2CAJA

Nikr from helicobacter pylori in closed trans-conformation and nickel bound to 4 intermediary sites
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
128
Chain Sequence
b'SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
molecule tags Transcriptional regulation
source organism Helicobacter pylori
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
total genus 32
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2cajA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2cajA02
1ARQA 3BKUA 1IRQA 1PARA 1QTGA 2CAXA 2BJ9A 2K29A 2BNWA 3FMTA 1MNTA 2WVFA 2NZCA 3QSIA 3LGHA 2HZAA 3VEAA 2BNZA 1B01A 2WVDA 1B28A 2CA9A 2CPGA 3VEBA 2FGCA 3BKTA 2K1OA 1BAZA 2GPEA 2K9IA 2CAJA 2JXGA 3VW4A 3BKFA 2K6LA 1EA4A 2JXIA 2BJ8A 1NLAA 4FXEA 2BJ3A 4HV0A 3H87C 3QOQA 2BA3A 1U9PA 1BDTA 1ARRA 2WVEA 2H1OE 2WVCA 2K5JA 3OD2A 1Q5VA 1BDVA 2Y3YA 2KELA 1MYKA 1MYLA 2AY0A 2PC6A 2BSQE 2RBFA 2HZVA 3PHTA 3GXQA 3FT7A 4D8JA 1X93A 2JXHA 1P94A 2BJ7A 2F1FA 2CADA 2WVBA 1Q5YA 4ME7E 2BJ1A
chains in the Genus database with same CATH superfamily
1K8AT 4LFAF 3IRXB 2MTLA 2J5AA 3THPA 4HYKA 2FJEB 4C48A 3FZ2A 1PAUB 3MEKA 3OR2B 4CT8A 5KT6A 2DYAA 3LGHA 1KOHA 4Y65A 4ZN3A 4WFBQ 2H3AA 1HARA 2U2FA 3I31A 2XTJP 4HHUA 4DX6A 1HNVA 3NNEA 3PJ9A 4GO5X 1OPZA 5LMUF 3L3CA 4UUXA 1PBUA 2XB2D 3X1LB 2Q79A 4GKJJ 3MMBB 3B8HA 5DETA 1MU2A 1RKIA 3BJYA 4QU6A 4EYIB 1MLAA 4ED8A 4OI6A 2F3JA 1RT7B 3ONQA 2I5JA 1WC5A 3J7YU 3D54A 4ITSA 1Y5NB 1BQMA 2AYEA 3AH6A 3R1LA 3Q2TC 2R42A 2WK4A 1FF2A 1LWCB 2BW7A 3OPKA 4LFCJ 1UW9A 4ZN1A 1H2VZ 4J9VA 2XMAA 4DQQA 3DU6A 5A8WB 4X66F 5KG4A 1N5YA 1Y00A 3NGKA 4PXBA 2DEIA 2RQ4A 2QYCA 3GWCA 4FDFA 4Y2AA 5L9NA 3SQGB 1HBMB 4DWIA 3GFZA 1CJUB 3CCES 2KOEA 3EYZA 2HVHA 2R3VA 2WVDA 3BKTA 3KG4A 1JKHA 1SJ1A 4K5RA 4H4OB 4QIGA 2R8JA 4ANDA 1KQFB 2LEAA 1D9FA 2IM0A 4PG8A 1S9GB 3PX6A 1RAAB 2VBWA 2MKKA 5LJ3Y 1YVFA 4Q43A 2VV5A 6FD1A 1S1VB 2OD6A 3HHLC 3PXGa 4A8QA 2FB0A 2JEFA 4EFAC 2DGSA 3BF4A 2Y8WA 4QCLA 4ILRA 2Y0BB 1RU2A 2E9RX 4DR1F 3IBWA 2M70A 4KHPF 3PHTA 3SI8A 4XTTA 3POTA 4UOGA 2BJ7A 1IBCB 4J9OA 1GXLA 4EMDA 4DEZA 5M2UA 3QGIA 1GX6A 3BKUA 1M90T 3C46A 4YS2A 1VQ9S 3OV7A 4B9VA 1TU0B 1EKRA 4FS2A 3JSBA 4J90A 3W64A 3MPDA 1IBLJ 1H98A 2GVZB 2HURA 3FNNA 4HACB 4ZPWR 5J2NA 1JXLA 2AJQA 2F8HA 3VQTA 2FLNA 1UW4A 1WC4A 4CLTA 3IR7A 2GMLA 4X4RA 3PW5A 1T03A 5L1KA 3G86A 4A8KA 2C2EA 2N4DA 5F8LA 2HVEA 2RJZA 4GVBB 5ETSA 3EVMA 4K4YA 1HWKA 3AT1B 4DV6F 1HR0J 2XNRA 2Y1JA 1IJFB 2EC2A 1VQNS 3U7JA 3Q8RB 2Y8YA 2JRSA 1EZZB 2I5JB 2ASJA 3RW6A 2UXCJ 3HZEA 3CF5Q 1TKDA 1HNXJ 1YJTA 2YKOA 2YPZA 4YR0A 3PEJA 1U6FA 1WI8A 1BQNB 2QN6B 2YY3A 3KLEB 2XMTA 1ARQA 3KJNB 4TYBA 4URQU 4WK1A 3T5HA 3DRPB 3CDBA 3IA0A 1DZ5A 1MW7A 4M95A 1TR0A 4FYVB 3JQJA 3S7RA 1NKBA 3JQKA 2VPWB 5F3ZA 5A2QU 1JLFB 1NM2A 2H3EB 3HT0A 2MKHA 3I5CA 5A2QY 4ECTA 1QAXA 3EGNA 2D9OA 1WTBA 4I7FB 1JK9B 1RLCL 5EDWA 4GVBA 1S57A 4GC6A 5KFOA 3T1YJ 4J9QA 2J6SA 4ED3A 2FVSA 2XQCA 3M2VB 4QW9A 4HL9A 1NJIT 2YWWA 4ZCKA 2FZCB 4URGA 4I64A 1H2UX 3MM7A 1SH3A 2OIHA 4WE1B 1RBOB 1XK8A 1VBXA 1P94A 5J2QB 4J5OA 4G1QB 3UD5A 5U47A 3ZZOA 1S9GA 2CAXA 2CNNB 2HBZB 2K29A 4F0HA 4TU9A 3HK2A 3FMWA 3LAMA 2BEFA 2BZ2A 2NXNA 2Z8QA 2ZVSA 3TOQA 4ED4A 3OJUA 4I2QA 4IQXA 1RTJA 3OTBA 4USUA 5H9FJ 4ANCA 5H9FK 2DT9A 5RUBA 1Y0HA 1LW2B 4G1PA 2OSRA 1VHFA 3ZZUA 5KG5A 5IQ6A 1U9PA 3FBCA 2ZH9A 2CQ4A 2DH7A 2QGFB 1RADB 3T41A 3W7BA 5KFEA 1FRHA 2J9CA 2QA1A 2R7VA 3FGVA 3HI9A 2KM8C 3PO4A 3P6YC 3KHRA 3JSRA 1Z2LA 3ZO7A 2ALZA 1FJGJ 1HL6A 1FFWB 3PHEA 1BQMB 2AEMA 2ZH3A 4M5JA 4ED1A 1PIEA 5CQGA 2RE1A 2MMYA 2YTCA 3N6LA 3O5TB 1S77D 3CULA 3H5YA 3TARA 2C2RA 2IC3B 1R31A 4PCQA 2Q66A 2HHHJ 2DIUA 4X2BA 1FD2A 4HI1A 4QPXA 1VK8A 3DOKA 3IG1B 3ZC4A 1XJWB 3DN9A 3FKBA 3GFYA 2J0SD 3E2EA 2CQIA 3QPIA 3F56A 2JDJA 1E6VB 3NKYA 4RW6A 1IKYA 4MIWA 4OYOA 4DL7A 2C22A 1ITPA 1NLAA 1HI1A 1MNEA 1B3TA 3SV3A 2I6WA 1ZOTA 2RHSB 2XG8A 1S6UA 2CPHA 2ZD1B 3EDRB 2F4FA 2K1RA 4QIVA 1RWXB 2H1OE 2UUBJ 4KPYA 3LP2B 3OD2A 2K5JA 1S79A 2P9CA 3PYDA 2JEJA 3GSIA 1Q7YT 3NGSA 3PTWA 5BR8F 3DU5A 1VIXA 2AP6A 1O6XA 3WC0A 2FHKA 2J6TA 2CRLA 3M4XA 4OI0A 1HFEL 2DKOB 2CWXA 3A3OB 2PIIA 4DV2F 1RHKB 3GTYX 1N34J 4JI1F 4NLGA 2KZZA 1AFJA 1CS4A 2R8HA 2F65A 3ITHB 2BJ9A 3G2XA 3MPYA 2J7WA 2HPUA 2VUGA 2HHQA 1FVSA 4OV6A 3PIPQ 1OQ3A 4USIA 2G1DA 3D1HA 1ZH5A 1R43A 3H4BA 1FXDA 2ZWOA 2WW4A 2VG6A 2C3MA 1VLYA 3H87C 2F5GA 2H48B 1RDRA 2WHOA 3MAAA 3MOZA 4FVMA 1DFDA 4U7CA 5IV4A 1YZ7A 1X5SA 1VRTA 1ARRA 1HLWA 2EFGA 2YWFA 4YR3A 4K50A 2J8AA 3FRYA 3RB4A 4JI3J 1FRJA 2IM1A 3I32A 3RZAA 4QWDA 1NUEA 5HP1B 4DMZA 3CJQA 4JI2J 1SKRA 4C11A 4DX5A 3QSYB 3MFIA 4F4KA 2RKIA 4Q5VA 2XBPA 1PYTA 4QIEA 4B17A 2B4PA 3CDWA 4FXVA 3MMJA 5IS2A 1VQPS 3RRHA 2F4VJ 2V4JB 1BHNA 3DOLB 1VDHA 3FBBA 2BNZA 1ZPWX 2QSFA 3C16A 3HJVA 4MKVA 5A6WA 4OLOA 2CPGA 1RWOB 1X4CA 3VVTA 4CDIA 1RWUA 1X31C 4I6AA 1YDLA 1HD0A 1NPRA 3BKFA 3HVTB 3M32B 4ICLB 2Z57B 4DUZF 2W4CA 5H9EK 4PG4A 4X4QA 3GJTB 4YHHJ 3MUMP 1X0FA 1JLEA 1S97A 4OI2A 1N6QB 4ELVA 4F4AA 4K8RA 1XR6A 3SMZA 2KG0A 1T02A 4WXWA 2XCPA 2WOMB 3K17A 1Q5VA 4P6QA 1HQUB 3KK2A 1FXLA 2BA9A 2DD8S 2FY1A 1Y5IB 3AQOA 3LGMA 3VQSA 4K4TA 4OHWA 1C1BA 3C14A 3JYTB 1S0VA 2VG7A 1NK5A 4DR5F 2LYVA 4P2FA 2L9NA 4KQZA 4OHVA 1OY9A 4W4MA 1WEZA 3ILOA 2W4DA 4WCEQ 1CG2A 3V6HA 2ASDA 1SJ4P 1MNTA 3CJ8A 3VR1A 3T5JA 2NXEA 4HKQA 2HNZB 1JNZB 3ZTOA 4LF1A 1F5CA 2GAHC 3QNWB 3TVZA 3D6TB 1S72S 4PWDA 2KTQA 2GIQA 2HMIA 4WP9A 1WACA 2RKIB 2OTJS 5C5JA 4XDCA 2DPIA 2DR7A 2FJDB 2MPUA 3JXOA 2LDYA 2BE9B 2V4JA 3DOLA 2UV8G 1S0OA 4WFXA 2UXBF 1YX2A 3OR1A 2B8QA 3C3LA 4DV5J 1UEUA 3MURP 3E3XA 3V5RA 3GP9A 4TN2A 1Q8IA 4K5SA 4LREA 3KJVA 2NPIA 5CHCB 3WBZA 1N54B 4DPXA 1WKLA 2YX4A 3KYLA 2JZ5A 1KNZA 2MGZB 4LBIA 4C0BA 2E7WA 1OYEA 3FMTA 3ISNC 5CCMA 1KLMA 2B4VA 3Q22A 4EZ9A 1PYOB 1LWEA 3L7PA 2EI5A 4C98A 1HHTP 3W5YA 4AL7A 4KKOA 2MY8A 4OI4A 4NZ0A 3K8VA 4PAAA 3T6BA 3K58A 1UPPA 4NWBA 3PW7A 3HHNB 5A8KA 3A8JA 1GK8A 4RW9B 3H2UB 1XMQJ 2RU3A 2FLPA 7FD1A 4OLPA 4LF7F 3WX8A 3W9JA 5F9NA 3HX9A 4ES1A 4RUCA 4DR5J 2UXDJ 1WHWA 1RE1B 3L9ZA 4OJHA 3BYRA 3HKZD 2CDQA 3IS9A 5K14A 3ZZPA 3OW2R 1WKKA 3FEZA 5ETRA 3RAQA 2BUNA 3L7UA 4L3NA 3N6NA 1NSQA 4F4WA 1X93A 5K8MA 3M2UA 2F1FA 3BEGB 1U1OA 4TQSA 3RW7A 2GIFA 4YMEA 3VWSA 2DR5A 1HQ2A 3DRRB 3MZIA 1GMWD 2DO4A 3KLIB 4MTPA 2FY8A 4TQRA 2GCFA 2AN7A 3IG1A 1A7GE 3EDQB 2ZD1A 5KAKA 4OV1A 2OLWA 1FJEB 3PY8A 1FKOA 4NCAA 2W01A 1K44A 3NNHA 4UY8T 4YY3F 1Y10A 4RW7B 1U25A 4WFAQ 3I82A 2GS8A 5KG6A 1FRKA 1LWFB 4MYTA 4YP3A 2JXIA 2ERRA 2LA4A 3MMAA 1T7PA 3CCQS 1YRUA 1O0PA 2D9PA 1WF1A 4FVCA 2B3TB 4NX9A 2HWIA 4ZS6A 5D4PA 2CZ9A 2N7CA 5LSLA 1TL7A 2EBEA 2KB2A 3D1QA 3LJPA 2V67A 4X65F 5GAGI 2CQPA 3I0SB 4C7QA 3N0VA 2JXHA 2HQIA 4USHA 1UJ4A 2OD4A 2XHWA 3TVYA 1UVIA 4O44B 4C11B 4RU9A 1F6TA 1C4AA 2F63A 2YWKA 2AIRB 1TV6A 2E66A 4OZNA 5HQ8A 5FD1A 5KFLA 1FHTA 4DSJA 3TAMB 4CLSA 4X4OA 4A8MP 4RNFA 3HF5A 2MLZA 3J80U 1TUWA 4CLLA 1DTQA 2IMOA 1SI9A 3HLUA 2W8KA 4X65J 1D1UA 1QAJA 1AB8A 3OLAA 2QO3A 3D1OA 3L4BC 4WP8A 1KEKA 2V50A 3DXBA 4FP9A 4MMOA 4EEYA 4DSEA 1S1UA 1KOOA 2Q43A 3DRXA 3LP1A 4IDKB 3CJKB 4BC7A 4LBPA 2K7KA 2R7XA 3TZYA 3V6DA 1IR0A 1SQFA 2AT1B 4URSA 1FK9A 1TL1B 1TP7A 3QGHA 1NXIA 5CD4H 1KQSR 2HRTA 3GG1A 4I7FA 5HJYA 1DARA 2DR6A 2OI2A 4M1KA 4W98A 5HBMB 2H9ZA 2IDEA 4MKBA 4BWMA 4UOCA 2GV1A 1KRPA 1NBEB 1NEEA 4OYIA 1MSWD 4YEAA 2BW2A 2MY7A 1L5UA 1B7FA 5J2MA 1SJFA 3G9CA 2CAJA 4WU3A 2KRRA 3E01B 2FVRA 3ADAC 4NPOA 3VTIA 1YJVA 1UZHA 2NSBA 3MCNA 3I6PA 2VB6A 1ICEB 3QGPA 1UKUA 4O4GB 4DCJB 1KN6A 3Q8PB 1T9UA 4YDXA 2LEBA 1JB0C 1F60B 2APOA 3C6TA 3I87A 3QWPA 5L9XA 1N4LA 1HD1A 1S0NA 1VQYA 1WORA 2NS1B 2EKNA 1P6TA 2BJDA 2FIUA 2B56A 2HIQA 2IC3A 2JC0A 2DO0A 4RW4A 4RKUC 4JI0J 4NA2A 4XPCA 1QAIA 3IR7B 1JQGA 4JB8B 1T05A 1RAJA 3WQPA 4DL0C 2B9EA 3AJDA 1O51A 3NL0A 2YNIB 5D0GA 2X7IA 2YWGA 3OHBA 4O3RA 1N5VA 2B4UA 4LF5J 5J2MB 3LWLA 3KJQB 2QRRA 2MXYA 4OZ0A 1NH7A 2FJBB 3VAFA 1OS5A 2HRYA 2W2PP 5AE1A 3KOAA 3PJXA 5DG9A 2L41A 4LF8F 5KG0A 1QUVA 2BM0A 1F9EB 5DM7Q 3SCKE 1TMMA 3FK4A 4YDDB 3KHLA 1EQ0A 2JEIA 1HBOB 1RTZA 1XMBA 3AD9C 5LMNF 1YI2S 3CJKA 1EHWA 5GMKa 4FF1A 1CJTA 4J9NA 2E9ZA 5EN1A 2HQCA 1QLNA 2YVSA 2QLJB 1R8HA 2QV6A 1W7WA 2P2CB 2LXUA 2HG4A 4H4OA 4Y34A 1Z4UA 3MTJA 2ZHAA 3SV4A 1PARA 2C2KB 3NGUA 4Y28C 2AX0A 1KHWA 1QUPA 1IKVB 4I67A 3AODA 3G6XA 3UVJA 1JLQA 2LA6A 4KB7A 1O8BA 1LXJA 2FPHX 4ZVRB 1B99A 1K1QA 5G0RA 3V2UC 3SSRA 3ZTPA 1VBYA 2UUBF 1KTVA 4P71A 4LRFA 4ZA1A 4MKYA 2EG2A 1Q7LB 4DF8A 4AQYF 4ZVQB 2KH9A 1JMTA 4H4KC 2P6SA 4OMFG 2IVFB 3JAMY 4A8WA 1TK8A 1RABB 4GKKJ 2H5IB 3CT9A 4R8UA 1T05B 4R5PB 1IM4A 3OTOJ 5F41A 3QZ8A 2V4RA 2DGOA 1TL7B 2DVIA 4KFBA 2AV5A 2KN4A 2AJ0A 1SIWA 2J0XA 4P2SA 5HMWA 3GIMA 2ZH5A 2UUAJ 4JV1A 2GQ2A 3GR1A 1BQNA 2AEFA 4Z7CA 3HSJA 2MQPA 1U7LA 1EETA 3M6XA 3ZZYA 5C25A 2BOAA 2VPXB 1PG5B 3C6TB 4RNMA 1V3ZA 4C8MA 2HGNA 3KXDA 3MCSA 5GAEI 2DY9A 4O0NA 5KFKA 2RT3A 1L3VA 4U8VA 1EP4B 1I51B 3GJRB 2RRAA 1DQ8A 4BCAA 1UA0A 1BLUA 3KDOA 5B0CA 1VQLS 2GVDA 1NKEA 1X4DA 3BGLA 5KFBA 1NK9A 1F1BB 4Q44A 2B9YA 1HNVB 4IFVA 4DCPB 4HTIA 4OYXA 4USWA 2XS7A 4P7TA 2B8PA 2G9OA 3NCRA 3OR2A 5L38A 2CDRB 1HPZA 1NPKA 2GO8A 2O01C 1S4EA 2VJUA 2ADBA 2R8GA 4HVZA 1FESA 2EFPA 1VR6A 1FRIA 1T95A 3KK3A 1TL3B 1LNQA 4FZVA 3IS9B 1HBUB 3KKFA 2GFFA 2WTFA 1F9FA 4OX7A 3W2VB 4CH1A 3V6DB 1RP5A 1HWIA 3EGZA 1YJUA 2GHPA 5KFMA 1N32F 5D15A 3D6MB 4DDFA 3LOUA 1KC8T 2BKOA 1ZZFA 4B3MF 3TUPA 1RAHB 3AAWB 3ENVA 1RACB 4DV0F 2W4PA 5HQLA 2HZAA 4JYAJ 2C3UA 4PQAA 1TTHB 1M5PC 2HAIA 1WD6A 2EFOA 3CCZA 3UNYA 4ZLNA 3DYAA 3RB0A 1Q16A 3PV8A 4WK3A 4WTYA 2HNYB 4F25A 2E44A 3LWMA 3EXYA 2KO1A 3DCAA 3KHHA 3AOBA 4LT6A 2VHGA 3I4PA 5ETTA 4C6AA 2AF6A 3F73A 4QR2A 1SQEA 4ZVHA 1NNDA 2QA4G 1BWVA 1V3RA 5IT9Y 2RILA 4K2JA 5T7LA 1FA0A 2VIHA 4ECUA 4A8XA 1UWBA 4BLGA 4LF7J 4DS4A 3DRSB 1X60A 2QLBB 2YNHB 1GTEA 3O44A 3Q83A 3ZTRA 4ALZA 2BE2A 4EBEA 1X9WA 4PQUB 4QYZJ 5G4DA 3KLFB 2CZ4A 3VHQA 2E7XA 3W8GA 1YGYA 3FZBA 1RWVB 4ZP7A 3OUYA 3CCUS 1UTAA 4KSEB 3BSNA 5EWFA 4JI5F 2RNEA 3BM7A 3CDAA 3ZTSA 3RB3A 2HNZA 3R7BB 4K59A 2DNYA 4KO0B 4C8ZA 4ELTA 2F8MA 2XZTB 2K8GA 3LH2S 1N52B 1J27A 3MM5B 5CABA 3HMJG 1SUQB 2YNFB 4KT0C 2VPZB 3PG9A 2G0CA 1ZA2B 2EC0A 2RB7A 2ZDOA 1P9YA 4Y2CA 3OL8A 4C4WA 5L1LA 2YNFA 1NLKL 1CQNA 2K3KA 2KKHA 2N4CA 1C0TB 3IM8A 3KK2B 3T1HJ 5D8HB 1UL3A 1FWPA 2XGQA 2B9XA 3T9NA 1ZM9A 2WBRA 5GVQA 3UD3P 2LKZA 3ILIA 3UO0A 5HO4A 4JI8F 2XCAA 3EICA 2ZWPA 2DHGA 1YZ6A 3H2LA 1H3DA 1RWWB 2DRDA 2HFUA 2ZOMA 3M05A 3R1HA 4RLEA 4DS5A 2DEJA 5A8KB 1IWAA 3MF5A 3DXSX 2V8GA 4IR1A 1U47A 4LF8J 1CJKB 3D6FB 1WG5A 4OZ1A 3ZZTA 5DDRC 4J9UE 3TO8A 4XO0A 2BA3A 5B0FA 5HATA 3J81j 1TVRB 1NB2A 1Y7PA 1U1MA 3GR0A 3R5CA 4IOCQ 4N5SA 1FERA 3QWUA 2KYZA 2A6OA 2XHCA 3NLCA 2OJ3A 2MDAA 4IRDA 1P1TA 1U26A 5I42B 3K5MA 2Y9HA 1WC3A 3ILLA 4YOEA 2XI3A 1JXVA 1TQLA 2G0JA 2V69A 2HNYA 3ELHA 4DV4F 2NQPA 4OI3A 3KDNA 2GO9A 1IKXB 2LECA 2XULA 4DLGA 4Y0FA 2UXCF 3NS7B 2OHDA 3OR1B 4JI2F 4FF2A 2KRBA 3M8YA 4USKA 3TAQA 2HS0A 4GMKA 4ERDA 3HVWA 2HFVA 3MAHA 3IGNA 2VPYB 3ZNJ1 4KYZA 1RZMA 4BDPA 2B7BB 3MR7A 2HYIB 3A12A 1M5KC 4LSNB 3BDEA 4HHJA 4A47A 3RAMA 2D69A 1FEHA 4M5MA 2E7VA 2ROEA 2RHQB 3OXGA 2VZ9A 4F67A 2R7QA 1PSDA 1D8ZA 4M5DB 3LW5C 3OFEA 4MK9A 3KK3B 2RAQA 4LQ9A 1KWMA 3LF0A 4GC7A 2BQUA 4OFZA 1C1CB 4OYWA 2YX1A 2W1BA 3DKDA 4M5HA 1N56A 1N32J 2YH0A 3RRGA 3RAXA 4I6WA 4K4WA 1UVNA 4LIRA 2VG7B 3D0GE 2JVOA 3HT3A 2JNJA 4L3KA 3VGSA 1QTNB 1R27B 5KG3A 3OSNA 4NXMF 5KFUA 3SYZA 3U27A 2WOMA 5AE2A 5LOQA 1RAEB 2FHMA 3IM9A 4P9SA 4W90B 1N5TA 4CT9A 3IFEA 2AEJA 1APSA 3BYPA 2MHNA 3UQSA 4DR3J 2BE7D 1H74A 1NDPA 5DGAA 3PM9A 4LRVA 4IYQA 1LOUA 2EPIA 3UN2A 3UNGC 3VGTA 3NS6A 4NRTA 4FKXA 3A1YG 4M5IA 4FF3A 2XWXA 2GQQA 4C8YA 3SEOA 3GJQB 3HVRA 3DLLQ 3UN3A 4J9KA 2WSEC 3AB2B 2VONA 3M30B 4AT1B 4DFPA 1UMJA 1W26A 2DNOA 2HQFA 3KWMA 3H5XA 4C0OC 5A76A 3DLEB 5J2PB 4ZPDA 1RA7A 2BRLA 4N7TA 5J1EB 1RHRB 4L72B 3PYFA 4CLFA 2YWEA 4DU8A 5LJ5Y 2XC9A 2VDIA 4ATNA 3KHGA 2EFQA 1VQSA 1URRA 2X3GA 1NSKL 1SJQA 3TJ9A 4U95A 2IYIA 3LO3A 4MK8A 3ZFVA 1VQ4S 3PFOA 1GMUA 3BR8A 1IN0A 3DOMA 5D4OA 1SIZA 2KZMA 3PFEA 5HK4A 1RT1B 5KFZA 3CXCR 4CH7A 2J0WA 4U7UK 5BR8J 1HBOA 2EXUA 3PR4A 4K2XA 2XMKA 1CULB 2VC0A 3CEDA 3DM2B 1C0UB 2FD2A 2C2MB 1H72C 2R2UA 4ED7A 3CCJS 3HDSA 2I2YA 2DBBA 5JJBA 3OL7A 4ZLJA 4DG1A 2FVCA 1LK5A 1R8CA 2IJRA 3R2DJ 1GH8A 4DSKA 1SL2A 1IXKA 3W2VA 4CNYA 1OMSA 2PA8D 1IRQA 2JFDA 3O2IA 3QT5A 3UFCX 3LP2A 2W9CB 2HBYB 2OGUA 2DNKA 3QJLA 2LQJA 4P2XA 1IBMF 1Z1ZA 4CLWA 1SL1A 3P45B 1LK7A 1H0HB 1XWLA 4OJ3A 3SDEB 4U67Q 4RW6B 4E98A 4C2MA 1BQXA 1KQGB 4A8OA 4C8KA 3P5TL 3FCVA 3DDKA 2OPQA 4UUWA 3N4WA 3FUYA 3EGVA 4J91A 1VBZA 3M8PA 4LVNP 4KH0B 2YNGA 1BE4A 1G4CA 2NXJA 2W2QP 4M5GA 3CC7S 3EUNA 3PRDA 2YKPA 2MZQA 2YKMB 2YX7A 4PYDA 1N36F 2CKWA 1T11A 4CO4A 2I38A 4R5PA 4DLEA 4JI8J 2IYGA 1HW9A 1R8PA 2WVBA 2CPDA 5HROB 2BVZA 2MJNA 4C9DA 1SIWB 3W66A 3MD1A 3S1TA 2N82B 2E5LJ 3IWXA 1XMOF 3NGRA 3VAMA 2WSFC 3RBDA 1YJWS 3TNVA 3OJSA 2FGCA 1N5SA 4LF6F 1RI7A 1OPIA 3LGNA 2PFDA 1TKXB 2GJIA 4USMA 2ZBRA 3MFHA 2CQGA 2FYXA 3SFUA 1NJZA 1MWZA 1N88A 3I55S 3D2WA 2V2ZA 2BJ3A 2HLUA 3G8QA 5IM0B 1DJ0A 4B08A 2ASYA 2QE5A 3R5GA 4OZ3A 4ZPVR 2CJQA 5M2PA 3TW0A 2F7VA 5DJBA 1S1UB 2KVQE 1XEZA 4CIOA 3QRQA 2AY0A 1KONA 2RBFA 4DFMA 5F0UA 1UZDA 2AGPA 1YG0A 4KJIA 4RNNA 1IBMJ 2JHEA 3ENWA 4RBVA 4C8NA 1RAFB 4K4XA 2BANB 5KTQA 1CJTB 2B9WA 1RHQB 4QIFA 2CZVC 3KLGB 2E1PA 4V1Ak 2CPZA 4NI2B 2C42A 4KHRA 1X5PA 4NLUA 4J7CA 4ED6A 1S4FA 1FE0A 2XLJA 2HHHF 2CNLB 2QMUB 2MLYA 3AJ2A 2YNIA 5CYMA 1B0VA 4JI6F 4UOHA 3C6UB 1J2VA 1PC5A 2FC9A 2X1AA 5A6PA 3AA8A 5KOWA 3FEXB 3R5BA 5AJ3F 4KGXB 1Q1KA 5HLFA 1AUDA 2OO4A 3BBCA 1VIOA 3Q8UA 4KGVB 2LMIA 5E33A 4PWUA 3W9HA 4HDHA 4TXSA 1PYSB 4CO0A 2UV8A 2W25A 5I3UB 1TFWA 4JV5F 3NGDA 3AQPA 5AT1B 5F8IA 1PGZA 1TMJA 2N7YA 3H20A 3KG0A 1WC6A 2CQDA 2E1MC 4P75A 4BS2A 1NK4A 4WF9Q 2RVJA 4WKYA 4PPDA 1MU2B 3E01A 2YNGB 1WF0A 4LBHA 3GV8B 2XY5A 4G1IA 3CC4S 4QPTA 4DSIA 3BQ1A 1BAZA 3CWJA 5CA5A 3IGVA 1ZM2A 3UDEA 1JLGB 5ETKA 1TAQA 2K2PA 3UW1A 4DBQA 3G8SA 1RTIB 3MCOA 3MECA 5E2QA 4ETXA 5CCLA 2NSCA 5DG8A 1JX4A 4DG1B 4NCBA 4UZBA 1QY7A 1LWXA 2GVZA 4HACA 5J2NB 3CPWR 3HZGA 4X4SA 5ITHA 5K14B 3PZPA 2AQ4A 1PKUA 4NZ7A 4V19J 1IUJA 1CULA 4MFBA 3MPUB 2CYYA 5BXIA 3CCWA 3BGOP 1N33J 2ZBIA 4I68A 2D1CA 3DHWC 4KAIA 4CO1A 5LSOA 4M94A 3QZ7A 5HBMA 1SKWA 1SC4B 2HVZA 3BPSP 3T3FA 2BANA 1YBTA 2KJVA 3TANA 4RBUA 3OSPA 3DOMB 1FE4A 2RQMA 3R9LA 5B09A 2FJXA 4DI6A 2MKYA 1KVJA 1YBAA 2DPJA 1S1VA 1LWEB 2W2MP 1K0TA 1IKWB 2J7UA 4LRDA 3FQKA 1HYSA 2HK3A 4QWAA 3D3BJ 3VCDA 3RB6A 3GQCA 1JKHB 2HHTA 2WB4A 1R6VA 4F3MA 5DO2A 1E6YB 1ZAXA 3SQGA 4MJWA 3WX4A 2IJFA 2OEMA 4KRWA 2IM3A 3L7OA 3NWRA 3NY0A 3CDEA 4DV7J 4Q2LA 1URNA 4X4VA 4NEZA 3BO4A 2DR8A 2VA2A 2DNGA 4PR6A 1SVDA 2DNHA 2G2ZA 3PKYA 4DFKA 1T9XA 2CG4A 2V8DA 4LIWA 3W2WB 2E5HA 3WIUA 3CC2S 1ZYQA 1N5QA 3T5KA 1U1PA 3BDPA 2JEGA 2Z56B 2HFNA 2RS8A 2XZWA 2XSJA 3I0SA 1RT7A 3MMAB 3OL6A 2XLIA 1VFJA 5KFRA 3Q86A 4FS1A 4UY85 4Q0BB 1M1HA 2ZE2B 4ZVEA 5GADU 1RSCA 4ECQA 2ACYA 4CLYA 3S01A 5AXLA 1Q79A 1WDTA 2COLA 1U1QA 5E5NA 1S6OA 4DL2A 1CQMA 2WONB 4QR1A 3EGWB 1Q53A 4MH8A 4DV6J 1R0CB 4IH7A 2N3LA 2VFTA 2Y3YA 3CB4A 4R0JA 2JLFA 2FUG9 5IC4B 3MMCA 3QFHA 2HQGA 2IRYA 1S6PB 3BH7B 5ETMA 3HVTA 4PUOB 2PE8A 3B6BA 3R7SB 1QTGA 1BWEA 3C16B 1Y4ZB 4NMXA 3BSOA 5JVHQ 1T9WA 2OEKA 4CO5A 4ECRA 2FJVA 4NXMJ 3V81B 1SXLA 2OPRB 4N41A 3FSYA 4QOTA 5SUHA 4AUKA 4ES3A 2GPEA 2G1HA 3VGVA 2HIYA 4B3MJ 3CJ4A 2B6AB 4B9NA 4MKAA 1DAXA 2CQHA 3EWGA 1TKZA 3H2VE 1M1GA 2JX2A 3TP2A 2AGOA 3M8ZA 1JLAB 2KDOA 1LQ9A 3KUEA 1AUSL 2YQ0A 4LFCF 4RUAA 2W9AA 2OAUA 1DQ9A 1GEHA 4TYAA 1XR5A 5DQIA 3S8SA 2M52A 2BQ3A 1I3OB 3BR9A 4HH0A 1S1XB 4ZJQA 3LPYA 1OSDA 3VZHA 3Q8SB 1HR0F 3DLEA 5DRKA 4JI3F 1X9SA 5F0WA 1LKZA 1R89A 1X4GA 1TKZB 2H4WB 1MWYA 1D09B 1HWUA 3M30A 2HK2A 2O67A 4PWDB 3CSKA 2OPPA 3MPWA 2Z0GA 1DHMA 2PEHA 4OYAA 4IG3B 3NEKA 2E5JA 4M8LA 1GTHA 2RF2B 4ZOSA 3UD4P 4ZP9A 2DHAA 3LP0A 2AD9A 3K5PA 4IFYA 2WVEA 4MT1A 2AZ3A 3CCRS 3V4MA 2CVIA 1FRXA 1G3OA 1ZBTA 2VG5A 2GAGC 3J7ZT 2JWNA 2HS4A 3R97A 2ZC4A 1RTHA 4CTAA 3PYEA 1SQGA 3MM5A 3M8RA 4ZPCA 3RBZA 1IKYB 1ZPVA 1U0HB 2RSQA 3IR5B 2JH3A 2VH7A 1NMEB 3BBFA 2BYCA 3BGUA 3JTOA 4OZ5A 4OYBA 3HJFA 2V34A 5F8MA 3JYTA 4J9MA 4OX9J 4ICLA 4DN9A 1OG7A 1RT3B 1YRXA 2ZM6J 2KI2A 3D67A 3N6MA 4E8UA 2Z2MA 2BR0A 2C3PA 3W9IA 3OVAA 1R0BG 1N6QA 2CQ3A 3GYXB 2EW9A 1EJ7L 4XPEA 3NO7A 2BRKA 2XYGB 4CRJA 1FKPB 3J80Y 1UVLA 3W2WA 4JV5J 5K9FA 2L3MA 2A10A 3KLFA 1KFSA 3VAJA 1RT2A 1F3VA 2QX0A 4ZIWA 1MYKA 1M5SA 2JFKA 4DPUA 2HWHA 1VISA 4WTOB 4OX8A 5EWGA 3L09A 1LV5A 2J9EA 2LU1A 3QQCD 2NLWA 3MM9B 4QQBA 3QIDA 2DHSA 4DCOB 4ZIVA 2UU9J 1WOPA 3DYAB 3ENAA 1WI6A 1U45A 2UVUA 1KDNA 2NZCA 1RHJB 1L3KA 4C8OA 4I2QB 3A3PB 4I4BA 1HW8A 2DNNA 5I42A 5D78A 1HNWJ 4YB1P 5KFWA 3NXZA 3HULA 2DH8A 4KBIA 4ZVTB 1SKSA 4ED2A 2HVDA 2AHOB 1EARA 1TVRA 2XNQA 1WUUA 4USJC 2KHCA 1R8BA 1TAUA 1U2CA 4DR1J 3HHLB 3BN7A 4HHHA 3P4UB 1QAYA 2MZ1A 2J0QD 2A3JA 4DR3F 2DNPA 1RCXB 2C2NA 2YH1A 3Q8YA 3OT9A 3CJ2A 1BD6A 1OY8A 2FTRA 2U1AA 1AA1B 3MEEB 4Y3CA 3HP6A 1I94F 2MB0B 4N47A 4NLOA 2J7KA 2DGQA 3F44A 2V8HA 3DNCA 2KXHA 1HNWF 1FDBA 3QJJA 2B51A 1NJYA 2MKJA 3R8YA 1I5OB 1KLNA 2GVDB 2P8IA 4P7VA 3CD0A 1HPZB 3ET6B 3KLVA 2ZITA 1RT4B 1T9YA 2D3O1 2FC8A 2DR9A 2DHXA 3AOCA 2V2KA 3AHPA 4MIAA 4U9RA 2J8SA 4OHYA 4O3NA 5HAOA 3IRWP 3MWBA 1U1KA 3CCMS 3M1VB 2CQ1A 4PZVA 4B3OB 2FLLA 2P9GA 2H54B 3FQLA 2ZH6A 4DUYF 2PT0A 4Q8FA 4NZ6A 2XS2A 5F8JA 5SZTA 5L46A 3HD1A 2MJUA 4U96A 4R8UB 3CJ3A 3M9OB 4ECWA 1S0MA 3Q24A 3M8QB 2PI5A 4LF9J 2HFZA 3HSGA 1U1NA 3DLGA 5D0RA 4QW8A 1L3TA 5DG7A 2G0IA 2WCXA 4FNHA 1RTDA 3OFFA 2CJ9A 3UVJB 2PMWA 1V3SA 1F2GA 4DV1F 3I5BA 4Q7AA 1K9MT 1FTRA 4KPCA 2ATLA 4WP3A 1NRKA 1ZA1B 1LFPA 3M2RB 2FVQA 3TZWA 5DQHA 3OFGA 3WC2A 1B28A 1RJJA 1U09A 2CQ2A 3C66A 2SXLA 2UUCF 4BBYA 3EZOA 2FVPA 4F3OA 1UVKA 3KLHA 1HNIB 2ZVIA 4HEA9 5A0YA 4LR8A 2EFNA 2DY1A 1RAGB 1WTFA 2DGTA 3MUVP 1FJGF 2HHXA 2M3DA 4IR9A 2GC8A 3QMQA 5KFFA 2OKQA 1YBUA 1DLOB 4MJKA 2IRXA 4JI1J 5EWEA 1NPPA 3TA2A 4A4JA 4D8JA 3QRRA 1RYRA 5KFPA 2GIRA 4DV7F 4UT4A 4X62F 3L95X 1GNKA 1VOMA 4P10A 3NNCA 1KP6A 2B4OA 4MFBB 4HR2A 3EVWA 5IC6B 3W1YC 5J2QA 1N36J 2DISA 4DL6A 4M5KA 2WVFA 4WE1A 3GONA 4B3TF 1TKXA 1WNEA 1X4FA 2RU9A 3BQ0A 2LQBA 5FDLB 2NR0A 5LM7E 5KFVA 4UOFA 3ICLA 2VASA 3FBFA 2ZJQQ 2BBEA 2JOQA 2LEPA 2X3DA 4QYZK 4AE5A 2HAFA 3NBPB 1XNRF 2BM1A 1Q86T 2XGPA 4O23A 2XZDB 4OHXA 2M0GB 1HI8A 2VQEF 3NAHA 3KLEA 4EBDA 4JI7F 5KFCA 1JLFA 3M6WA 1YKWA 3VVUA 3MM8A 1GT8A 1IWGA 1UEVA 3DMJA 5AXKA 5KFDA 4H54A 4RJVA 2E5GA 4WIQA 3IN5A 4DV1J 3MM8B 4O4GA 4H4MA 1XNQJ 1U02A 1EETB 2CPFA 2DB1A 2ZKTA 5C25B 2XEXA 4B3TJ 2UVWA 4ME7E 3GSDA 5IZHA 2ZM6F 1XN9A 3FBEA 4F02A 3BPDA 4I2PA 1S10A 4JI0F 4DL3A 5FDLA 2K1OA 3C6UA 5B0EA 2DGVA 2KHDA 2K6LA 3M8SA 5M2RA 4HV0A 1LEOA 4FXEA 4NRUA 3UI3A 4ZDNA 1NH8A 4P74A 3G82B 4X4TA 3K5NA 1XNQF 2WRMA 1AZSB 2DNZA 1JLCA 3MEEA 2FJAB 2UUTA 2ABYA 2VFRA 4MIBA 2PEBA 1FDAA 2HNDA 2ACMA 1IKVA 3EE3A 2FDNA 3TUIC 4U6PA 4F2SA 2CJXB 2VODA 1XR7A 2BSQE 1T9TA 1X0PA 2PGCA 2CPYA 4Q8EA 3J7A1 3HHLA 3PRVA 4M5LA 4K0KJ 2X51A 2DRBA 2P5VA 3D68A 1X4BA 1H38A 3GCXP 1RT1A 2PN6A 1S1TA 3LUYA 4UF4A 2RUGA 3PW2A 1RKJA 4CP5A 2QLWA 2YWHA 3GFXA 4O3PA 1REVA 4YUDA 3CCSS 1EQMA 3CJRA 2WB1D 4NOHA 3CUNA 2M88A 4L76A 3W62A 1DTQB 2JXGA 1DY3A 1HBMA 3D3CJ 3FVYA 4LSZB 4WU2A 4OYMA 4OX9F 4ED5A 4EBCA 1WOSA 5KFXA 5B7WA 1ELOA 3QOQA 3LA0A 3QT7A 3V4IB 4B3RF 1U24A 2AX1A 2ZOFA 4FBTA 5D77A 2GA7A 1VS3A 1LFWA 1FVQA 3H90A 3SIPB 3VGUA 3EZ5A 2BABA 1QSYA 8AT1B 1A9NB 2IVYA 3K2YA 3BSCA 3PNIA 4HH1A 4XAKA 2KXFA 2YKNA 3M2RA 3MR6A 1OJ4A 3FC9A 1M5HA 2GGPA 5HROA 3J7AN 3M8QA 1SC3B 1D8YA 2YQ3A 4Y2IA 2CXEA 1RT6A 3BBBA 2ATCB 1TUVA 2X1GA 1U0SA 4IOBA 4B3OA 4FXWA 4JV2A 4FKYA 3MMBA 2RMLA 1NDCA 1H2TZ 1LWCA 1RT3A 3M8PB 4DQIA 1Q4RA 4E2FB 2LCWA 1U6BA 4WZQA 3M9MB 3CJTA 3KLIA 1HBNA 2BV3A 4AFFA 8RUCA 3D7SB 1U1LA 1L3UA 2UXBJ 2E1CA 2BJ8A 1A0OB 3ET6A 1Y11A 2LFVA 2XSFA 1TELA 4KC5A 1PJ7A 1FKOB 2OSQA 2EK1A 1LW0A 4MAKA 4WBFA 3EX7B 1R7IA 1SJRA 4PWWA 1I6JA 1FJ7A 2ADLA 4OQJA 1KS2A 2MQOA 4LSLB 1W2IA 4E0DA 2HZVA 5C2GA 2R8IA 2AU0A 2ZEJA 1RB0A 2IHR1 4ETZA 4J37A 1S5ZA 5E0OA 4ZCMA 2OEJA 5EUHA 1R8AA 1UWAA 4M5DA 2BJ1A 1S7IA 2J9DA 3NNAA 2D3UA 2KT5A 1C0UA 3ILJA 4IG0B 4PPZA 2C2OB 2VL1A 7FDRA 2OPPB 2V8PA 1B0TA 1CJVB 1HQEA 1QSSA 4CO3A 3TJ8A 3R3TA 4JV0A 3BS9A 3GLJA 4RW9A 1VQKS 1MROB 2R9LA 4DFJA 2PD1A 1Y3KA 5DGBA 3B82A 3H59A 2Q1LA 1RGVA 1U2FA 4RW8A 6FDRA 1V9OA 4O3QA 5LXRA 4KIAA 4UW2A 3KTQA 2MHEA 1AW0A 2RIJA 2W9BA 3CO9A 3TRGA 4ECSA 2XO6A 1WHYA 1IBKF 2PSZA 2GMJA 3HXMA 1D9AA 3BQ2A 3H5SA 2KT2A 1S6QA 4CM0A 1MYLA 5KT5A 1U2RA 2BJEA 1H6KX 4NEYA 4D3GA 3BO2A 2C1EB 2C2ZB 3HSZA 2RDDA 3LALA 2NYIA 5THWA 3KJVB 3GILA 3QJPA 2DNQA 4LF9F 1HNXF 1FKPA 1UFKA 4GRSA 3RBXA 4ZPBA 4F3QA 4LR9A 4AAIA 1WEYA 3V81A 2KFZA 4DR7F 3AD7C 5KFHA 3WZ0A 2ZJRQ 2ZDPA 1CC8A 2H4YB 1RT2B 2ZKUA 3AA9A 3TA1A 3ULHA 1NSAA 5B0AA 3UN5A 4EWTA 2AJ1A 4NMLA 2BKPA 3M8WA 1VMBA 3VF0B 3KNGA 1WG1A 1UA1A 1M5OC 3DLBA 3OTOF 1F5AA 1NCLA 3W8PA 2XYHB 2VFSA 3DLKB 3D9BA 1HA1A 2JVRA 2ZUAA 1FRLA 1U0HA 3EM1A 2FHOB 4NL5A 2QL7B 1S7HA 3UE2A 4C3LA 2CNOB 1RWMB 3CJ5A 1RTHB 1T9VA 3TI0A 1JJ2R 1PC4A 2I9SA 2YQ1A 4FN5A 4PXCA 3J7Z5 1RT5A 1SH0A 3JAMU 3OHAA 3KUHA 3SCJE 4K4UA 5I3QA 1XBWA 2PMHA 2YKAA 2PI4A 1DTTB 2BDPA 4ILMA 3PDNA 3VV2B 4DOZA 1RLDA 2VJVA 5F8NA 2CQ0A 2RF2A 1JJCB 1OO0B 4I6YA 4KHMA 1HKAA 5FIIA 2ZH7A 3T1HF 2NZ4A 1Q0NA 1TFYA 2L08A 3ETMA 5B08A 5D6GA 2XSJB 2A2CA 1RAIB 4CH0S 1JIHA 4OIXA 3W5XA 4O3SA 1RBAA 1ZM4A 1Q8BA 3UPFA 2MSSA 3G4SS 1UJ6A 3D6HB 3GU0A 4BWJA 1BDTA 5CZVA 5F9LA 3IBFB 4G3IA 3MEGA 2HKEA 4WYWA 1IR2A 2MLXA 3N5FA 1JLBB 3IXQA 2Q3PA 5DDQC 3N79A 4JBCA 1XMOJ 3OTCA 4ECXA 2CADA 1ZAVA 2POKA 1JLAA 2CG8A 2DK2A 4YB7A 2UP1A 4QZVB 1UCNA 2DGUA 1TKTA 1YLXA 2H51B 4QJVA 1WKJA 2W2NP 3SCIE 2ZBQA 2IAJA 4DR6J 5FLXU 2LP4A 3DGPA 2GHVC 2ZUGA 3RU0A 1U4BA 3C2PA 3UDVA 1RQ0A 3A8EA 1QVGR 1GMVA 1MG7A 4EK2A 4F2RA 2MEWA 4LR7A 2VF3A 1HNZF 4PUOA 3QGGA 2OUGA 1V6HA 2HMIB 1XQIA 3GPAA 2HVIA 4EI2A 5ETPA 4DV3J 4ECVA 2C3YA 1BDVA 3MMCB 3Q2SC 2R2RA 3MD3A 4ZPAA 1CEZA 4JI7J 4CLUA 4KGMA 4NXNJ 1UETA 4DQRA 2IJNA 2QMXA 3FDSA 4IO1A 1X4EA 4XDDA 3FSIA 5KFSA 3TA0A 1UVMA 1VK3A 1HBNB 3ISND 2QMWA 1JLGA 4NLXA 4YB5A 3AXKA 4P2MA 5AE3A 1B64A 1PCAA 3VAHA 5KT3A 4F36A 1X5OA 1EIYB 5HMZA 1X9MA 2ZBPA 5HANA 4K0KF 3Q23A 1AT1B 3IMQJ 2OTLS 3F41A 2KJWA 2XMMA 2WONA 3I56S 1F2HA 3UCUP 2JBVA 4B02A 5JVGQ 4DV3F 1EA4A 3B4MA 3FEYB 2I0XA 3HD2A 1FEEA 4I69A 3O3LA 4Q2MA 5LL6d 4CYUA 3TEHB 3M32A 1Q82T 4TLRA 1UAWA 2CPEA 2KYXA 3BZQA 5B0GA 4BC9A 5I3UA 2RUSA 4NLSA 2IPOB 3M6UA 3NG8A 4MK7A 3WHIA 1RUSA 3SQOP 3HFVA 2BE2B 2QL5B 3V6JA 1VLOA 4PRFA 1P27B 3GYGA 4EO8A 3LAKA 3K5LA 5HJXA 4K4SA 2HHSA 1OY6A 4HT5A 4HT7A 5T7LB 4QBUA 1QDUB 2YKNB 3PYGA 3DHXA 3HHDA 3G6ES 1KBRA 4D3HA 3MR2A 4FPRA 3HCXA 5KG1A 4KTQA 3IWNC 2MSTA 3IP0A 1REVB 4F04B 3P96A 1RBLA 1R6YA 4DQSA 3V4IA 4NI2A 5C42B 3MR3A 3H98A 1D3WA 1VRTB 5KT4A 2DXFA 4FYWB 1N0VC 3HHEA 1IKWA 2MKCA 1TL5A 1KR4A 3R5JB 2UUWA 4G1QA 4NLTA 4HDGA 2CPXA 4DPYA 2BKNA 3EPGA 4AQYJ 4O4RA 1NSPA 3I4HX 2ZZNA 1G1XA 2KU7A 1HWLA 1B0PA 1XTZA 5DZ7A 4AD6A 2DHHA 1MROA 1S1TB 2EWHA 2EKYA 4ID5A 1S9EB 2CVEA 3UCGA 2PC6A 3TEGA 3MDFA 5K5MA 3PEHA 4ZP6A 3ZTQA 1QVFR 3QIPB 2HZCA 3MEDB 5HMYA 1FDDA 3G82A 4DUYJ 1M1KT 1CS4B 1HBUA 1CBKA 5E3AA 4NYPA 3HFZB 5ETLA 2IRUA 3TWZA 1TL4A 3BN4A 3EVOA 3HPOA 2QEXS 2LU2A 2DCLA 3PJWA 1FNXH 4CQ1A 1ZTWA 3N01A 1REGX 1JLCB 1KKHA 2NXUA 1ZETA 2E1AA 3H0PA 1KSPA 2B0GA 2OELA 3EMTA 4ZVUB 5FLXY 3NRBA 2QSWA 3I5AA 2QFIA 3CMAS 4DF4A 3AD8C 4P73A 1SCJB 5C7PA 1F3FA 4KGZB 1Q8LA 1RTIA 2VQFF 3FMBA 3TUZC 3PR5B 3CO0P 1IM6A 3H40A 1S1WB 3BGRB 1U8SA 2OFHX 3DMJB 3FFIA 3N5BA 4RW4B 4ZHRA 5IFMA 1YJNS 3DOKB 1R3NA 4WYLA 4F4YA 2ZOGA 3DRPA 4UZCA 3R5DA 1XMQF 4B9SA 2OFGX 3X3UA 2KL8A 2MQQA 3C19A 4N8NA 4RNHA 5HLFB 3MOJB 2XO7A 1NK7A 1K47A 2HRUA 3NBPA 3EZUA 1YJ9S 1T03B 1BGXT 2MKSA 2V4QA 3HKWA 4DX8H 3RG6A 2AYBA 4B3SF 2PFFB 3GMGA 3SDEA 3KG1A 1RXOB 2GGPB 3DFEA 4IH6A 1TK0A 3SFGA 4B9MA 4FF4A 2JLGA 1NDKA 3SBMA 4GKJF 3ZNUA 3CCTA 4IQMA 4NLYA 2H1YA 5G0RB 1SL0A 2X1FA 2DNRA 3HHKA 5D0HA 4ZITA 3W3SA 4QWEA 4EU0A 1Y3JA 2HHWA 2UZAA 2ALYB 4OI1A 4EZ6A 3FSXA 3MPVA 4DPTA 4NXNF 1SV5B 3V6KA 1DLOA 1RTJB 2GMHA 1SPBP 1XNRJ 4ECZA 1Q95G 3B78A 1HMVB 5KFQA 2UXDF 2F8EX 4NA3A 4ZVGA 3GV7B 1X5TA 3LANA 4NLQA 4GKKF 4RUHA 1YRTA 1N33F 5L8RC 1VJWA 1K1SA 2A2DA 2RDIA 3K89A 4K4VA 3AB4B 1WSRA 4LF5F 1C4CA 2I1RA 5IM0A 5T14A 1Q78A 3QBCA 2LQ8A 4USVA 3Q0AA 2G13A 2KFYA 1NB7A 5IV3A 4TY9A 5LXYA 3CW2C 5MAOA 4PEOA 3Q89A 1MMNA 2M5YA 1BC6A 1NZAA 5E3CA 5K20B 2R2SA 2L9WA 4DR4J 1HNZJ 3CTRA 1IQTA 1XC9A 3JS9A 1M5VC 3MR5A 3NWGA 2HLTA 1KVKA 5B0BA 4USTA 2FHJD 4ANEA 4LF4F 2PDAA 2ZHBA 2QA2A 4O44A 1SKUB 1VHIA 2EBGA 1ZS6A 3DLJA 4LVOP 3R7NB 2R7UA 4HI2A 1VBKA 3D0HE 4ZCIA 4PG7A 1RTDB 2LDIA 2EK6A 2V9KA 5AXNA 4H4KA 2WW8A 2HEKA 2G4BA 3AXMA 3DLGB 1YWXA 3CGIA 3GV5B 2ROPA 5HL7Q 1AYEA 2CNKB 1EKSA 4KE5A 4CYUB 3MI7X 5L1IA 1SH2A 1WWHA 2MZJA 2XMVA 4X66J 2KXNB 4UQGA 3VEBA 1X4AA 1UP1A 3QAUA 3TQEA 2R2TA 1NK8A 3RR8A 1SBRA 2JC1A 2XYPB 2IMWP 2LXIA 1BMQB 3A8IA 2Q6CA 3G96A 4ZPTR 2W9CA 3VZIA 4DR6F 4NLPA 3M6VA 1RT4A 4KGKA 4XK8C 3RGIA 3OVBA 3LTOA 4FPIA 4PXDA 3IRXA 1NHUA 4NYOA 2O5DA 2A2BA 5LT5A 1NHVA 4DR2F 1VRQC 4P72A 2Q2KA 1YHQS 1TL1A 4ZVOB 2H5EA 3MHYA 3H42A 2IBKA 3QIPA 1GFWB 2R4FA 4RWXA 2Z30B 3A13A 2BMBA 4OJGA 1WG4A 4ZJOA 4CCHA 2YBVA 1PO6A 3LP1B 5LMNJ 4A8YA 4FBUA 2QL9B 4J9LA 2CJYB 3DDIA 4LFAJ 2JSXA 3SCLE 4X84A 2VICA 1WC0A 1VRUB 4IKAA 2KFNA 2YPYA 3SXLA 2XY6A 3JB9k 4YB6A 4TU7A 1CVJA 4A8FA 2DRAA 2G2OA 3O6QA 6AT1B 1FXRA 3KK1B 3TR5A 2MGZA 3IR6B 1I94J 2M7SA 3KLHB 3JSMB 1TV6B 4DXLA 1W2BR 5CXTA 4DUTA 2KM8B 2M2BA 4QWBA 1FX4A 3CCVS 2D3OR 3TVKA 2HGLA 4ZVPB 4R25A 3RR7A 4WWSA 3C15B 1VQOS 4LQ3A 4EYHB 3M9NB 1QM9A 5A8RA 3BREA 3MEGB 1HWJA 3ETOA 5CZXA 2C3OA 2QFJA 2MQNA 1S49A 2RQCA 4OZLA 4B9TA 5I4MA 2VOPA 3GIRA 2ZHOA 1GX5A 2W2OP 3NMRA 1RHUB 2WZ1A 2UU9F 4LF2A 2HFSA 2CA9A 4I1TA 2NXCA 2AJFE 4ELUA 2A0FB 2VBYA 2IA0A 1ACMB 1ROFA 3FRZA 3OTDA 4GVLA 4UQTA 4WFZA 2VQFJ 1JXEA 2QA4S 2AJ4A 1X7VA 1FCAA 2YKQA 3TUJC 4YFUA 2V5HG 5DLFA 1IBLF 5CYQB 4RWWA 1C0TA 3GB0A 1DTTA 1OYDA 2GZOA 2VG5B 3AY0A 4TU8A 1GQEA 4RNOA 5E7OB 2Z2LA 1B7YB 1AROP 1LXNA 1RT5B 3AJ1A 4NA1A 1C1BB 3C14B 4IFYB 1X4HA 1KQKA 3EPIA 1C1CA 1SUQA 5L1JA 1H73A 1WELA 2IY5B 1CLFA 5D0EA 4RUBA 1AXQA 1MMDA 4CTAB 3N9UC 4KO0A 4DX7A 2CPIA 4CNZA 4ZKAA 2AJ2A 5IQQA 4RZRA 3JQMA 5KFAA 3RYLA 4QWCA 2MQMA 4TVAB 4ED0A 2R8KA 2CUYA 4TKTA 3A3NB 3SZ2A 2ZNZA 1BXNA 1WDDA 1FWLA 3H7HB 4ZVFA 5HSPA 5K8OA 2FJWA 4B9UA 3T6JA 2V9WA 1WEXA 2D74B 4IG3A 4P52A 5GMEA 3W5ZA 1GXUA 2NUUG 2DGXA 2XM3A 3GIKA 1YITS 4PQUA 4DV0J 1QE1B 3PRBA 1RK8A 1Q8KA 2IM2A 1UWBB 4KKOB 1SC6A 3NCPA 4QR0A 4N56A 2KVIA 1IKXA 2P6TA 1KLMB 1V5VA 2XI2A 5KOXA 4DUZJ 4AL6A 4JOUA 2DNLA 1L3SA 3IBCB 2PO4A 2QLXA 5DZ6A 1U49A 2HWTA 5IOLA 2KELA 3GZ7A 5E3RA 4CO2A 1T94A 3K57A 3T1YF 5JMNA 1P1LA 2ASLA 4ECYA 1FWKA 1RWPB 2DXEA 4NCGA 4CI0B 2R7RA 3PX4A 4N76A 2E9TA 2GNKA 5ETQA 4UTGA 3T9ZA 5HN0A 2B6AA 2CFXA 2DTJA 3FCHA 2IIHA 2ZC3A 4ZJLA 3MM9A 1VQ7S 3VAIA 4NCGB 4LJMA 3MAAB 1G7CB 4F8RA 3NMAA 4K4ZA 3ZZRA 4DN0A 3PIOQ 3F0NA 3OVSA 3PW0A 4AL5A 3KFWX 3DLHA 2V63A 5CYJA 5J1PA 1UJ5A 4I0WA 1IBKJ 2HHPA 2H65B 3R6LB 4AXIA 5I3PA 5F3TA 2OPSB 2E5IA 2ADCA 2DXDA 5KFGA 1CJKA 2OH2A 5KT7A 2MYFA 3CJSA 4RR5A 3TJAA 4YR2A 4DL5A 2MQ8A 4DQPA 2UUAF 1WHXA 2D7SA 3TAPA 1EB0A 1VI7A 2FLOA 2CPJA 3DI6B 5JUMA 4LSLA 4DJBA 5C2CA 2HBRB 2H5JB 2RD5C 2M4MA 4WJBA 1S48A 5DDOC 2MZTA 2QLFB 2E29A 3MGJA 2WBMA 5BYSA 4QU7A 1J5EJ 3G71S 1OSCA 1NJWA 8ATCB 1E6VA 2O66A 3CD7A 3NP5A 4C3MA 2LQ9A 1ZAWA 2XMWA 4KR0B 2AYMA 2ZFHA 5HVFA 1S99A 4X4UA 2GJ2A 4TNOA 1HI0P 1TUGB 1NKCA 1DRZA 3JTPA 3IAM9 2BXJA 3D66A 5CD4A 1IR1A 2ZH8A 1KD1T 4N77A 3G6YA 3DRSA 1V5IB 2I8EA 1F0XA 3QFWA 4I56A 2MKIA 2FGOA 3QT6A 5A8RB 3W60A 4IH5A 3E51A 2AYGA 1NHKL 3TX0A 4RX6A 1KFDA 1J5EF 2ZH1A 2DH9A 4ES2A 3CVKA 1ZM3A 4GO7X 2NPFA 2DITA 5F8GA 4IRKA 2KKEA 4YQWA 4OZ2A 1OQ6A 1MWQA 2ZNYA 2ILYA 2GHWA 3C15A 4LFBJ 2CJBA 4TY8A 2GX8A 4JI6J 3QLHB 5C24A 3P8BB 2VG6B 3HSDA 2PA3A 3OFHA 3TYTA 1KTQA 4AYBD 4RPFA 5AJ3J 1YTYA 2F4VF 3BSAA 5J1NA 3A8KA 5DLGA 2O1PA 4DR4F 1Q16B 1WC1A 1HYSB 2CJKA 2W8LA 4M63A 1CJVA 4NLWA 1YSJA 3LPEA 1KHVA 3ITHA 3K59A 3D5MA 2V2QA 2AMCB 3PCOB 1GAOA 3UDCA 3OXFA 2VBXA 3CD5A 5DQGA 2VU5A 3FJ2A 1W25A 5D4LA 2QJ3A 3MM7B 3QYYA 5D4NA 4DZDA 4O3OA 2M9KA 2VFVA 4C3KA 5GAGU 5MLCV 3BO3A 3AOAA 3M2VA 5KFYA 1S6PA 1QJHA 2DJWA 5HMXA 2IFXA 5KFJA 2K1RB 1F9HA 4R0EA 1RA6A 1LW0B 4C97A 5H1SV 2M8DB 2V68A 5KFIA 3MECB 1JNRB 1YIJS 3G6VA 4F0MA 1VQ6S 5HQMA 3RJMB 4IOAQ 2R7OA 2A18A 4IFVB 2VA3A 3GYNA 1ZZNA 4ZP8A 3ISZA 3JTNA 2C28A 3R5AA 4Q0BA 2LLZA 3K5OA 5E3QA 1EP4A 2Y1LB 3GCWP 3QATA 4NE9C 1OWXA 4ZMMA 3BGRA 4LMZA 1DQAA 1RT6B 3CMQA 3EXCX 4ZK7M 5LSRA 3GXQA 3GJSB 4B3RJ 1RAOA 2HHVA 1YQHA 1Q5YA 1HHSA 5CH7B 2CIMA 1PBAA 5ETVA 3CIZA 4DZ6A 4XIUA 4PG5A 4KFBB 2UVRA 2HFOA 1FFGB 3RRKA 3ZZZA 2F9DA 2FQQB 2GW8A 4CWBA 4IUFA 4ILLA 4X64J 5HVGA 2HW3A 5IWAF 4RBTA 4F4ZA 4Z7YA 2K9IA 3BGFA 1LW2A 3M7VA 3HM9A 4QYRA 5GAHI 1J5OB 1D0EA 3B54A 2VQEJ 1E6YA 4JUZA 3OTEA 4F0KA 1FK9B 2K7JA 4QIWD 4CM2A 4RU2A 3BB5A 1JLQB 2VC1A 3TQ1A 3WDOA 2QZ8A 4YHHF 1S9EA 3KLGA 1VQMS 3CD6S 3POTB 5BYRA 2CQCA 1VQ5S 2QTWA 1RISA 4BHQA 3RTVA 5KT2A 4J9SA 2AZ1A 3IC1A 4L73A 4LRCA 2E5LF 3T19A 2EVZA 5E41A 2JLEA 1YJRA 2VDHA 4ZLLA 1SJ3P 1J5OA 4DR7J 4ZCLA 2OP5A 4ER8A 4C8LA 2HNDB 1YJ7A 3GG0A 3QSIA 3TAMA 1HMVA 1QD1A 1M0SA 4EGLA 1AZSA 3HVAA 3KJFB 1U8WA 5GADI 5ADZA 3P49B 2PMZD 2NUHA 5F8HA 1AFIA 1SV5A 1CJUA 1FFSB 2A1BA 2KG1A 1NZ8A 4DU7A 1FD8A 2CJAA 1YK9A 4L75A 1VJQA 1N5YB 3G8TA 2D3ZA 4JI4F 2HSEB 2V8VA 4I2PB 1FI4A 5EX0A 2YKMA 1H7XA 2RDJA 1HHQA 3QAEA 1P9QC 2ILZA 2WSCC 4JP8A 4Y2KA 4DPOA 3HHLD 2BACA 4OX6A 2YXLA 2IVMA 3Q8QB 1NJXA 2OPQB 5DS7A 3C8YA 2L48A 3D28A 3LQVA 4H4MB 5EX3A 4DSFA 1QSLA 1JWWA 1S1WA 4ZHRB 5IWAJ 2VOOA 4HLBA 4OJ1A 1OHNA 1IJEB 2F40A 4C0HA 2BNWA 4RW7A 2VFUA 1VC0A 3CMES 2R7WA 4EUVA 2XWYA 1VQ8S 1X8DA 3NGTA 4DV2J 3OL9A 1FT8A 4NASA 5FJ4A 3FFIB 2V94A 1K73T 3VW4A 1RU1A 1T8EA 2Z58B 2W24A 3M2UB 3DGVA 3PVXA 4CLZA 4LRAA 2XMJA 5CYMB 4ENOA 2B43A 3IAS9 5IXUA 2LXFA 2RQKA 2OMLA 4YY3J 2ZJPQ 1JJ4A 1CPZA 1RCOB 3R27A 4L74A 1GMWA 3GFHA 4RO0A 1DBDA 1SC1B 4KV8B 3T1AA 4X4NA 5IT9U 2GJFA 2Z4PA 3H25A 3J81Y 5K8NA 4L6V3 3PX0A 4N8OA 4V19X 1JJHA 3BV8A 4FYYB 5GMDA 4IDKA 1Y5LB 2W7AA 5K8PA 2J6UA 1K0VA 5AXMA 4X4PA 2JL9A 4DHVA 2KT3A 4F50A 1ZTTA 1HIYA 4DR2J 3NAIA 1EAYC 1G6BA 3D4JA 3DM2A 3I0RA 3KUGA 3MEDA 3MTKA 3QLHA 4RL1A 5C24B 1R0AA 1T0TV 2IA6A 5DM6Q 3U02A 1B01A 4ID5B 1TKTB 5A0YB 4A46A 1HNIA 5DDPC 5J1EA 2X1BA 1IQZA 4G6VB 3KMQA 1B4SA 4NLRA 5T41A 1DURA 1TK5A 1NU4A 4X62J 1JLBA 1O5JA 5C42A 2W7OA 3HO1A 2R7SA 4DV4J 3A4TA 1NDLA 1S59A 4Y6IA 4WZMA 3GE9A 3QRPA 4PG6A 1VGYA 1MN7A 5A8WA 1Q81T 3U1LA 3J81U 4J9PA 1FKAF 4LF6J 4F4XA 2BOPA 2HHUA 2V6AA 3U1NA 1CC7A 3R6GB 5H9EJ 2CQBA 3IO1A 3IWLA 3FCWA 2VKZG 3JSYA 4A48A 4ID8A 2L9DA 2ZBCA 3NCQA 1WOOA 2JJ4D 2Y1RI 1Z2ZA 2Z2ZA 3O1LA 3W63A 5HVHA 4Y00A 3MUTP 2A6MA 4Z2XA 4J9RA 3UR3C 3VAKA 4LF4J 3M1VA 4OYZA 4CLKA 4OZJA 1S12A 4LFBF 2QG9B 2VBZA 1RWKB 3ZZ0A 4A8SA 1CSJA 1WHVA 5L39A 1MMLA 3H5UA 2W7PA 4CLPA 1LWFA 3QO9B 1XERA 2HQ3A 3NOGA 4PABA 3THTA 4NYZA 2QT7A 3W61A 2ZH4A 2VKRA 1SB6A 3CIMA 1HQUA 1P8GA 2Z2YB 3K8WA 2EFVA 2DCUB 1S9FA 1N34F 2G2YA 1N48A 3RBEA 2AKWB 3TZZA 3QT8A 3SSQA 3UDLA 5KFTA 3T5LA 4YN3B 1UPMB 4DSLA 1EX8A 5D3GA 4FXDA 3DRRA 3UWTA 2D41A 3B4DA 3CNQP 3LP0B 2R7TA 5HI7A 1G2EA 4KHPJ 3SSSA 2F9JA 4Q45A 4JYAF 3US5A 2NREA 2B7CB 4DV5F 2QIFA 3TX8A 4OYPA 3HFKA 1H7WA 2EG1A 4IO9Q 3CDUA 3H4DA 2OPSA 1RHMB 1RWNB 3CCLS 2IAJB 3KMSA 1U48A 4LUBA 3MCMA 4LSNA 1RYSA 4U7UD 1N0UA 4PYAA 3PACA 2NCKL 5HP1A 1PJ5A 3I96A 4S0MA 3E8OA 2UUCJ 2MZRA 1B70B 2EEYA 2C2DA 1MN9A 4M5NA 4MYUA 2WVCA 3CE8A 3DGPB 5EHHA 3J7YI 1D9DA 2RRNA 4TY8B 3D0IE 1FNMA 1FRMA 4G65A 2GQCA 2HBQB 2RH3A 1OIAA 4HTJA 4X64F 3KNAA 1PJ6A 3U1MA 5GAHU 1S76D 4NLVA 3DDNA 5J2PA 2J76E 5E3PA 2N3OA 4F7VA 1GXTA 2E1RA 2VD3A 3ZXWA 2QYGA 3PW4A 1FO1A 1HQEB 3VEAA 1NK0A 2V0NA 2HS3A 4PXEA 2OPRA 1VC5A 1QE1A 4KH1B 1N8RT 1FTCA 3ENQA 4IG0A 2XLKA 2ZZMA 2B5JA 2MQLA 4WKRA 2AGQA 3I9V9 3H8YA 1ULRA 1FX2A 1XIQA 5KG7A 2OMOA 1C2PA 1WF2A 2ROGA 2FZKB 3O8WA 2FZGB 4FYXB 5D3GB 1A6LA 3GIIA 3P5BP 3VAGA 3MM6A 2K3IA 3G87A 5CYQA 1QTMA 3EJMA 2J9DE 3MM6B 2BX6A 4Z37A 1KVIA 3DRYA 4TLQA 5IT0A 3VALA 4IRCA 3QO9A 4ZVSB 3AFGA 3PKMA 4ZLPA 1Y9OA 3W65A 7AT1B 3DI6A 3RUBL 2FHJA 1NAQA 1UEKA 2P9EA 3NOCA 5CAAA 2ZE2A 3UR0A 3MAQA 4O0IA 4WIIA 2B5JB 4U8YA 1VCTA 1JLEB 4KY3A 2YNHA 4F26A 3TZXA 3DLKA 2HGMA 3CJ0A 5ETNA 1BUXA 2BQRA 1U6ZA 5IT4A 2ZZTA 9RUBA 3OUYB 1TZ0A 2DNMA 3UCZP 1NO8A 4WFNQ 2IBOA 3PO5A 3BH6B 3P3DA 3OLBA 2M8HA 3K0JA 4OL8A 4NLDA 3OQ2A 2DGWA 5BJRA 2RS2A 2UVVA 3MXHP 1U1RA 1S1XA 1S6QB 2DIVA 4OHZA 4JI4J 3NS5A 3DC2A 2CWKA 4WPAA 1PAEX 3KK1A 2ZH2A 4FNIA 1IVZA 1UFLA 4CZCA 5KFNA 4JI5J 3THVA 2Y0SD 2LQ5A 1VYAA 2LVWA 5BYQA 4EO6A 4W92B 2W9BB 9ATCB 5GAEU 4DL4A 4LRBA 2MZSA 3N28A 2K06A 3JSMA 4AXJA 2QC3A 1UFWA 4RW8B 2WAQD 1WSVA 2XS5A 2O3DA 1FDNA 3R2CJ 2Q6BA 3OBIA 4WFYA 1BY9A 1FNOA 2RRBA 2XY7A 1T3OA 4B3SJ 5EGYA 4K7QA 2HQDA 1F5BA 1VRUA 3I0RB 1R0AB 3WIVA 2NYHA 4DPWA 3GIJA 2Y1IA 4B9LA 3OXLA 1PILA 2AWZA 1TL3A 1UVJA 4PKDB 2IDLA 5LMUJ 3K7RA 4FYDA 3I9ZA 1T3NA 5KG2A 2AW0A 1NK6A 2V2VA 3Q8VA 5B0DA 1FJCA 5JXSA 4Y2MA 3FT7A 2XMUA 1I1GA 1WJ9A 4KV8A 5ETOA 3S6EA 4WXOA 3G5OA 1VC6A
chains in the Genus database with same CATH topology
1ARQA 3BKUA 1IRQA 1PARA 1QTGA 2CAXA 2BJ9A 2K29A 2BNWA 3FMTA 1MNTA 2WVFA 2NZCA 3QSIA 3LGHA 2HZAA 3VEAA 2BNZA 1B01A 2WVDA 1B28A 2CA9A 2CPGA 3VEBA 2FGCA 3BKTA 2K1OA 1BAZA 2GPEA 2K9IA 2CAJA 2JXGA 3VW4A 3BKFA 2K6LA 1EA4A 2JXIA 2BJ8A 1NLAA 4FXEA 2BJ3A 4HV0A 3H87C 3QOQA 2BA3A 1U9PA 1BDTA 1ARRA 2WVEA 2H1OE 2WVCA 2K5JA 3OD2A 1Q5VA 1BDVA 2Y3YA 2KELA 1MYKA 1MYLA 2AY0A 2PC6A 2BSQE 2RBFA 2HZVA 3PHTA 3GXQA 3FT7A 4D8JA 1X93A 2JXHA 1P94A 2BJ7A 2F1FA 2CADA 2WVBA 1Q5YA 4ME7E 2BJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARQ A;  3BKU A;  1IRQ A;  1PAR A;  1QTG A;  2CAX A;  2BJ9 A;  2K29 A;  2BNW A;  3FMT A;  1MNT A;  2WVF A;  2NZC A;  3QSI A;  3LGH A;  2HZA A;  3VEA A;  2BNZ A;  1B01 A;  2WVD A;  1B28 A;  2CA9 A;  2CPG A;  3VEB A;  2FGC A;  3BKT A;  2K1O A;  1BAZ A;  2GPE A;  2K9I A;  2CAJ A;  2JXG A;  3VW4 A;  3BKF A;  2K6L A;  1EA4 A;  2JXI A;  2BJ8 A;  1NLA A;  4FXE A;  2BJ3 A;  4HV0 A;  3H87 C;  3QOQ A;  2BA3 A;  1U9P A;  1BDT A;  1ARR A;  2WVE A;  2H1O E;  2WVC A;  2K5J A;  3OD2 A;  1Q5V A;  1BDV A;  2Y3Y A;  2KEL A;  1MYK A;  1MYL A;  2AY0 A;  2PC6 A;  2BSQ E;  2RBF A;  2HZV A;  3PHT A;  3GXQ A;  3FT7 A;  4D8J A;  1X93 A;  2JXH A;  1P94 A;  2BJ7 A;  2F1F A;  2CAD A;  2WVB A;  1Q5Y A;  4ME7 E;  2BJ1 A; 
#chains in the Genus database with same CATH topology
 1K8A T;  4LFA F;  3IRX B;  2MTL A;  2J5A A;  3THP A;  4HYK A;  2FJE B;  4C48 A;  3FZ2 A;  1PAU B;  3MEK A;  3OR2 B;  4CT8 A;  5KT6 A;  2DYA A;  3LGH A;  1KOH A;  4Y65 A;  4ZN3 A;  4WFB Q;  2H3A A;  1HAR A;  2U2F A;  3I31 A;  2XTJ P;  4HHU A;  4DX6 A;  1HNV A;  3NNE A;  3PJ9 A;  4GO5 X;  1OPZ A;  5LMU F;  3L3C A;  4UUX A;  1PBU A;  2XB2 D;  3X1L B;  2Q79 A;  4GKJ J;  3MMB B;  3B8H A;  5DET A;  1MU2 A;  1RKI A;  3BJY A;  4QU6 A;  4EYI B;  1MLA A;  4ED8 A;  4OI6 A;  2F3J A;  1RT7 B;  3ONQ A;  2I5J A;  1WC5 A;  3J7Y U;  3D54 A;  4ITS A;  1Y5N B;  1BQM A;  2AYE A;  3AH6 A;  3R1L A;  3Q2T C;  2R42 A;  2WK4 A;  1FF2 A;  1LWC B;  2BW7 A;  3OPK A;  4LFC J;  1UW9 A;  4ZN1 A;  1H2V Z;  4J9V A;  2XMA A;  4DQQ A;  3DU6 A;  5A8W B;  4X66 F;  5KG4 A;  1N5Y A;  1Y00 A;  3NGK A;  4PXB A;  2DEI A;  2RQ4 A;  2QYC A;  3GWC A;  4FDF A;  4Y2A A;  5L9N A;  3SQG B;  1HBM B;  4DWI A;  3GFZ A;  1CJU B;  3CCE S;  2KOE A;  3EYZ A;  2HVH A;  2R3V A;  2WVD A;  3BKT A;  3KG4 A;  1JKH A;  1SJ1 A;  4K5R A;  4H4O B;  4QIG A;  2R8J A;  4AND A;  1KQF B;  2LEA A;  1D9F A;  2IM0 A;  4PG8 A;  1S9G B;  3PX6 A;  1RAA B;  2VBW A;  2MKK A;  5LJ3 Y;  1YVF A;  4Q43 A;  2VV5 A;  6FD1 A;  1S1V B;  2OD6 A;  3HHL C;  3PXG a;  4A8Q A;  2FB0 A;  2JEF A;  4EFA C;  2DGS A;  3BF4 A;  2Y8W A;  4QCL A;  4ILR A;  2Y0B B;  1RU2 A;  2E9R X;  4DR1 F;  3IBW A;  2M70 A;  4KHP F;  3PHT A;  3SI8 A;  4XTT A;  3POT A;  4UOG A;  2BJ7 A;  1IBC B;  4J9O A;  1GXL A;  4EMD A;  4DEZ A;  5M2U A;  3QGI A;  1GX6 A;  3BKU A;  1M90 T;  3C46 A;  4YS2 A;  1VQ9 S;  3OV7 A;  4B9V A;  1TU0 B;  1EKR A;  4FS2 A;  3JSB A;  4J90 A;  3W64 A;  3MPD A;  1IBL J;  1H98 A;  2GVZ B;  2HUR A;  3FNN A;  4HAC B;  4ZPW R;  5J2N A;  1JXL A;  2AJQ A;  2F8H A;  3VQT A;  2FLN A;  1UW4 A;  1WC4 A;  4CLT A;  3IR7 A;  2GML A;  4X4R A;  3PW5 A;  1T03 A;  5L1K A;  3G86 A;  4A8K A;  2C2E A;  2N4D A;  5F8L A;  2HVE A;  2RJZ A;  4GVB B;  5ETS A;  3EVM A;  4K4Y A;  1HWK A;  3AT1 B;  4DV6 F;  1HR0 J;  2XNR A;  2Y1J A;  1IJF B;  2EC2 A;  1VQN S;  3U7J A;  3Q8R B;  2Y8Y A;  2JRS A;  1EZZ B;  2I5J B;  2ASJ A;  3RW6 A;  2UXC J;  3HZE A;  3CF5 Q;  1TKD A;  1HNX J;  1YJT A;  2YKO A;  2YPZ A;  4YR0 A;  3PEJ A;  1U6F A;  1WI8 A;  1BQN B;  2QN6 B;  2YY3 A;  3KLE B;  2XMT A;  1ARQ A;  3KJN B;  4TYB A;  4URQ U;  4WK1 A;  3T5H A;  3DRP B;  3CDB A;  3IA0 A;  1DZ5 A;  1MW7 A;  4M95 A;  1TR0 A;  4FYV B;  3JQJ A;  3S7R A;  1NKB A;  3JQK A;  2VPW B;  5F3Z A;  5A2Q U;  1JLF B;  1NM2 A;  2H3E B;  3HT0 A;  2MKH A;  3I5C A;  5A2Q Y;  4ECT A;  1QAX A;  3EGN A;  2D9O A;  1WTB A;  4I7F B;  1JK9 B;  1RLC L;  5EDW A;  4GVB A;  1S57 A;  4GC6 A;  5KFO A;  3T1Y J;  4J9Q A;  2J6S A;  4ED3 A;  2FVS A;  2XQC A;  3M2V B;  4QW9 A;  4HL9 A;  1NJI T;  2YWW A;  4ZCK A;  2FZC B;  4URG A;  4I64 A;  1H2U X;  3MM7 A;  1SH3 A;  2OIH A;  4WE1 B;  1RBO B;  1XK8 A;  1VBX A;  1P94 A;  5J2Q B;  4J5O A;  4G1Q B;  3UD5 A;  5U47 A;  3ZZO A;  1S9G A;  2CAX A;  2CNN B;  2HBZ B;  2K29 A;  4F0H A;  4TU9 A;  3HK2 A;  3FMW A;  3LAM A;  2BEF A;  2BZ2 A;  2NXN A;  2Z8Q A;  2ZVS A;  3TOQ A;  4ED4 A;  3OJU A;  4I2Q A;  4IQX A;  1RTJ A;  3OTB A;  4USU A;  5H9F J;  4ANC A;  5H9F K;  2DT9 A;  5RUB A;  1Y0H A;  1LW2 B;  4G1P A;  2OSR A;  1VHF A;  3ZZU A;  5KG5 A;  5IQ6 A;  1U9P A;  3FBC A;  2ZH9 A;  2CQ4 A;  2DH7 A;  2QGF B;  1RAD B;  3T41 A;  3W7B A;  5KFE A;  1FRH A;  2J9C A;  2QA1 A;  2R7V A;  3FGV A;  3HI9 A;  2KM8 C;  3PO4 A;  3P6Y C;  3KHR A;  3JSR A;  1Z2L A;  3ZO7 A;  2ALZ A;  1FJG J;  1HL6 A;  1FFW B;  3PHE A;  1BQM B;  2AEM A;  2ZH3 A;  4M5J A;  4ED1 A;  1PIE A;  5CQG A;  2RE1 A;  2MMY A;  2YTC A;  3N6L A;  3O5T B;  1S77 D;  3CUL A;  3H5Y A;  3TAR A;  2C2R A;  2IC3 B;  1R31 A;  4PCQ A;  2Q66 A;  2HHH J;  2DIU A;  4X2B A;  1FD2 A;  4HI1 A;  4QPX A;  1VK8 A;  3DOK A;  3IG1 B;  3ZC4 A;  1XJW B;  3DN9 A;  3FKB A;  3GFY A;  2J0S D;  3E2E A;  2CQI A;  3QPI A;  3F56 A;  2JDJ A;  1E6V B;  3NKY A;  4RW6 A;  1IKY A;  4MIW A;  4OYO A;  4DL7 A;  2C22 A;  1ITP A;  1NLA A;  1HI1 A;  1MNE A;  1B3T A;  3SV3 A;  2I6W A;  1ZOT A;  2RHS B;  2XG8 A;  1S6U A;  2CPH A;  2ZD1 B;  3EDR B;  2F4F A;  2K1R A;  4QIV A;  1RWX B;  2H1O E;  2UUB J;  4KPY A;  3LP2 B;  3OD2 A;  2K5J A;  1S79 A;  2P9C A;  3PYD A;  2JEJ A;  3GSI A;  1Q7Y T;  3NGS A;  3PTW A;  5BR8 F;  3DU5 A;  1VIX A;  2AP6 A;  1O6X A;  3WC0 A;  2FHK A;  2J6T A;  2CRL A;  3M4X A;  4OI0 A;  1HFE L;  2DKO B;  2CWX A;  3A3O B;  2PII A;  4DV2 F;  1RHK B;  3GTY X;  1N34 J;  4JI1 F;  4NLG A;  2KZZ A;  1AFJ A;  1CS4 A;  2R8H A;  2F65 A;  3ITH B;  2BJ9 A;  3G2X A;  3MPY A;  2J7W A;  2HPU A;  2VUG A;  2HHQ A;  1FVS A;  4OV6 A;  3PIP Q;  1OQ3 A;  4USI A;  2G1D A;  3D1H A;  1ZH5 A;  1R43 A;  3H4B A;  1FXD A;  2ZWO A;  2WW4 A;  2VG6 A;  2C3M A;  1VLY A;  3H87 C;  2F5G A;  2H48 B;  1RDR A;  2WHO A;  3MAA A;  3MOZ A;  4FVM A;  1DFD A;  4U7C A;  5IV4 A;  1YZ7 A;  1X5S A;  1VRT A;  1ARR A;  1HLW A;  2EFG A;  2YWF A;  4YR3 A;  4K50 A;  2J8A A;  3FRY A;  3RB4 A;  4JI3 J;  1FRJ A;  2IM1 A;  3I32 A;  3RZA A;  4QWD A;  1NUE A;  5HP1 B;  4DMZ A;  3CJQ A;  4JI2 J;  1SKR A;  4C11 A;  4DX5 A;  3QSY B;  3MFI A;  4F4K A;  2RKI A;  4Q5V A;  2XBP A;  1PYT A;  4QIE A;  4B17 A;  2B4P A;  3CDW A;  4FXV A;  3MMJ A;  5IS2 A;  1VQP S;  3RRH A;  2F4V J;  2V4J B;  1BHN A;  3DOL B;  1VDH A;  3FBB A;  2BNZ A;  1ZPW X;  2QSF A;  3C16 A;  3HJV A;  4MKV A;  5A6W A;  4OLO A;  2CPG A;  1RWO B;  1X4C A;  3VVT A;  4CDI A;  1RWU A;  1X31 C;  4I6A A;  1YDL A;  1HD0 A;  1NPR A;  3BKF A;  3HVT B;  3M32 B;  4ICL B;  2Z57 B;  4DUZ F;  2W4C A;  5H9E K;  4PG4 A;  4X4Q A;  3GJT B;  4YHH J;  3MUM P;  1X0F A;  1JLE A;  1S97 A;  4OI2 A;  1N6Q B;  4ELV A;  4F4A A;  4K8R A;  1XR6 A;  3SMZ A;  2KG0 A;  1T02 A;  4WXW A;  2XCP A;  2WOM B;  3K17 A;  1Q5V A;  4P6Q A;  1HQU B;  3KK2 A;  1FXL A;  2BA9 A;  2DD8 S;  2FY1 A;  1Y5I B;  3AQO A;  3LGM A;  3VQS A;  4K4T A;  4OHW A;  1C1B A;  3C14 A;  3JYT B;  1S0V A;  2VG7 A;  1NK5 A;  4DR5 F;  2LYV A;  4P2F A;  2L9N A;  4KQZ A;  4OHV A;  1OY9 A;  4W4M A;  1WEZ A;  3ILO A;  2W4D A;  4WCE Q;  1CG2 A;  3V6H A;  2ASD A;  1SJ4 P;  1MNT A;  3CJ8 A;  3VR1 A;  3T5J A;  2NXE A;  4HKQ A;  2HNZ B;  1JNZ B;  3ZTO A;  4LF1 A;  1F5C A;  2GAH C;  3QNW B;  3TVZ A;  3D6T B;  1S72 S;  4PWD A;  2KTQ A;  2GIQ A;  2HMI A;  4WP9 A;  1WAC A;  2RKI B;  2OTJ S;  5C5J A;  4XDC A;  2DPI A;  2DR7 A;  2FJD B;  2MPU A;  3JXO A;  2LDY A;  2BE9 B;  2V4J A;  3DOL A;  2UV8 G;  1S0O A;  4WFX A;  2UXB F;  1YX2 A;  3OR1 A;  2B8Q A;  3C3L A;  4DV5 J;  1UEU A;  3MUR P;  3E3X A;  3V5R A;  3GP9 A;  4TN2 A;  1Q8I A;  4K5S A;  4LRE A;  3KJV A;  2NPI A;  5CHC B;  3WBZ A;  1N54 B;  4DPX A;  1WKL A;  2YX4 A;  3KYL A;  2JZ5 A;  1KNZ A;  2MGZ B;  4LBI A;  4C0B A;  2E7W A;  1OYE A;  3FMT A;  3ISN C;  5CCM A;  1KLM A;  2B4V A;  3Q22 A;  4EZ9 A;  1PYO B;  1LWE A;  3L7P A;  2EI5 A;  4C98 A;  1HHT P;  3W5Y A;  4AL7 A;  4KKO A;  2MY8 A;  4OI4 A;  4NZ0 A;  3K8V A;  4PAA A;  3T6B A;  3K58 A;  1UPP A;  4NWB A;  3PW7 A;  3HHN B;  5A8K A;  3A8J A;  1GK8 A;  4RW9 B;  3H2U B;  1XMQ J;  2RU3 A;  2FLP A;  7FD1 A;  4OLP A;  4LF7 F;  3WX8 A;  3W9J A;  5F9N A;  3HX9 A;  4ES1 A;  4RUC A;  4DR5 J;  2UXD J;  1WHW A;  1RE1 B;  3L9Z A;  4OJH A;  3BYR A;  3HKZ D;  2CDQ A;  3IS9 A;  5K14 A;  3ZZP A;  3OW2 R;  1WKK A;  3FEZ A;  5ETR A;  3RAQ A;  2BUN A;  3L7U A;  4L3N A;  3N6N A;  1NSQ A;  4F4W A;  1X93 A;  5K8M A;  3M2U A;  2F1F A;  3BEG B;  1U1O A;  4TQS A;  3RW7 A;  2GIF A;  4YME A;  3VWS A;  2DR5 A;  1HQ2 A;  3DRR B;  3MZI A;  1GMW D;  2DO4 A;  3KLI B;  4MTP A;  2FY8 A;  4TQR A;  2GCF A;  2AN7 A;  3IG1 A;  1A7G E;  3EDQ B;  2ZD1 A;  5KAK A;  4OV1 A;  2OLW A;  1FJE B;  3PY8 A;  1FKO A;  4NCA A;  2W01 A;  1K44 A;  3NNH A;  4UY8 T;  4YY3 F;  1Y10 A;  4RW7 B;  1U25 A;  4WFA Q;  3I82 A;  2GS8 A;  5KG6 A;  1FRK A;  1LWF B;  4MYT A;  4YP3 A;  2JXI A;  2ERR A;  2LA4 A;  3MMA A;  1T7P A;  3CCQ S;  1YRU A;  1O0P A;  2D9P A;  1WF1 A;  4FVC A;  2B3T B;  4NX9 A;  2HWI A;  4ZS6 A;  5D4P A;  2CZ9 A;  2N7C A;  5LSL A;  1TL7 A;  2EBE A;  2KB2 A;  3D1Q A;  3LJP A;  2V67 A;  4X65 F;  5GAG I;  2CQP A;  3I0S B;  4C7Q A;  3N0V A;  2JXH A;  2HQI A;  4USH A;  1UJ4 A;  2OD4 A;  2XHW A;  3TVY A;  1UVI A;  4O44 B;  4C11 B;  4RU9 A;  1F6T A;  1C4A A;  2F63 A;  2YWK A;  2AIR B;  1TV6 A;  2E66 A;  4OZN A;  5HQ8 A;  5FD1 A;  5KFL A;  1FHT A;  4DSJ A;  3TAM B;  4CLS A;  4X4O A;  4A8M P;  4RNF A;  3HF5 A;  2MLZ A;  3J80 U;  1TUW A;  4CLL A;  1DTQ A;  2IMO A;  1SI9 A;  3HLU A;  2W8K A;  4X65 J;  1D1U A;  1QAJ A;  1AB8 A;  3OLA A;  2QO3 A;  3D1O A;  3L4B C;  4WP8 A;  1KEK A;  2V50 A;  3DXB A;  4FP9 A;  4MMO A;  4EEY A;  4DSE A;  1S1U A;  1KOO A;  2Q43 A;  3DRX A;  3LP1 A;  4IDK B;  3CJK B;  4BC7 A;  4LBP A;  2K7K A;  2R7X A;  3TZY A;  3V6D A;  1IR0 A;  1SQF A;  2AT1 B;  4URS A;  1FK9 A;  1TL1 B;  1TP7 A;  3QGH A;  1NXI A;  5CD4 H;  1KQS R;  2HRT A;  3GG1 A;  4I7F A;  5HJY A;  1DAR A;  2DR6 A;  2OI2 A;  4M1K A;  4W98 A;  5HBM B;  2H9Z A;  2IDE A;  4MKB A;  4BWM A;  4UOC A;  2GV1 A;  1KRP A;  1NBE B;  1NEE A;  4OYI A;  1MSW D;  4YEA A;  2BW2 A;  2MY7 A;  1L5U A;  1B7F A;  5J2M A;  1SJF A;  3G9C A;  2CAJ A;  4WU3 A;  2KRR A;  3E01 B;  2FVR A;  3ADA C;  4NPO A;  3VTI A;  1YJV A;  1UZH A;  2NSB A;  3MCN A;  3I6P A;  2VB6 A;  1ICE B;  3QGP A;  1UKU A;  4O4G B;  4DCJ B;  1KN6 A;  3Q8P B;  1T9U A;  4YDX A;  2LEB A;  1JB0 C;  1F60 B;  2APO A;  3C6T A;  3I87 A;  3QWP A;  5L9X A;  1N4L A;  1HD1 A;  1S0N A;  1VQY A;  1WOR A;  2NS1 B;  2EKN A;  1P6T A;  2BJD A;  2FIU A;  2B56 A;  2HIQ A;  2IC3 A;  2JC0 A;  2DO0 A;  4RW4 A;  4RKU C;  4JI0 J;  4NA2 A;  4XPC A;  1QAI A;  3IR7 B;  1JQG A;  4JB8 B;  1T05 A;  1RAJ A;  3WQP A;  4DL0 C;  2B9E A;  3AJD A;  1O51 A;  3NL0 A;  2YNI B;  5D0G A;  2X7I A;  2YWG A;  3OHB A;  4O3R A;  1N5V A;  2B4U A;  4LF5 J;  5J2M B;  3LWL A;  3KJQ B;  2QRR A;  2MXY A;  4OZ0 A;  1NH7 A;  2FJB B;  3VAF A;  1OS5 A;  2HRY A;  2W2P P;  5AE1 A;  3KOA A;  3PJX A;  5DG9 A;  2L41 A;  4LF8 F;  5KG0 A;  1QUV A;  2BM0 A;  1F9E B;  5DM7 Q;  3SCK E;  1TMM A;  3FK4 A;  4YDD B;  3KHL A;  1EQ0 A;  2JEI A;  1HBO B;  1RTZ A;  1XMB A;  3AD9 C;  5LMN F;  1YI2 S;  3CJK A;  1EHW A;  5GMK a;  4FF1 A;  1CJT A;  4J9N A;  2E9Z A;  5EN1 A;  2HQC A;  1QLN A;  2YVS A;  2QLJ B;  1R8H A;  2QV6 A;  1W7W A;  2P2C B;  2LXU A;  2HG4 A;  4H4O A;  4Y34 A;  1Z4U A;  3MTJ A;  2ZHA A;  3SV4 A;  1PAR A;  2C2K B;  3NGU A;  4Y28 C;  2AX0 A;  1KHW A;  1QUP A;  1IKV B;  4I67 A;  3AOD A;  3G6X A;  3UVJ A;  1JLQ A;  2LA6 A;  4KB7 A;  1O8B A;  1LXJ A;  2FPH X;  4ZVR B;  1B99 A;  1K1Q A;  5G0R A;  3V2U C;  3SSR A;  3ZTP A;  1VBY A;  2UUB F;  1KTV A;  4P71 A;  4LRF A;  4ZA1 A;  4MKY A;  2EG2 A;  1Q7L B;  4DF8 A;  4AQY F;  4ZVQ B;  2KH9 A;  1JMT A;  4H4K C;  2P6S A;  4OMF G;  2IVF B;  3JAM Y;  4A8W A;  1TK8 A;  1RAB B;  4GKK J;  2H5I B;  3CT9 A;  4R8U A;  1T05 B;  4R5P B;  1IM4 A;  3OTO J;  5F41 A;  3QZ8 A;  2V4R A;  2DGO A;  1TL7 B;  2DVI A;  4KFB A;  2AV5 A;  2KN4 A;  2AJ0 A;  1SIW A;  2J0X A;  4P2S A;  5HMW A;  3GIM A;  2ZH5 A;  2UUA J;  4JV1 A;  2GQ2 A;  3GR1 A;  1BQN A;  2AEF A;  4Z7C A;  3HSJ A;  2MQP A;  1U7L A;  1EET A;  3M6X A;  3ZZY A;  5C25 A;  2BOA A;  2VPX B;  1PG5 B;  3C6T B;  4RNM A;  1V3Z A;  4C8M A;  2HGN A;  3KXD A;  3MCS A;  5GAE I;  2DY9 A;  4O0N A;  5KFK A;  2RT3 A;  1L3V A;  4U8V A;  1EP4 B;  1I51 B;  3GJR B;  2RRA A;  1DQ8 A;  4BCA A;  1UA0 A;  1BLU A;  3KDO A;  5B0C A;  1VQL S;  2GVD A;  1NKE A;  1X4D A;  3BGL A;  5KFB A;  1NK9 A;  1F1B B;  4Q44 A;  2B9Y A;  1HNV B;  4IFV A;  4DCP B;  4HTI A;  4OYX A;  4USW A;  2XS7 A;  4P7T A;  2B8P A;  2G9O A;  3NCR A;  3OR2 A;  5L38 A;  2CDR B;  1HPZ A;  1NPK A;  2GO8 A;  2O01 C;  1S4E A;  2VJU A;  2ADB A;  2R8G A;  4HVZ A;  1FES A;  2EFP A;  1VR6 A;  1FRI A;  1T95 A;  3KK3 A;  1TL3 B;  1LNQ A;  4FZV A;  3IS9 B;  1HBU B;  3KKF A;  2GFF A;  2WTF A;  1F9F A;  4OX7 A;  3W2V B;  4CH1 A;  3V6D B;  1RP5 A;  1HWI A;  3EGZ A;  1YJU A;  2GHP A;  5KFM A;  1N32 F;  5D15 A;  3D6M B;  4DDF A;  3LOU A;  1KC8 T;  2BKO A;  1ZZF A;  4B3M F;  3TUP A;  1RAH B;  3AAW B;  3ENV A;  1RAC B;  4DV0 F;  2W4P A;  5HQL A;  2HZA A;  4JYA J;  2C3U A;  4PQA A;  1TTH B;  1M5P C;  2HAI A;  1WD6 A;  2EFO A;  3CCZ A;  3UNY A;  4ZLN A;  3DYA A;  3RB0 A;  1Q16 A;  3PV8 A;  4WK3 A;  4WTY A;  2HNY B;  4F25 A;  2E44 A;  3LWM A;  3EXY A;  2KO1 A;  3DCA A;  3KHH A;  3AOB A;  4LT6 A;  2VHG A;  3I4P A;  5ETT A;  4C6A A;  2AF6 A;  3F73 A;  4QR2 A;  1SQE A;  4ZVH A;  1NND A;  2QA4 G;  1BWV A;  1V3R A;  5IT9 Y;  2RIL A;  4K2J A;  5T7L A;  1FA0 A;  2VIH A;  4ECU A;  4A8X A;  1UWB A;  4BLG A;  4LF7 J;  4DS4 A;  3DRS B;  1X60 A;  2QLB B;  2YNH B;  1GTE A;  3O44 A;  3Q83 A;  3ZTR A;  4ALZ A;  2BE2 A;  4EBE A;  1X9W A;  4PQU B;  4QYZ J;  5G4D A;  3KLF B;  2CZ4 A;  3VHQ A;  2E7X A;  3W8G A;  1YGY A;  3FZB A;  1RWV B;  4ZP7 A;  3OUY A;  3CCU S;  1UTA A;  4KSE B;  3BSN A;  5EWF A;  4JI5 F;  2RNE A;  3BM7 A;  3CDA A;  3ZTS A;  3RB3 A;  2HNZ A;  3R7B B;  4K59 A;  2DNY A;  4KO0 B;  4C8Z A;  4ELT A;  2F8M A;  2XZT B;  2K8G A;  3LH2 S;  1N52 B;  1J27 A;  3MM5 B;  5CAB A;  3HMJ G;  1SUQ B;  2YNF B;  4KT0 C;  2VPZ B;  3PG9 A;  2G0C A;  1ZA2 B;  2EC0 A;  2RB7 A;  2ZDO A;  1P9Y A;  4Y2C A;  3OL8 A;  4C4W A;  5L1L A;  2YNF A;  1NLK L;  1CQN A;  2K3K A;  2KKH A;  2N4C A;  1C0T B;  3IM8 A;  3KK2 B;  3T1H J;  5D8H B;  1UL3 A;  1FWP A;  2XGQ A;  2B9X A;  3T9N A;  1ZM9 A;  2WBR A;  5GVQ A;  3UD3 P;  2LKZ A;  3ILI A;  3UO0 A;  5HO4 A;  4JI8 F;  2XCA A;  3EIC A;  2ZWP A;  2DHG A;  1YZ6 A;  3H2L A;  1H3D A;  1RWW B;  2DRD A;  2HFU A;  2ZOM A;  3M05 A;  3R1H A;  4RLE A;  4DS5 A;  2DEJ A;  5A8K B;  1IWA A;  3MF5 A;  3DXS X;  2V8G A;  4IR1 A;  1U47 A;  4LF8 J;  1CJK B;  3D6F B;  1WG5 A;  4OZ1 A;  3ZZT A;  5DDR C;  4J9U E;  3TO8 A;  4XO0 A;  2BA3 A;  5B0F A;  5HAT A;  3J81 j;  1TVR B;  1NB2 A;  1Y7P A;  1U1M A;  3GR0 A;  3R5C A;  4IOC Q;  4N5S A;  1FER A;  3QWU A;  2KYZ A;  2A6O A;  2XHC A;  3NLC A;  2OJ3 A;  2MDA A;  4IRD A;  1P1T A;  1U26 A;  5I42 B;  3K5M A;  2Y9H A;  1WC3 A;  3ILL A;  4YOE A;  2XI3 A;  1JXV A;  1TQL A;  2G0J A;  2V69 A;  2HNY A;  3ELH A;  4DV4 F;  2NQP A;  4OI3 A;  3KDN A;  2GO9 A;  1IKX B;  2LEC A;  2XUL A;  4DLG A;  4Y0F A;  2UXC F;  3NS7 B;  2OHD A;  3OR1 B;  4JI2 F;  4FF2 A;  2KRB A;  3M8Y A;  4USK A;  3TAQ A;  2HS0 A;  4GMK A;  4ERD A;  3HVW A;  2HFV A;  3MAH A;  3IGN A;  2VPY B;  3ZNJ 1;  4KYZ A;  1RZM A;  4BDP A;  2B7B B;  3MR7 A;  2HYI B;  3A12 A;  1M5K C;  4LSN B;  3BDE A;  4HHJ A;  4A47 A;  3RAM A;  2D69 A;  1FEH A;  4M5M A;  2E7V A;  2ROE A;  2RHQ B;  3OXG A;  2VZ9 A;  4F67 A;  2R7Q A;  1PSD A;  1D8Z A;  4M5D B;  3LW5 C;  3OFE A;  4MK9 A;  3KK3 B;  2RAQ A;  4LQ9 A;  1KWM A;  3LF0 A;  4GC7 A;  2BQU A;  4OFZ A;  1C1C B;  4OYW A;  2YX1 A;  2W1B A;  3DKD A;  4M5H A;  1N56 A;  1N32 J;  2YH0 A;  3RRG A;  3RAX A;  4I6W A;  4K4W A;  1UVN A;  4LIR A;  2VG7 B;  3D0G E;  2JVO A;  3HT3 A;  2JNJ A;  4L3K A;  3VGS A;  1QTN B;  1R27 B;  5KG3 A;  3OSN A;  4NXM F;  5KFU A;  3SYZ A;  3U27 A;  2WOM A;  5AE2 A;  5LOQ A;  1RAE B;  2FHM A;  3IM9 A;  4P9S A;  4W90 B;  1N5T A;  4CT9 A;  3IFE A;  2AEJ A;  1APS A;  3BYP A;  2MHN A;  3UQS A;  4DR3 J;  2BE7 D;  1H74 A;  1NDP A;  5DGA A;  3PM9 A;  4LRV A;  4IYQ A;  1LOU A;  2EPI A;  3UN2 A;  3UNG C;  3VGT A;  3NS6 A;  4NRT A;  4FKX A;  3A1Y G;  4M5I A;  4FF3 A;  2XWX A;  2GQQ A;  4C8Y A;  3SEO A;  3GJQ B;  3HVR A;  3DLL Q;  3UN3 A;  4J9K A;  2WSE C;  3AB2 B;  2VON A;  3M30 B;  4AT1 B;  4DFP A;  1UMJ A;  1W26 A;  2DNO A;  2HQF A;  3KWM A;  3H5X A;  4C0O C;  5A76 A;  3DLE B;  5J2P B;  4ZPD A;  1RA7 A;  2BRL A;  4N7T A;  5J1E B;  1RHR B;  4L72 B;  3PYF A;  4CLF A;  2YWE A;  4DU8 A;  5LJ5 Y;  2XC9 A;  2VDI A;  4ATN A;  3KHG A;  2EFQ A;  1VQS A;  1URR A;  2X3G A;  1NSK L;  1SJQ A;  3TJ9 A;  4U95 A;  2IYI A;  3LO3 A;  4MK8 A;  3ZFV A;  1VQ4 S;  3PFO A;  1GMU A;  3BR8 A;  1IN0 A;  3DOM A;  5D4O A;  1SIZ A;  2KZM A;  3PFE A;  5HK4 A;  1RT1 B;  5KFZ A;  3CXC R;  4CH7 A;  2J0W A;  4U7U K;  5BR8 J;  1HBO A;  2EXU A;  3PR4 A;  4K2X A;  2XMK A;  1CUL B;  2VC0 A;  3CED A;  3DM2 B;  1C0U B;  2FD2 A;  2C2M B;  1H72 C;  2R2U A;  4ED7 A;  3CCJ S;  3HDS A;  2I2Y A;  2DBB A;  5JJB A;  3OL7 A;  4ZLJ A;  4DG1 A;  2FVC A;  1LK5 A;  1R8C A;  2IJR A;  3R2D J;  1GH8 A;  4DSK A;  1SL2 A;  1IXK A;  3W2V A;  4CNY A;  1OMS A;  2PA8 D;  1IRQ A;  2JFD A;  3O2I A;  3QT5 A;  3UFC X;  3LP2 A;  2W9C B;  2HBY B;  2OGU A;  2DNK A;  3QJL A;  2LQJ A;  4P2X A;  1IBM F;  1Z1Z A;  4CLW A;  1SL1 A;  3P45 B;  1LK7 A;  1H0H B;  1XWL A;  4OJ3 A;  3SDE B;  4U67 Q;  4RW6 B;  4E98 A;  4C2M A;  1BQX A;  1KQG B;  4A8O A;  4C8K A;  3P5T L;  3FCV A;  3DDK A;  2OPQ A;  4UUW A;  3N4W A;  3FUY A;  3EGV A;  4J91 A;  1VBZ A;  3M8P A;  4LVN P;  4KH0 B;  2YNG A;  1BE4 A;  1G4C A;  2NXJ A;  2W2Q P;  4M5G A;  3CC7 S;  3EUN A;  3PRD A;  2YKP A;  2MZQ A;  2YKM B;  2YX7 A;  4PYD A;  1N36 F;  2CKW A;  1T11 A;  4CO4 A;  2I38 A;  4R5P A;  4DLE A;  4JI8 J;  2IYG A;  1HW9 A;  1R8P A;  2WVB A;  2CPD A;  5HRO B;  2BVZ A;  2MJN A;  4C9D A;  1SIW B;  3W66 A;  3MD1 A;  3S1T A;  2N82 B;  2E5L J;  3IWX A;  1XMO F;  3NGR A;  3VAM A;  2WSF C;  3RBD A;  1YJW S;  3TNV A;  3OJS A;  2FGC A;  1N5S A;  4LF6 F;  1RI7 A;  1OPI A;  3LGN A;  2PFD A;  1TKX B;  2GJI A;  4USM A;  2ZBR A;  3MFH A;  2CQG A;  2FYX A;  3SFU A;  1NJZ A;  1MWZ A;  1N88 A;  3I55 S;  3D2W A;  2V2Z A;  2BJ3 A;  2HLU A;  3G8Q A;  5IM0 B;  1DJ0 A;  4B08 A;  2ASY A;  2QE5 A;  3R5G A;  4OZ3 A;  4ZPV R;  2CJQ A;  5M2P A;  3TW0 A;  2F7V A;  5DJB A;  1S1U B;  2KVQ E;  1XEZ A;  4CIO A;  3QRQ A;  2AY0 A;  1KON A;  2RBF A;  4DFM A;  5F0U A;  1UZD A;  2AGP A;  1YG0 A;  4KJI A;  4RNN A;  1IBM J;  2JHE A;  3ENW A;  4RBV A;  4C8N A;  1RAF B;  4K4X A;  2BAN B;  5KTQ A;  1CJT B;  2B9W A;  1RHQ B;  4QIF A;  2CZV C;  3KLG B;  2E1P A;  4V1A k;  2CPZ A;  4NI2 B;  2C42 A;  4KHR A;  1X5P A;  4NLU A;  4J7C A;  4ED6 A;  1S4F A;  1FE0 A;  2XLJ A;  2HHH F;  2CNL B;  2QMU B;  2MLY A;  3AJ2 A;  2YNI A;  5CYM A;  1B0V A;  4JI6 F;  4UOH A;  3C6U B;  1J2V A;  1PC5 A;  2FC9 A;  2X1A A;  5A6P A;  3AA8 A;  5KOW A;  3FEX B;  3R5B A;  5AJ3 F;  4KGX B;  1Q1K A;  5HLF A;  1AUD A;  2OO4 A;  3BBC A;  1VIO A;  3Q8U A;  4KGV B;  2LMI A;  5E33 A;  4PWU A;  3W9H A;  4HDH A;  4TXS A;  1PYS B;  4CO0 A;  2UV8 A;  2W25 A;  5I3U B;  1TFW A;  4JV5 F;  3NGD A;  3AQP A;  5AT1 B;  5F8I A;  1PGZ A;  1TMJ A;  2N7Y A;  3H20 A;  3KG0 A;  1WC6 A;  2CQD A;  2E1M C;  4P75 A;  4BS2 A;  1NK4 A;  4WF9 Q;  2RVJ A;  4WKY A;  4PPD A;  1MU2 B;  3E01 A;  2YNG B;  1WF0 A;  4LBH A;  3GV8 B;  2XY5 A;  4G1I A;  3CC4 S;  4QPT A;  4DSI A;  3BQ1 A;  1BAZ A;  3CWJ A;  5CA5 A;  3IGV A;  1ZM2 A;  3UDE A;  1JLG B;  5ETK A;  1TAQ A;  2K2P A;  3UW1 A;  4DBQ A;  3G8S A;  1RTI B;  3MCO A;  3MEC A;  5E2Q A;  4ETX A;  5CCL A;  2NSC A;  5DG8 A;  1JX4 A;  4DG1 B;  4NCB A;  4UZB A;  1QY7 A;  1LWX A;  2GVZ A;  4HAC A;  5J2N B;  3CPW R;  3HZG A;  4X4S A;  5ITH A;  5K14 B;  3PZP A;  2AQ4 A;  1PKU A;  4NZ7 A;  4V19 J;  1IUJ A;  1CUL A;  4MFB A;  3MPU B;  2CYY A;  5BXI A;  3CCW A;  3BGO P;  1N33 J;  2ZBI A;  4I68 A;  2D1C A;  3DHW C;  4KAI A;  4CO1 A;  5LSO A;  4M94 A;  3QZ7 A;  5HBM A;  1SKW A;  1SC4 B;  2HVZ A;  3BPS P;  3T3F A;  2BAN A;  1YBT A;  2KJV A;  3TAN A;  4RBU A;  3OSP A;  3DOM B;  1FE4 A;  2RQM A;  3R9L A;  5B09 A;  2FJX A;  4DI6 A;  2MKY A;  1KVJ A;  1YBA A;  2DPJ A;  1S1V A;  1LWE B;  2W2M P;  1K0T A;  1IKW B;  2J7U A;  4LRD A;  3FQK A;  1HYS A;  2HK3 A;  4QWA A;  3D3B J;  3VCD A;  3RB6 A;  3GQC A;  1JKH B;  2HHT A;  2WB4 A;  1R6V A;  4F3M A;  5DO2 A;  1E6Y B;  1ZAX A;  3SQG A;  4MJW A;  3WX4 A;  2IJF A;  2OEM A;  4KRW A;  2IM3 A;  3L7O A;  3NWR A;  3NY0 A;  3CDE A;  4DV7 J;  4Q2L A;  1URN A;  4X4V A;  4NEZ A;  3BO4 A;  2DR8 A;  2VA2 A;  2DNG A;  4PR6 A;  1SVD A;  2DNH A;  2G2Z A;  3PKY A;  4DFK A;  1T9X A;  2CG4 A;  2V8D A;  4LIW A;  3W2W B;  2E5H A;  3WIU A;  3CC2 S;  1ZYQ A;  1N5Q A;  3T5K A;  1U1P A;  3BDP A;  2JEG A;  2Z56 B;  2HFN A;  2RS8 A;  2XZW A;  2XSJ A;  3I0S A;  1RT7 A;  3MMA B;  3OL6 A;  2XLI A;  1VFJ A;  5KFR A;  3Q86 A;  4FS1 A;  4UY8 5;  4Q0B B;  1M1H A;  2ZE2 B;  4ZVE A;  5GAD U;  1RSC A;  4ECQ A;  2ACY A;  4CLY A;  3S01 A;  5AXL A;  1Q79 A;  1WDT A;  2COL A;  1U1Q A;  5E5N A;  1S6O A;  4DL2 A;  1CQM A;  2WON B;  4QR1 A;  3EGW B;  1Q53 A;  4MH8 A;  4DV6 J;  1R0C B;  4IH7 A;  2N3L A;  2VFT A;  2Y3Y A;  3CB4 A;  4R0J A;  2JLF A;  2FUG 9;  5IC4 B;  3MMC A;  3QFH A;  2HQG A;  2IRY A;  1S6P B;  3BH7 B;  5ETM A;  3HVT A;  4PUO B;  2PE8 A;  3B6B A;  3R7S B;  1QTG A;  1BWE A;  3C16 B;  1Y4Z B;  4NMX A;  3BSO A;  5JVH Q;  1T9W A;  2OEK A;  4CO5 A;  4ECR A;  2FJV A;  4NXM J;  3V81 B;  1SXL A;  2OPR B;  4N41 A;  3FSY A;  4QOT A;  5SUH A;  4AUK A;  4ES3 A;  2GPE A;  2G1H A;  3VGV A;  2HIY A;  4B3M J;  3CJ4 A;  2B6A B;  4B9N A;  4MKA A;  1DAX A;  2CQH A;  3EWG A;  1TKZ A;  3H2V E;  1M1G A;  2JX2 A;  3TP2 A;  2AGO A;  3M8Z A;  1JLA B;  2KDO A;  1LQ9 A;  3KUE A;  1AUS L;  2YQ0 A;  4LFC F;  4RUA A;  2W9A A;  2OAU A;  1DQ9 A;  1GEH A;  4TYA A;  1XR5 A;  5DQI A;  3S8S A;  2M52 A;  2BQ3 A;  1I3O B;  3BR9 A;  4HH0 A;  1S1X B;  4ZJQ A;  3LPY A;  1OSD A;  3VZH A;  3Q8S B;  1HR0 F;  3DLE A;  5DRK A;  4JI3 F;  1X9S A;  5F0W A;  1LKZ A;  1R89 A;  1X4G A;  1TKZ B;  2H4W B;  1MWY A;  1D09 B;  1HWU A;  3M30 A;  2HK2 A;  2O67 A;  4PWD B;  3CSK A;  2OPP A;  3MPW A;  2Z0G A;  1DHM A;  2PEH A;  4OYA A;  4IG3 B;  3NEK A;  2E5J A;  4M8L A;  1GTH A;  2RF2 B;  4ZOS A;  3UD4 P;  4ZP9 A;  2DHA A;  3LP0 A;  2AD9 A;  3K5P A;  4IFY A;  2WVE A;  4MT1 A;  2AZ3 A;  3CCR S;  3V4M A;  2CVI A;  1FRX A;  1G3O A;  1ZBT A;  2VG5 A;  2GAG C;  3J7Z T;  2JWN A;  2HS4 A;  3R97 A;  2ZC4 A;  1RTH A;  4CTA A;  3PYE A;  1SQG A;  3MM5 A;  3M8R A;  4ZPC A;  3RBZ A;  1IKY B;  1ZPV A;  1U0H B;  2RSQ A;  3IR5 B;  2JH3 A;  2VH7 A;  1NME B;  3BBF A;  2BYC A;  3BGU A;  3JTO A;  4OZ5 A;  4OYB A;  3HJF A;  2V34 A;  5F8M A;  3JYT A;  4J9M A;  4OX9 J;  4ICL A;  4DN9 A;  1OG7 A;  1RT3 B;  1YRX A;  2ZM6 J;  2KI2 A;  3D67 A;  3N6M A;  4E8U A;  2Z2M A;  2BR0 A;  2C3P A;  3W9I A;  3OVA A;  1R0B G;  1N6Q A;  2CQ3 A;  3GYX B;  2EW9 A;  1EJ7 L;  4XPE A;  3NO7 A;  2BRK A;  2XYG B;  4CRJ A;  1FKP B;  3J80 Y;  1UVL A;  3W2W A;  4JV5 J;  5K9F A;  2L3M A;  2A10 A;  3KLF A;  1KFS A;  3VAJ A;  1RT2 A;  1F3V A;  2QX0 A;  4ZIW A;  1MYK A;  1M5S A;  2JFK A;  4DPU A;  2HWH A;  1VIS A;  4WTO B;  4OX8 A;  5EWG A;  3L09 A;  1LV5 A;  2J9E A;  2LU1 A;  3QQC D;  2NLW A;  3MM9 B;  4QQB A;  3QID A;  2DHS A;  4DCO B;  4ZIV A;  2UU9 J;  1WOP A;  3DYA B;  3ENA A;  1WI6 A;  1U45 A;  2UVU A;  1KDN A;  2NZC A;  1RHJ B;  1L3K A;  4C8O A;  4I2Q B;  3A3P B;  4I4B A;  1HW8 A;  2DNN A;  5I42 A;  5D78 A;  1HNW J;  4YB1 P;  5KFW A;  3NXZ A;  3HUL A;  2DH8 A;  4KBI A;  4ZVT B;  1SKS A;  4ED2 A;  2HVD A;  2AHO B;  1EAR A;  1TVR A;  2XNQ A;  1WUU A;  4USJ C;  2KHC A;  1R8B A;  1TAU A;  1U2C A;  4DR1 J;  3HHL B;  3BN7 A;  4HHH A;  3P4U B;  1QAY A;  2MZ1 A;  2J0Q D;  2A3J A;  4DR3 F;  2DNP A;  1RCX B;  2C2N A;  2YH1 A;  3Q8Y A;  3OT9 A;  3CJ2 A;  1BD6 A;  1OY8 A;  2FTR A;  2U1A A;  1AA1 B;  3MEE B;  4Y3C A;  3HP6 A;  1I94 F;  2MB0 B;  4N47 A;  4NLO A;  2J7K A;  2DGQ A;  3F44 A;  2V8H A;  3DNC A;  2KXH A;  1HNW F;  1FDB A;  3QJJ A;  2B51 A;  1NJY A;  2MKJ A;  3R8Y A;  1I5O B;  1KLN A;  2GVD B;  2P8I A;  4P7V A;  3CD0 A;  1HPZ B;  3ET6 B;  3KLV A;  2ZIT A;  1RT4 B;  1T9Y A;  2D3O 1;  2FC8 A;  2DR9 A;  2DHX A;  3AOC A;  2V2K A;  3AHP A;  4MIA A;  4U9R A;  2J8S A;  4OHY A;  4O3N A;  5HAO A;  3IRW P;  3MWB A;  1U1K A;  3CCM S;  3M1V B;  2CQ1 A;  4PZV A;  4B3O B;  2FLL A;  2P9G A;  2H54 B;  3FQL A;  2ZH6 A;  4DUY F;  2PT0 A;  4Q8F A;  4NZ6 A;  2XS2 A;  5F8J A;  5SZT A;  5L46 A;  3HD1 A;  2MJU A;  4U96 A;  4R8U B;  3CJ3 A;  3M9O B;  4ECW A;  1S0M A;  3Q24 A;  3M8Q B;  2PI5 A;  4LF9 J;  2HFZ A;  3HSG A;  1U1N A;  3DLG A;  5D0R A;  4QW8 A;  1L3T A;  5DG7 A;  2G0I A;  2WCX A;  4FNH A;  1RTD A;  3OFF A;  2CJ9 A;  3UVJ B;  2PMW A;  1V3S A;  1F2G A;  4DV1 F;  3I5B A;  4Q7A A;  1K9M T;  1FTR A;  4KPC A;  2ATL A;  4WP3 A;  1NRK A;  1ZA1 B;  1LFP A;  3M2R B;  2FVQ A;  3TZW A;  5DQH A;  3OFG A;  3WC2 A;  1B28 A;  1RJJ A;  1U09 A;  2CQ2 A;  3C66 A;  2SXL A;  2UUC F;  4BBY A;  3EZO A;  2FVP A;  4F3O A;  1UVK A;  3KLH A;  1HNI B;  2ZVI A;  4HEA 9;  5A0Y A;  4LR8 A;  2EFN A;  2DY1 A;  1RAG B;  1WTF A;  2DGT A;  3MUV P;  1FJG F;  2HHX A;  2M3D A;  4IR9 A;  2GC8 A;  3QMQ A;  5KFF A;  2OKQ A;  1YBU A;  1DLO B;  4MJK A;  2IRX A;  4JI1 J;  5EWE A;  1NPP A;  3TA2 A;  4A4J A;  4D8J A;  3QRR A;  1RYR A;  5KFP A;  2GIR A;  4DV7 F;  4UT4 A;  4X62 F;  3L95 X;  1GNK A;  1VOM A;  4P10 A;  3NNC A;  1KP6 A;  2B4O A;  4MFB B;  4HR2 A;  3EVW A;  5IC6 B;  3W1Y C;  5J2Q A;  1N36 J;  2DIS A;  4DL6 A;  4M5K A;  2WVF A;  4WE1 A;  3GON A;  4B3T F;  1TKX A;  1WNE A;  1X4F A;  2RU9 A;  3BQ0 A;  2LQB A;  5FDL B;  2NR0 A;  5LM7 E;  5KFV A;  4UOF A;  3ICL A;  2VAS A;  3FBF A;  2ZJQ Q;  2BBE A;  2JOQ A;  2LEP A;  2X3D A;  4QYZ K;  4AE5 A;  2HAF A;  3NBP B;  1XNR F;  2BM1 A;  1Q86 T;  2XGP A;  4O23 A;  2XZD B;  4OHX A;  2M0G B;  1HI8 A;  2VQE F;  3NAH A;  3KLE A;  4EBD A;  4JI7 F;  5KFC A;  1JLF A;  3M6W A;  1YKW A;  3VVU A;  3MM8 A;  1GT8 A;  1IWG A;  1UEV A;  3DMJ A;  5AXK A;  5KFD A;  4H54 A;  4RJV A;  2E5G A;  4WIQ A;  3IN5 A;  4DV1 J;  3MM8 B;  4O4G A;  4H4M A;  1XNQ J;  1U02 A;  1EET B;  2CPF A;  2DB1 A;  2ZKT A;  5C25 B;  2XEX A;  4B3T J;  2UVW A;  4ME7 E;  3GSD A;  5IZH A;  2ZM6 F;  1XN9 A;  3FBE A;  4F02 A;  3BPD A;  4I2P A;  1S10 A;  4JI0 F;  4DL3 A;  5FDL A;  2K1O A;  3C6U A;  5B0E A;  2DGV A;  2KHD A;  2K6L A;  3M8S A;  5M2R A;  4HV0 A;  1LEO A;  4FXE A;  4NRU A;  3UI3 A;  4ZDN A;  1NH8 A;  4P74 A;  3G82 B;  4X4T A;  3K5N A;  1XNQ F;  2WRM A;  1AZS B;  2DNZ A;  1JLC A;  3MEE A;  2FJA B;  2UUT A;  2ABY A;  2VFR A;  4MIB A;  2PEB A;  1FDA A;  2HND A;  2ACM A;  1IKV A;  3EE3 A;  2FDN A;  3TUI C;  4U6P A;  4F2S A;  2CJX B;  2VOD A;  1XR7 A;  2BSQ E;  1T9T A;  1X0P A;  2PGC A;  2CPY A;  4Q8E A;  3J7A 1;  3HHL A;  3PRV A;  4M5L A;  4K0K J;  2X51 A;  2DRB A;  2P5V A;  3D68 A;  1X4B A;  1H38 A;  3GCX P;  1RT1 A;  2PN6 A;  1S1T A;  3LUY A;  4UF4 A;  2RUG A;  3PW2 A;  1RKJ A;  4CP5 A;  2QLW A;  2YWH A;  3GFX A;  4O3P A;  1REV A;  4YUD A;  3CCS S;  1EQM A;  3CJR A;  2WB1 D;  4NOH A;  3CUN A;  2M88 A;  4L76 A;  3W62 A;  1DTQ B;  2JXG A;  1DY3 A;  1HBM A;  3D3C J;  3FVY A;  4LSZ B;  4WU2 A;  4OYM A;  4OX9 F;  4ED5 A;  4EBC A;  1WOS A;  5KFX A;  5B7W A;  1ELO A;  3QOQ A;  3LA0 A;  3QT7 A;  3V4I B;  4B3R F;  1U24 A;  2AX1 A;  2ZOF A;  4FBT A;  5D77 A;  2GA7 A;  1VS3 A;  1LFW A;  1FVQ A;  3H90 A;  3SIP B;  3VGU A;  3EZ5 A;  2BAB A;  1QSY A;  8AT1 B;  1A9N B;  2IVY A;  3K2Y A;  3BSC A;  3PNI A;  4HH1 A;  4XAK A;  2KXF A;  2YKN A;  3M2R A;  3MR6 A;  1OJ4 A;  3FC9 A;  1M5H A;  2GGP A;  5HRO A;  3J7A N;  3M8Q A;  1SC3 B;  1D8Y A;  2YQ3 A;  4Y2I A;  2CXE A;  1RT6 A;  3BBB A;  2ATC B;  1TUV A;  2X1G A;  1U0S A;  4IOB A;  4B3O A;  4FXW A;  4JV2 A;  4FKY A;  3MMB A;  2RML A;  1NDC A;  1H2T Z;  1LWC A;  1RT3 A;  3M8P B;  4DQI A;  1Q4R A;  4E2F B;  2LCW A;  1U6B A;  4WZQ A;  3M9M B;  3CJT A;  3KLI A;  1HBN A;  2BV3 A;  4AFF A;  8RUC A;  3D7S B;  1U1L A;  1L3U A;  2UXB J;  2E1C A;  2BJ8 A;  1A0O B;  3ET6 A;  1Y11 A;  2LFV A;  2XSF A;  1TEL A;  4KC5 A;  1PJ7 A;  1FKO B;  2OSQ A;  2EK1 A;  1LW0 A;  4MAK A;  4WBF A;  3EX7 B;  1R7I A;  1SJR A;  4PWW A;  1I6J A;  1FJ7 A;  2ADL A;  4OQJ A;  1KS2 A;  2MQO A;  4LSL B;  1W2I A;  4E0D A;  2HZV A;  5C2G A;  2R8I A;  2AU0 A;  2ZEJ A;  1RB0 A;  2IHR 1;  4ETZ A;  4J37 A;  1S5Z A;  5E0O A;  4ZCM A;  2OEJ A;  5EUH A;  1R8A A;  1UWA A;  4M5D A;  2BJ1 A;  1S7I A;  2J9D A;  3NNA A;  2D3U A;  2KT5 A;  1C0U A;  3ILJ A;  4IG0 B;  4PPZ A;  2C2O B;  2VL1 A;  7FDR A;  2OPP B;  2V8P A;  1B0T A;  1CJV B;  1HQE A;  1QSS A;  4CO3 A;  3TJ8 A;  3R3T A;  4JV0 A;  3BS9 A;  3GLJ A;  4RW9 A;  1VQK S;  1MRO B;  2R9L A;  4DFJ A;  2PD1 A;  1Y3K A;  5DGB A;  3B82 A;  3H59 A;  2Q1L A;  1RGV A;  1U2F A;  4RW8 A;  6FDR A;  1V9O A;  4O3Q A;  5LXR A;  4KIA A;  4UW2 A;  3KTQ A;  2MHE A;  1AW0 A;  2RIJ A;  2W9B A;  3CO9 A;  3TRG A;  4ECS A;  2XO6 A;  1WHY A;  1IBK F;  2PSZ A;  2GMJ A;  3HXM A;  1D9A A;  3BQ2 A;  3H5S A;  2KT2 A;  1S6Q A;  4CM0 A;  1MYL A;  5KT5 A;  1U2R A;  2BJE A;  1H6K X;  4NEY A;  4D3G A;  3BO2 A;  2C1E B;  2C2Z B;  3HSZ A;  2RDD A;  3LAL A;  2NYI A;  5THW A;  3KJV B;  3GIL A;  3QJP A;  2DNQ A;  4LF9 F;  1HNX F;  1FKP A;  1UFK A;  4GRS A;  3RBX A;  4ZPB A;  4F3Q A;  4LR9 A;  4AAI A;  1WEY A;  3V81 A;  2KFZ A;  4DR7 F;  3AD7 C;  5KFH A;  3WZ0 A;  2ZJR Q;  2ZDP A;  1CC8 A;  2H4Y B;  1RT2 B;  2ZKU A;  3AA9 A;  3TA1 A;  3ULH A;  1NSA A;  5B0A A;  3UN5 A;  4EWT A;  2AJ1 A;  4NML A;  2BKP A;  3M8W A;  1VMB A;  3VF0 B;  3KNG A;  1WG1 A;  1UA1 A;  1M5O C;  3DLB A;  3OTO F;  1F5A A;  1NCL A;  3W8P A;  2XYH B;  2VFS A;  3DLK B;  3D9B A;  1HA1 A;  2JVR A;  2ZUA A;  1FRL A;  1U0H A;  3EM1 A;  2FHO B;  4NL5 A;  2QL7 B;  1S7H A;  3UE2 A;  4C3L A;  2CNO B;  1RWM B;  3CJ5 A;  1RTH B;  1T9V A;  3TI0 A;  1JJ2 R;  1PC4 A;  2I9S A;  2YQ1 A;  4FN5 A;  4PXC A;  3J7Z 5;  1RT5 A;  1SH0 A;  3JAM U;  3OHA A;  3KUH A;  3SCJ E;  4K4U A;  5I3Q A;  1XBW A;  2PMH A;  2YKA A;  2PI4 A;  1DTT B;  2BDP A;  4ILM A;  3PDN A;  3VV2 B;  4DOZ A;  1RLD A;  2VJV A;  5F8N A;  2CQ0 A;  2RF2 A;  1JJC B;  1OO0 B;  4I6Y A;  4KHM A;  1HKA A;  5FII A;  2ZH7 A;  3T1H F;  2NZ4 A;  1Q0N A;  1TFY A;  2L08 A;  3ETM A;  5B08 A;  5D6G A;  2XSJ B;  2A2C A;  1RAI B;  4CH0 S;  1JIH A;  4OIX A;  3W5X A;  4O3S A;  1RBA A;  1ZM4 A;  1Q8B A;  3UPF A;  2MSS A;  3G4S S;  1UJ6 A;  3D6H B;  3GU0 A;  4BWJ A;  1BDT A;  5CZV A;  5F9L A;  3IBF B;  4G3I A;  3MEG A;  2HKE A;  4WYW A;  1IR2 A;  2MLX A;  3N5F A;  1JLB B;  3IXQ A;  2Q3P A;  5DDQ C;  3N79 A;  4JBC A;  1XMO J;  3OTC A;  4ECX A;  2CAD A;  1ZAV A;  2POK A;  1JLA A;  2CG8 A;  2DK2 A;  4YB7 A;  2UP1 A;  4QZV B;  1UCN A;  2DGU A;  1TKT A;  1YLX A;  2H51 B;  4QJV A;  1WKJ A;  2W2N P;  3SCI E;  2ZBQ A;  2IAJ A;  4DR6 J;  5FLX U;  2LP4 A;  3DGP A;  2GHV C;  2ZUG A;  3RU0 A;  1U4B A;  3C2P A;  3UDV A;  1RQ0 A;  3A8E A;  1QVG R;  1GMV A;  1MG7 A;  4EK2 A;  4F2R A;  2MEW A;  4LR7 A;  2VF3 A;  1HNZ F;  4PUO A;  3QGG A;  2OUG A;  1V6H A;  2HMI B;  1XQI A;  3GPA A;  2HVI A;  4EI2 A;  5ETP A;  4DV3 J;  4ECV A;  2C3Y A;  1BDV A;  3MMC B;  3Q2S C;  2R2R A;  3MD3 A;  4ZPA A;  1CEZ A;  4JI7 J;  4CLU A;  4KGM A;  4NXN J;  1UET A;  4DQR A;  2IJN A;  2QMX A;  3FDS A;  4IO1 A;  1X4E A;  4XDD A;  3FSI A;  5KFS A;  3TA0 A;  1UVM A;  1VK3 A;  1HBN B;  3ISN D;  2QMW A;  1JLG A;  4NLX A;  4YB5 A;  3AXK A;  4P2M A;  5AE3 A;  1B64 A;  1PCA A;  3VAH A;  5KT3 A;  4F36 A;  1X5O A;  1EIY B;  5HMZ A;  1X9M A;  2ZBP A;  5HAN A;  4K0K F;  3Q23 A;  1AT1 B;  3IMQ J;  2OTL S;  3F41 A;  2KJW A;  2XMM A;  2WON A;  3I56 S;  1F2H A;  3UCU P;  2JBV A;  4B02 A;  5JVG Q;  4DV3 F;  1EA4 A;  3B4M A;  3FEY B;  2I0X A;  3HD2 A;  1FEE A;  4I69 A;  3O3L A;  4Q2M A;  5LL6 d;  4CYU A;  3TEH B;  3M32 A;  1Q82 T;  4TLR A;  1UAW A;  2CPE A;  2KYX A;  3BZQ A;  5B0G A;  4BC9 A;  5I3U A;  2RUS A;  4NLS A;  2IPO B;  3M6U A;  3NG8 A;  4MK7 A;  3WHI A;  1RUS A;  3SQO P;  3HFV A;  2BE2 B;  2QL5 B;  3V6J A;  1VLO A;  4PRF A;  1P27 B;  3GYG A;  4EO8 A;  3LAK A;  3K5L A;  5HJX A;  4K4S A;  2HHS A;  1OY6 A;  4HT5 A;  4HT7 A;  5T7L B;  4QBU A;  1QDU B;  2YKN B;  3PYG A;  3DHX A;  3HHD A;  3G6E S;  1KBR A;  4D3H A;  3MR2 A;  4FPR A;  3HCX A;  5KG1 A;  4KTQ A;  3IWN C;  2MST A;  3IP0 A;  1REV B;  4F04 B;  3P96 A;  1RBL A;  1R6Y A;  4DQS A;  3V4I A;  4NI2 A;  5C42 B;  3MR3 A;  3H98 A;  1D3W A;  1VRT B;  5KT4 A;  2DXF A;  4FYW B;  1N0V C;  3HHE A;  1IKW A;  2MKC A;  1TL5 A;  1KR4 A;  3R5J B;  2UUW A;  4G1Q A;  4NLT A;  4HDG A;  2CPX A;  4DPY A;  2BKN A;  3EPG A;  4AQY J;  4O4R A;  1NSP A;  3I4H X;  2ZZN A;  1G1X A;  2KU7 A;  1HWL A;  1B0P A;  1XTZ A;  5DZ7 A;  4AD6 A;  2DHH A;  1MRO A;  1S1T B;  2EWH A;  2EKY A;  4ID5 A;  1S9E B;  2CVE A;  3UCG A;  2PC6 A;  3TEG A;  3MDF A;  5K5M A;  3PEH A;  4ZP6 A;  3ZTQ A;  1QVF R;  3QIP B;  2HZC A;  3MED B;  5HMY A;  1FDD A;  3G82 A;  4DUY J;  1M1K T;  1CS4 B;  1HBU A;  1CBK A;  5E3A A;  4NYP A;  3HFZ B;  5ETL A;  2IRU A;  3TWZ A;  1TL4 A;  3BN4 A;  3EVO A;  3HPO A;  2QEX S;  2LU2 A;  2DCL A;  3PJW A;  1FNX H;  4CQ1 A;  1ZTW A;  3N01 A;  1REG X;  1JLC B;  1KKH A;  2NXU A;  1ZET A;  2E1A A;  3H0P A;  1KSP A;  2B0G A;  2OEL A;  3EMT A;  4ZVU B;  5FLX Y;  3NRB A;  2QSW A;  3I5A A;  2QFI A;  3CMA S;  4DF4 A;  3AD8 C;  4P73 A;  1SCJ B;  5C7P A;  1F3F A;  4KGZ B;  1Q8L A;  1RTI A;  2VQF F;  3FMB A;  3TUZ C;  3PR5 B;  3CO0 P;  1IM6 A;  3H40 A;  1S1W B;  3BGR B;  1U8S A;  2OFH X;  3DMJ B;  3FFI A;  3N5B A;  4RW4 B;  4ZHR A;  5IFM A;  1YJN S;  3DOK B;  1R3N A;  4WYL A;  4F4Y A;  2ZOG A;  3DRP A;  4UZC A;  3R5D A;  1XMQ F;  4B9S A;  2OFG X;  3X3U A;  2KL8 A;  2MQQ A;  3C19 A;  4N8N A;  4RNH A;  5HLF B;  3MOJ B;  2XO7 A;  1NK7 A;  1K47 A;  2HRU A;  3NBP A;  3EZU A;  1YJ9 S;  1T03 B;  1BGX T;  2MKS A;  2V4Q A;  3HKW A;  4DX8 H;  3RG6 A;  2AYB A;  4B3S F;  2PFF B;  3GMG A;  3SDE A;  3KG1 A;  1RXO B;  2GGP B;  3DFE A;  4IH6 A;  1TK0 A;  3SFG A;  4B9M A;  4FF4 A;  2JLG A;  1NDK A;  3SBM A;  4GKJ F;  3ZNU A;  3CCT A;  4IQM A;  4NLY A;  2H1Y A;  5G0R B;  1SL0 A;  2X1F A;  2DNR A;  3HHK A;  5D0H A;  4ZIT A;  3W3S A;  4QWE A;  4EU0 A;  1Y3J A;  2HHW A;  2UZA A;  2ALY B;  4OI1 A;  4EZ6 A;  3FSX A;  3MPV A;  4DPT A;  4NXN F;  1SV5 B;  3V6K A;  1DLO A;  1RTJ B;  2GMH A;  1SPB P;  1XNR J;  4ECZ A;  1Q95 G;  3B78 A;  1HMV B;  5KFQ A;  2UXD F;  2F8E X;  4NA3 A;  4ZVG A;  3GV7 B;  1X5T A;  3LAN A;  4NLQ A;  4GKK F;  4RUH A;  1YRT A;  1N33 F;  5L8R C;  1VJW A;  1K1S A;  2A2D A;  2RDI A;  3K89 A;  4K4V A;  3AB4 B;  1WSR A;  4LF5 F;  1C4C A;  2I1R A;  5IM0 A;  5T14 A;  1Q78 A;  3QBC A;  2LQ8 A;  4USV A;  3Q0A A;  2G13 A;  2KFY A;  1NB7 A;  5IV3 A;  4TY9 A;  5LXY A;  3CW2 C;  5MAO A;  4PEO A;  3Q89 A;  1MMN A;  2M5Y A;  1BC6 A;  1NZA A;  5E3C A;  5K20 B;  2R2S A;  2L9W A;  4DR4 J;  1HNZ J;  3CTR A;  1IQT A;  1XC9 A;  3JS9 A;  1M5V C;  3MR5 A;  3NWG A;  2HLT A;  1KVK A;  5B0B A;  4UST A;  2FHJ D;  4ANE A;  4LF4 F;  2PDA A;  2ZHB A;  2QA2 A;  4O44 A;  1SKU B;  1VHI A;  2EBG A;  1ZS6 A;  3DLJ A;  4LVO P;  3R7N B;  2R7U A;  4HI2 A;  1VBK A;  3D0H E;  4ZCI A;  4PG7 A;  1RTD B;  2LDI A;  2EK6 A;  2V9K A;  5AXN A;  4H4K A;  2WW8 A;  2HEK A;  2G4B A;  3AXM A;  3DLG B;  1YWX A;  3CGI A;  3GV5 B;  2ROP A;  5HL7 Q;  1AYE A;  2CNK B;  1EKS A;  4KE5 A;  4CYU B;  3MI7 X;  5L1I A;  1SH2 A;  1WWH A;  2MZJ A;  2XMV A;  4X66 J;  2KXN B;  4UQG A;  3VEB A;  1X4A A;  1UP1 A;  3QAU A;  3TQE A;  2R2T A;  1NK8 A;  3RR8 A;  1SBR A;  2JC1 A;  2XYP B;  2IMW P;  2LXI A;  1BMQ B;  3A8I A;  2Q6C A;  3G96 A;  4ZPT R;  2W9C A;  3VZI A;  4DR6 F;  4NLP A;  3M6V A;  1RT4 A;  4KGK A;  4XK8 C;  3RGI A;  3OVB A;  3LTO A;  4FPI A;  4PXD A;  3IRX A;  1NHU A;  4NYO A;  2O5D A;  2A2B A;  5LT5 A;  1NHV A;  4DR2 F;  1VRQ C;  4P72 A;  2Q2K A;  1YHQ S;  1TL1 A;  4ZVO B;  2H5E A;  3MHY A;  3H42 A;  2IBK A;  3QIP A;  1GFW B;  2R4F A;  4RWX A;  2Z30 B;  3A13 A;  2BMB A;  4OJG A;  1WG4 A;  4ZJO A;  4CCH A;  2YBV A;  1PO6 A;  3LP1 B;  5LMN J;  4A8Y A;  4FBU A;  2QL9 B;  4J9L A;  2CJY B;  3DDI A;  4LFA J;  2JSX A;  3SCL E;  4X84 A;  2VIC A;  1WC0 A;  1VRU B;  4IKA A;  2KFN A;  2YPY A;  3SXL A;  2XY6 A;  3JB9 k;  4YB6 A;  4TU7 A;  1CVJ A;  4A8F A;  2DRA A;  2G2O A;  3O6Q A;  6AT1 B;  1FXR A;  3KK1 B;  3TR5 A;  2MGZ A;  3IR6 B;  1I94 J;  2M7S A;  3KLH B;  3JSM B;  1TV6 B;  4DXL A;  1W2B R;  5CXT A;  4DUT A;  2KM8 B;  2M2B A;  4QWB A;  1FX4 A;  3CCV S;  2D3O R;  3TVK A;  2HGL A;  4ZVP B;  4R25 A;  3RR7 A;  4WWS A;  3C15 B;  1VQO S;  4LQ3 A;  4EYH B;  3M9N B;  1QM9 A;  5A8R A;  3BRE A;  3MEG B;  1HWJ A;  3ETO A;  5CZX A;  2C3O A;  2QFJ A;  2MQN A;  1S49 A;  2RQC A;  4OZL A;  4B9T A;  5I4M A;  2VOP A;  3GIR A;  2ZHO A;  1GX5 A;  2W2O P;  3NMR A;  1RHU B;  2WZ1 A;  2UU9 F;  4LF2 A;  2HFS A;  2CA9 A;  4I1T A;  2NXC A;  2AJF E;  4ELU A;  2A0F B;  2VBY A;  2IA0 A;  1ACM B;  1ROF A;  3FRZ A;  3OTD A;  4GVL A;  4UQT A;  4WFZ A;  2VQF J;  1JXE A;  2QA4 S;  2AJ4 A;  1X7V A;  1FCA A;  2YKQ A;  3TUJ C;  4YFU A;  2V5H G;  5DLF A;  1IBL F;  5CYQ B;  4RWW A;  1C0T A;  3GB0 A;  1DTT A;  1OYD A;  2GZO A;  2VG5 B;  3AY0 A;  4TU8 A;  1GQE A;  4RNO A;  5E7O B;  2Z2L A;  1B7Y B;  1ARO P;  1LXN A;  1RT5 B;  3AJ1 A;  4NA1 A;  1C1B B;  3C14 B;  4IFY B;  1X4H A;  1KQK A;  3EPI A;  1C1C A;  1SUQ A;  5L1J A;  1H73 A;  1WEL A;  2IY5 B;  1CLF A;  5D0E A;  4RUB A;  1AXQ A;  1MMD A;  4CTA B;  3N9U C;  4KO0 A;  4DX7 A;  2CPI A;  4CNZ A;  4ZKA A;  2AJ2 A;  5IQQ A;  4RZR A;  3JQM A;  5KFA A;  3RYL A;  4QWC A;  2MQM A;  4TVA B;  4ED0 A;  2R8K A;  2CUY A;  4TKT A;  3A3N B;  3SZ2 A;  2ZNZ A;  1BXN A;  1WDD A;  1FWL A;  3H7H B;  4ZVF A;  5HSP A;  5K8O A;  2FJW A;  4B9U A;  3T6J A;  2V9W A;  1WEX A;  2D74 B;  4IG3 A;  4P52 A;  5GME A;  3W5Z A;  1GXU A;  2NUU G;  2DGX A;  2XM3 A;  3GIK A;  1YIT S;  4PQU A;  4DV0 J;  1QE1 B;  3PRB A;  1RK8 A;  1Q8K A;  2IM2 A;  1UWB B;  4KKO B;  1SC6 A;  3NCP A;  4QR0 A;  4N56 A;  2KVI A;  1IKX A;  2P6T A;  1KLM B;  1V5V A;  2XI2 A;  5KOX A;  4DUZ J;  4AL6 A;  4JOU A;  2DNL A;  1L3S A;  3IBC B;  2PO4 A;  2QLX A;  5DZ6 A;  1U49 A;  2HWT A;  5IOL A;  2KEL A;  3GZ7 A;  5E3R A;  4CO2 A;  1T94 A;  3K57 A;  3T1Y F;  5JMN A;  1P1L A;  2ASL A;  4ECY A;  1FWK A;  1RWP B;  2DXE A;  4NCG A;  4CI0 B;  2R7R A;  3PX4 A;  4N76 A;  2E9T A;  2GNK A;  5ETQ A;  4UTG A;  3T9Z A;  5HN0 A;  2B6A A;  2CFX A;  2DTJ A;  3FCH A;  2IIH A;  2ZC3 A;  4ZJL A;  3MM9 A;  1VQ7 S;  3VAI A;  4NCG B;  4LJM A;  3MAA B;  1G7C B;  4F8R A;  3NMA A;  4K4Z A;  3ZZR A;  4DN0 A;  3PIO Q;  3F0N A;  3OVS A;  3PW0 A;  4AL5 A;  3KFW X;  3DLH A;  2V63 A;  5CYJ A;  5J1P A;  1UJ5 A;  4I0W A;  1IBK J;  2HHP A;  2H65 B;  3R6L B;  4AXI A;  5I3P A;  5F3T A;  2OPS B;  2E5I A;  2ADC A;  2DXD A;  5KFG A;  1CJK A;  2OH2 A;  5KT7 A;  2MYF A;  3CJS A;  4RR5 A;  3TJA A;  4YR2 A;  4DL5 A;  2MQ8 A;  4DQP A;  2UUA F;  1WHX A;  2D7S A;  3TAP A;  1EB0 A;  1VI7 A;  2FLO A;  2CPJ A;  3DI6 B;  5JUM A;  4LSL A;  4DJB A;  5C2C A;  2HBR B;  2H5J B;  2RD5 C;  2M4M A;  4WJB A;  1S48 A;  5DDO C;  2MZT A;  2QLF B;  2E29 A;  3MGJ A;  2WBM A;  5BYS A;  4QU7 A;  1J5E J;  3G71 S;  1OSC A;  1NJW A;  8ATC B;  1E6V A;  2O66 A;  3CD7 A;  3NP5 A;  4C3M A;  2LQ9 A;  1ZAW A;  2XMW A;  4KR0 B;  2AYM A;  2ZFH A;  5HVF A;  1S99 A;  4X4U A;  2GJ2 A;  4TNO A;  1HI0 P;  1TUG B;  1NKC A;  1DRZ A;  3JTP A;  3IAM 9;  2BXJ A;  3D66 A;  5CD4 A;  1IR1 A;  2ZH8 A;  1KD1 T;  4N77 A;  3G6Y A;  3DRS A;  1V5I B;  2I8E A;  1F0X A;  3QFW A;  4I56 A;  2MKI A;  2FGO A;  3QT6 A;  5A8R B;  3W60 A;  4IH5 A;  3E51 A;  2AYG A;  1NHK L;  3TX0 A;  4RX6 A;  1KFD A;  1J5E F;  2ZH1 A;  2DH9 A;  4ES2 A;  3CVK A;  1ZM3 A;  4GO7 X;  2NPF A;  2DIT A;  5F8G A;  4IRK A;  2KKE A;  4YQW A;  4OZ2 A;  1OQ6 A;  1MWQ A;  2ZNY A;  2ILY A;  2GHW A;  3C15 A;  4LFB J;  2CJB A;  4TY8 A;  2GX8 A;  4JI6 J;  3QLH B;  5C24 A;  3P8B B;  2VG6 B;  3HSD A;  2PA3 A;  3OFH A;  3TYT A;  1KTQ A;  4AYB D;  4RPF A;  5AJ3 J;  1YTY A;  2F4V F;  3BSA A;  5J1N A;  3A8K A;  5DLG A;  2O1P A;  4DR4 F;  1Q16 B;  1WC1 A;  1HYS B;  2CJK A;  2W8L A;  4M63 A;  1CJV A;  4NLW A;  1YSJ A;  3LPE A;  1KHV A;  3ITH A;  3K59 A;  3D5M A;  2V2Q A;  2AMC B;  3PCO B;  1GAO A;  3UDC A;  3OXF A;  2VBX A;  3CD5 A;  5DQG A;  2VU5 A;  3FJ2 A;  1W25 A;  5D4L A;  2QJ3 A;  3MM7 B;  3QYY A;  5D4N A;  4DZD A;  4O3O A;  2M9K A;  2VFV A;  4C3K A;  5GAG U;  5MLC V;  3BO3 A;  3AOA A;  3M2V A;  5KFY A;  1S6P A;  1QJH A;  2DJW A;  5HMX A;  2IFX A;  5KFJ A;  2K1R B;  1F9H A;  4R0E A;  1RA6 A;  1LW0 B;  4C97 A;  5H1S V;  2M8D B;  2V68 A;  5KFI A;  3MEC B;  1JNR B;  1YIJ S;  3G6V A;  4F0M A;  1VQ6 S;  5HQM A;  3RJM B;  4IOA Q;  2R7O A;  2A18 A;  4IFV B;  2VA3 A;  3GYN A;  1ZZN A;  4ZP8 A;  3ISZ A;  3JTN A;  2C28 A;  3R5A A;  4Q0B A;  2LLZ A;  3K5O A;  5E3Q A;  1EP4 A;  2Y1L B;  3GCW P;  3QAT A;  4NE9 C;  1OWX A;  4ZMM A;  3BGR A;  4LMZ A;  1DQA A;  1RT6 B;  3CMQ A;  3EXC X;  4ZK7 M;  5LSR A;  3GXQ A;  3GJS B;  4B3R J;  1RAO A;  2HHV A;  1YQH A;  1Q5Y A;  1HHS A;  5CH7 B;  2CIM A;  1PBA A;  5ETV A;  3CIZ A;  4DZ6 A;  4XIU A;  4PG5 A;  4KFB B;  2UVR A;  2HFO A;  1FFG B;  3RRK A;  3ZZZ A;  2F9D A;  2FQQ B;  2GW8 A;  4CWB A;  4IUF A;  4ILL A;  4X64 J;  5HVG A;  2HW3 A;  5IWA F;  4RBT A;  4F4Z A;  4Z7Y A;  2K9I A;  3BGF A;  1LW2 A;  3M7V A;  3HM9 A;  4QYR A;  5GAH I;  1J5O B;  1D0E A;  3B54 A;  2VQE J;  1E6Y A;  4JUZ A;  3OTE A;  4F0K A;  1FK9 B;  2K7J A;  4QIW D;  4CM2 A;  4RU2 A;  3BB5 A;  1JLQ B;  2VC1 A;  3TQ1 A;  3WDO A;  2QZ8 A;  4YHH F;  1S9E A;  3KLG A;  1VQM S;  3CD6 S;  3POT B;  5BYR A;  2CQC A;  1VQ5 S;  2QTW A;  1RIS A;  4BHQ A;  3RTV A;  5KT2 A;  4J9S A;  2AZ1 A;  3IC1 A;  4L73 A;  4LRC A;  2E5L F;  3T19 A;  2EVZ A;  5E41 A;  2JLE A;  1YJR A;  2VDH A;  4ZLL A;  1SJ3 P;  1J5O A;  4DR7 J;  4ZCL A;  2OP5 A;  4ER8 A;  4C8L A;  2HND B;  1YJ7 A;  3GG0 A;  3QSI A;  3TAM A;  1HMV A;  1QD1 A;  1M0S A;  4EGL A;  1AZS A;  3HVA A;  3KJF B;  1U8W A;  5GAD I;  5ADZ A;  3P49 B;  2PMZ D;  2NUH A;  5F8H A;  1AFI A;  1SV5 A;  1CJU A;  1FFS B;  2A1B A;  2KG1 A;  1NZ8 A;  4DU7 A;  1FD8 A;  2CJA A;  1YK9 A;  4L75 A;  1VJQ A;  1N5Y B;  3G8T A;  2D3Z A;  4JI4 F;  2HSE B;  2V8V A;  4I2P B;  1FI4 A;  5EX0 A;  2YKM A;  1H7X A;  2RDJ A;  1HHQ A;  3QAE A;  1P9Q C;  2ILZ A;  2WSC C;  4JP8 A;  4Y2K A;  4DPO A;  3HHL D;  2BAC A;  4OX6 A;  2YXL A;  2IVM A;  3Q8Q B;  1NJX A;  2OPQ B;  5DS7 A;  3C8Y A;  2L48 A;  3D28 A;  3LQV A;  4H4M B;  5EX3 A;  4DSF A;  1QSL A;  1JWW A;  1S1W A;  4ZHR B;  5IWA J;  2VOO A;  4HLB A;  4OJ1 A;  1OHN A;  1IJE B;  2F40 A;  4C0H A;  2BNW A;  4RW7 A;  2VFU A;  1VC0 A;  3CME S;  2R7W A;  4EUV A;  2XWY A;  1VQ8 S;  1X8D A;  3NGT A;  4DV2 J;  3OL9 A;  1FT8 A;  4NAS A;  5FJ4 A;  3FFI B;  2V94 A;  1K73 T;  3VW4 A;  1RU1 A;  1T8E A;  2Z58 B;  2W24 A;  3M2U B;  3DGV A;  3PVX A;  4CLZ A;  4LRA A;  2XMJ A;  5CYM B;  4ENO A;  2B43 A;  3IAS 9;  5IXU A;  2LXF A;  2RQK A;  2OML A;  4YY3 J;  2ZJP Q;  1JJ4 A;  1CPZ A;  1RCO B;  3R27 A;  4L74 A;  1GMW A;  3GFH A;  4RO0 A;  1DBD A;  1SC1 B;  4KV8 B;  3T1A A;  4X4N A;  5IT9 U;  2GJF A;  2Z4P A;  3H25 A;  3J81 Y;  5K8N A;  4L6V 3;  3PX0 A;  4N8O A;  4V19 X;  1JJH A;  3BV8 A;  4FYY B;  5GMD A;  4IDK A;  1Y5L B;  2W7A A;  5K8P A;  2J6U A;  1K0V A;  5AXM A;  4X4P A;  2JL9 A;  4DHV A;  2KT3 A;  4F50 A;  1ZTT A;  1HIY A;  4DR2 J;  3NAI A;  1EAY C;  1G6B A;  3D4J A;  3DM2 A;  3I0R A;  3KUG A;  3MED A;  3MTK A;  3QLH A;  4RL1 A;  5C24 B;  1R0A A;  1T0T V;  2IA6 A;  5DM6 Q;  3U02 A;  1B01 A;  4ID5 B;  1TKT B;  5A0Y B;  4A46 A;  1HNI A;  5DDP C;  5J1E A;  2X1B A;  1IQZ A;  4G6V B;  3KMQ A;  1B4S A;  4NLR A;  5T41 A;  1DUR A;  1TK5 A;  1NU4 A;  4X62 J;  1JLB A;  1O5J A;  5C42 A;  2W7O A;  3HO1 A;  2R7S A;  4DV4 J;  3A4T A;  1NDL A;  1S59 A;  4Y6I A;  4WZM A;  3GE9 A;  3QRP A;  4PG6 A;  1VGY A;  1MN7 A;  5A8W A;  1Q81 T;  3U1L A;  3J81 U;  4J9P A;  1FKA F;  4LF6 J;  4F4X A;  2BOP A;  2HHU A;  2V6A A;  3U1N A;  1CC7 A;  3R6G B;  5H9E J;  2CQB A;  3IO1 A;  3IWL A;  3FCW A;  2VKZ G;  3JSY A;  4A48 A;  4ID8 A;  2L9D A;  2ZBC A;  3NCQ A;  1WOO A;  2JJ4 D;  2Y1R I;  1Z2Z A;  2Z2Z A;  3O1L A;  3W63 A;  5HVH A;  4Y00 A;  3MUT P;  2A6M A;  4Z2X A;  4J9R A;  3UR3 C;  3VAK A;  4LF4 J;  3M1V A;  4OYZ A;  4CLK A;  4OZJ A;  1S12 A;  4LFB F;  2QG9 B;  2VBZ A;  1RWK B;  3ZZ0 A;  4A8S A;  1CSJ A;  1WHV A;  5L39 A;  1MML A;  3H5U A;  2W7P A;  4CLP A;  1LWF A;  3QO9 B;  1XER A;  2HQ3 A;  3NOG A;  4PAB A;  3THT A;  4NYZ A;  2QT7 A;  3W61 A;  2ZH4 A;  2VKR A;  1SB6 A;  3CIM A;  1HQU A;  1P8G A;  2Z2Y B;  3K8W A;  2EFV A;  2DCU B;  1S9F A;  1N34 F;  2G2Y A;  1N48 A;  3RBE A;  2AKW B;  3TZZ A;  3QT8 A;  3SSQ A;  3UDL A;  5KFT A;  3T5L A;  4YN3 B;  1UPM B;  4DSL A;  1EX8 A;  5D3G A;  4FXD A;  3DRR A;  3UWT A;  2D41 A;  3B4D A;  3CNQ P;  3LP0 B;  2R7T A;  5HI7 A;  1G2E A;  4KHP J;  3SSS A;  2F9J A;  4Q45 A;  4JYA F;  3US5 A;  2NRE A;  2B7C B;  4DV5 F;  2QIF A;  3TX8 A;  4OYP A;  3HFK A;  1H7W A;  2EG1 A;  4IO9 Q;  3CDU A;  3H4D A;  2OPS A;  1RHM B;  1RWN B;  3CCL S;  2IAJ B;  3KMS A;  1U48 A;  4LUB A;  3MCM A;  4LSN A;  1RYS A;  4U7U D;  1N0U A;  4PYA A;  3PAC A;  2NCK L;  5HP1 A;  1PJ5 A;  3I96 A;  4S0M A;  3E8O A;  2UUC J;  2MZR A;  1B70 B;  2EEY A;  2C2D A;  1MN9 A;  4M5N A;  4MYU A;  2WVC A;  3CE8 A;  3DGP B;  5EHH A;  3J7Y I;  1D9D A;  2RRN A;  4TY8 B;  3D0I E;  1FNM A;  1FRM A;  4G65 A;  2GQC A;  2HBQ B;  2RH3 A;  1OIA A;  4HTJ A;  4X64 F;  3KNA A;  1PJ6 A;  3U1M A;  5GAH U;  1S76 D;  4NLV A;  3DDN A;  5J2P A;  2J76 E;  5E3P A;  2N3O A;  4F7V A;  1GXT A;  2E1R A;  2VD3 A;  3ZXW A;  2QYG A;  3PW4 A;  1FO1 A;  1HQE B;  3VEA A;  1NK0 A;  2V0N A;  2HS3 A;  4PXE A;  2OPR A;  1VC5 A;  1QE1 A;  4KH1 B;  1N8R T;  1FTC A;  3ENQ A;  4IG0 A;  2XLK A;  2ZZM A;  2B5J A;  2MQL A;  4WKR A;  2AGQ A;  3I9V 9;  3H8Y A;  1ULR A;  1FX2 A;  1XIQ A;  5KG7 A;  2OMO A;  1C2P A;  1WF2 A;  2ROG A;  2FZK B;  3O8W A;  2FZG B;  4FYX B;  5D3G B;  1A6L A;  3GII A;  3P5B P;  3VAG A;  3MM6 A;  2K3I A;  3G87 A;  5CYQ A;  1QTM A;  3EJM A;  2J9D E;  3MM6 B;  2BX6 A;  4Z37 A;  1KVI A;  3DRY A;  4TLQ A;  5IT0 A;  3VAL A;  4IRC A;  3QO9 A;  4ZVS B;  3AFG A;  3PKM A;  4ZLP A;  1Y9O A;  3W65 A;  7AT1 B;  3DI6 A;  3RUB L;  2FHJ A;  1NAQ A;  1UEK A;  2P9E A;  3NOC A;  5CAA A;  2ZE2 A;  3UR0 A;  3MAQ A;  4O0I A;  4WII A;  2B5J B;  4U8Y A;  1VCT A;  1JLE B;  4KY3 A;  2YNH A;  4F26 A;  3TZX A;  3DLK A;  2HGM A;  3CJ0 A;  5ETN A;  1BUX A;  2BQR A;  1U6Z A;  5IT4 A;  2ZZT A;  9RUB A;  3OUY B;  1TZ0 A;  2DNM A;  3UCZ P;  1NO8 A;  4WFN Q;  2IBO A;  3PO5 A;  3BH6 B;  3P3D A;  3OLB A;  2M8H A;  3K0J A;  4OL8 A;  4NLD A;  3OQ2 A;  2DGW A;  5BJR A;  2RS2 A;  2UVV A;  3MXH P;  1U1R A;  1S1X A;  1S6Q B;  2DIV A;  4OHZ A;  4JI4 J;  3NS5 A;  3DC2 A;  2CWK A;  4WPA A;  1PAE X;  3KK1 A;  2ZH2 A;  4FNI A;  1IVZ A;  1UFL A;  4CZC A;  5KFN A;  4JI5 J;  3THV A;  2Y0S D;  2LQ5 A;  1VYA A;  2LVW A;  5BYQ A;  4EO6 A;  4W92 B;  2W9B B;  9ATC B;  5GAE U;  4DL4 A;  4LRB A;  2MZS A;  3N28 A;  2K06 A;  3JSM A;  4AXJ A;  2QC3 A;  1UFW A;  4RW8 B;  2WAQ D;  1WSV A;  2XS5 A;  2O3D A;  1FDN A;  3R2C J;  2Q6B A;  3OBI A;  4WFY A;  1BY9 A;  1FNO A;  2RRB A;  2XY7 A;  1T3O A;  4B3S J;  5EGY A;  4K7Q A;  2HQD A;  1F5B A;  1VRU A;  3I0R B;  1R0A B;  3WIV A;  2NYH A;  4DPW A;  3GIJ A;  2Y1I A;  4B9L A;  3OXL A;  1PIL A;  2AWZ A;  1TL3 A;  1UVJ A;  4PKD B;  2IDL A;  5LMU J;  3K7R A;  4FYD A;  3I9Z A;  1T3N A;  5KG2 A;  2AW0 A;  1NK6 A;  2V2V A;  3Q8V A;  5B0D A;  1FJC A;  5JXS A;  4Y2M A;  3FT7 A;  2XMU A;  1I1G A;  1WJ9 A;  4KV8 A;  5ETO A;  3S6E A;  4WXO A;  3G5O A;  1VC6 A; 
#chains in the Genus database with same CATH homology
 1ARQ A;  3BKU A;  1IRQ A;  1PAR A;  1QTG A;  2CAX A;  2BJ9 A;  2K29 A;  2BNW A;  3FMT A;  1MNT A;  2WVF A;  2NZC A;  3QSI A;  3LGH A;  2HZA A;  3VEA A;  2BNZ A;  1B01 A;  2WVD A;  1B28 A;  2CA9 A;  2CPG A;  3VEB A;  2FGC A;  3BKT A;  2K1O A;  1BAZ A;  2GPE A;  2K9I A;  2CAJ A;  2JXG A;  3VW4 A;  3BKF A;  2K6L A;  1EA4 A;  2JXI A;  2BJ8 A;  1NLA A;  4FXE A;  2BJ3 A;  4HV0 A;  3H87 C;  3QOQ A;  2BA3 A;  1U9P A;  1BDT A;  1ARR A;  2WVE A;  2H1O E;  2WVC A;  2K5J A;  3OD2 A;  1Q5V A;  1BDV A;  2Y3Y A;  2KEL A;  1MYK A;  1MYL A;  2AY0 A;  2PC6 A;  2BSQ E;  2RBF A;  2HZV A;  3PHT A;  3GXQ A;  3FT7 A;  4D8J A;  1X93 A;  2JXH A;  1P94 A;  2BJ7 A;  2F1F A;  2CAD A;  2WVB A;  1Q5Y A;  4ME7 E;  2BJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...