT8A 2BW7A 4G6VB 4CM2A 5C7PA 4JI0J 4HI1A 2COLA 5A6PA 1B0PA 4LJMA 2R2UA 4JV5J 1Y5LB 2DNPA 2FJXA 3OR1A 4MIBA 4NLVA 5HBMB 4EWTA 1SL1A 1XIQA 3FSYA 3BGRB 4PXDA 4AUKA 2MKSA 2RS8A 2W4PA 4ZVPB 4YB5A 5HJYA 2BKNA 3POTB 4WYWA 3WC2A 2CAJA 2RH3A 4JB8B 1PIEA 3MEEA 3J7A1 4PG7A 2CQ0A 3DOMA 4J91A 4KHRA 4YY3F 4DV7F 1P1TA 2R7RA 2IC3A 1HBMA 4PRFA 5LJ5Y 1N0UA 3G6YA 4ED7A 1JLBA 4N41A 4MMOA 4DSJA 1F5CA 3ULHA 3T1HF 1VGYA 4LFCF 4FPIA 2H4WB 4DUYJ 1M5SA 4WP3A 3VQTA 3RW6A 2E29A 1JQGA 1ZM3A 3D6FB 4ICLA 2AF6A 2QJ3A 5ETKA 5IC4B 3MECA 2XQCA 2AIRB 3BBBA 5A6WA 3J7YI 2BE2A 2K06A 4ECTA 1DLOA 2MZTA 4X62J 2VBXA 3ENVA 1WHWA 1MN9A 4LF8J 2OLWA 4DR2F 5GMKa 3E01B 2MKCA 1IBCB 4W4MA 4ZVQB 3KOAA 4DR7J 3NAHA 3FGVA 5A8WA 1V9OA 3H4BA 3G4SS 3KJVB 1VDHA 4PXBA 3HJFA 1GMVA 2MKHA 2WOMB 2V8GA 4LVNP 1NO8A 5KG7A 3J81Y 1O51A 4RW8B 5GMEA 5H9FJ 2XTJP 2W9AA 4B9UA 3SDEA 2I5JA 4OQJA 5CABA 3N5FA 5GMDA 2XO7A 1SJ3P 4OZNA 2FJDB 2WVEA 3ISNC 1QE1A 3T9ZA 3D9BA 4KB7A 2CZ4A 3WX4A 1JLFA 2KO1A 2BM0A 3EVOA 2VA3A 2YKNA 1OO0B 3DM2A 3FT7A 3B82A 3JSYA 4K59A 4RNOA 4UQGA 1VQ7S 1LWFB 3S6EA 1Y3KA 3O6QA 2GJIA 2OAUA 3W64A 1H7WA 2EC0A 1PKUA 4YDXA 1Z2LA 1T9XA 1KONA 1T03A 4X65J 4EBCA 1C0TA 1S59A 2DGQA 3BPDA 4DZ6A 2K2PA 4WZMA 1GQEA 3UN5A 1JJCB 3DOKB 2DJWA 3JQMA 3P8BB 4RKUC 5KFDA 5KT6A 3KG4A 4RR5A 2CQHA 1IJEB 3CMQA 3WBZA 4ZHRA 3M8YA 3PYFA 3CJ0A 3RUBL 2GPEA 5K8OA 2GX8A 3GV5B 2XY5A 3K2YA 2G0CA 1R0AA 3QAUA 2CJKA 1VBYA 3MM9A 2XO6A 2F7VA 1JB0C 2LYVA 4C48A 3OXFA 2YNHB 1TL4A 3CCMS 1NMEB 1SUQA 1C4CA 2DYAA 2QX0A 3NCQA 5J2QA 1VBZA 4BHQA 5I42B 4ED1A 5DGAA 2R8KA 1WKJA 2DPJA 2XLIA 2J9DE 4HH0A 1FDDA 4ZVUB 3NAIA 2BQ3A 2NPIA 3FJ2A 4IKAA 2VHGA 4ECZA 3B54A 2OD6A 3OFHA 4PQAA 1NBEB 4MYUA 2KH9A 1F9EB 1RQ0A 2J0WA 1RT2A 2QIFA 4CTAB 4FYWB 3LP0B 1O8BA 3POTA 4MJKA 1QTMA 1HYSA 1PILA 1DTQB 4I7FB 4N8NA 4UQTA 3SSRA 2RJZA 5FDLB 2DGXA 4CLUA 1YG0A 3ADAC 1WELA 2KHCA 5ETTA 4YP3A 3PW4A 3PX6A 4KR0B 1XR7A 2DNLA 2A2BA 3QO9A 5HVHA 1A9NB 2D7SA 3MMAB 2BEFA 3RU0A 3BBCA 1NDPA 2ASYA 3QIDA 3FQLA 5G0RA 3H59A 5HVFA 5AE1A 2UVVA 4YMEA 4USTA 4NRUA 1T05A 3T3FA 1IWAA 2GGPB 1EQ0A 3DRPB 2JVOA 1ZZFA 2F8HA 4RL1A 2HHUA 1LWEB 3BO2A 2B5JB 1YKWA 1GNKA 2VC0A 1ULRA 1P6TA 1GEHA 1FWPA 2G9OA 3NEKA 4OYMA 5KFVA 3LAMA 3HKWA 4WK1A 5CYQB 2VU5A 1IBMF 5FJ4A 1QDUB 3VVTA 3ITHB 4I0WA 2CPIA 2AEMA 4KO0B 4X4NA 5AE3A 1DJ0A 3K5LA 1CJVA 4FYYB 3C46A 1AA1B 1F5BA 4AD6A 1YVFA 1TKDA 2YNGA 1N5VA 4FVCA 5EGYA 3NBPB 1I94F 3G87A 3NL0A 3MM7A 2GVDA 2N4DA 5IQ6A 4Y28C 1KLMB 3EGZA 1TZ0A 2XG8A 2GIFA 3UR0A 3VV2B 3DLJA 3IGVA 3NGKA 4FXWA 3MD1A 3NNEA 4PG6A 3CB4A 5CYQA 4LF7F 2ZNZA 2AN7A 1RAGB 1IN0A 2H54B 4R0EA 3TA1A 2XC9A 1U6BA 4QBUA 2Y1LB 4FF2A 1IWGA 1R8CA 4JUZA 2R7TA 2R8HA 2UVRA 4ID8A 2IDLA 3W60A 2YX4A 3IN5A 1NPPA 4B3SF 4G1IA 1RDRA 2W1BA 1SJQA 1U2CA 1VK8A 3BGOP 1WD6A 2V6AA 4Y2AA 3Q8VA 2MQPA 1ARQA 2QN6B 2M52A 1NHVA 2VG6A 3OTOJ 1FRKA 1LKZA 2CVIA 3GJSB 3O5TB 2G2OA 1DRZA 3K89A 5AXLA 2VQFF 1Q1KA 3SCKE 4CNYA 1WC1A 1H2VZ 4ZN1A 3E8OA 2CQ1A 1R43A 2ZDPA 4PXEA 4ED5A 2AX0A 1Q16B 4NZ7A 1S49A 1RKIA 1RHJB 4MKBA 4WWSA 4EMDA 2EFVA 4KBIA 4ILMA 2HZVA 2R2TA 1YRXA 1DFDA 2JBVA 1WDTA 3IP0A 1S72S 1NKBA 4RJVA 4PYDA 4B17A 3NCPA 4KTQA 3MOJB 1KVIA 3G8TA 2HQFA 1RWXB 3UNGC 6FDRA 4NASA 3KK2A 1SJ1A 4NEZA 1D3WA 2YQ3A 3SZ2A 1HR0J 3TEGA 4ZPDA 1GT8A 3CIMA 3MM9B 4AL5A 3ZFVA 2BNZA 2MSTA 3L7UA 1SKWA 5CXTA 2IAJB 4LIWA 4QR2A 4YQWA 2CPFA 5D77A 4W90B 3ONQA 2JVRA 2M5YA 3J80Y 2UVUA 2R7XA 2E66A 7FD1A 4BC9A 3KHRA 3PKMA 1XNRJ 4I56A 1WEXA 3AT1B 3GFYA 2FC8A 4ZA1A 3LWLA 2DNGA 2CADA 1LEOA 2X51A 3G2XA 3DLEB 4J7CA 3MI7X 2V8PA 4NYZA 2P9EA 4P71A 4WKYA 5K8NA 3CCES 1XQIA 3IBCB 3NGSA 3MAAA 5HP1A 4ELVA 2QGFB 2HHTA 2BE7D 2U1AA 2JH3A 3R5BA 4Y34A 2W24A 4C8NA 1LWXA 3THVA 5KFCA 1RWNB 2WK4A 1X4DA 1Y5NB 3NKYA 1APSA 5BJRA 1VQ8S 1JLFB 1J27A 2ZDOA 3SQOP 2EK1A 4ER8A 2QSWA 2BV3A 3E2EA 1S4EA 2UUTA 2L3MA 3G6ES 3NNCA 3IR7A 2PMHA 4X4RA 1AZSA 3SDEB 4IG3A 4USVA 2PIIA 2IDEA 4OHYA 4QWAA 1Q86T 1FESA 1OYEA 1X0PA 5F0WA 5A8WB 4URSA 4LF6F 2DEIA 3MM5A 1FEHA 5H9EJ 4B02A 2KKEA 1LNQA 1HQ2A 2CQDA 2FC9A 1S1XB 1S6PA 3JXOA 5K5MA 1YITS 4DR4F 1N36J 2HZAA 1JK9B 1PG5B 1C1BA 4TU9A 3PRVA 2LKZA 1NEEA 4OJGA 3TAMA 1UPMB 4ICLB 1VC5A 4ZVHA 3I56S 2YQ1A 2A18A 4B9VA 2RRAA 1K73T 3W9JA 3KNGA 3Q0AA 3DRPA 1R8AA 2MZRA 1T9TA 3CXCR 2ZJRQ 3T6BA 4B3OB 2V4JA 1UJ4A 1S6QA 3M8QB 1FHTA 4OFZA 3LALA 4IQMA 4NLQA 3KLIA 1HNXF 2D69A 2GIQA 3AOAA 5E7OB 4BWJA 4LREA 1B99A 4ECWA 2LQJA 3M6UA 4CYUA 4DPTA 4K2XA 3LJPA 2JEGA 2XZTB 3DLGB 4DL0C 4DQIA 4NLGA 4C3LA 1MMDA 2PD1A 2PI5A 4KGVB 2BM1A 4R5PB 3JSBA 2YWGA 4F0KA 2NYIA 2FHKA 3BQ2A 4M5LA 1HW8A 4CLLA 4C8MA 2DR5A 1FA0A 2CQIA 3TUJC 1FE0A 2EEYA 2QA1A 2N7YA 4N7TA 1Z1ZA 2AYGA 1RTHA 2FDNA 3G82B 2CQ3A 1JLGA 3D7SB 4IR1A 2GMJA 3BKTA 1D1UA 1VRTA 1Q8IA 1SC4B 1V5IB 3QIPB 3MPUB 3CMAS 4DV0J 1X60A 4ETZA 2FZCB 2DT9A 3H98A 4HHJA 5T14A 3CCWA 1YTYA 4NA3A 2HS0A 2P5VA 3QGPA 3QYYA 1N48A 3GYNA 5LJ3Y 2RT3A 1PJ5A 1X4HA 2B56A 2HNZA 2QC3A 3C6UA 4MAKA 4EO8A 4A8SA 1YRTA 1XNRF 2KVIA 2V5HG 3S7RA 2SXLA 3OTDA 4C0OC 5HANA 2VFSA 1NKEA 4F2RA 4MJWA 2JFKA 1SXLA 1RGVA 4ZKAA 1D9FA 3A8IA 1UL3A 3QMQA 4C6AA 2L41A 1DQ8A 4RW4B 3V4MA 4OLOA 5A2QU 4LFBF 2A3JA 4C97A 2Z2YB 3QATA 4Y2CA 1WNEA 2BBEA 3JSRA 3PO5A 2VPZB 2YKMB 4P2SA 3ZZ0A 4DV2J 3RB0A 1X9WA 5K9FA 3GJQB 2LXIA 2LFVA 3H5YA 1RT4B 1N6QB 1KD1T 3FNNA 2BJ7A 2DHSA 1FVQA 2CRLA 2ZOFA 1NJWA 1UVIA 1RU1A 5HQ8A 4MYTA 2E1RA 2V4QA 2RILA 3K7RA 1QAIA 4KT0C 1W2IA 2ZC4A 3ISZA 2VB6A 2B4VA 4ANDA 4X4OA 5JVHQ 1PYTA 2DHGA 2VZ9A 2KM8B 4KJIA 2HVDA 4Q2LA 1ACMB 1X8DA 2FJAB 2CWXA 3JYTB 2IA6A 2UUWA 3FZBA 3ZZTA 4CLZA 3NO7A 2LCWA 2C42A 1GXUA 3TAPA 1TL3B 1AUDA 3BDPA 1WC5A 2Q43A 3R7BB 4P7TA 1ZM2A 4JI3F 5LT5A 2HHHF 3WIUA 2X7IA 1YK9A 4CM0A 4N76A 4DN9A 2M88A 3AB4B 1UKUA 5F8JA 1HBMB 1HMVA 2HIYA 4M5HA 2QA4G 5IT9Y 2GQ2A 1MW7A 5I3PA 4H54A 3AHPA 4ERDA 1URNA 3KTQA 4KKOB 3CDEA 1SKSA 3NXZA 1XMQF 2G2ZA 5GAHI 4I6WA 3GILA 1TELA 1O0PA 5HBMA 2IRYA 3MM5B 3VZHA 5DLFA 3RG6A 3OFFA 3Q89A 2KJWA 2QFIA 2IY5B 3D3CJ 3Q2SC 2VPWB 3D6HB 3F56A 1BE4A 4YB6A 4X65F 3BYPA 3EVWA 4KPCA 3G6VA 2KKHA 2I8EA 3RJMB 4AT1B 4OX7A 1N5YB 2M8DB 2VBZA 3CWJA 4D3HA 2VPYB 3QWUA 4ZP8A 4A8QA 3ISND 3MHYA 1TFWA 4LR8A 2QT7A 4DQRA 1HNZJ 1BMQB 3C14A 5CYMA 3AJDA 5HQMA 1JLEB 1LFPA 2EPIA 1PARA 2EFOA 4IFYA 1R8HA 5FLXU 1FXLA 2F40A 3CJKA 3IM9A 2XSJB 4IOBA 3M32A 2B43A 2YNIA 2DEJA 3NGDA 4DSKA 3UCUP 1I51B 3UPFA 1FJGF 3OT9A 4RBVA 2FYXA 2RB7A 3K5MA 3M1VA 1NM2A 2CWKA 2RU3A 2MQLA 1ZZNA 3GE9A 2VFTA 4WBFA 2HURA 1OY9A 4CO2A 1Q5VA 5LMNF 2MQNA 4UW2A 4FF4A 2HLUA 4U7UK 1CEZA 4MKYA 1D09B 2B9EA 2W9BA 4USIA 5ETNA 4DQQA 1GX5A 2XNRA 4IDKB 3V6DB 5GAEI 1PC5A 2OO4A 3PV8A 4U7UD 1CQMA 1LXNA 4CLFA 3M2UA 2DK2A 4CRJA 1RT7A 2W4DA 3CE8A 4P52A 4JI6F 4N56A 2PDAA 2ATLA 1M0SA 2ZHOA 3S1TA 3AQPA 1X4EA 3VAIA 3Q2TC 4QIWD 1S6UA 1WI8A 2CQBA 2PN6A 5E3PA 3KHHA 2LA4A 1HNXJ 2VASA 3K0JA 3HO1A 1RHQB 2PSZA 4W98A 4O44A 4YN3B 1UEUA 4DX7A 4DV2F 3GP9A 2BSQE 3VVUA 1Y00A 5F3TA 3SSQA 1OYDA 3CJQA 3M7VA 3FVYA 2J6UA 3J7AN 4YR3A 2FHMA 2FHJA 4DHVA 5DLGA 3V6HA 3FK4A 2HQGA 3ICLA 2MLYA 2YX1A 2ABYA 2MQQA 4GC6A 2XWYA 5IFMA 1URRA 2WB4A 2HS3A 2HQCA 2F9DA 2HQDA 3LP1A 3QLHA 5EWEA 4YHHF 2IM1A 3D0IE 1IUJA 1X31C 4NI2A 3K5PA 5GVQA 3OLAA 1N36F 3NRBA 2GVDB 4P72A 1IM4A 2RQMA 3GSIA 4OX9F 1JLEA 1WG5A 3CCLS 2VQEF 1IKVA 4OHZA 5U47A 4C8KA 3UQSA 2NPFA 2AHOB 2KZZA 4G1PA 4OZJA 3W65A 1S0OA 3TZXA 3UD4P 1HNWF 3BV8A 1J5EJ 4TY8A 4LFCJ 2C2DA 1OPZA 3LP2B 3R5DA 3VAFA 4OYIA 1V3RA 3Q8PB 1HL6A 4KAIA 2A0FB 2WB1D 3FCHA 4OI1A 3E51A 3ZTPA 4DOZA 2HRUA 2PEBA 2A6MA 2WW4A 3BZQA 4JI8F 1VQKS 5K14A 5IXUA 5EDWA 1OJ4A 3BEGB 2AQ4A 1EARA 1FE4A 4ED3A 1YBUA 1QD1A 3DOLA 3NMAA 2M9KA 3OQ2A 2ZD1A 1W2BR 3OFGA 3MM6A 1KQSR 4UY85 3LP0A 4WFNQ 5HROA 2M8HA 4O23A 1W25A 2F1FA 4O3NA 5BYSA 2N4CA 4TYBA 1GTEA 3HHLA 2RBFA 1F9HA 4CH1A 4EYIB 2WRMA 1YJTA 2MZJA 2Y1IA 2UU9F 1QVFR 4PXCA 3W63A 3RBXA 2RQCA 2QEXS 1ZH5A 5AT1B 1X4AA 1ZPWX 3BGUA 4ES1A 2L9DA 5C2CA 7FDRA 3OHBA 2W2QP 4BC7A 3H90A 3RGIA 2QO3A 2ZE2A 4N47A 1YJVA 3TAMB 4A8WA 1KC8T 3QT5A 3KK2B 1MWZA 3VGVA 1FRXA 3I0RB 4IFVA 1S6PB 4P2FA 2BJ3A 2OFGX 4RU9A 2IJRA 4KGXB 1VQ9S 3U7JA 1LWCA 2C3MA 3CO9A 2DY1A 5KFRA 4KH1B 4M5DA 4U8VA 3FCWA 3W1YC 3UVJB 4EI2A 5KFWA 4XPCA 3GIJA 1YJNS 1DQAA 1CS4B 1UEVA 2ZBRA 5CQGA 2MQOA 1WTBA 2JX2A 3FFIB 1F3VA 4FVMA 1VK3A 4E98A 8RUCA 1T9YA 1ELOA 2V94A 4ED8A 5DJBA 4AXIA 2IRXA 1OY6A 3H8YA 4Z7CA 3R9LA 5IWAF 3HSDA 4CLYA 1FJCA 2ADLA 3DU5A 4CIOA 2EBGA 1M90T 2H5IB 2XS5A 4RW4A 2X1AA 1YJUA 1FNXH 4OLPA 3CUNA 2K8GA 4DPXA 3HPOA 3R1HA 2XHWA 1NDKA 3MCOA 4O3SA 1HFEL 1U26A 3AOBA 2XZWA 2I2YA 5A2QY 3I4HX 3EICA 3DHXA 1SIZA 2KU7A 2E44A 1S79A 3AA9A 1KLMA 3TZWA 3ZZOA 3PX4A 2X1FA 4ZVGA 1S12A 3D54A 3TVYA 2H51B 3NS5A 4JYAJ 2OP5A 5F3ZA 2YNGB 3GB0A 1IQZA 3MM8A 3L9ZA 1NZAA 2W7OA 2V68A 4CQ1A 5HSPA 1S9GA 3DN9A 2CG4A 1KDNA 4KFBB 4HTJA 4F7VA 1NU4A 1YSJA 2YKQA 4QR1A 2XCPA 1RTHB 1F1BB 3AQOA 4FS2A 2N7CA 2UV8A 1JX4A 2PEHA 2H1YA 1SKRA 1ZYQA 2HGLA 2DY9A 4ZVEA 4DSEA 1WC4A 5BXIA 5L8RC 2FQQB 3G8QA 1YI2S 4XPEA 4OHWA 3HP6A 1XN9A 3H4DA 1NJYA 2J8SA 2HBQB 3BQ0A 1WDDA 2W8KA 2DHHA 2FLOA 3SQGA 2IFXA 1QSYA 3BGRA 2VJUA 1NAQA 3L4BC 4KIAA 2W01A 2HPUA 4KGMA 3K58A 5LMUJ 4QCLA 2BKPA 1HWKA 4GO5X 1N4LA 3DI6A 3OTOF 3B8HA 2FZKB 1R31A 2CPHA 2J8AA 3FBCA 1VQ6S 4I4BA 2KYXA 4M1KA 4ECVA 4KGZB 4B3OA 1IKYA 5DM7Q 4HKQA 1KR4A 2FTRA 1RADB 3ILIA 4HHUA 5LMNJ 3EPGA 1RE1B 2NYHA 4J9LA 4PYAA 4X66J 2JLFA 2BVZA 1HWLA 2BUNA 3P3DA 4DU8A 2FLPA 3IM8A 1XJWB 5E2QA 2VH7A 3S01A 3MUVP 3PO4A 2X3GA 3TYTA 3NBPA 3Q83A 1K1QA 4RNHA 2E9RX 1TL5A 2ZZTA 3MMJA 1I94J 3VW4A 3QGGA 2DGSA 2A6OA 2EG1A 4B9SA 2WONB 4V1Ak 1RA6A 4DR3J 1TUVA 1RXOB 4DV5F 3LH2S 2DB1A 5IQQA 4U7CA 2HFUA 4USJC 5T7LB 1JXLA 3EGVA 3R5JB 2KN4A 3O44A 3CCUS 1HBOA 1ZAVA 3HVTA 3T5KA 1FT8A 2UP1A 1LWFA 3TJAA 3DGPA 1HQUA 2AGPA 3KUEA 2EBEA 1SPBP 3R8YA 4ITSA 2YKNB 2Y1JA 1SV5B 5B0EA 2IRUA 3DYAA 1FX2A 4LR7A 2OH2A 1NK8A 1CPZA 1B70B 2B9XA 4C8LA 1JLQB 1ROFA 1DQ9A 2GMHA 2LXUA 4QWEA 4DL7A 2E5LJ 4LFBJ 4QOTA 4RW8A 3HCXA 3LGNA 1FO1A 1D9AA 1X5TA 1NPRA 2CDQA 3GWCA 5KG0A 4C2MA 1RT6A 4ZCLA 4O0IA 1P1LA 1JJ2R 4DR2J 1G1XA 1DURA 1FWLA 2Z0GA 3UVJA 1KEKA 1RT3A 2GO9A 4IDKA 2DHXA 1TV6A 1MMNA 1WHXA 2IM0A 4HT7A 2IAJA 3J7YU 2VBYA 3RRKA 5E41A 1SJRA 4YR0A 5DZ6A 2N3OA 5KFNA 4B3SJ 2HBYB 4G3IA 3QZ8A 1U7LA 2ZE2B 2M2BA 2ZM6F 1VQPS 2RKIB 1EIYB 2HFZA 3N28A 5DDPC 1QSSA 2DRBA 5CA5A 3N5BA 4GO7X 4GVBA 1WHYA 5KFBA 4LVOP 2R2SA 4ZHRB 2UUAF 2DXEA 3F73A 2K5JA 1PJ6A 1RT5A 4DPWA 2O3DA 1RT6B 1YGYA 1KBRA 2MZQA 1S99A 4G65A 5A8KA 3PM9A 2DR6A 2IMWP 2APOA 2B4OA 4Y3CA 2KTQA 1RAIB 3W62A 5DG8A 1MYLA 3EE3A 3D68A 4RO0A 4K8RA 5D6GA 1BWEA 4OYPA 1GTHA 2R7VA 4NOHA 1SL0A 2Y3YA 3FEXB 1LW2A 1FJEB 3RRHA 4ED6A 4DCPB 1N5YA 2L9NA 3VQSA 2NR0A 1OHNA 3I6PA 3BJYA 4XTTA 2UVWA 4JI5J 5HMXA 1TKTB 3G86A 4K7QA 1AT1B 4F04B 2CJ9A 2CPXA 2MMYA 4ELUA 3TAQA 1WOOA 4X4PA 4NMXA 4NXMF 1BGXT 1Y5IB 4IRKA 1HNZF 2HZCA 1OIAA 3R27A 5J2PA 4L3KA 4F50A 4F2SA 1U0HB 4WYLA 5J2PB 3OJUA 1HW9A 4ZVTB 1U2RA 1R0CB 2Z2MA 4HVZA 1I5OB 4OYWA 1DY3A 3ETOA 3LO3A 2M70A 4WTYA 3GZ7A 4EUVA 3V81B 2M4MA 5CD4A 1TR0A 3PJWA 3TUIC 3FSIA 1WKKA 3FC9A 1HMVB 2VDIA 2XYGB 2C2ZB 2XSFA 4N77A 2IVFB 2RUSA 2UUBJ 3HHNB 4EU0A 1RAHB 2DBBA 3CD0A 4F67A 3WQPA 1NK6A 5D3GA 2BRLA 2DNOA 1UWBA 2GGPA 2J6TA 2YPYA 2QYCA 4DV0F 1T05B 4MIAA 2VL1A 2R7UA 2JXIA 2VG5B 3US5A 2BNWA 2PFFB 2DH7A 2K1RA 3HHDA 4Q2MA 3KLFA 1RYSA 3DRRA 3E3XA 3KG0A 3MEEB 1U02A 4WCEQ 2JOQA 2BABA 3PRBA 4DV7J 3TEHB 3SYZA 3DRYA 2I6WA 1DTQA 3SQGB 4WTOB 2KG0A 2XB2D 3QNWB 2JWNA 3CF5Q 2O66A 5B7WA 3KLEB 3GR1A 1Q5YA 3GU0A 3S8SA 5F8GA 2HNDB 4CO0A 1B7FA 3NMRA 1RT4A 3MMBA 4CCHA 3V4IA 1CBKA 4OZ3A 2JEJA 3M2RB 2R8GA 3KJFB 4QIFA 3DMJB 1UFWA 2JDJA 3EVMA 2V9KA 5L46A 2WSFC 1DTTB 1RKJA 3GFHA 5F8NA 5RUBA 3VAHA 3I87A 1IKXB 2GVZA 3BH7B 2AJ0A 1VQOS 1QUVA 3KDOA 3LTOA 1U1PA 1RTJA 3MM8B 4DV4J 4JI1J 3VF0B 1B0VA 3J81U 5C25A 1G4CA 1LW0A 2E1MC 4JV2A 2DH8A 4DL5A 4JV1A 2LA6A 4X62F 5BR8F 1KNZA 4NCBA 4ID5B 1RBLA 3UO0A 1U8WA 2VD3A 1UW4A 3K59A 1Y10A 4M5GA 5B0AA 1BC6A 1BD6A 4DCJB 2QLBB 1N54B 3FZ2A 4KYZA 3CCRS 4DWIA 1JLGB 2RMLA 4MK7A 1ZTTA 4NMLA 1ICEB 1YJWS 1OMSA 4FXDA 1N32F 1YJ7A 3UR3C 2GJFA 2VFVA 2CJAA 4OV1A 1CJKA 4RW9B 3GTYX 5THWA 4OX6A 4B3MF 4DFPA 2XLKA 3DU6A 2XEXA 1HQEB 2GIRA 2ZH6A 3D1HA 2PT0A 2JRSA 2X1GA 3HD1A 3R5CA 4MIWA 1FERA 4URQU 3VCDA 1MU2B 3CNQP 5B0CA 4QR0A 4ES3A 5HN0A 1HNVA 5IV4A 4QQBA 3R2CJ 2RDDA 4RBTA 4LFAJ 3FMBA 2BA9A 4CYUB 3ET6B 3I0RA 5HATA 4ES2A 3QRQA 1U48A 4RNFA 5KG2A 2H3EB 1DHMA 4ZPTR 3KHLA 1DARA 2O5DA 4K4WA 1Z2ZA 1Q95G 1WORA 4NLXA 4M5MA 1CLFA 1FDNA 3MEGA 5CZVA 3HHKA 3CT9A 2ALYB 2KXNB 1JLBB 2BJDA 5KFGA 1TK5A 4X4UA 2BXJA 1JKHB 1WF2A 4JYAF 1RUSA 4I69A 4OMFG 1MROA 2DR8A 4PQUA 2GC8A 2KT5A 3DOMB 4LMZA 3D66A 2E1PA 2C28A 1S9FA 3UDLA 4Z37A 5IT9U 1F0XA 1RBAA 3FQKA 2Q2KA 1YQHA 3MAHA 3PACA 3UDEA 2MPUA 3DXBA 3NGUA 2ZD1B 1PO6A 4HEA9 3CC7S 2J0QD 3C6TA 2UXBJ 1IQTA 3K17A 6FD1A 3N6LA 3HXMA 3ZZYA 4ECYA 3B4MA 3LANA 4DV6F 3KNAA 2WSCC 2B51A 4LSNA 5ETSA 4UOGA 3OL6A 1KVKA 2W2NP 4DF4A 4D8JA 5KFSA 1AZSB 3MTKA 2UUCF 2DNYA 2OPRB 4HLBA 5MAOA 2H4YB 4LRDA 4A4JA 1V3ZA 2HBRB 2ZEJA 1E6VA 2CNOB 3CJSA 3KDNA 3O1LA 3WX8A 1D9DA 2AGOA 2NS1B 1QY7A 4LBPA 2OPQB 2ZJQQ 1V5VA 3AFGA 4ZPWR 2AT1B 3FBBA 1YZ6A 4DG1A 1SKUB 2UXBF 3GLJA 3JQJA 1ZPVA 1JIHA 5K20B 1C1CA 1MWQA 4PWDA 5AXMA 4HDGA 2ZBPA 1I1GA 1YRUA 3HHLC 3M8PA 3CO0P 4HH1A 1CULA 4WK3A 4O3QA 2H5EA 2Y0BB 4F4YA 1RWOB 5J2MB 2MYFA 1P8GA 4LF5J 1OY8A 2ZH8A 1S6OA 3TARA 4K4SA 1TKXB 4CO1A 2R2RA 2VODA 4QU6A 2KL8A 4DZDA 1X9MA 4MH8A 4ECXA 2RVJA 2F4VF 2EW9A 4PPZA 1TAUA 5F9LA 1VLOA 3GFZA 2DNZA 1V3SA 3IFEA 1TK0A 3A8EA 2ZNYA 2RE1A 3RAXA 2R7OA 1SQEA 3MFHA 1EAYC 4O3OA 2C2NA 2L08A 2QLXA 3OVAA 4UOFA 5C24B 1H6KX 1LQ9A 2DO4A 5KFZA 3QJJA 2H9ZA 1WC0A 5KFXA 3TVZA 2HFOA 2Z58B 1H98A 4BLGA 3MURP 4LF9J 1XR5A 2Y0SD 3C15A 1Q53A 3M2UB 4IG0A 4WU3A 2EFNA 3EUNA 4LSNB 5FIIA 4R5PA 1UPPA 3NOGA 1RAFB 1GFWB 2JL9A 3W8GA 1RTDA 2FB0A 3EJMA 4EO6A 1NHKL 3PX0A 3Q8UA 4KPYA 3D1QA 1UVJA 4KGKA 3W61A 1V6HA 1NK9A 2FVPA 4IO1A 2ZOGA 3RB3A 1WHVA 2VG6B 3VTIA 2N82B 3LAKA 4CLTA 4NWBA 3VEAA 1WOSA 2CPDA 3D28A 3F0NA 3QRPA 3KLFB 3MPVA 5HLFB 4UZCA 4ETXA 2BKOA 2HFVA 2EC2A 3CDWA 4TQRA 4IRCA 2D3ZA 1T3OA 3J80U 2KJVA 2J9CA 6AT1B 3GR0A 4Y2KA 4AE5A 2R9LA 3C3LA 4RZRA 4OX9J 2YNIB 3HHEA 4LR9A 2UV8G 1XWLA 3ILOA 4PR6A 5F0UA 3KKFA 2DCLA 2HLTA 4LF4J 3DDNA 4YY3J 4KSEB 1QAYA 3QRRA 1U0HA 2EFGA 1FRMA 4URGA 3KLGA 1FCAA 1FFSB 2GS8A 2OD4A 1SL2A 2VPXB 1S7HA 1VBXA 4GKKJ 2HAIA 1NSAA 1GX6A 4LF9F 3T1YJ 3WIVA 3KHGA 4L3NA 2DITA 1EHWA 1RI7A 2QG9B 3N6NA 2OEKA 3PNIA 4IR9A 3OD2A 4DS5A 2CQPA 4OI0A 3SCIE 1H38A 4QU7A 3M8WA 3WC0A 4V19J 4USMA 1F6TA 2RNEA 4DL4A 4TY8B 5KT7A 5KFTA 1RLDA 2ZH2A 2OELA 2QL5B 2ILZA 4PG5A 2IBKA 2ZBCA 2HHVA 1XMBA 1QM9A 2FIUA 1SQGA 4Y2IA 5FDLA 4U95A 3KLGB 3AB2B 2P6SA 1HYSB 3CMES 4ID5A 3CW2C 4KKOA 1HWUA 2O1PA 4NXNJ 4FYDA 2CNNB 2ZKUA 4ZITA 4U67Q 1F5AA 2W4CA 1KRPA 4U96A 1OSDA 4DR7F 5D0HA 1MROB 2OEJA 2Y8WA 1NJZA 2KFZA 2OPPA 3IC1A 5SZTA 1RWKB 1WUUA 2XWXA 3QJLA 4J90A 1HBNB 2R4FA 1X5OA 1RTJB 2W2PP 4TKTA 1BQMB 2HAFA 4ECQA 3H87C 2VFRA 4XO0A 5CD4H 3FRZA 5J2QB 2Z57B 1NLAA 4QPTA 3MR7A 5KFLA 2ADCA 2PMZD 2KDOA 4O44B 1QJHA 3BB5A 3TZYA 2G13A 4LBHA 5LMUF 1SIWA 4TU7A 5BYRA 4C11B 2OFHX 1IR0A 3CGIA 1RTDB 3SFUA 2P9GA 1Q16A 1HQEA 1RLCL 2D74B 2HNYA 3N01A 4P7VA 1T03B 3DKDA 3AXKA 2FLNA 5L1JA 2C22A 2DPIA 1IVZA 4PEOA 4WIIA 3VAMA 4WU2A 2VJVA 2FZGB 3EGNA 3IR5B 3VR1A 1U1MA 3IAM9 1TL7A 3D0GE 3FKBA 3HFZB 2YTCA 4E8UA 4JV5F 3MPWA 4OI6A 5EX3A 3KJNB 4H4MB 3LGHA 1RWWB 4WE1A 3THPA 1RB0A 2I5JB 3OJSA 3CVKA 3LGMA 2LDIA 3TP2A 4DQSA 3GIMA 2GV1A 5KG4A 3Q86A 4ED2A 3K8VA 2HHWA 1XEZA 2B4PA 3HHLD 3R3TA 3CDUA 1RT1A 1FF2A 1CULB 2C3OA 3HFKA 4LF5F 3G9CA 3DDIA 4WJBA 3DFEA 4NLOA 5JUMA 5DDOC 3DLLQ 2PMWA 4I64A 3QJPA 5HJXA 3BSAA 2GCFA 3I82A 1K0TA 2J9EA 1UP1A 2LQ8A 2AZ1A 5GAGI 1RK8A 4ZDNA 3CCZA 1B4SA 2VKZG 1FRHA 4PWWA 5E3AA 5H9FK 2XMMA 4A46A 1M5VC 2DXFA 4NPOA 2R7QA 1KOOA 1TUWA 1QTNB 5KFQA 2YKAA 3M9MB 4ZJLA 3NS7B 3IBWA 4R0JA 4F4ZA 4U9RA 3PIPQ 2V69A 3DRSB 2JLGA 3HT3A 2BZ2A 2HNDA 3BKFA 1FEEA 3DLKB 4LRCA 5DETA 3BQ1A 4K4XA 2KZMA 1WTFA 3A3NB 1VQYA 4H4OA 2H3AA 3P5BP 2RHSB 1JJHA 4DV6J 2HHQA 4GKKF 2F5GA 2AD9A 2FGOA 1K9MT 2EXUA 1FKOA 1DZ5A 4CTAA 4OL8A 3CJ2A 1S1UB 1RAJA 4L73A 4PKDB 4DBQA 2LQBA 2E1CA 2DNMA 3A3PB 3KLIB 3T9NA 4ECUA 3PW5A 4IQXA 2BRKA 4DV3F 1RT5B 1U6FA 1F60B 2EKNA 4F8RA 2LDYA 1VR6A 3K57A 1HNIB 2YWKA 3DRSA 3H7HB 2DO0A 3QQCD 4QYZJ 5I42A 2ZC3A 1SUQB 1U09A 2ROEA 3I9V9 1NNDA 1X9SA 1Y7PA 4FYVB 3OUYA 3MCSA 2FJBB 1C0UB 2BANB 2YX7A 3FSXA 1CQNA 2LU2A 2QLWA 3TQEA 3W5XA 3JYTA 1UZDA 2DNKA 2HK2A 4NA2A 3MPDA 1NJXA 1G7CB 3D6TB 5D4PA 1VJQA 1N0VC 2B7CB 2MLXA 2K7KA 3LPYA 2LQ5A 4BWMA 2G0IA 3DDKA 4ZVOB 3T1AA 2KELA 2MY8A 4I1TA 2LMIA 2XMUA 4K0KJ 3R5AA 4ZPCA 1REGX 1U47A 2BACA 1UWAA 2VDHA 2DD8S 1RYRA 1IRQA 1CJKB 4RW9A 5F41A 3I55S 2IA0A 4BDPA 4IG3B 1S9EB 3C16A 3IR7B 4QYZK 1WWHA 1JLQA 4LUBA 4ZVFA 4AL6A 2ZHBA 4GKJJ 2AJFE 3QT6A 5C42A 1HBUB 2Z2LA 1SV5A 1R89A 1VYAA 4K4YA 1XMOF 1TU0B 1IBKF 1HNWJ 2RF2B 2FJEB 4B3RF 2AW0A 1T94A 5D4OA 4JOUA 3UFCX 2E5GA 2V8DA 4WIQA 3HKZD 3C16B 5F8MA 5DG9A 4TLRA 5FLXY 2VQEJ 3RAQA 2HHXA 1AFJA 2XNQA 4DFMA 4C0BA 5L9NA 4IO9Q 2WOMA 5AE2A 3CD6S 3PW2A 5BR8J 5A8KB 3KJVA 3ZNJ1 1CJUA 4GRSA 3BREA 1SB6A 2KT2A 4DCOB 4JI7J 2NXUA 4YHHJ 2XGPA 4AQYJ 4N5SA 4ZP6A 4F3QA 5J2NB 4JI1F 2B8PA 3TZZA 1E6YB 3M8SA 3VAJA 2P6TA 4X4QA 4UOHA 2VF3A 5CHCB 4LSLB 2FUG9 3MECB 1VI7A 4HDHA 5MLCV 1PAEX 4YEAA 3ZTSA 5GAEU 3DMJA 2BMBA 1EKSA 2J76E 3MWBA 2LEAA 1U2FA 3PEHA 3R6LB 7AT1B 5HMWA 3KK3A 2QL9B 1UVLA 1S5ZA 3HVAA 2HHSA 1UJ5A 2LVWA 2EWHA 2WW8A 3MMBB 3PXGa 3TNVA 2HGNA 2AJ4A 1IKYB 2H5JB 3TRGA 1ZETA 3BSOA 1T3NA 4NYPA 5LXYA 2CFXA 2NCKL 4O3PA 5DQHA 2NXCA 3PRDA 5H1SV 2OTLS 1H72C 1UW9A 2B6AA 4Y6IA 4J9SA 1PJ7A 4Y65A 2E9TA 2RRNA 1FKOB 1JNRB 1X5SA 4DF8A 2VA2A 1SI9A 4YOEA 1DAXA 1VIOA 2MDAA 1S1WA 1VJWA 2JZ5A 2MEWA 3MMCB 2ZH7A 2M7SA 3DYAB 3HI9A 1M1KT 1B64A 1Q7LB 1S0NA 3AD7C 2J5AA 3GQCA 2LEBA 1BWVA 5DDQC 3W5YA 1QVGR 4LRAA 2F8MA 2C2OB 5K14B 5IWAJ 4NCAA 2Q66A 4RBUA 2FJVA 3BPSP 1J5OA 1F3FA 2CXEA 2O67A 2ZH9A 2IVYA 2R3VA 2QMWA 4DSIA 3BSCA 5C5JA 2FVQA 1RA7A 1WF1A 2QLFB 4PPDA 4OYOA 4PAAA 4C3KA 2BOPA 4EZ6A 5I3UA 3T5LA 4CT9A 3MR3A 1WG4A 2DTJA 3I31A 3GYXB 1HHSA 3IG1B 1JXVA 2K7JA 4M95A 2DNHA 2DNQA 3UDCA 4IUFA 2W25A 3TW0A 2CQGA 4YR2A 3GIKA 2L9WA 1S1VB 3PIOQ 5KAKA 1U45A 4J9VA 2XCAA 1NPKA 2ALZA 4UUWA 4FXVA 1S76D 1F2HA 3PJ9A 4HV0A 4J9PA 4H4MA 4ZLNA 1B7YB 1TQLA 1X5PA 2FD2A 3F41A 2JLEA 3HD2A 2QFJA 2W7PA 1U24A 1D8YA 2UU9J 1M5KC 1KVJA 4ZVRB 1L3KA 2I9SA 4CT8A 1LW2B 4MFBB 1Q8LA 2XMAA 1RJJA 4KE5A 3MUMP 2CAXA 4CO3A 4X4TA 1KTQA 1S1WB 2XGQA 5KFEA 3T1YF 2P2CB 4CH0S 5D15A 4DR3F 1QUPA 3EDQB 3SBMA 1XMQJ 2Q1LA 1SJFA 2HNYB 1A6LA 4UF4A 3GIIA 4DFKA 4X64F 2BR0A 2LLZA 3CJ5A 1WSRA 3EPIA 4OI3A 5B0FA 4JI8J 5SUHA 4D3GA 5H9EK 1JWWA 1IM6A 2F4FA 2BDPA 5EUHA 1GH8A 4KFBA
chains in the Genus database with same CATH topology
2BJ3A 4FXEA 2WVEA 1MNTA 1MYLA 2CPGA 3VEAA 3VW4A 1Q5YA 3QSIA 2BNZA 2JXGA 3BKUA 2BJ7A 4D8JA 2K29A 3H87C 1PARA 3FT7A 2CAXA 1ARQA 1NLAA 3OD2A 1B28A 2Y3YA 2K9IA 2CA9A 2F1FA 3BKFA 3LGHA 1ARRA 3QOQA 1EA4A 2K1OA 1BDVA 1MYKA 1QTGA 2RBFA 3VEBA 2WVFA 1B01A 2BA3A 1BAZA 2K6LA 2CADA 3GXQA 1BDTA 2WVCA 2JXIA 2BNWA 1P94A 2AY0A 2HZAA 2BJ9A 2NZCA 2KELA 2WVBA 2FGCA 2WVDA 1U9PA 2BSQE 2PC6A 4HV0A 2HZVA 2CAJA 1X93A 2K5JA 1IRQA 1Q5VA 2BJ1A 2BJ8A 2GPEA 2H1OE 3FMTA 4ME7E 3BKTA 2JXHA 3PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ3 A;  4FXE A;  2WVE A;  1MNT A;  1MYL A;  2CPG A;  3VEA A;  3VW4 A;  1Q5Y A;  3QSI A;  2BNZ A;  2JXG A;  3BKU A;  2BJ7 A;  4D8J A;  2K29 A;  3H87 C;  1PAR A;  3FT7 A;  2CAX A;  1ARQ A;  1NLA A;  3OD2 A;  1B28 A;  2Y3Y A;  2K9I A;  2CA9 A;  2F1F A;  3BKF A;  3LGH A;  1ARR A;  3QOQ A;  1EA4 A;  2K1O A;  1BDV A;  1MYK A;  1QTG A;  2RBF A;  3VEB A;  2WVF A;  1B01 A;  2BA3 A;  1BAZ A;  2K6L A;  2CAD A;  3GXQ A;  1BDT A;  2WVC A;  2JXI A;  2BNW A;  1P94 A;  2AY0 A;  2HZA A;  2BJ9 A;  2NZC A;  2KEL A;  2WVB A;  2FGC A;  2WVD A;  1U9P A;  2BSQ E;  2PC6 A;  4HV0 A;  2HZV A;  2CAJ A;  1X93 A;  2K5J A;  1IRQ A;  1Q5V A;  2BJ1 A;  2BJ8 A;  2GPE A;  2H1O E;  3FMT A;  4ME7 E;  3BKT A;  2JXH A;  3PHT A; 
#chains in the Genus database with same CATH topology
 5M2U A;  4HL9 A;  5E5N A;  2MY7 A;  5D4N A;  4LSL A;  2Q6C A;  3GV8 B;  4EYH B;  4ZIW A;  3T5J A;  1HIY A;  1HI8 A;  5F9N A;  1R0A B;  3B6B A;  3LPE A;  3BKU A;  4I2Q A;  4C0H A;  3ENA A;  2ZUG A;  2GO8 A;  3M1V B;  1TV6 B;  2V67 A;  1JNZ B;  3MF5 A;  4QWB A;  1VRU B;  4TNO A;  1ZTW A;  4OZ1 A;  4JI2 J;  2HW3 A;  4NE9 C;  3ILJ A;  2MKJ A;  2XSJ A;  1Q81 T;  2KXH A;  3Q22 A;  4MKV A;  2AYB A;  4DEZ A;  2MQM A;  5E0O A;  1C0T B;  3M8P B;  3W66 A;  3V6J A;  2CPY A;  4LIR A;  3I9Z A;  3H20 A;  4I67 A;  4ZPV R;  1RHK B;  3BBF A;  3MM6 B;  1RHU B;  1U9P A;  1OQ6 A;  2C3U A;  2BYC A;  2IM2 A;  5HK4 A;  4ZCM A;  4DL3 A;  1IKW B;  2MZ1 A;  3PHE A;  4AFF A;  5KOX A;  3VAL A;  1G6B A;  1RHM B;  1S0M A;  1ARO P;  3TX8 A;  4JI5 F;  3AJ2 A;  3QBC A;  3BR9 A;  2VUG A;  4XK8 C;  3FBF A;  2V9W A;  1AYE A;  2DRD A;  2OHD A;  3SEO A;  1S9E A;  1EZZ B;  2Z2Z A;  2DGW A;  4QIE A;  1S1V A;  2AZ3 A;  1HHT P;  5HVG A;  4DR6 F;  1BXN A;  4MK9 A;  3BO3 A;  2F4V J;  2K3K A;  4C9D A;  5I4M A;  2ZHA A;  1VC6 A;  2HWH A;  1OSC A;  3BO4 A;  4Q8E A;  1BDV A;  4LF2 A;  2XMT A;  4HHH A;  3R7S B;  3HZE A;  3VWS A;  1Y9O A;  5ITH A;  2WSE C;  3L09 A;  1S10 A;  3BGL A;  2RDJ A;  3RRG A;  1Q78 A;  3JTP A;  1X4F A;  2CIM A;  1PCA A;  2BE2 B;  3BH6 B;  4C7Q A;  4EBE A;  5KFJ A;  4DL6 A;  1FKP A;  2F3J A;  3A1Y G;  2MJU A;  4O0N A;  3N79 A;  3R7N B;  1C0U A;  2V8V A;  5G4D A;  3MGJ A;  2DIS A;  5ETV A;  1RAE B;  4NLU A;  1WSV A;  2H48 B;  2VIH A;  3HVW A;  1K44 A;  4I68 A;  1BLU A;  2GHW A;  2VBW A;  2HHH J;  1NK0 A;  4Q8F A;  3KJQ B;  2HG4 A;  1RWM B;  3HX9 A;  3TOQ A;  4UY8 T;  4GC7 A;  1M1H A;  4PAB A;  1RBO B;  2J7U A;  4QZV B;  5G0R B;  3FEZ A;  1UJ6 A;  2CPZ A;  3UW1 A;  3MR5 A;  1LV5 A;  1IBK J;  2VFU A;  2UUC J;  4LBI A;  2BE9 B;  2YH1 A;  1X0F A;  2YY3 A;  3DI6 B;  3EDR B;  5B09 A;  4U6P A;  1UA0 A;  4AL7 A;  4P2M A;  2DGT A;  2RRB A;  4QJV A;  2OTJ S;  1VLY A;  2RU9 A;  1MWY A;  3HSG A;  2OPS B;  3NG8 A;  5E3R A;  2A10 A;  4M94 A;  1RT7 B;  2AP6 A;  3A4T A;  1LFW A;  1IBL F;  1ITP A;  2Y1R I;  4H4O B;  2XMW A;  2NXE A;  2C3P A;  1KQK A;  3IWN C;  2WVB A;  2PC6 A;  2Z4P A;  1C2P A;  3PTW A;  3W5Z A;  3LA0 A;  1NH8 A;  3M2V B;  2AJ1 A;  2ZBQ A;  4BCA A;  4QPX A;  4QWD A;  5B0B A;  1S57 A;  2YXL A;  2VKR A;  1HPZ B;  1RAB B;  3V6K A;  3HFV A;  1NSQ A;  3QPI A;  4EK2 A;  2ASJ A;  4C4W A;  4OHV A;  3UDV A;  4WF9 Q;  1FRL A;  1NCL A;  4RX6 A;  1S9G B;  3A13 A;  4TVA B;  3SV3 A;  1IKV B;  4K4T A;  1P9Y A;  2AEF A;  3OTB A;  3WDO A;  4OI4 A;  1K47 A;  1H7X A;  1XR6 A;  3AH6 A;  1IR1 A;  4R8U B;  1B28 A;  5LXR A;  3X1L B;  4C8Y A;  5HQL A;  4Q44 A;  1FNM A;  2B0G A;  3HSJ A;  3DOK A;  3SCL E;  1CJU B;  3ZO7 A;  3VEB A;  3AY0 A;  3CCT A;  1B01 A;  1W7W A;  5LSO A;  3TA2 A;  3PJX A;  4EFA C;  2CG8 A;  4RUC A;  5DQI A;  1BQX A;  3L7P A;  1FWK A;  3RR7 A;  2QA4 S;  1NB2 A;  4FN5 A;  3UI3 A;  3KUG A;  3OSN A;  3GIR A;  4EZ9 A;  1X93 A;  1H3D A;  5LSR A;  2YH0 A;  3QIP A;  2YKO A;  3BR8 A;  2BQR A;  2V50 A;  3T19 A;  5GAG U;  5IS2 A;  1N32 J;  3CC2 S;  3M2V A;  1ZM4 A;  5DGB A;  1TVR B;  3MD3 A;  1HAR A;  2AYM A;  3OR2 A;  4CP5 A;  4I6Y A;  2AEJ A;  1O5J A;  2ZIT A;  3H5U A;  4R25 A;  2KM8 C;  1CS4 A;  1A7G E;  3CED A;  3W2W B;  2CJQ A;  1TL1 A;  3GJR B;  1LWC B;  5DS7 A;  4CLS A;  1U8S A;  1U1Q A;  2W9B B;  4F02 A;  2ROG A;  4QW8 A;  1BY9 A;  1VHI A;  2A2C A;  2MLZ A;  4Z2X A;  1D0E A;  3DRR B;  2UXC F;  4ZOS A;  2K1R B;  1VS3 A;  2AJ2 A;  4USH A;  5AXK A;  5CCL A;  3QGH A;  1K1S A;  1S6Q B;  2RHQ B;  2V4J B;  2NXN A;  2ZVI A;  3M8Q A;  1GAO A;  1L3S A;  3OVS A;  5A0Y A;  1UWB B;  3P45 B;  8ATC B;  3LF0 A;  4NZ6 A;  4Q0B B;  3GYG A;  3DLH A;  1TUG B;  4IH7 A;  4O4R A;  4QIG A;  3JAM Y;  4ZLP A;  1KQG B;  2VG7 B;  5KTQ A;  1C1B B;  3X3U A;  5IT0 A;  1FKP B;  4L76 A;  1H73 A;  1VMB A;  1P27 B;  3SIP B;  1M5O C;  1TKZ B;  4RW6 B;  3HK2 A;  3OPK A;  2DIU A;  1FDB A;  3OV7 A;  5J1E B;  2X3D A;  4C98 A;  4P6Q A;  1KS2 A;  5DRK A;  1KQF B;  4QWC A;  3CCJ S;  2OML A;  1YLX A;  3DC2 A;  1BAZ A;  1U49 A;  1XTZ A;  1YJR A;  1U1O A;  3C19 A;  4CLP A;  2E7W A;  4WFZ A;  3SI8 A;  3MAQ A;  2QMU B;  5B0G A;  4NLP A;  1Q0N A;  2W8L A;  3RYL A;  2ZVS A;  2NQP A;  4Y0F A;  1RWP B;  4TYA A;  3DRX A;  1BQN B;  1NHU A;  1WAC A;  3EM1 A;  4LF1 A;  3JSM B;  4A8M P;  2GQQ A;  1ZOT A;  3HJV A;  2I0X A;  2CJB A;  3M30 A;  4OZL A;  2JC1 A;  1KKH A;  4B9T A;  1T9U A;  4ALZ A;  1EQM A;  4KQZ A;  2PO4 A;  4ATN A;  3OL8 A;  1WC3 A;  1YZ7 A;  4RUH A;  3KMQ A;  3BSN A;  5HI7 A;  2MB0 B;  4DPU A;  4NYO A;  3V2U C;  4L72 B;  4FBU A;  1LW0 B;  1H2T Z;  2C2K B;  2D1C A;  2OSQ A;  1PC4 A;  4LT6 A;  4M5N A;  1S4F A;  3R97 A;  3H25 A;  4DR1 J;  2KOE A;  2FHO B;  1Z4U A;  3C6U B;  4OYB A;  4B3T F;  3U02 A;  3A8J A;  1CVJ A;  1XBW A;  4KH0 B;  4GVB B;  4I2Q B;  3CJ3 A;  3QGI A;  4GVL A;  3GCW P;  3QWP A;  3R5G A;  1TL3 A;  4NA1 A;  2QL7 B;  1H2U X;  3RAM A;  3IA0 A;  2UXD F;  3HDS A;  5HL7 Q;  1MLA A;  5A76 A;  3UE2 A;  2VIC A;  4AQY F;  3G82 A;  1S77 D;  2HIQ A;  1TMJ A;  4OHX A;  1UET A;  2WBR A;  4O4G A;  4G1Q B;  4KC5 A;  4K50 A;  2E7V A;  3M05 A;  3UWT A;  3W2W A;  2HWI A;  5T41 A;  2E5J A;  5KG6 A;  1UVN A;  5J1N A;  4X2B A;  4JV0 A;  3CCV S;  1RWU A;  4TQS A;  4O4G B;  1SIW B;  4XDC A;  2LEC A;  4DU7 A;  5KFK A;  3Q23 A;  3GJT B;  3LUY A;  2AJQ A;  3BS9 A;  2LP4 A;  2V0N A;  2YKM A;  3LWM A;  3ZNU A;  4MFB A;  1REV A;  4UUX A;  4A47 A;  2CPJ A;  3U27 A;  3JAM U;  4DQP A;  2HVH A;  4ZJQ A;  2IJN A;  2DKO B;  2VG5 A;  3W8P A;  3EZO A;  2HYI B;  2UUA J;  4FZV A;  3R2D J;  2DCU B;  4KRW A;  5CCM A;  1EJ7 L;  3TQ1 A;  1HLW A;  2V2V A;  4FBT A;  1TFY A;  4L6V 3;  3P4U B;  2XY6 A;  2RQ4 A;  3NCR A;  2ZM6 J;  3MXH P;  2D3O R;  3BYR A;  2DR9 A;  3CD7 A;  3G96 A;  5J2M A;  1N56 A;  2CNL B;  4H4K C;  1HKA A;  5HO4 A;  3OSP A;  2FJW A;  2HNZ B;  4NLD A;  3IG1 A;  1Q79 A;  3V81 A;  1K8A T;  3JTN A;  3MM7 B;  4YS2 A;  3GSD A;  3JTO A;  3RZA A;  4UT4 A;  3H2L A;  2AMC B;  4DX6 A;  4F0H A;  1CJV B;  1K0V A;  4ECS A;  1IBM J;  5D0G A;  3O2I A;  5LL6 d;  1VRT B;  2CZV C;  2ROP A;  2HS4 A;  5LOQ A;  1HPZ A;  2CDR B;  3CIZ A;  3AXM A;  4DXL A;  2Y8Y A;  4WPA A;  4DX8 H;  3DXS X;  4RWW A;  3IRX B;  1LK5 A;  2OPR A;  1TKT A;  2L48 A;  2QZ8 A;  1VFJ A;  2ZKT A;  4DV3 J;  4A8X A;  5IV3 A;  2BJ8 A;  2A1B A;  2GML A;  2J7K A;  2ZZN A;  4P73 A;  4GKJ F;  3MR6 A;  4B08 A;  2G2Y A;  4GMK A;  2HWT A;  3U1M A;  1RIS A;  5DQG A;  4CWB A;  4A8K A;  2CPG A;  1IR2 A;  4K4U A;  3DLG A;  1NDC A;  1X4B A;  4LQ3 A;  2OPS A;  5HP1 B;  4JI6 J;  4O3R A;  4WZQ A;  4QIV A;  2YNF B;  4DV5 J;  2B4U A;  2NUH A;  4JI4 F;  3DLE A;  1NK4 A;  2XYH B;  5L1I A;  4LF8 F;  2MHN A;  4ZS6 A;  1RAO A;  1R8B A;  1SJ4 P;  4PQU B;  1Y11 A;  2OMO A;  1RCO B;  2KRR A;  3GG1 A;  4EEY A;  2W2M P;  4M8L A;  4L74 A;  1U4B A;  3D4J A;  1FXD A;  1UFK A;  2G1H A;  1HI1 A;  2NZC A;  2XMK A;  4NLR A;  5A0Y B;  3CJT A;  3KK3 B;  3SV4 A;  1KOH A;  3T1H J;  3NGR A;  3UNY A;  3FRY A;  4F4W A;  2PI4 A;  4Q45 A;  3FCV A;  4X66 F;  3B4D A;  2V2Q A;  4EGL A;  4TU8 A;  1WKL A;  1HD0 A;  1IXK A;  1R8P A;  3PW0 A;  1S1T B;  1YIJ S;  4M5J A;  2WZ1 A;  4ZIV A;  1E6Y A;  4PCQ A;  5J2N A;  1OPI A;  4Y00 A;  2RIJ A;  2XHC A;  2DGU A;  1RT3 B;  1MU2 A;  2QMX A;  3FUY A;  5ETL A;  3UN3 A;  3OXL A;  3OW2 R;  2RSQ A;  2X1B A;  2XMV A;  4K4V A;  1N5Q A;  3D2W A;  2QRR A;  4BS2 A;  4I2P B;  3ZTO A;  1LXJ A;  2ILY A;  4OYZ A;  1ARR A;  4ANC A;  1TVR A;  3SCJ E;  2DR7 A;  2LU1 A;  4M63 A;  4OJ3 A;  2AGQ A;  1EB0 A;  1RHR B;  2FHJ D;  3CD5 A;  2FVC A;  1D8Z A;  3HM9 A;  2A2D A;  3H5S A;  3DM2 B;  1N52 B;  4NL5 A;  4J9M A;  2BJ9 A;  1MNE A;  1SC6 A;  1N5S A;  5KT3 A;  2WVD A;  2WBM A;  3PG9 A;  3JS9 A;  5AXN A;  1I6J A;  4ZPA A;  3ZXW A;  2B9W A;  3DGP B;  1PAU B;  4MTP A;  3EGW B;  3PKY A;  2XS2 A;  5T7L A;  3AA8 A;  1T8E A;  3PW7 A;  4NLY A;  2MKK A;  1PYS B;  3FFI A;  2QLJ B;  4TXS A;  4Q43 A;  2QTW A;  5C25 B;  3Q24 A;  2I1R A;  1IJF B;  3CCS S;  1N34 J;  2MZS A;  1SH0 A;  1R3N A;  3ETM A;  1CC8 A;  2XZD B;  3GPA A;  1YWX A;  2CJX B;  3I5A A;  3O8W A;  4NEY A;  4OJ1 A;  1T0T V;  5D0R A;  3E01 A;  1C1C B;  2B9Y A;  3O3L A;  4ZCI A;  1NJI T;  4PWD B;  2AX1 A;  2HGM A;  4PG8 A;  4USK A;  4USU A;  1UTA A;  5D4L A;  4DG1 B;  5E3Q A;  4KV8 B;  1O6X A;  2G1D A;  2K6L A;  3GXQ A;  1H74 A;  2IHR 1;  3OBI A;  4WFX A;  5D0E A;  1XMO J;  1FK9 B;  1FI4 A;  2XM3 A;  4WKR A;  3V5R A;  2B5J A;  3MDF A;  5HMY A;  2M3D A;  4IOA Q;  3V4I B;  1X7V A;  4JI3 J;  2OI2 A;  4J9N A;  5FD1 A;  1T95 A;  1HNI A;  4USW A;  3NP5 A;  2IC3 B;  1RWV B;  1XER A;  3F44 A;  3NS6 A;  1FRI A;  3QAE A;  3RW7 A;  3HHL B;  5J1P A;  1KTV A;  2DGV A;  2RUG A;  3KLE A;  1VCT A;  2IJF A;  1OS5 A;  3G6X A;  2ADB A;  1S1U A;  2HFS A;  4NCG B;  1YHQ S;  5HRO B;  2VOP A;  3VGT A;  2YNF A;  3LOU A;  3IS9 B;  4AAI A;  5ETO A;  1TMM A;  3TWZ A;  2HMI B;  4JI0 F;  3ZZU A;  5KFI A;  3U1N A;  3QOQ A;  3FMW A;  2K1O A;  2ASL A;  4NRT A;  2CQ4 A;  2V2Z A;  1Y4Z B;  3GMG A;  4DMZ A;  1NUE A;  1ZA1 B;  2G0J A;  2E5H A;  1Q4R A;  3QFW A;  1S0V A;  2OEM A;  2GQC A;  2ZZM A;  2AY0 A;  3A3O B;  2IM3 A;  3MEG B;  5EWF A;  2XY7 A;  1L3U A;  4CDI A;  2YWH A;  4I6A A;  2ATC B;  1HR0 F;  2UXD J;  4WFY A;  1FK9 A;  1PBU A;  4P75 A;  1TP7 A;  4ZP9 A;  4HI2 A;  2Q6B A;  3D5M A;  4UOC A;  4NLW A;  1KP6 A;  3L95 X;  4LSZ B;  2NUU G;  1ZS6 A;  4UTG A;  2KFY A;  4KV8 A;  2JFD A;  3M6X A;  4FP9 A;  1AB8 A;  1J2V A;  2IYG A;  2CZ9 A;  3ET6 A;  3HF5 A;  4RU2 A;  4LF4 F;  2HVI A;  3BGF A;  2YWF A;  4DR1 F;  1HNV B;  1XK8 A;  3L3C A;  2W7A A;  4KO0 A;  1FNO A;  3PEJ A;  1RT1 B;  1U0S A;  4TN2 A;  2OSR A;  3SSS A;  3DHW C;  4LF6 J;  4OV6 A;  4OZ2 A;  5F8H A;  1CJT A;  2XLJ A;  1VQS A;  2VQF J;  2FVS A;  3HMJ G;  3G5O A;  1LWE A;  2LXF A;  4JBC A;  4DUT A;  5HMZ A;  4P9S A;  2EKY A;  5L39 A;  3VAG A;  1NKC A;  2XI3 A;  4DPY A;  1YBA A;  3GCX P;  2DNR A;  3BDE A;  3SFG A;  4DDF A;  1HA1 A;  3CC4 S;  2ZBI A;  4J37 A;  4NX9 A;  1HBU A;  3RB4 A;  3MMC A;  1DBD A;  3IWL A;  2CUY A;  1FRJ A;  3PR4 A;  1F2G A;  3MAA B;  2ZUA A;  4MKA A;  2BOA A;  3HT0 A;  1EX8 A;  2DVI A;  1RT2 B;  2YVS A;  4CI0 B;  1J5E F;  2B6A B;  5CZX A;  3R1L A;  4C8O A;  2QYG A;  2KB2 A;  5KT4 A;  2G4B A;  4B3T J;  3ILL A;  1F9F A;  3QSI A;  4OJH A;  1YBT A;  4M5D B;  4G1Q A;  1VRU A;  3W7B A;  4DPO A;  5DZ7 A;  5KG1 A;  4RLE A;  4F25 A;  5KFH A;  1NK7 A;  1S97 A;  2AWZ A;  1G2E A;  1DLO B;  3R6G B;  4MT1 A;  2GAG C;  4IFV B;  2RQK A;  2C2M B;  1S1T A;  2V34 A;  1VOM A;  2Q3P A;  3AD9 C;  5D8H B;  4RW7 B;  2BAN A;  3DCA A;  1NLK L;  3KUH A;  3OUY B;  2IIH A;  4K5S A;  2HFN A;  3I4P A;  3PFO A;  1WF0 A;  4BBY A;  5IZH A;  2ZH1 A;  5GAH U;  2FGC A;  2EG2 A;  3D3B J;  1N5T A;  3OTC A;  1NZ8 A;  1MML A;  3CSK A;  3ENW A;  5L9X A;  2CNK B;  4RPF A;  4W92 B;  2OPP B;  4Z7Y A;  5A8R A;  2OIH A;  2OKQ A;  2WHO A;  5AJ3 F;  1WC6 A;  3NLC A;  1XNQ F;  2UXC J;  1GK8 A;  2PA8 D;  3M6V A;  4PZV A;  4AXJ A;  1Q7Y T;  1FVS A;  4X4V A;  1UZH A;  1T11 A;  4DR4 J;  4E2F B;  4J9U E;  2XUL A;  4ECR A;  4IFY B;  1VQL S;  3AD8 C;  2AYE A;  4DN0 A;  1IBL J;  3OVB A;  1QAX A;  2PGC A;  4YFU A;  4A8F A;  1VC0 A;  3KXD A;  1WEY A;  1JLC A;  2IVM A;  3C14 B;  4ZP7 A;  3G71 S;  1VQ4 S;  4IRD A;  4Y2M A;  3D67 A;  4FKY A;  3MED A;  2Y9H A;  2NRE A;  3FBE A;  4FDF A;  1WI6 A;  1EKR A;  4E0D A;  2HSE B;  3DLK A;  3H42 A;  5B08 A;  3J7Z 5;  1N33 J;  3W2V B;  2WVC A;  2P8I A;  2YWE A;  4X4S A;  4WFA Q;  4CH7 A;  5L1L A;  2B3T B;  5EN1 A;  3PCO B;  2DRA A;  4DSF A;  3Q8Y A;  3EZ5 A;  1CJT B;  4Q5V A;  1GMW D;  5DM6 Q;  4C8Z A;  2UZA A;  4M5K A;  3TA0 A;  1RCX B;  1RU2 A;  3IGN A;  5L38 A;  1ZAX A;  2RD5 C;  1XNQ J;  3M8R A;  3PZP A;  4OIX A;  2J0X A;  3K8W A;  4EBD A;  1FJG J;  3LQV A;  5I3U B;  2E1A A;  3ELH A;  3MCM A;  2NLW A;  4RW6 A;  5DO2 A;  1KWM A;  3PY8 A;  3MTJ A;  5DG7 A;  1GMW A;  1RTI B;  1T9V A;  4JP8 A;  2W9C A;  2KG1 A;  3IXQ A;  1M1G A;  2K29 A;  2NSC A;  4FPR A;  3NWG A;  4PG4 A;  4Q7A A;  4OYX A;  5JXS A;  3T6J A;  5JMN A;  4XIU A;  4IOC Q;  2IPO B;  2P9C A;  4FF1 A;  2FY1 A;  1KSP A;  2DXD A;  1MYK A;  4J9R A;  4K2J A;  4DLE A;  4DL2 A;  4Q0B A;  1N33 F;  3PYE A;  3EZU A;  3ZTQ A;  4TLQ A;  1L3V A;  1TK8 A;  4YB1 P;  2MKI A;  5HLF A;  3MMA A;  1SH3 A;  8AT1 B;  3NNH A;  3CJR A;  1Q82 T;  3QO9 B;  2D9O A;  1VIS A;  1FX4 A;  2HKE A;  1ZM9 A;  2HVE A;  1TL7 B;  3A12 A;  1JLC B;  2PFD A;  3CJ8 A;  2GAH C;  3HLU A;  3SMZ A;  3WZ0 A;  4CO5 A;  3HZG A;  3TVK A;  1U1N A;  3FDS A;  3M9O B;  4JI7 F;  3FMT A;  2XS7 A;  4ME7 E;  1VRQ C;  1RAC B;  3DNC A;  3IS9 A;  4IH6 A;  4OYA A;  4OZ0 A;  3OR1 B;  5GAD U;  1U25 A;  4UZB A;  2BJE A;  1CSJ A;  3BN7 A;  1TTH B;  2QA2 A;  4IYQ A;  5ETM A;  4A8Y A;  1B3T A;  3MZI A;  4RUB A;  4V19 X;  3C66 A;  5KG3 A;  1SBR A;  2NXJ A;  4CLK A;  1XC9 A;  2QE5 A;  2HBZ B;  2U2F A;  5A8R B;  2ACY A;  3K5O A;  2HVZ A;  4JI2 F;  1R0B G;  2HQI A;  3KFW X;  3PFE A;  1SC1 B;  2IMO A;  4TY9 A;  2F9J A;  3CPW R;  3DLB A;  2NSB A;  3ENQ A;  4WXO A;  3KLH B;  3H40 A;  1L3T A;  4DS4 A;  2VON A;  3DGV A;  2IYI A;  3IR6 B;  1FFW B;  4QYR A;  1N88 A;  2Z56 B;  3OLB A;  1HBN A;  1WOP A;  4DX5 A;  2RDI A;  4N8O A;  3VAK A;  1C4A A;  2KRB A;  2HHP A;  3PYG A;  3TO8 A;  5IT4 A;  5IC6 B;  4ZPB A;  1A0O B;  2XI2 A;  4J9Q A;  4DV1 J;  1Y0H A;  2JEI A;  1S48 A;  2MGZ B;  4X64 J;  4NXN F;  1S7I A;  3CJK B;  3TX0 A;  4U8Y A;  4KHP F;  1NDL A;  4OX8 A;  2CYY A;  4HAC A;  4FXE A;  2EI5 A;  1MN7 A;  2CJY B;  4R8U A;  2J9D A;  2WCX A;  5KFM A;  4WE1 B;  3L7O A;  4WP8 A;  2AKW B;  2HK3 A;  2I38 A;  4ED0 A;  2CVE A;  3PVX A;  5LM7 E;  4DR6 J;  1HD1 A;  5JJB A;  5L1K A;  5E3C A;  1EA4 A;  1E6V B;  2MQ8 A;  3MEK A;  4DUZ F;  1M5P C;  1FD8 A;  1HQU B;  2F8E X;  1QE1 B;  2MHE A;  2O01 C;  3IBF B;  1UVK A;  3N6M A;  2ZJP Q;  3PR5 B;  3QSY B;  3IWX A;  3T5H A;  1AW0 A;  4ZK7 M;  3M8Z A;  3IMQ J;  3N0V A;  1R6Y A;  3D1O A;  3KG1 A;  1GXL A;  4I2P A;  1MG7 A;  4PWU A;  3ZZP A;  5JVG Q;  2BQU A;  4ILL A;  4A48 A;  1NB7 A;  1SVD A;  1X4G A;  5M2P A;  4DV1 F;  3AJ1 A;  2J0S D;  1UA1 A;  3W3S A;  3AOD A;  4ZJO A;  5J1E A;  2CQ2 A;  3UCZ P;  2N3L A;  5GAD I;  3UD3 P;  3T41 A;  1FJ7 A;  2B7B B;  2DNN A;  3BF4 A;  3RR8 A;  3CJ4 A;  1M5H A;  3MCN A;  2JXG A;  2GNK A;  2VV5 A;  3CDA A;  4J9K A;  2GA7 A;  2ACM A;  2KT3 A;  2VG7 A;  4J5O A;  2GFF A;  2HRY A;  4B9L A;  4FYX B;  2ZH3 A;  2CA9 A;  1BQM A;  1EP4 A;  1OG7 A;  5ETQ A;  5LSL A;  2ZFH A;  3HUL A;  4DUY F;  4KHM A;  2V63 A;  2POK A;  3BN4 A;  1CG2 A;  4H4K A;  1GMU A;  4ZCK A;  4OZ5 A;  1GXT A;  4ILR A;  3ZZR A;  9RUB A;  5K8P A;  3P96 A;  3C8Y A;  5IM0 A;  3I5B A;  4HTI A;  4F4X A;  3K5N A;  2KHD A;  4FS1 A;  4ELT A;  1H0H B;  1FDA A;  1U1R A;  1HI0 P;  3VGU A;  3MOZ A;  5EWG A;  2C2R A;  3KMS A;  3DOL B;  1TL1 B;  2JNJ A;  2HEK A;  4NCG A;  3IO1 A;  2UUB F;  2Q79 A;  4FNH A;  1PYO B;  3C15 B;  1PSD A;  3EXY A;  4IG0 B;  2EFP A;  3OR2 B;  1NXI A;  3I0S B;  3M6W A;  1BUX A;  1SH2 A;  2V4R A;  3CDB A;  5M2R A;  3KK1 A;  4NLT A;  3MFI A;  3IRX A;  3KWM A;  2HMI A;  4FF3 A;  3QFH A;  3EX7 B;  2YQ0 A;  1IKW A;  4P2X A;  1BDT A;  1EET B;  1P94 A;  3CTR A;  1G3O A;  4CZC A;  2JHE A;  2DHA A;  3Q8Q B;  4WFB Q;  2DGO A;  4ZLJ A;  2J6S A;  4B9N A;  4KY3 A;  1HWI A;  2D41 A;  3JB9 k;  4LFA F;  1YDL A;  3OL9 A;  3H2V E;  4NI2 B;  1JLA B;  2V8H A;  1JLA A;  3QLH B;  3QT7 A;  4F26 A;  3NGT A;  2Z30 B;  4YDD B;  5DDR C;  1RTZ A;  3NNA A;  3KLV A;  3P49 B;  3WHI A;  2VOO A;  2F65 A;  2YKP A;  1W26 A;  3I5C A;  4LRF A;  4NZ0 A;  2CPE A;  1IKX A;  2GVZ B;  5KG5 A;  4PUO A;  3P6Y C;  1NSP A;  2LEP A;  2OPQ A;  2GW8 A;  3EXC X;  4RNN A;  1FTR A;  2CQC A;  4QW9 A;  2ERR A;  3UN2 A;  1JXE A;  1KHW A;  4P10 A;  2BA3 A;  4LRB A;  2EFQ A;  5KOW A;  3Q8S B;  1PBA A;  3TJ8 A;  3GG0 A;  3KK1 B;  4X84 A;  2HQ3 A;  4JI4 J;  2XMJ A;  2E7X A;  1U6Z A;  1HHQ A;  1MSW D;  3VGS A;  1RSC A;  3NOC A;  1VQM S;  3J81 j;  1HWJ A;  1R7I A;  3IRW P;  2R7S A;  2BJ1 A;  1Y3J A;  3C6T B;  1R27 B;  3GON A;  3AOC A;  2D3U A;  4C11 A;  3V6D A;  2FVR A;  1AUS L;  4ANE A;  3PHT A;  4S0M A;  5C24 A;  1T7P A;  4DFJ A;  2OJ3 A;  2R8I A;  3M9N B;  1WJ9 A;  3ZC4 A;  2C3Y A;  2GHP A;  5IM0 B;  2F63 A;  1RAA B;  4F3O A;  2YWW A;  2C2E A;  2YBV A;  4F36 A;  1JKH A;  3LW5 C;  3TR5 A;  4IH5 A;  4RNM A;  1SC3 B;  4DLG A;  3PYD A;  1QTG A;  2KI2 A;  2JEF A;  2WVF A;  1VIX A;  5D3G B;  1VHF A;  4LRV A;  2BW2 A;  3GV7 B;  2RAQ A;  3M32 B;  4XAK A;  5C2G A;  1UVM A;  5IOL A;  1RP5 A;  3NY0 A;  3BM7 A;  4DSL A;  4KHP J;  3CCQ S;  2KYZ A;  4HT5 A;  1S1X A;  3UCG A;  2MJN A;  3JQK A;  1NRK A;  2QV6 A;  3SXL A;  5CYM B;  4ZLL A;  2KVQ E;  1EET A;  1UCN A;  2MTL A;  3OXG A;  3KYL A;  3RBE A;  2GJ2 A;  4CNZ A;  2R7W A;  4M5I A;  1YJ9 S;  3P5T L;  4NLS A;  4XDD A;  1MNT A;  3AAW B;  1BQN A;  2BX6 A;  1JMT A;  3JSM A;  1CC7 A;  4HYK A;  3RB6 A;  3C2P A;  5ADZ A;  2LQ9 A;  4CLW A;  2KXF A;  2V2K A;  3CUL A;  1I3O B;  3EWG A;  9ATC B;  3EYZ A;  3RTV A;  1KLN A;  4B3R J;  5KFP A;  3THT A;  3ZZZ A;  3UD5 A;  3I0S A;  1SCJ B;  4DR5 F;  4YUD A;  1T02 A;  3LP2 A;  4P74 A;  3RBZ A;  3FEY B;  3MED B;  4FNI A;  2EK6 A;  1FTC A;  1NH7 A;  4ED4 A;  4YB7 A;  2EVZ A;  1LOU A;  5EHH A;  4I7F A;  1KFD A;  3I96 A;  4HR2 A;  2OGU A;  1TKZ A;  3ZTR A;  4C3M A;  4ENO A;  5B0D A;  2ZH5 A;  2ZWP A;  1LK7 A;  2QSF A;  5D78 A;  4LF7 J;  1FKA F;  4K0K F;  1QSL A;  1UEK A;  2K3I A;  2DIV A;  5F8I A;  3OFE A;  5AJ3 J;  3MUT P;  2JSX A;  4NXM J;  1T9W A;  2HRT A;  5HAO A;  1ZA2 B;  3LP1 B;  1KN6 A;  2IBO A;  1Q8K A;  4DI6 A;  2AV5 A;  3OTE A;  1NK5 A;  1FFG B;  4ZMM A;  5KFY A;  2W2O P;  1EP4 B;  2ZH4 A;  2KFN A;  2RS2 A;  1NSK L;  1FD2 A;  5CAA A;  5KFU A;  2RKI A;  4WP9 A;  4RUA A;  2YNH A;  3J7Z T;  3W9H A;  4CO4 A;  3W9I A;  3MPY A;  5CH7 B;  1DTT A;  4RW7 A;  1OQ3 A;  3TUZ C;  1REV B;  5KT5 A;  1UAW A;  4K4Z A;  5KFF A;  2MXY A;  3TI0 A;  1JJ4 A;  3H5X A;  1R6V A;  2VC1 A;  4RWX A;  3QZ7 A;  5E33 A;  4A8O A;  1AXQ A;  1Q8B A;  1WG1 A;  3H0P A;  4OI2 A;  4ZVS B;  5KT2 A;  2DH9 A;  3OHA A;  1KFS A;  1PGZ A;  2MSS A;  4F4A A;  5F8L A;  3TAN A;  3M4X A;  1RZM A;  2H1O E;  1ZAW A;  3U1L A;  1P9Q C;  2FLL A;  2NZ4 A;  1BHN A;  2H65 B;  2J7W A;  3PDN A;  1N6Q A;  4B3M J;  1OWX A;  1YX2 A;  3GFX A;  4F0M A;  4AYB D;  4B9M A;  4F3M A;  2E9Z A;  2WAQ D;  5I3Q A;  2OUG A;  4MK8 A;  2RF2 A;  1QLN A;  4K5R A;  1N8R T;  5ETP A;  2PE8 A;  4DR5 J;  1U1L A;  1VQ5 S;  1VQN S;  2ASD A;  2XBP A;  2FY8 A;  3MR2 A;  2D3O 1;  4DJB A;  2AU0 A;  2C1E B;  3H2U B;  3HSZ A;  5C42 B;  2XYP B;  5ETR A;  3RBD A;  4F4K A;  4PUO B;  1HBO B;  3HVT B;  2FPH X;  3D0H E;  3Q8R B;  3VHQ A;  1FXR A;  4ZN3 A;  3TJ9 A;  1TKX A;  1QAJ A;  1TAQ A;  3NWR A;  2GZO A;  4HAC B;  3EMT A;  2D9P A;  1UFL A;  1X4C A;  2MGZ A;  3TUP A;  2WON A;  2GHV C;  2CKW A;  2E5I A;  2B8Q A;  2R8J A;  2JJ4 D;  2M0G B;  5CYJ A;  1RTI A;  2W9C B;  1B0T A;  3B78 A;  1N34 F;  1UMJ A;  2ZWO A;  3G8S A;  5BYQ A;  3VZI A;  4L75 A;  2R42 A;  1U1K A;  1ZBT A;  3IAS 9;  2MKY A;  3I32 A;  5KFO A;  2JXH A;  2Z8Q A;  5KFA A;  3KLH A;  4DV4 F;  1WEZ A;  3M30 B;  3ITH A;  2E5L F;  4LQ9 A;  1SQF A;  3HVR A;  2PA3 A;  3N9U C;  2JC0 A;  3M2R A;  4WXW A;  1L5U A;  3A8K A;  1J5O B;  1VBK A;  4FKX A;  5K8M A;  2WTF A;  4J9O A;  3W2V A;  3OL7 A;  2K9I A;  4DUZ J;  2ZOM A;  3N4W A;  2YPZ A;  1KHV A;  1AFI A;  5EX0 A;  3D6M B;  3QT8 A;  2BW7 A;  4G6V B;  4CM2 A;  5C7P A;  4JI0 J;  4HI1 A;  2COL A;  5A6P A;  1B0P A;  4LJM A;  2R2U A;  4JV5 J;  1Y5L B;  2DNP A;  2FJX A;  3OR1 A;  4MIB A;  4NLV A;  5HBM B;  4EWT A;  1SL1 A;  1XIQ A;  3FSY A;  3BGR B;  4PXD A;  4AUK A;  2MKS A;  2RS8 A;  2W4P A;  4ZVP B;  4YB5 A;  5HJY A;  2BKN A;  3POT B;  4WYW A;  3WC2 A;  2CAJ A;  2RH3 A;  4JB8 B;  1PIE A;  3MEE A;  3J7A 1;  4PG7 A;  2CQ0 A;  3DOM A;  4J91 A;  4KHR A;  4YY3 F;  4DV7 F;  1P1T A;  2R7R A;  2IC3 A;  1HBM A;  4PRF A;  5LJ5 Y;  1N0U A;  3G6Y A;  4ED7 A;  1JLB A;  4N41 A;  4MMO A;  4DSJ A;  1F5C A;  3ULH A;  3T1H F;  1VGY A;  4LFC F;  4FPI A;  2H4W B;  4DUY J;  1M5S A;  4WP3 A;  3VQT A;  3RW6 A;  2E29 A;  1JQG A;  1ZM3 A;  3D6F B;  4ICL A;  2AF6 A;  2QJ3 A;  5ETK A;  5IC4 B;  3MEC A;  2XQC A;  2AIR B;  3BBB A;  5A6W A;  3J7Y I;  2BE2 A;  2K06 A;  4ECT A;  1DLO A;  2MZT A;  4X62 J;  2VBX A;  3ENV A;  1WHW A;  1MN9 A;  4LF8 J;  2OLW A;  4DR2 F;  5GMK a;  3E01 B;  2MKC A;  1IBC B;  4W4M A;  4ZVQ B;  3KOA A;  4DR7 J;  3NAH A;  3FGV A;  5A8W A;  1V9O A;  3H4B A;  3G4S S;  3KJV B;  1VDH A;  4PXB A;  3HJF A;  1GMV A;  2MKH A;  2WOM B;  2V8G A;  4LVN P;  1NO8 A;  5KG7 A;  3J81 Y;  1O51 A;  4RW8 B;  5GME A;  5H9F J;  2XTJ P;  2W9A A;  4B9U A;  3SDE A;  2I5J A;  4OQJ A;  5CAB A;  3N5F A;  5GMD A;  2XO7 A;  1SJ3 P;  4OZN A;  2FJD B;  2WVE A;  3ISN C;  1QE1 A;  3T9Z A;  3D9B A;  4KB7 A;  2CZ4 A;  3WX4 A;  1JLF A;  2KO1 A;  2BM0 A;  3EVO A;  2VA3 A;  2YKN A;  1OO0 B;  3DM2 A;  3FT7 A;  3B82 A;  3JSY A;  4K59 A;  4RNO A;  4UQG A;  1VQ7 S;  1LWF B;  3S6E A;  1Y3K A;  3O6Q A;  2GJI A;  2OAU A;  3W64 A;  1H7W A;  2EC0 A;  1PKU A;  4YDX A;  1Z2L A;  1T9X A;  1KON A;  1T03 A;  4X65 J;  4EBC A;  1C0T A;  1S59 A;  2DGQ A;  3BPD A;  4DZ6 A;  2K2P A;  4WZM A;  1GQE A;  3UN5 A;  1JJC B;  3DOK B;  2DJW A;  3JQM A;  3P8B B;  4RKU C;  5KFD A;  5KT6 A;  3KG4 A;  4RR5 A;  2CQH A;  1IJE B;  3CMQ A;  3WBZ A;  4ZHR A;  3M8Y A;  3PYF A;  3CJ0 A;  3RUB L;  2GPE A;  5K8O A;  2GX8 A;  3GV5 B;  2XY5 A;  3K2Y A;  2G0C A;  1R0A A;  3QAU A;  2CJK A;  1VBY A;  3MM9 A;  2XO6 A;  2F7V A;  1JB0 C;  2LYV A;  4C48 A;  3OXF A;  2YNH B;  1TL4 A;  3CCM S;  1NME B;  1SUQ A;  1C4C A;  2DYA A;  2QX0 A;  3NCQ A;  5J2Q A;  1VBZ A;  4BHQ A;  5I42 B;  4ED1 A;  5DGA A;  2R8K A;  1WKJ A;  2DPJ A;  2XLI A;  2J9D E;  4HH0 A;  1FDD A;  4ZVU B;  3NAI A;  2BQ3 A;  2NPI A;  3FJ2 A;  4IKA A;  2VHG A;  4ECZ A;  3B54 A;  2OD6 A;  3OFH A;  4PQA A;  1NBE B;  4MYU A;  2KH9 A;  1F9E B;  1RQ0 A;  2J0W A;  1RT2 A;  2QIF A;  4CTA B;  4FYW B;  3LP0 B;  1O8B A;  3POT A;  4MJK A;  1QTM A;  1HYS A;  1PIL A;  1DTQ B;  4I7F B;  4N8N A;  4UQT A;  3SSR A;  2RJZ A;  5FDL B;  2DGX A;  4CLU A;  1YG0 A;  3ADA C;  1WEL A;  2KHC A;  5ETT A;  4YP3 A;  3PW4 A;  3PX6 A;  4KR0 B;  1XR7 A;  2DNL A;  2A2B A;  3QO9 A;  5HVH A;  1A9N B;  2D7S A;  3MMA B;  2BEF A;  3RU0 A;  3BBC A;  1NDP A;  2ASY A;  3QID A;  3FQL A;  5G0R A;  3H59 A;  5HVF A;  5AE1 A;  2UVV A;  4YME A;  4UST A;  4NRU A;  1T05 A;  3T3F A;  1IWA A;  2GGP B;  1EQ0 A;  3DRP B;  2JVO A;  1ZZF A;  2F8H A;  4RL1 A;  2HHU A;  1LWE B;  3BO2 A;  2B5J B;  1YKW A;  1GNK A;  2VC0 A;  1ULR A;  1P6T A;  1GEH A;  1FWP A;  2G9O A;  3NEK A;  4OYM A;  5KFV A;  3LAM A;  3HKW A;  4WK1 A;  5CYQ B;  2VU5 A;  1IBM F;  5FJ4 A;  1QDU B;  3VVT A;  3ITH B;  4I0W A;  2CPI A;  2AEM A;  4KO0 B;  4X4N A;  5AE3 A;  1DJ0 A;  3K5L A;  1CJV A;  4FYY B;  3C46 A;  1AA1 B;  1F5B A;  4AD6 A;  1YVF A;  1TKD A;  2YNG A;  1N5V A;  4FVC A;  5EGY A;  3NBP B;  1I94 F;  3G87 A;  3NL0 A;  3MM7 A;  2GVD A;  2N4D A;  5IQ6 A;  4Y28 C;  1KLM B;  3EGZ A;  1TZ0 A;  2XG8 A;  2GIF A;  3UR0 A;  3VV2 B;  3DLJ A;  3IGV A;  3NGK A;  4FXW A;  3MD1 A;  3NNE A;  4PG6 A;  3CB4 A;  5CYQ A;  4LF7 F;  2ZNZ A;  2AN7 A;  1RAG B;  1IN0 A;  2H54 B;  4R0E A;  3TA1 A;  2XC9 A;  1U6B A;  4QBU A;  2Y1L B;  4FF2 A;  1IWG A;  1R8C A;  4JUZ A;  2R7T A;  2R8H A;  2UVR A;  4ID8 A;  2IDL A;  3W60 A;  2YX4 A;  3IN5 A;  1NPP A;  4B3S F;  4G1I A;  1RDR A;  2W1B A;  1SJQ A;  1U2C A;  1VK8 A;  3BGO P;  1WD6 A;  2V6A A;  4Y2A A;  3Q8V A;  2MQP A;  1ARQ A;  2QN6 B;  2M52 A;  1NHV A;  2VG6 A;  3OTO J;  1FRK A;  1LKZ A;  2CVI A;  3GJS B;  3O5T B;  2G2O A;  1DRZ A;  3K89 A;  5AXL A;  2VQF F;  1Q1K A;  3SCK E;  4CNY A;  1WC1 A;  1H2V Z;  4ZN1 A;  3E8O A;  2CQ1 A;  1R43 A;  2ZDP A;  4PXE A;  4ED5 A;  2AX0 A;  1Q16 B;  4NZ7 A;  1S49 A;  1RKI A;  1RHJ B;  4MKB A;  4WWS A;  4EMD A;  2EFV A;  4KBI A;  4ILM A;  2HZV A;  2R2T A;  1YRX A;  1DFD A;  2JBV A;  1WDT A;  3IP0 A;  1S72 S;  1NKB A;  4RJV A;  4PYD A;  4B17 A;  3NCP A;  4KTQ A;  3MOJ B;  1KVI A;  3G8T A;  2HQF A;  1RWX B;  3UNG C;  6FDR A;  4NAS A;  3KK2 A;  1SJ1 A;  4NEZ A;  1D3W A;  2YQ3 A;  3SZ2 A;  1HR0 J;  3TEG A;  4ZPD A;  1GT8 A;  3CIM A;  3MM9 B;  4AL5 A;  3ZFV A;  2BNZ A;  2MST A;  3L7U A;  1SKW A;  5CXT A;  2IAJ B;  4LIW A;  4QR2 A;  4YQW A;  2CPF A;  5D77 A;  4W90 B;  3ONQ A;  2JVR A;  2M5Y A;  3J80 Y;  2UVU A;  2R7X A;  2E66 A;  7FD1 A;  4BC9 A;  3KHR A;  3PKM A;  1XNR J;  4I56 A;  1WEX A;  3AT1 B;  3GFY A;  2FC8 A;  4ZA1 A;  3LWL A;  2DNG A;  2CAD A;  1LEO A;  2X51 A;  3G2X A;  3DLE B;  4J7C A;  3MI7 X;  2V8P A;  4NYZ A;  2P9E A;  4P71 A;  4WKY A;  5K8N A;  3CCE S;  1XQI A;  3IBC B;  3NGS A;  3MAA A;  5HP1 A;  4ELV A;  2QGF B;  2HHT A;  2BE7 D;  2U1A A;  2JH3 A;  3R5B A;  4Y34 A;  2W24 A;  4C8N A;  1LWX A;  3THV A;  5KFC A;  1RWN B;  2WK4 A;  1X4D A;  1Y5N B;  3NKY A;  1APS A;  5BJR A;  1VQ8 S;  1JLF B;  1J27 A;  2ZDO A;  3SQO P;  2EK1 A;  4ER8 A;  2QSW A;  2BV3 A;  3E2E A;  1S4E A;  2UUT A;  2L3M A;  3G6E S;  3NNC A;  3IR7 A;  2PMH A;  4X4R A;  1AZS A;  3SDE B;  4IG3 A;  4USV A;  2PII A;  2IDE A;  4OHY A;  4QWA A;  1Q86 T;  1FES A;  1OYE A;  1X0P A;  5F0W A;  5A8W B;  4URS A;  4LF6 F;  2DEI A;  3MM5 A;  1FEH A;  5H9E J;  4B02 A;  2KKE A;  1LNQ A;  1HQ2 A;  2CQD A;  2FC9 A;  1S1X B;  1S6P A;  3JXO A;  5K5M A;  1YIT S;  4DR4 F;  1N36 J;  2HZA A;  1JK9 B;  1PG5 B;  1C1B A;  4TU9 A;  3PRV A;  2LKZ A;  1NEE A;  4OJG A;  3TAM A;  1UPM B;  4ICL B;  1VC5 A;  4ZVH A;  3I56 S;  2YQ1 A;  2A18 A;  4B9V A;  2RRA A;  1K73 T;  3W9J A;  3KNG A;  3Q0A A;  3DRP A;  1R8A A;  2MZR A;  1T9T A;  3CXC R;  2ZJR Q;  3T6B A;  4B3O B;  2V4J A;  1UJ4 A;  1S6Q A;  3M8Q B;  1FHT A;  4OFZ A;  3LAL A;  4IQM A;  4NLQ A;  3KLI A;  1HNX F;  2D69 A;  2GIQ A;  3AOA A;  5E7O B;  4BWJ A;  4LRE A;  1B99 A;  4ECW A;  2LQJ A;  3M6U A;  4CYU A;  4DPT A;  4K2X A;  3LJP A;  2JEG A;  2XZT B;  3DLG B;  4DL0 C;  4DQI A;  4NLG A;  4C3L A;  1MMD A;  2PD1 A;  2PI5 A;  4KGV B;  2BM1 A;  4R5P B;  3JSB A;  2YWG A;  4F0K A;  2NYI A;  2FHK A;  3BQ2 A;  4M5L A;  1HW8 A;  4CLL A;  4C8M A;  2DR5 A;  1FA0 A;  2CQI A;  3TUJ C;  1FE0 A;  2EEY A;  2QA1 A;  2N7Y A;  4N7T A;  1Z1Z A;  2AYG A;  1RTH A;  2FDN A;  3G82 B;  2CQ3 A;  1JLG A;  3D7S B;  4IR1 A;  2GMJ A;  3BKT A;  1D1U A;  1VRT A;  1Q8I A;  1SC4 B;  1V5I B;  3QIP B;  3MPU B;  3CMA S;  4DV0 J;  1X60 A;  4ETZ A;  2FZC B;  2DT9 A;  3H98 A;  4HHJ A;  5T14 A;  3CCW A;  1YTY A;  4NA3 A;  2HS0 A;  2P5V A;  3QGP A;  3QYY A;  1N48 A;  3GYN A;  5LJ3 Y;  2RT3 A;  1PJ5 A;  1X4H A;  2B56 A;  2HNZ A;  2QC3 A;  3C6U A;  4MAK A;  4EO8 A;  4A8S A;  1YRT A;  1XNR F;  2KVI A;  2V5H G;  3S7R A;  2SXL A;  3OTD A;  4C0O C;  5HAN A;  2VFS A;  1NKE A;  4F2R A;  4MJW A;  2JFK A;  1SXL A;  1RGV A;  4ZKA A;  1D9F A;  3A8I A;  1UL3 A;  3QMQ A;  4C6A A;  2L41 A;  1DQ8 A;  4RW4 B;  3V4M A;  4OLO A;  5A2Q U;  4LFB F;  2A3J A;  4C97 A;  2Z2Y B;  3QAT A;  4Y2C A;  1WNE A;  2BBE A;  3JSR A;  3PO5 A;  2VPZ B;  2YKM B;  4P2S A;  3ZZ0 A;  4DV2 J;  3RB0 A;  1X9W A;  5K9F A;  3GJQ B;  2LXI A;  2LFV A;  3H5Y A;  1RT4 B;  1N6Q B;  1KD1 T;  3FNN A;  2BJ7 A;  2DHS A;  1FVQ A;  2CRL A;  2ZOF A;  1NJW A;  1UVI A;  1RU1 A;  5HQ8 A;  4MYT A;  2E1R A;  2V4Q A;  2RIL A;  3K7R A;  1QAI A;  4KT0 C;  1W2I A;  2ZC4 A;  3ISZ A;  2VB6 A;  2B4V A;  4AND A;  4X4O A;  5JVH Q;  1PYT A;  2DHG A;  2VZ9 A;  2KM8 B;  4KJI A;  2HVD A;  4Q2L A;  1ACM B;  1X8D A;  2FJA B;  2CWX A;  3JYT B;  2IA6 A;  2UUW A;  3FZB A;  3ZZT A;  4CLZ A;  3NO7 A;  2LCW A;  2C42 A;  1GXU A;  3TAP A;  1TL3 B;  1AUD A;  3BDP A;  1WC5 A;  2Q43 A;  3R7B B;  4P7T A;  1ZM2 A;  4JI3 F;  5LT5 A;  2HHH F;  3WIU A;  2X7I A;  1YK9 A;  4CM0 A;  4N76 A;  4DN9 A;  2M88 A;  3AB4 B;  1UKU A;  5F8J A;  1HBM B;  1HMV A;  2HIY A;  4M5H A;  2QA4 G;  5IT9 Y;  2GQ2 A;  1MW7 A;  5I3P A;  4H54 A;  3AHP A;  4ERD A;  1URN A;  3KTQ A;  4KKO B;  3CDE A;  1SKS A;  3NXZ A;  1XMQ F;  2G2Z A;  5GAH I;  4I6W A;  3GIL A;  1TEL A;  1O0P A;  5HBM A;  2IRY A;  3MM5 B;  3VZH A;  5DLF A;  3RG6 A;  3OFF A;  3Q89 A;  2KJW A;  2QFI A;  2IY5 B;  3D3C J;  3Q2S C;  2VPW B;  3D6H B;  3F56 A;  1BE4 A;  4YB6 A;  4X65 F;  3BYP A;  3EVW A;  4KPC A;  3G6V A;  2KKH A;  2I8E A;  3RJM B;  4AT1 B;  4OX7 A;  1N5Y B;  2M8D B;  2VBZ A;  3CWJ A;  4D3H A;  2VPY B;  3QWU A;  4ZP8 A;  4A8Q A;  3ISN D;  3MHY A;  1TFW A;  4LR8 A;  2QT7 A;  4DQR A;  1HNZ J;  1BMQ B;  3C14 A;  5CYM A;  3AJD A;  5HQM A;  1JLE B;  1LFP A;  2EPI A;  1PAR A;  2EFO A;  4IFY A;  1R8H A;  5FLX U;  1FXL A;  2F40 A;  3CJK A;  3IM9 A;  2XSJ B;  4IOB A;  3M32 A;  2B43 A;  2YNI A;  2DEJ A;  3NGD A;  4DSK A;  3UCU P;  1I51 B;  3UPF A;  1FJG F;  3OT9 A;  4RBV A;  2FYX A;  2RB7 A;  3K5M A;  3M1V A;  1NM2 A;  2CWK A;  2RU3 A;  2MQL A;  1ZZN A;  3GE9 A;  2VFT A;  4WBF A;  2HUR A;  1OY9 A;  4CO2 A;  1Q5V A;  5LMN F;  2MQN A;  4UW2 A;  4FF4 A;  2HLU A;  4U7U K;  1CEZ A;  4MKY A;  1D09 B;  2B9E A;  2W9B A;  4USI A;  5ETN A;  4DQQ A;  1GX5 A;  2XNR A;  4IDK B;  3V6D B;  5GAE I;  1PC5 A;  2OO4 A;  3PV8 A;  4U7U D;  1CQM A;  1LXN A;  4CLF A;  3M2U A;  2DK2 A;  4CRJ A;  1RT7 A;  2W4D A;  3CE8 A;  4P52 A;  4JI6 F;  4N56 A;  2PDA A;  2ATL A;  1M0S A;  2ZHO A;  3S1T A;  3AQP A;  1X4E A;  3VAI A;  3Q2T C;  4QIW D;  1S6U A;  1WI8 A;  2CQB A;  2PN6 A;  5E3P A;  3KHH A;  2LA4 A;  1HNX J;  2VAS A;  3K0J A;  3HO1 A;  1RHQ B;  2PSZ A;  4W98 A;  4O44 A;  4YN3 B;  1UEU A;  4DX7 A;  4DV2 F;  3GP9 A;  2BSQ E;  3VVU A;  1Y00 A;  5F3T A;  3SSQ A;  1OYD A;  3CJQ A;  3M7V A;  3FVY A;  2J6U A;  3J7A N;  4YR3 A;  2FHM A;  2FHJ A;  4DHV A;  5DLG A;  3V6H A;  3FK4 A;  2HQG A;  3ICL A;  2MLY A;  2YX1 A;  2ABY A;  2MQQ A;  4GC6 A;  2XWY A;  5IFM A;  1URR A;  2WB4 A;  2HS3 A;  2HQC A;  2F9D A;  2HQD A;  3LP1 A;  3QLH A;  5EWE A;  4YHH F;  2IM1 A;  3D0I E;  1IUJ A;  1X31 C;  4NI2 A;  3K5P A;  5GVQ A;  3OLA A;  1N36 F;  3NRB A;  2GVD B;  4P72 A;  1IM4 A;  2RQM A;  3GSI A;  4OX9 F;  1JLE A;  1WG5 A;  3CCL S;  2VQE F;  1IKV A;  4OHZ A;  5U47 A;  4C8K A;  3UQS A;  2NPF A;  2AHO B;  2KZZ A;  4G1P A;  4OZJ A;  3W65 A;  1S0O A;  3TZX A;  3UD4 P;  1HNW F;  3BV8 A;  1J5E J;  4TY8 A;  4LFC J;  2C2D A;  1OPZ A;  3LP2 B;  3R5D A;  3VAF A;  4OYI A;  1V3R A;  3Q8P B;  1HL6 A;  4KAI A;  2A0F B;  2WB1 D;  3FCH A;  4OI1 A;  3E51 A;  3ZTP A;  4DOZ A;  2HRU A;  2PEB A;  2A6M A;  2WW4 A;  3BZQ A;  4JI8 F;  1VQK S;  5K14 A;  5IXU A;  5EDW A;  1OJ4 A;  3BEG B;  2AQ4 A;  1EAR A;  1FE4 A;  4ED3 A;  1YBU A;  1QD1 A;  3DOL A;  3NMA A;  2M9K A;  3OQ2 A;  2ZD1 A;  1W2B R;  3OFG A;  3MM6 A;  1KQS R;  4UY8 5;  3LP0 A;  4WFN Q;  5HRO A;  2M8H A;  4O23 A;  1W25 A;  2F1F A;  4O3N A;  5BYS A;  2N4C A;  4TYB A;  1GTE A;  3HHL A;  2RBF A;  1F9H A;  4CH1 A;  4EYI B;  2WRM A;  1YJT A;  2MZJ A;  2Y1I A;  2UU9 F;  1QVF R;  4PXC A;  3W63 A;  3RBX A;  2RQC A;  2QEX S;  1ZH5 A;  5AT1 B;  1X4A A;  1ZPW X;  3BGU A;  4ES1 A;  2L9D A;  5C2C A;  7FDR A;  3OHB A;  2W2Q P;  4BC7 A;  3H90 A;  3RGI A;  2QO3 A;  2ZE2 A;  4N47 A;  1YJV A;  3TAM B;  4A8W A;  1KC8 T;  3QT5 A;  3KK2 B;  1MWZ A;  3VGV A;  1FRX A;  3I0R B;  4IFV A;  1S6P B;  4P2F A;  2BJ3 A;  2OFG X;  4RU9 A;  2IJR A;  4KGX B;  1VQ9 S;  3U7J A;  1LWC A;  2C3M A;  3CO9 A;  2DY1 A;  5KFR A;  4KH1 B;  4M5D A;  4U8V A;  3FCW A;  3W1Y C;  3UVJ B;  4EI2 A;  5KFW A;  4XPC A;  3GIJ A;  1YJN S;  1DQA A;  1CS4 B;  1UEV A;  2ZBR A;  5CQG A;  2MQO A;  1WTB A;  2JX2 A;  3FFI B;  1F3V A;  4FVM A;  1VK3 A;  4E98 A;  8RUC A;  1T9Y A;  1ELO A;  2V94 A;  4ED8 A;  5DJB A;  4AXI A;  2IRX A;  1OY6 A;  3H8Y A;  4Z7C A;  3R9L A;  5IWA F;  3HSD A;  4CLY A;  1FJC A;  2ADL A;  3DU5 A;  4CIO A;  2EBG A;  1M90 T;  2H5I B;  2XS5 A;  4RW4 A;  2X1A A;  1YJU A;  1FNX H;  4OLP A;  3CUN A;  2K8G A;  4DPX A;  3HPO A;  3R1H A;  2XHW A;  1NDK A;  3MCO A;  4O3S A;  1HFE L;  1U26 A;  3AOB A;  2XZW A;  2I2Y A;  5A2Q Y;  3I4H X;  3EIC A;  3DHX A;  1SIZ A;  2KU7 A;  2E44 A;  1S79 A;  3AA9 A;  1KLM A;  3TZW A;  3ZZO A;  3PX4 A;  2X1F A;  4ZVG A;  1S12 A;  3D54 A;  3TVY A;  2H51 B;  3NS5 A;  4JYA J;  2OP5 A;  5F3Z A;  2YNG B;  3GB0 A;  1IQZ A;  3MM8 A;  3L9Z A;  1NZA A;  2W7O A;  2V68 A;  4CQ1 A;  5HSP A;  1S9G A;  3DN9 A;  2CG4 A;  1KDN A;  4KFB B;  4HTJ A;  4F7V A;  1NU4 A;  1YSJ A;  2YKQ A;  4QR1 A;  2XCP A;  1RTH B;  1F1B B;  3AQO A;  4FS2 A;  2N7C A;  2UV8 A;  1JX4 A;  2PEH A;  2H1Y A;  1SKR A;  1ZYQ A;  2HGL A;  2DY9 A;  4ZVE A;  4DSE A;  1WC4 A;  5BXI A;  5L8R C;  2FQQ B;  3G8Q A;  1YI2 S;  4XPE A;  4OHW A;  3HP6 A;  1XN9 A;  3H4D A;  1NJY A;  2J8S A;  2HBQ B;  3BQ0 A;  1WDD A;  2W8K A;  2DHH A;  2FLO A;  3SQG A;  2IFX A;  1QSY A;  3BGR A;  2VJU A;  1NAQ A;  3L4B C;  4KIA A;  2W01 A;  2HPU A;  4KGM A;  3K58 A;  5LMU J;  4QCL A;  2BKP A;  1HWK A;  4GO5 X;  1N4L A;  3DI6 A;  3OTO F;  3B8H A;  2FZK B;  1R31 A;  2CPH A;  2J8A A;  3FBC A;  1VQ6 S;  4I4B A;  2KYX A;  4M1K A;  4ECV A;  4KGZ B;  4B3O A;  1IKY A;  5DM7 Q;  4HKQ A;  1KR4 A;  2FTR A;  1RAD B;  3ILI A;  4HHU A;  5LMN J;  3EPG A;  1RE1 B;  2NYH A;  4J9L A;  4PYA A;  4X66 J;  2JLF A;  2BVZ A;  1HWL A;  2BUN A;  3P3D A;  4DU8 A;  2FLP A;  3IM8 A;  1XJW B;  5E2Q A;  2VH7 A;  3S01 A;  3MUV P;  3PO4 A;  2X3G A;  3TYT A;  3NBP A;  3Q83 A;  1K1Q A;  4RNH A;  2E9R X;  1TL5 A;  2ZZT A;  3MMJ A;  1I94 J;  3VW4 A;  3QGG A;  2DGS A;  2A6O A;  2EG1 A;  4B9S A;  2WON B;  4V1A k;  1RA6 A;  4DR3 J;  1TUV A;  1RXO B;  4DV5 F;  3LH2 S;  2DB1 A;  5IQQ A;  4U7C A;  2HFU A;  4USJ C;  5T7L B;  1JXL A;  3EGV A;  3R5J B;  2KN4 A;  3O44 A;  3CCU S;  1HBO A;  1ZAV A;  3HVT A;  3T5K A;  1FT8 A;  2UP1 A;  1LWF A;  3TJA A;  3DGP A;  1HQU A;  2AGP A;  3KUE A;  2EBE A;  1SPB P;  3R8Y A;  4ITS A;  2YKN B;  2Y1J A;  1SV5 B;  5B0E A;  2IRU A;  3DYA A;  1FX2 A;  4LR7 A;  2OH2 A;  1NK8 A;  1CPZ A;  1B70 B;  2B9X A;  4C8L A;  1JLQ B;  1ROF A;  1DQ9 A;  2GMH A;  2LXU A;  4QWE A;  4DL7 A;  2E5L J;  4LFB J;  4QOT A;  4RW8 A;  3HCX A;  3LGN A;  1FO1 A;  1D9A A;  1X5T A;  1NPR A;  2CDQ A;  3GWC A;  5KG0 A;  4C2M A;  1RT6 A;  4ZCL A;  4O0I A;  1P1L A;  1JJ2 R;  4DR2 J;  1G1X A;  1DUR A;  1FWL A;  2Z0G A;  3UVJ A;  1KEK A;  1RT3 A;  2GO9 A;  4IDK A;  2DHX A;  1TV6 A;  1MMN A;  1WHX A;  2IM0 A;  4HT7 A;  2IAJ A;  3J7Y U;  2VBY A;  3RRK A;  5E41 A;  1SJR A;  4YR0 A;  5DZ6 A;  2N3O A;  5KFN A;  4B3S J;  2HBY B;  4G3I A;  3QZ8 A;  1U7L A;  2ZE2 B;  2M2B A;  2ZM6 F;  1VQP S;  2RKI B;  1EIY B;  2HFZ A;  3N28 A;  5DDP C;  1QSS A;  2DRB A;  5CA5 A;  3N5B A;  4GO7 X;  4GVB A;  1WHY A;  5KFB A;  4LVO P;  2R2S A;  4ZHR B;  2UUA F;  2DXE A;  3F73 A;  2K5J A;  1PJ6 A;  1RT5 A;  4DPW A;  2O3D A;  1RT6 B;  1YGY A;  1KBR A;  2MZQ A;  1S99 A;  4G65 A;  5A8K A;  3PM9 A;  2DR6 A;  2IMW P;  2APO A;  2B4O A;  4Y3C A;  2KTQ A;  1RAI B;  3W62 A;  5DG8 A;  1MYL A;  3EE3 A;  3D68 A;  4RO0 A;  4K8R A;  5D6G A;  1BWE A;  4OYP A;  1GTH A;  2R7V A;  4NOH A;  1SL0 A;  2Y3Y A;  3FEX B;  1LW2 A;  1FJE B;  3RRH A;  4ED6 A;  4DCP B;  1N5Y A;  2L9N A;  3VQS A;  2NR0 A;  1OHN A;  3I6P A;  3BJY A;  4XTT A;  2UVW A;  4JI5 J;  5HMX A;  1TKT B;  3G86 A;  4K7Q A;  1AT1 B;  4F04 B;  2CJ9 A;  2CPX A;  2MMY A;  4ELU A;  3TAQ A;  1WOO A;  4X4P A;  4NMX A;  4NXM F;  1BGX T;  1Y5I B;  4IRK A;  1HNZ F;  2HZC A;  1OIA A;  3R27 A;  5J2P A;  4L3K A;  4F50 A;  4F2S A;  1U0H B;  4WYL A;  5J2P B;  3OJU A;  1HW9 A;  4ZVT B;  1U2R A;  1R0C B;  2Z2M A;  4HVZ A;  1I5O B;  4OYW A;  1DY3 A;  3ETO A;  3LO3 A;  2M70 A;  4WTY A;  3GZ7 A;  4EUV A;  3V81 B;  2M4M A;  5CD4 A;  1TR0 A;  3PJW A;  3TUI C;  3FSI A;  1WKK A;  3FC9 A;  1HMV B;  2VDI A;  2XYG B;  2C2Z B;  2XSF A;  4N77 A;  2IVF B;  2RUS A;  2UUB J;  3HHN B;  4EU0 A;  1RAH B;  2DBB A;  3CD0 A;  4F67 A;  3WQP A;  1NK6 A;  5D3G A;  2BRL A;  2DNO A;  1UWB A;  2GGP A;  2J6T A;  2YPY A;  2QYC A;  4DV0 F;  1T05 B;  4MIA A;  2VL1 A;  2R7U A;  2JXI A;  2VG5 B;  3US5 A;  2BNW A;  2PFF B;  2DH7 A;  2K1R A;  3HHD A;  4Q2M A;  3KLF A;  1RYS A;  3DRR A;  3E3X A;  3KG0 A;  3MEE B;  1U02 A;  4WCE Q;  2JOQ A;  2BAB A;  3PRB A;  4DV7 J;  3TEH B;  3SYZ A;  3DRY A;  2I6W A;  1DTQ A;  3SQG B;  4WTO B;  2KG0 A;  2XB2 D;  3QNW B;  2JWN A;  3CF5 Q;  2O66 A;  5B7W A;  3KLE B;  3GR1 A;  1Q5Y A;  3GU0 A;  3S8S A;  5F8G A;  2HND B;  4CO0 A;  1B7F A;  3NMR A;  1RT4 A;  3MMB A;  4CCH A;  3V4I A;  1CBK A;  4OZ3 A;  2JEJ A;  3M2R B;  2R8G A;  3KJF B;  4QIF A;  3DMJ B;  1UFW A;  2JDJ A;  3EVM A;  2V9K A;  5L46 A;  2WSF C;  1DTT B;  1RKJ A;  3GFH A;  5F8N A;  5RUB A;  3VAH A;  3I87 A;  1IKX B;  2GVZ A;  3BH7 B;  2AJ0 A;  1VQO S;  1QUV A;  3KDO A;  3LTO A;  1U1P A;  1RTJ A;  3MM8 B;  4DV4 J;  4JI1 J;  3VF0 B;  1B0V A;  3J81 U;  5C25 A;  1G4C A;  1LW0 A;  2E1M C;  4JV2 A;  2DH8 A;  4DL5 A;  4JV1 A;  2LA6 A;  4X62 F;  5BR8 F;  1KNZ A;  4NCB A;  4ID5 B;  1RBL A;  3UO0 A;  1U8W A;  2VD3 A;  1UW4 A;  3K59 A;  1Y10 A;  4M5G A;  5B0A A;  1BC6 A;  1BD6 A;  4DCJ B;  2QLB B;  1N54 B;  3FZ2 A;  4KYZ A;  3CCR S;  4DWI A;  1JLG B;  2RML A;  4MK7 A;  1ZTT A;  4NML A;  1ICE B;  1YJW S;  1OMS A;  4FXD A;  1N32 F;  1YJ7 A;  3UR3 C;  2GJF A;  2VFV A;  2CJA A;  4OV1 A;  1CJK A;  4RW9 B;  3GTY X;  5THW A;  4OX6 A;  4B3M F;  4DFP A;  2XLK A;  3DU6 A;  2XEX A;  1HQE B;  2GIR A;  2ZH6 A;  3D1H A;  2PT0 A;  2JRS A;  2X1G A;  3HD1 A;  3R5C A;  4MIW A;  1FER A;  4URQ U;  3VCD A;  1MU2 B;  3CNQ P;  5B0C A;  4QR0 A;  4ES3 A;  5HN0 A;  1HNV A;  5IV4 A;  4QQB A;  3R2C J;  2RDD A;  4RBT A;  4LFA J;  3FMB A;  2BA9 A;  4CYU B;  3ET6 B;  3I0R A;  5HAT A;  4ES2 A;  3QRQ A;  1U48 A;  4RNF A;  5KG2 A;  2H3E B;  1DHM A;  4ZPT R;  3KHL A;  1DAR A;  2O5D A;  4K4W A;  1Z2Z A;  1Q95 G;  1WOR A;  4NLX A;  4M5M A;  1CLF A;  1FDN A;  3MEG A;  5CZV A;  3HHK A;  3CT9 A;  2ALY B;  2KXN B;  1JLB B;  2BJD A;  5KFG A;  1TK5 A;  4X4U A;  2BXJ A;  1JKH B;  1WF2 A;  4JYA F;  1RUS A;  4I69 A;  4OMF G;  1MRO A;  2DR8 A;  4PQU A;  2GC8 A;  2KT5 A;  3DOM B;  4LMZ A;  3D66 A;  2E1P A;  2C28 A;  1S9F A;  3UDL A;  4Z37 A;  5IT9 U;  1F0X A;  1RBA A;  3FQK A;  2Q2K A;  1YQH A;  3MAH A;  3PAC A;  3UDE A;  2MPU A;  3DXB A;  3NGU A;  2ZD1 B;  1PO6 A;  4HEA 9;  3CC7 S;  2J0Q D;  3C6T A;  2UXB J;  1IQT A;  3K17 A;  6FD1 A;  3N6L A;  3HXM A;  3ZZY A;  4ECY A;  3B4M A;  3LAN A;  4DV6 F;  3KNA A;  2WSC C;  2B51 A;  4LSN A;  5ETS A;  4UOG A;  3OL6 A;  1KVK A;  2W2N P;  4DF4 A;  4D8J A;  5KFS A;  1AZS B;  3MTK A;  2UUC F;  2DNY A;  2OPR B;  4HLB A;  5MAO A;  2H4Y B;  4LRD A;  4A4J A;  1V3Z A;  2HBR B;  2ZEJ A;  1E6V A;  2CNO B;  3CJS A;  3KDN A;  3O1L A;  3WX8 A;  1D9D A;  2AGO A;  2NS1 B;  1QY7 A;  4LBP A;  2OPQ B;  2ZJQ Q;  1V5V A;  3AFG A;  4ZPW R;  2AT1 B;  3FBB A;  1YZ6 A;  4DG1 A;  1SKU B;  2UXB F;  3GLJ A;  3JQJ A;  1ZPV A;  1JIH A;  5K20 B;  1C1C A;  1MWQ A;  4PWD A;  5AXM A;  4HDG A;  2ZBP A;  1I1G A;  1YRU A;  3HHL C;  3M8P A;  3CO0 P;  4HH1 A;  1CUL A;  4WK3 A;  4O3Q A;  2H5E A;  2Y0B B;  4F4Y A;  1RWO B;  5J2M B;  2MYF A;  1P8G A;  4LF5 J;  1OY8 A;  2ZH8 A;  1S6O A;  3TAR A;  4K4S A;  1TKX B;  4CO1 A;  2R2R A;  2VOD A;  4QU6 A;  2KL8 A;  4DZD A;  1X9M A;  4MH8 A;  4ECX A;  2RVJ A;  2F4V F;  2EW9 A;  4PPZ A;  1TAU A;  5F9L A;  1VLO A;  3GFZ A;  2DNZ A;  1V3S A;  3IFE A;  1TK0 A;  3A8E A;  2ZNY A;  2RE1 A;  3RAX A;  2R7O A;  1SQE A;  3MFH A;  1EAY C;  4O3O A;  2C2N A;  2L08 A;  2QLX A;  3OVA A;  4UOF A;  5C24 B;  1H6K X;  1LQ9 A;  2DO4 A;  5KFZ A;  3QJJ A;  2H9Z A;  1WC0 A;  5KFX A;  3TVZ A;  2HFO A;  2Z58 B;  1H98 A;  4BLG A;  3MUR P;  4LF9 J;  1XR5 A;  2Y0S D;  3C15 A;  1Q53 A;  3M2U B;  4IG0 A;  4WU3 A;  2EFN A;  3EUN A;  4LSN B;  5FII A;  4R5P A;  1UPP A;  3NOG A;  1RAF B;  1GFW B;  2JL9 A;  3W8G A;  1RTD A;  2FB0 A;  3EJM A;  4EO6 A;  1NHK L;  3PX0 A;  3Q8U A;  4KPY A;  3D1Q A;  1UVJ A;  4KGK A;  3W61 A;  1V6H A;  1NK9 A;  2FVP A;  4IO1 A;  2ZOG A;  3RB3 A;  1WHV A;  2VG6 B;  3VTI A;  2N82 B;  3LAK A;  4CLT A;  4NWB A;  3VEA A;  1WOS A;  2CPD A;  3D28 A;  3F0N A;  3QRP A;  3KLF B;  3MPV A;  5HLF B;  4UZC A;  4ETX A;  2BKO A;  2HFV A;  2EC2 A;  3CDW A;  4TQR A;  4IRC A;  2D3Z A;  1T3O A;  3J80 U;  2KJV A;  2J9C A;  6AT1 B;  3GR0 A;  4Y2K A;  4AE5 A;  2R9L A;  3C3L A;  4RZR A;  4OX9 J;  2YNI B;  3HHE A;  4LR9 A;  2UV8 G;  1XWL A;  3ILO A;  4PR6 A;  5F0U A;  3KKF A;  2DCL A;  2HLT A;  4LF4 J;  3DDN A;  4YY3 J;  4KSE B;  1QAY A;  3QRR A;  1U0H A;  2EFG A;  1FRM A;  4URG A;  3KLG A;  1FCA A;  1FFS B;  2GS8 A;  2OD4 A;  1SL2 A;  2VPX B;  1S7H A;  1VBX A;  4GKK J;  2HAI A;  1NSA A;  1GX6 A;  4LF9 F;  3T1Y J;  3WIV A;  3KHG A;  4L3N A;  2DIT A;  1EHW A;  1RI7 A;  2QG9 B;  3N6N A;  2OEK A;  3PNI A;  4IR9 A;  3OD2 A;  4DS5 A;  2CQP A;  4OI0 A;  3SCI E;  1H38 A;  4QU7 A;  3M8W A;  3WC0 A;  4V19 J;  4USM A;  1F6T A;  2RNE A;  4DL4 A;  4TY8 B;  5KT7 A;  5KFT A;  1RLD A;  2ZH2 A;  2OEL A;  2QL5 B;  2ILZ A;  4PG5 A;  2IBK A;  2ZBC A;  2HHV A;  1XMB A;  1QM9 A;  2FIU A;  1SQG A;  4Y2I A;  5FDL A;  4U95 A;  3KLG B;  3AB2 B;  2P6S A;  1HYS B;  3CME S;  4ID5 A;  3CW2 C;  4KKO A;  1HWU A;  2O1P A;  4NXN J;  4FYD A;  2CNN B;  2ZKU A;  4ZIT A;  4U67 Q;  1F5A A;  2W4C A;  1KRP A;  4U96 A;  1OSD A;  4DR7 F;  5D0H A;  1MRO B;  2OEJ A;  2Y8W A;  1NJZ A;  2KFZ A;  2OPP A;  3IC1 A;  5SZT A;  1RWK B;  1WUU A;  2XWX A;  3QJL A;  4J90 A;  1HBN B;  2R4F A;  1X5O A;  1RTJ B;  2W2P P;  4TKT A;  1BQM B;  2HAF A;  4ECQ A;  3H87 C;  2VFR A;  4XO0 A;  5CD4 H;  3FRZ A;  5J2Q B;  2Z57 B;  1NLA A;  4QPT A;  3MR7 A;  5KFL A;  2ADC A;  2PMZ D;  2KDO A;  4O44 B;  1QJH A;  3BB5 A;  3TZY A;  2G13 A;  4LBH A;  5LMU F;  1SIW A;  4TU7 A;  5BYR A;  4C11 B;  2OFH X;  1IR0 A;  3CGI A;  1RTD B;  3SFU A;  2P9G A;  1Q16 A;  1HQE A;  1RLC L;  2D74 B;  2HNY A;  3N01 A;  4P7V A;  1T03 B;  3DKD A;  3AXK A;  2FLN A;  5L1J A;  2C22 A;  2DPI A;  1IVZ A;  4PEO A;  4WII A;  3VAM A;  4WU2 A;  2VJV A;  2FZG B;  3EGN A;  3IR5 B;  3VR1 A;  1U1M A;  3IAM 9;  1TL7 A;  3D0G E;  3FKB A;  3HFZ B;  2YTC A;  4E8U A;  4JV5 F;  3MPW A;  4OI6 A;  5EX3 A;  3KJN B;  4H4M B;  3LGH A;  1RWW B;  4WE1 A;  3THP A;  1RB0 A;  2I5J B;  3OJS A;  3CVK A;  3LGM A;  2LDI A;  3TP2 A;  4DQS A;  3GIM A;  2GV1 A;  5KG4 A;  3Q86 A;  4ED2 A;  3K8V A;  2HHW A;  1XEZ A;  2B4P A;  3HHL D;  3R3T A;  3CDU A;  1RT1 A;  1FF2 A;  1CUL B;  2C3O A;  3HFK A;  4LF5 F;  3G9C A;  3DDI A;  4WJB A;  3DFE A;  4NLO A;  5JUM A;  5DDO C;  3DLL Q;  2PMW A;  4I64 A;  3QJP A;  5HJX A;  3BSA A;  2GCF A;  3I82 A;  1K0T A;  2J9E A;  1UP1 A;  2LQ8 A;  2AZ1 A;  5GAG I;  1RK8 A;  4ZDN A;  3CCZ A;  1B4S A;  2VKZ G;  1FRH A;  4PWW A;  5E3A A;  5H9F K;  2XMM A;  4A46 A;  1M5V C;  2DXF A;  4NPO A;  2R7Q A;  1KOO A;  1TUW A;  1QTN B;  5KFQ A;  2YKA A;  3M9M B;  4ZJL A;  3NS7 B;  3IBW A;  4R0J A;  4F4Z A;  4U9R A;  3PIP Q;  2V69 A;  3DRS B;  2JLG A;  3HT3 A;  2BZ2 A;  2HND A;  3BKF A;  1FEE A;  3DLK B;  4LRC A;  5DET A;  3BQ1 A;  4K4X A;  2KZM A;  1WTF A;  3A3N B;  1VQY A;  4H4O A;  2H3A A;  3P5B P;  2RHS B;  1JJH A;  4DV6 J;  2HHQ A;  4GKK F;  2F5G A;  2AD9 A;  2FGO A;  1K9M T;  2EXU A;  1FKO A;  1DZ5 A;  4CTA A;  4OL8 A;  3CJ2 A;  1S1U B;  1RAJ A;  4L73 A;  4PKD B;  4DBQ A;  2LQB A;  2E1C A;  2DNM A;  3A3P B;  3KLI B;  3T9N A;  4ECU A;  3PW5 A;  4IQX A;  2BRK A;  4DV3 F;  1RT5 B;  1U6F A;  1F60 B;  2EKN A;  4F8R A;  2LDY A;  1VR6 A;  3K57 A;  1HNI B;  2YWK A;  3DRS A;  3H7H B;  2DO0 A;  3QQC D;  4QYZ J;  5I42 A;  2ZC3 A;  1SUQ B;  1U09 A;  2ROE A;  3I9V 9;  1NND A;  1X9S A;  1Y7P A;  4FYV B;  3OUY A;  3MCS A;  2FJB B;  1C0U B;  2BAN B;  2YX7 A;  3FSX A;  1CQN A;  2LU2 A;  2QLW A;  3TQE A;  3W5X A;  3JYT A;  1UZD A;  2DNK A;  2HK2 A;  4NA2 A;  3MPD A;  1NJX A;  1G7C B;  3D6T B;  5D4P A;  1VJQ A;  1N0V C;  2B7C B;  2MLX A;  2K7K A;  3LPY A;  2LQ5 A;  4BWM A;  2G0I A;  3DDK A;  4ZVO B;  3T1A A;  2KEL A;  2MY8 A;  4I1T A;  2LMI A;  2XMU A;  4K0K J;  3R5A A;  4ZPC A;  1REG X;  1U47 A;  2BAC A;  1UWA A;  2VDH A;  2DD8 S;  1RYR A;  1IRQ A;  1CJK B;  4RW9 A;  5F41 A;  3I55 S;  2IA0 A;  4BDP A;  4IG3 B;  1S9E B;  3C16 A;  3IR7 B;  4QYZ K;  1WWH A;  1JLQ A;  4LUB A;  4ZVF A;  4AL6 A;  2ZHB A;  4GKJ J;  2AJF E;  3QT6 A;  5C42 A;  1HBU B;  2Z2L A;  1SV5 A;  1R89 A;  1VYA A;  4K4Y A;  1XMO F;  1TU0 B;  1IBK F;  1HNW J;  2RF2 B;  2FJE B;  4B3R F;  2AW0 A;  1T94 A;  5D4O A;  4JOU A;  3UFC X;  2E5G A;  2V8D A;  4WIQ A;  3HKZ D;  3C16 B;  5F8M A;  5DG9 A;  4TLR A;  5FLX Y;  2VQE J;  3RAQ A;  2HHX A;  1AFJ A;  2XNQ A;  4DFM A;  4C0B A;  5L9N A;  4IO9 Q;  2WOM A;  5AE2 A;  3CD6 S;  3PW2 A;  5BR8 J;  5A8K B;  3KJV A;  3ZNJ 1;  1CJU A;  4GRS A;  3BRE A;  1SB6 A;  2KT2 A;  4DCO B;  4JI7 J;  2NXU A;  4YHH J;  2XGP A;  4AQY J;  4N5S A;  4ZP6 A;  4F3Q A;  5J2N B;  4JI1 F;  2B8P A;  3TZZ A;  1E6Y B;  3M8S A;  3VAJ A;  2P6T A;  4X4Q A;  4UOH A;  2VF3 A;  5CHC B;  4LSL B;  2FUG 9;  3MEC B;  1VI7 A;  4HDH A;  5MLC V;  1PAE X;  4YEA A;  3ZTS A;  5GAE U;  3DMJ A;  2BMB A;  1EKS A;  2J76 E;  3MWB A;  2LEA A;  1U2F A;  3PEH A;  3R6L B;  7AT1 B;  5HMW A;  3KK3 A;  2QL9 B;  1UVL A;  1S5Z A;  3HVA A;  2HHS A;  1UJ5 A;  2LVW A;  2EWH A;  2WW8 A;  3MMB B;  3PXG a;  3TNV A;  2HGN A;  2AJ4 A;  1IKY B;  2H5J B;  3TRG A;  1ZET A;  3BSO A;  1T3N A;  4NYP A;  5LXY A;  2CFX A;  2NCK L;  4O3P A;  5DQH A;  2NXC A;  3PRD A;  5H1S V;  2OTL S;  1H72 C;  1UW9 A;  2B6A A;  4Y6I A;  4J9S A;  1PJ7 A;  4Y65 A;  2E9T A;  2RRN A;  1FKO B;  1JNR B;  1X5S A;  4DF8 A;  2VA2 A;  1SI9 A;  4YOE A;  1DAX A;  1VIO A;  2MDA A;  1S1W A;  1VJW A;  2JZ5 A;  2MEW A;  3MMC B;  2ZH7 A;  2M7S A;  3DYA B;  3HI9 A;  1M1K T;  1B64 A;  1Q7L B;  1S0N A;  3AD7 C;  2J5A A;  3GQC A;  2LEB A;  1BWV A;  5DDQ C;  3W5Y A;  1QVG R;  4LRA A;  2F8M A;  2C2O B;  5K14 B;  5IWA J;  4NCA A;  2Q66 A;  4RBU A;  2FJV A;  3BPS P;  1J5O A;  1F3F A;  2CXE A;  2O67 A;  2ZH9 A;  2IVY A;  2R3V A;  2QMW A;  4DSI A;  3BSC A;  5C5J A;  2FVQ A;  1RA7 A;  1WF1 A;  2QLF B;  4PPD A;  4OYO A;  4PAA A;  4C3K A;  2BOP A;  4EZ6 A;  5I3U A;  3T5L A;  4CT9 A;  3MR3 A;  1WG4 A;  2DTJ A;  3I31 A;  3GYX B;  1HHS A;  3IG1 B;  1JXV A;  2K7J A;  4M95 A;  2DNH A;  2DNQ A;  3UDC A;  4IUF A;  2W25 A;  3TW0 A;  2CQG A;  4YR2 A;  3GIK A;  2L9W A;  1S1V B;  3PIO Q;  5KAK A;  1U45 A;  4J9V A;  2XCA A;  1NPK A;  2ALZ A;  4UUW A;  4FXV A;  1S76 D;  1F2H A;  3PJ9 A;  4HV0 A;  4J9P A;  4H4M A;  4ZLN A;  1B7Y B;  1TQL A;  1X5P A;  2FD2 A;  3F41 A;  2JLE A;  3HD2 A;  2QFJ A;  2W7P A;  1U24 A;  1D8Y A;  2UU9 J;  1M5K C;  1KVJ A;  4ZVR B;  1L3K A;  2I9S A;  4CT8 A;  1LW2 B;  4MFB B;  1Q8L A;  2XMA A;  1RJJ A;  4KE5 A;  3MUM P;  2CAX A;  4CO3 A;  4X4T A;  1KTQ A;  1S1W B;  2XGQ A;  5KFE A;  3T1Y F;  2P2C B;  4CH0 S;  5D15 A;  4DR3 F;  1QUP A;  3EDQ B;  3SBM A;  1XMQ J;  2Q1L A;  1SJF A;  2HNY B;  1A6L A;  4UF4 A;  3GII A;  4DFK A;  4X64 F;  2BR0 A;  2LLZ A;  3CJ5 A;  1WSR A;  3EPI A;  4OI3 A;  5B0F A;  4JI8 J;  5SUH A;  4D3G A;  5H9E K;  1JWW A;  1IM6 A;  2F4F A;  2BDP A;  5EUH A;  1GH8 A;  4KFB A; 
#chains in the Genus database with same CATH homology
 2BJ3 A;  4FXE A;  2WVE A;  1MNT A;  1MYL A;  2CPG A;  3VEA A;  3VW4 A;  1Q5Y A;  3QSI A;  2BNZ A;  2JXG A;  3BKU A;  2BJ7 A;  4D8J A;  2K29 A;  3H87 C;  1PAR A;  3FT7 A;  2CAX A;  1ARQ A;  1NLA A;  3OD2 A;  1B28 A;  2Y3Y A;  2K9I A;  2CA9 A;  2F1F A;  3BKF A;  3LGH A;  1ARR A;  3QOQ A;  1EA4 A;  2K1O A;  1BDV A;  1MYK A;  1QTG A;  2RBF A;  3VEB A;  2WVF A;  1B01 A;  2BA3 A;  1BAZ A;  2K6L A;  2CAD A;  3GXQ A;  1BDT A;  2WVC A;  2JXI A;  2BNW A;  1P94 A;  2AY0 A;  2HZA A;  2BJ9 A;  2NZC A;  2KEL A;  2WVB A;  2FGC A;  2WVD A;  1U9P A;  2BSQ E;  2PC6 A;  4HV0 A;  2HZV A;  2CAJ A;  1X93 A;  2K5J A;  1IRQ A;  1Q5V A;  2BJ1 A;  2BJ8 A;  2GPE A;  2H1O E;  3FMT A;  4ME7 E;  3BKT A;  2JXH A;  3PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...