2CAJA

Nikr from helicobacter pylori in closed trans-conformation and nickel bound to 4 intermediary sites
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
128
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural Basis of the Nickel Response in Helicobacter Pylori: Crystal Structures of Hpnikr in Apo and Nickel-Bound States.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcriptional regulation
total genus 32
structure length 128
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2cajA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2cajA02
1IRQA 2BJ1A 1QTGA 2CAXA 3H87C 2BNWA 2CAJA 3BKTA 2WVBA 2WVEA 1ARRA 2WVCA 2K6LA 4HV0A 2GPEA 2CPGA 2JXHA 2Y3YA 1MYLA 2BJ8A 3FMTA 3PHTA 2K5JA 2H1OE 2CADA 1X93A 2WVFA 3VEBA 2BNZA 2RBFA 1MYKA 1BDTA 2JXIA 4ME7E 1Q5VA 3VW4A 2CA9A 1U9PA 2K1OA 2KELA 4D8JA 3BKUA 1PARA 2JXGA 2FGCA 2PC6A 2WVDA 2BJ7A 2NZCA 1B01A 2HZVA 1EA4A 2F1FA 3GXQA 3VEAA 1B28A 1MNTA 1BDVA 2K29A 2AY0A 2K9IA 2BA3A 3QSIA 2BJ9A 3LGHA 2BSQE 2BJ3A 1BAZA 3OD2A 2HZAA 3FT7A 3QOQA 1ARQA 4FXEA 1Q5YA 3BKFA 1P94A 1NLAA
chains in the Genus database with same CATH superfamily
1TKXA 1S0MA 3T6BA 3IGNA 1HNVA 3PCOB 4OYOA 1EP4A 1MROA 4X66F 1KKHA 3H4BA 3K5OA 3LOUA 1KQGB 3VVTA 2F9JA 3M6XA 3TZYA 3W9IA 2LECA 4FZVA 2GIRA 3UD4P 1FK9A 4OYXA 3E8OA 4N41A 4OYWA 4EEYA 3VTIA 2HRTA 4M5DB 3W63A 5A6PA 4XK8C 4LQ9A 3A3OB 4NLGA 2RS8A 1B64A 1W2IA 2HNZB 3SXLA 3OTOF 1RWVB 4PUOB 1BC6A 4I56A 5KG7A 1J27A 1KS2A 3GZ7A 1GXLA 1GEHA 2K29A 1RWOB 4OYPA 1EJ7L 1RT6A 3ZZUA 3S6EA 1RAEB 3LALA 3LA0A 3HPOA 2FVPA 2ASLA 3O44A 9ATCB 4EFAC 3CVKA 1U26A 1FXDA 5L39A 3DI6A 4LF1A 2FZKB 2R2RA 2OI2A 5KG1A 2HBZB 1K9MT 1MSWD 5IQ6A 1MN9A 3JTOA 2MQ8A 4ZVPB 4UOHA 3RRHA 1UPPA 1R7IA 3DMJA 4LVNP 4CLLA 4RR5A 2DNYA 1DBDA 2CA9A 1D0EA 1E6YB 3MTJA 3M8YA 4E98A 1BQMA 3DOLB 3OXFA 1S1UA 3DRXA 4PG8A 2IA0A 3MEGB 2OTJS 3BBBA 3M2UA 4I7FB 2B7CB 1HWKA 5A0YA 2HBQB 4OV1A 2Z8QA 2GGPA 1FE4A 2WZ1A 4N5SA 3ZFVA 3R8YA 4PG4A 4WWSA 1XR7A 1B4SA 3TEGA 1GAOA 4B9MA 2VBWA 1VR6A 5FDLA 3W64A 1KR4A 4P52A 2MLZA 3MF5A 3UR0A 2W2NP 3DLGB 4FBTA 3FEYB 3FK4A 4MKYA 1U49A 3ET6A 2DO4A 3VQSA 3GMGA 5BXIA 1IKWB 1Q4RA 2K6LA 4BCAA 3QLHA 3F73A 4OI3A 3DDNA 3G8SA 2OSRA 5J2QA 3EZUA 1R0AA 2DHAA 2KJVA 4QIWD 2XGPA 2R9LA 5KT7A 4KAIA 4DUYJ 2V2QA 1YWXA 2ZOGA 2DNZA 2AJ0A 3AT1B 4NLPA 2V8VA 1IKVA 4KE5A 4UZBA 2ZC4A 4PG6A 2KJWA 3ZTSA 1HNIB 3D0HE 3BO3A 2NCKL 5DLFA 2OTLS 3OR1A 2AEMA 2QA1A 2HK3A 3HI9A 4L72B 1VBXA 1X4FA 3ZZYA 3SEOA 4F4AA 1N5YB 4B3OA 1HHQA 1WF1A 2BM0A 3LP1A 1CJTA 3FFIA 1HD0A 2KTQA 1D8ZA 4DLGA 4JI0F 1RWKB 1P94A 3T6JA 3ZZPA 1IKXB 1TMMA 3K89A 4PQUA 5CD4H 2QLBB 3J81U 1N54B 1R8AA 4PXEA 2C3PA 3VAMA 1S12A 4JI5J 4DV4F 5F8JA 3SCKE 3OTCA 1RT2B 2V63A 2NZ4A 2WVFA 2QN6B 2FHOB 4O23A 3O3LA 5KG0A 2RIJA 2BE7D 4OZ3A 3Q23A 2XBPA 4P2XA 4RL1A 4I4BA 5BR8J 2CQBA 1JLBB 2GIFA 2N3LA 3H7HB 2M88A 1VYAA 2OHDA 4ZLJA 3OTBA 2CPXA 3AD9C 3ZZTA 1HL6A 1XMQJ 2MZ1A 2JC1A 3A8JA 1P27B 4BBYA 3NAHA 3C15A 2VG5B 2IBOA 3NWRA 2BMBA 1XMOJ 1OPZA 2WONB 2B5JB 1TK8A 4PPDA 2AWZA 4NRTA 1RACB 4LRVA 2VV5A 3H40A 4ALZA 1KFSA 3J80Y 1PJ5A 3AJDA 4HYKA 3DOMA 4FYVB 3IWXA 2IJRA 2HHTA 3MHYA 1N4LA 2FTRA 1X5SA 1WSRA 4CM2A 3SSRA 3NRBA 4DZ6A 3AQOA 2ZWPA 1GMUA 1ZTWA 3UE2A 3KK3A 4PEOA 1KHWA 3RBEA 3GSDA 4CRJA 2VDIA 1TQLA 1VK3A 3HHKA 1IKYA 2D41A 4ZPTR 5KFIA 3W2VA 4DX7A 4R0EA 3NKYA 1UMJA 1RU2A 4DHVA 1O8BA 3NS7B 1WORA 3CNQP 1NK8A 1KQKA 1F60B 3IA0A 2Y1RI 1RWPB 1U1MA 3W9HA 1YK9A 4NLUA 3MAAA 2EG1A 3WIUA 3PHEA 2IJNA 1U1KA 1FRLA 3M8PB 4F4XA 3QRQA 2GHWA 1DFDA 5L1JA 4URQU 3D5MA 2VD3A 1T3NA 1PGZA 5KFGA 2DTJA 1SBRA 4HTIA 4IFYB 2O67A 4J9QA 2CPDA 4KGMA 3FJ2A 1DHMA 3D28A 1SVDA 5EGYA 4MIAA 2BDPA 2DXEA 4NXNJ 1H3DA 2ZVIA 3TJAA 4QWEA 1FJGJ 5BYSA 2FLNA 1S6QA 3IXQA 1TV6B 3VEBA 1TVRA 2RBFA 1UTAA 2NXCA 5GADU 5IT4A 3BV8A 4C48A 3DRRA 2YKAA 4F2RA 5J1EB 2ROEA 4C8LA 3IR6B 1B7YB 1TTHB 1OMSA 3V81A 2PA3A 4CLZA 1GXTA 2K7JA 5LMNJ 1RTJB 2DCLA 4DSLA 5E41A 2IAJA 3KWMA 1HKAA 4B3SJ 2M0GB 3BZQA 3ZZZA 1XC9A 1RSCA 3OSPA 3ICLA 5GAGI 3ISND 3DLJA 2XS5A 3UQSA 2VB6A 3BQ1A 1KNZA 3HVTA 3Q8VA 5EWEA 4GKJJ 5T7LA 4IDKA 3FCHA 3R5AA 4C11B 2GHVC 4ZVUB 1GMWD 4WP3A 1PJ6A 4WZMA 2FJAB 2Y1LB 5E3CA 2A1BA 1ZPVA 5C24B 4PPZA 2HFNA 4WPAA 3KLGA 1RT4A 2CQPA 5J2NB 2XO6A 1FNOA 3DN9A 4MK8A 4PWWA 4UOCA 3OR2A 4Q45A 2HVDA 3KNGA 2G0IA 3EVWA 4QYZK 3DRPA 1RWXB 1KQSR 1TKXB 4K5SA 3DDKA 1HNVB 1HNXF 2IA6A 1EP4B 1MROB 4W4MA 5ETNA 2RQ4A 3GFYA 3QRPA 5LM7E 1UZDA 4HLBA 2E5IA 2JEGA 1BWVA 5IWAJ 2NXNA 4U96A 4I2PA 1FK9B 4FXWA 5F0WA 2KG0A 1L3KA 1UW9A 3FRYA 3BDEA 2H54B 3U1NA 2PEBA 1D09B 4LF6J 4FP9A 4J9LA 2KXFA 3CD5A 3OVAA 2RT3A 4I1TA 4MMOA 2G1HA 2QG9B 4X4RA 2XYGB 5DG7A 2MY8A 4F4ZA 2YX1A 1YZ6A 5HI7A 2V4QA 3AFGA 1CS4A 1RT6B 2J0WA 5HQ8A 2IBKA 3MEDA 1UKUA 3QATA 3TAMA 1HBNA 3MPWA 2AYEA 3KMSA 2ZHOA 1G3OA 3R5CA 3UCUP 3TJ8A 3M8RA 2V4RA 1ZM9A 4LF5J 3J81Y 4DX8H 3DI6B 4TXSA 4WKYA 4ZPVR 3I0SA 1L3VA 2DD8S 3SSSA 4UW2A 1H0HB 1T9WA 4IH7A 4Y2CA 4DR7J 5J1PA 2BE9B 4LSNA 4FBUA 4K0KJ 1RE1B 1XIQA 5KFSA 2W25A 3D0IE 1FDNA 3UNGC 1E6VA 3J81j 1RHJB 1R8PA 5C7PA 2ILZA 3PY8A 1SC6A 5M2PA 4IRDA 5C5JA 1JJHA 1QSYA 1UVMA 4MK9A 4AUKA 1K1SA 1S1UB 1T3OA 2M9KA 3CC2S 2FB0A 2W7PA 1YJNS 3M2UB 1T9UA 2VOOA 4K4WA 3ZTPA 3DLEA 2ATLA 5A0YB 4EZ6A 4I69A 1TL3A 2GGPB 2XLIA 4IR1A 2C2EA 4EU0A 3NEKA 2A2BA 4ED1A 1KVIA 2IMOA 2ASDA 3A3PB 4OX8A 5FDLB 1Q81T 2Z30B 1X9MA 3BSAA 2CKWA 3W3SA 3M2VA 2OPSA 4Z7YA 2MKCA 3VZHA 2UU9J 3ET6B 1YX2A 4DPTA 4LJMA 4EMDA 1X31C 2J6TA 1WUUA 3CT9A 4ZPWR 4YP3A 3MWBA 5J2QB 2QIFA 4I2QA 3W7BA 1R0AB 4JI8J 2HHQA 1NSPA 3BGLA 1YBAA 2YWHA 3IR5B 1SKUB 3F0NA 2ACYA 2Q3PA 2UXDF 2VONA 5AXMA 4A48A 1IKVB 3D54A 5A8RA 4QPTA 3OLBA 3ITHA 3OFFA 2UVRA 1APSA 5AXLA 2QLFB 1NDPA 3AODA 5L9XA 1EAYC 4LFCF 1IM6A 3OR1B 5FIIA 4U6PA 1D9AA 1FKOA 1T05A 3GJTB 3SYZA 1A7GE 5H9FK 3MMCA 4HVZA 4W98A 3MUMP 5KFNA 4B3OB 4C9DA 3I32A 3LP1B 1CJTB 3FFIB 4LUBA 4ES2A 5H9EK 4UY8T 2Z2ZA 1DJ0A 4YB1P 3R6LB 1WI6A 3M7VA 3QJLA 1WELA 3LGNA 3MCMA 2GZOA 4ZITA 1JLFA 3MR5A 3N28A 3CC4S 4WE1A 4KV8A 1WTBA 2LU2A 2HHHF 1N0UA 4LRDA 3UDVA 3GG0A 3PW7A 3KJVA 1WACA 1WI8A 2V94A 1Q5YA 2VZ9A 4WXOA 2V34A 1XNQJ 4WZQA 5LXYA 3AOCA 3M6VA 1WKKA 3IG1A 4N8NA 4PABA 2HFZA 4DL3A 2IC3A 3SDEA 4V19X 2HRUA 3VCDA 3EDQB 1NK6A 2WW8A 4KPCA 1OHNA 4NLVA 2H4WB 2MQMA 4RUBA 5KFFA 3BN7A 1CC8A 2LEBA 3J7Z5 3R6GB 1FNXH 1JMTA 3C15B 3OJUA 2VICA 1UEKA 1KWMA 3TAPA 1F5AA 2ROGA 4KHMA 2MLXA 5AXKA 4F7VA 1RISA 2YNIA 3I9ZA 3LAKA 3TZZA 3DOMB 2BUNA 1F9FA 1FKAF 4OX9J 1HNWJ 1S9EA 2KL8A 1K73T 1FX4A 1SJRA 1CC7A 3BR9A 1X4EA 8RUCA 2BSQE 2MTLA 1S5ZA 1UVKA 1R8HA 3KK3B 3RTVA 3D6TB 1X5OA 2MKKA 1R6VA 4KQZA 3MR3A 3UCZP 1IKYB 3W2VB 1HBOA 2H3EB 3VGUA 4DV6J 4WYWA 4WFNQ 1MWQA 1PYOB 1VDHA 1HARA 2QL9B 2FC8A 2R8IA 2E1PA 3HT0A 4OHVA 1NDKA 5EHHA 3NY0A 5B09A 4G1IA 4RW9A 3IAS9 3MAAB 3AJ2A 4NEZA 2KO1A 3P49B 4DMZA 3G96A 1FF2A 4DL4A 4CI0B 1IN0A 5HQLA 2G2OA 2HFUA 3DRSA 3Q8SB 3QT8A 3LW5C 1X8DA 3J7ZT 4WTYA 3NGDA 4J90A 1CQMA 3T5LA 3A12A 3B8HA 3C2PA 1NK7A 1QD1A 2R7RA 5HBMB 1FXRA 1S6QB 2PGCA 1IBMJ 2V9KA 5AXNA 4NCAA 1TVRB 2E9RX 1M1GA 2WBMA 1YJUA 1EQMA 5E7OB 2VBZA 1VGYA 3FUYA 1QTNB 4QIFA 5HROA 1BHNA 2EEYA 2VKRA 3DRRB 1S6PA 1C0UB 2BNWA 3KLEB 3V81B 1RWWB 2VG6A 3I0RA 3LPEA 2GX8A 2IAJB 2GMJA 2C28A 1ZZFA 4X84A 5IFMA 4I64A 1XQIA 3Q2TC 3VAIA 4WCEQ 2F4FA 1BY9A 5M2RA 3GWCA 3HVTB 3BEGB 5LJ3Y 3HK2A 4WJBA 1IJEB 1FTRA 1WJ9A 1LKZA 4OJ1A 5T7LB 3V4MA 2V8GA 2LA6A 4IDKB 3R7NB 1UWBA 1RWUA 2MZRA 3NWGA 2LQ9A 4FKXA 4AL6A 2HVHA 3QGPA 1HWIA 2BVZA 4X66J 5CCMA 4J9NA 2KYXA 5A6WA 3KOAA 1S59A 3X1LB 1SJ1A 3I4HX 1DTQA 3KLGB 1RT4B 4U8VA 4R25A 1UZHA 3OR2B 1SJ4P 4EBCA 4QCLA 2OO4A 3BH6B 3JYTA 4PKDB 3DC2A 2ZOFA 3Q8QB 4QR2A 5HP1A 3DRPB 3R9LA 3CJ4A 3EVMA 5DQIA 1U1QA 4OLPA 1NLKL 2E5LF 1HIYA 3CDUA 3HSDA 4JV1A 5C2CA 4URSA 5J2MA 3ZNJ1 2DIVA 2RUSA 2GIQA 2YVSA 4I2PB 1PARA 2LQJA 1REGX 3HX9A 4JI2F 2KOEA 2JLEA 1NPKA 3OVBA 1D1UA 2C3UA 4ZIWA 5HMZA 1UEVA 5CHCB 1OY6A 2DKOB 1UJ6A 3G4SS 1BXNA 4A8XA 2V8HA 5L46A 2A2DA 3MM7A 3J7YU 4H4KC 2A0FB 1CS4B 1PBAA 2W2MP 1UW4A 2ZUAA 3MEDB 4FXEA 1SC4B 4M1KA 3FVYA 3TAMB 1HBNB 5KOWA 4GO5X 3D6HB 3B78A 3DLBA 3TX0A 2J9DA 1Q79A 2O5DA 3MM5A 4ILMA 1AZSA 3IFEA 3I0SB 4NWBA 4WFYA 2VG7B 4OYAA 1RLDA 2MEWA 4OFZA 3SQGA 4B9NA 2KFZA 5K8PA 3SFUA 4LSNB 2BOPA 4LQ3A 3K5PA 5D3GA 3GYXB 1E6VB 2AGQA 2D69A 3HCXA 5IC4B 2M52A 4IOCQ 4ZP7A 5HJYA 2PC6A 1YI2S 3T1YJ 4X4UA 2HQ3A 4URGA 3ZTRA 1MWYA 4M5GA 4WK3A 2MHEA 3HP6A 3LP0A 2EC0A 4OYBA 2WSFC 5KT3A 4ETXA 2HAFA 3K5LA 4ZKAA 4O0IA 4O4GB 3T1AA 1FJ7A 3RAXA 2JC0A 1BDVA 3GV8B 4RW6B 3N01A 4X62F 4NXMJ 3DLEB 1WHVA 3PYDA 4YS2A 2BJ3A 1TL3B 3TWZA 1S9GA 3QOQA 1XN9A 2RDIA 2YQ3A 3KTQA 1VQ8S 3JAMU 1ZZNA 1SUQA 2HPUA 4PXDA 3PX0A 2ACMA 1XTZA 4OZJA 4KGXB 2AYMA 5ITHA 4L73A 3M2VB 2OPSB 1HBMA 4ID8A 1RHRB 2WHOA 5D15A 4Q0BA 1N33F 4IQXA 1DAXA 3LAMA 2IDLA 1N34F 1RT5A 1WDDA 3GQCA 2UZAA 1Q78A 1KP6A 1JLEA 5KAKA 2CPEA 3TQEA 2ROPA 1X4CA 2W7OA 5DG9A 3OL7A 2DHSA 4I2QB 1U6FA 2KT2A 2E1AA 4F67A 2GFFA 4USUA 3U02A 4JI0J 2MKHA 1RTZA 2WVDA 3QZ7A 2VH7A 5ETSA 2BJ7A 2CDRB 2V50A 1H38A 4B17A 4HT5A 2HZVA 3H59A 4Y65A 5L1KA 4OI0A 2DGWA 5A8RB 4O0NA 1WG5A 3ITHB 2J0XA 2WRMA 1EETA 3L7OA 4GRSA 2RRAA 5GADI 4DCOB 4MT1A 1FKOB 1T05B 4DL7A 3G86A 3VGVA 5FLXU 2IRUA 3MMCB 5DGBA 2JWNA 3FMBA 1JQGA 2X1AA 2B4PA 5T41A 3FGVA 5KFMA 4MJWA 1WEXA 3IAM9 3CCUS 1YLXA 4R8UA 4YUDA 4KYZA 2CAJA 5EWFA 1JIHA 2NS1B 2I38A 4U67Q 4DR5F 3OXLA 3NBPA 4G3IA 4DV3J 4TYAA 2W9BA 3C6UA 3H20A 2XS7A 3H5SA 1JLFB 3I82A 4WE1B 2KYZA 2X1BA 4RBVA 2Y0SD 3MAQA 2H5EA 3L7UA 3UN2A 3KJVB 3T5JA 2GHPA 1SPBP 2L41A 1GTHA 4DUYF 4ELUA 2ATCB 3RG6A 2J7UA 1RHQB 1VIOA 1SL1A 3GCWP 2AV5A 3TX8A 3IG1B 4F0KA 3IMQJ 3PYGA 2IC3B 3SDEB 2Z2LA 3EPGA 3M8QA 4ZMMA 1RTIA 3MXHP 4YQWA 2ZZMA 2HHXA 2MMYA 3W8GA 3Q2SC 2F8HA 5EX3A 3NS6A 2DHXA 3CGIA 4RX6A 5LT5A 3CJ5A 2BE2A 1VRUA 3QGIA 4HTJA 1UVNA 5DJBA 4NRUA 2F5GA 2GJIA 3CXCR 2IMWP 5DM6Q 2YNIB 2D9OA 5KT6A 4FS2A 1R0CB 2RQMA 1JXLA 1M5SA 4DR3J 1S9EB 4JI5F 3CCQS 1WC3A 1Y5NB 1JB0C 1D9FA 1NCLA 4A8OA 4LSZB 2XMMA 5CABA 3UD5A 2KM8C 3ZZOA 2FZCB 2ZH8A 2B9EA 1VQ5S 4KRWA 1HW8A 1HBOB 2ZHAA 2LLZA 1EA4A 2UVWA 5CYMA 3KLHA 2ZDOA 1XJWB 1LWFA 2CJAA 3N9UC 3VWSA 1XMQF 2HZAA 4RW9B 1RQ0A 3PW2A 4DSIA 3WC0A 3MM8A 1S49A 5KFWA 3KLIA 3KKFA 1NSAA 2WOMA 1LQ9A 1XMOF 1VQ9S 2H65B 3NNEA 3DRSB 3T5KA 2AJ1A 2QLXA 2QA4G 2YX7A 2XHCA 4AAIA 2KXHA 4A8KA 5HATA 3BF4A 1KOHA 3HM9A 2KH9A 3MM6B 4UT4A 3KJFB 4Q5VA 2KKHA 4IH5A 5F8MA 1OG7A 4PQAA 3NNAA 1WWHA 3LTOA 4C8KA 1TUVA 3WC2A 4ANCA 1HQUA 4G1PA 1TL4A 4TY8A 4X2BA 1PYSB 4ZPCA 2HYIB 5HROB 3KFWX 1T0TV 4CQ1A 4OI6A 1S6PB 4OZNA 1X5TA 5F8GA 3VEAA 5I3QA 4RUHA 2AP6A 3LF0A 4ZHRA 4J91A 2VG6B 1VFJA 3I0RB 2R42A 2UVUA 4B9TA 1NRKA 3Q22A 1UAWA 3V2UC 1RU1A 1G2EA 1H2UX 3ZZ0A 3CCSS 2HQGA 1Y3KA 2DNMA 5IV4A 4O4RA 2KRBA 1LFPA 2I5JA 4F8RA 1KBRA 1H2TZ 2GQQA 1EQ0A 2WVBA 3IWNC 1UWBB 4ED8A 4J9VA 3RR8A 1TP7A 2GVDB 3SCIE 3N4WA 1CBKA 3MFHA 3FMTA 1GMVA 2OEJA 3PTWA 4CM0A 3BYPA 3SFGA 2H1OE 4JV2A 4KJIA 1FFSB 4ZK7M 4PZVA 3BYRA 3ONQA 1DTQB 3CMQA 1ZA2B 3JAMY 2XSJA 5E3PA 4OX6A 5CQGA 3I6PA 1J5EF 3G6VA 2ZM6J 2XY7A 5K8MA 1GTEA 4Y3CA 2LEPA 3UVJA 4DF4A 2CPFA 4PCQA 4D3GA 1ZS6A 3CD0A 2AF6A 5LMNF 3T41A 3FQKA 4EO6A 2BJEA 4B3SF 1RT7A 1JK9B 3M30A 1DY3A 4OZ1A 2HS3A 5CH7B 2HIQA 5CZVA 4YDDB 3D9BA 5GMKa 3ISNC 2IHR1 3P5BP 2QYGA 1P1TA 1FA0A 4K4XA 2HFVA 1EKRA 4C0BA 3ENWA 4DPUA 3GILA 2WSEC 4MFBA 1YIJS 2DR7A 2ABYA 2UUAF 1HYSA 3JXOA 2MQQA 3O5TB 3I96A 4KC5A 3W1YC 5I42A 1U9PA 5ETMA 7FD1A 1BGXT 3EM1A 3MM7B 3GG1A 3CJSA 2OMOA 1QE1A 2QMWA 1J5OA 2MSSA 3GFXA 2NYIA 3JSYA 1VQMS 4NYOA 3TA0A 5F9LA 3I9V9 5HVFA 2AX0A 1F0XA 2HNZA 3MM5B 1WC0A 1VHFA 1AZSB 5KT2A 2K8GA 1AA1B 3H90A 1LWXA 1WD6A 1SJ3P 2HGNA 4RW8B 5D3GB 2C2MB 3PW5A 3BDPA 2CQ4A 3RYLA 3W65A 5IWAF 3MEEA 2J9CA 3CCMS 3O8WA 4LF9J 1G6BA 2AX1A 2CQHA 1N5SA 4IO1A 1IWAA 3WIVA 3LP0B 2QO3A 2Y3YA 3M8WA 4LF6F 1Q8BA 1YRXA 3CWJA 4XAKA 4DS4A 1U1NA 1X60A 3EICA 3KLVA 2E5HA 1TFYA 4S0MA 4CTAA 5HO4A 2AJQA 3PDNA 1S9GB 3THVA 2HKEA 2XYPB 2VBXA 3RR7A 4EI2A 1ULRA 1HMVA 1SUQB 5IZHA 5GAEU 4A8QA 1MNEA 4P2SA 1E6YA 4KH0B 3VGSA 5CCLA 3HULA 4E8UA 4N8OA 4Q0BB 1WHWA 4QWAA 3UFCX 3TANA 4LFCJ 3QYYA 1RKIA 3PIOQ 3VGTA 3EPIA 1RT5B 2R2TA 2FJWA 1S48A 2PI5A 4DPWA 3AB2B 3QGGA 1JLEB 3NGSA 2CG8A 2HWIA 4EBDA 4LFAF 2FVRA 1GX6A 1RHUB 1IWGA 3MCOA 2NXJA 1M0SA 2HNDA 3TUIC 3PX6A 1DQ8A 1WF2A 4RNFA 1FVQA 2BZ2A 2CG4A 1NK9A 2DITA 2OH2A 1NJXA 3VVUA 1JLGA 3NCPA 4WU3A 4DR2F 3SIPB 1N0VC 1EETB 1IKWA 3IM9A 3W2WA 3S8SA 1FI4A 2HHHJ 3QO9B 3L95X 1HW9A 4O3NA 2Y1JA 2DY9A 2OPQB 4FPRA 1DARA 5KFOA 1X4GA 4EZ9A 2IFXA 3TUJC 2RU3A 2X51A 4OI2A 5DETA 4JYAJ 2CNKB 2KI2A 3PJXA 5DRKA 4DOZA 3TZXA 4R8UB 2FJXA 3MEKA 4Y28C 3G6XA 2EK6A 2BA3A 4TNOA 3NBPB 2W9BB 3C6UB 2GC8A 2IIHA 3KXDA 1W2BR 4X4TA 2X7IA 1G4CA 3NGUA 1Q0NA 1NZAA 3PYFA 4Y6IA 1URNA 2YWKA 4C3MA 2M70A 4P2FA 3ZTOA 4IR9A 2ZZTA 4I0WA 1JNZB 1BLUA 2CJ9A 2XZDB 1SKWA 3M8QB 4QIGA 1HI0P 4JI7F 5F3TA 1RTIB 3GFHA 2CPJA 1PO6A 1FFWB 1PBUA 4IUFA 5KG5A 3KG0A 4CO4A 1QVGR 5LSOA 2JFKA 4X4VA 3CDEA 1NK4A 2ZH3A 1JXVA 4AT1B 3GE9A 1NZ8A 2BE2B 3DLKA 1VRUB 1N5QA 1N88A 2XCAA 3HVWA 2F1FA 4L76A 4I6WA 3OL8A 1IQZA 2K9IA 1H74A 3DHXA 3HKZD 4GVLA 1VQKS 2ZNYA 1RUSA 1FVSA 3Q8UA 2JEJA 2ZJPQ 2ZH1A 3AXMA 4RZRA 1S1TA 4C4WA 1P6TA 1K47A 3GTYX 3MECB 3NCQA 1U02A 4X65F 2NXEA 2B5JA 2DR5A 3FSYA 4KIAA 3DXBA 3KK2A 1P9QC 2IM1A 3DU6A 4M5HA 2GPEA 1XK8A 5CYMB 3KLHB 3NGKA 3J7YI 3CCRS 1LWFB 2CADA 1Q8IA 1VLYA 2FIUA 1BMQB 3FBEA 4JI3J 4LF4J 2CJQA 1IM4A 2W4CA 2L48A 3MM8B 3DFEA 3KLIB 4M5LA 3BO4A 2WOMB 4OHZA 4CNYA 5AJ3J 2WBRA 2M4MA 1RKJA 4DLEA 3GIJA 1KEKA 5KFKA 5DM7Q 2JZ5A 2BM1A 4QW8A 4K50A 2UXBF 2H5IB 2JJ4D 2R7QA 3A1YG 1FCAA 2QLWA 1C4AA 1KLMA 2DY1A 2ZJQQ 3THTA 3R97A 2BV3A 4OX9F 1HNWF 3DYAA 3QIPA 1Q1KA 3G6ES 1IJFB 4XPEA 4FF2A 3FKBA 2L9DA 4CDIA 4RPFA 2XMVA 3FZBA 1EIYB 2Z56B 4J9KA 3MCNA 2NLWA 1D3WA 3LP2A 4OMFG 3HFZB 4ZJQA 3D3CJ 2LU1A 1GH8A 1X93A 2HNYB 4ZHRB 2BQUA 2KT5A 2M8HA 5D4NA 2QSFA 3MPVA 3T19A 1PG5B 1RAFB 3SI8A 1JWWA 1I6JA 3DM2A 2NSBA 1MU2A 2FZGB 5A76A 2QL7B 4Y00A 4ZCIA 3W5YA 1CEZA 4HL9A 2I5JB 2IDEA 4HDHA 4NLYA 2C42A 3NO7A 2CJYB 1LV5A 2FDNA 4PG7A 2I1RA 3JQMA 2E5LJ 4QPXA 3CDBA 4NYZA 1I94J 3EWGA 1TL7A 3ILOA 2D7SA 2E29A 1NB2A 2Y1IA 3L9ZA 2BW7A 3D3BJ 1NJWA 4ZVEA 1O6XA 2XSJB 1HWJA 2MGZA 2UVVA 2G1DA 1TFWA 2AYGA 2HLTA 3UWTA 1VBYA 4C11A 2HZCA 2CPGA 1CULA 3UVJB 4AL5A 3MUVP 1MMLA 3CPWR 2K5JA 1QAXA 1M5PC 3QRRA 2YPYA 2N4CA 2NYHA 2Z57B 3P45B 1JX4A 2I6WA 2DVIA 1TKDA 2W24A 4K4YA 1RT7B 6FD1A 2XG8A 1NHUA 4U7UK 3M30B 3AOAA 3H2LA 5J2PA 2FGCA 5LMUF 2N82B 3CJKA 8ATCB 1PSDA 1W7WA 3GU0A 2XLKA 2XSFA 3TUPA 4LR7A 3M9MB 4MYUA 4ZVOB 3PRDA 1Q8LA 1OJ4A 2CZ4A 4MFBB 3MAHA 4NLDA 3TOQA 2K2PA 3GB0A 4P7TA 3OL6A 1HYSB 5D4LA 3CCJS 2GMHA 5D0HA 5I42B 3HMJG 1S10A 2GAGC 1GMWA 2HAIA 1B0PA 1N56A 3FEZA 4J9RA 5E2QA 3M6WA 1QE1B 1J5OB 3K8VA 4C3LA 3S7RA 4AE5A 3SBMA 3FEXB 1FERA 3C8YA 1V5IB 4PAAA 2CRLA 1HPZA 1RHKB 1Q82T 1H6KX 2VJVA 2MXYA 4BWMA 3H8YA 2BNZA 4YEAA 2GQCA 3FRZA 1V3SA 3MR6A 4ELVA 4ZVTB 2C2KB 4Y0FA 2YWEA 3MZIA 4X62J 2HURA 1FNMA 2E9TA 4GO7X 3UDEA 1RZMA 2JXGA 3A8KA 2CXEA 2DNPA 4OQJA 3MEEB 4A4JA 2LP4A 2RVJA 4ED6A 5KFUA 2JBVA 2M3DA 1PIEA 4DSFA 1AXQA 3R5BA 1JLAA 2MQOA 2POKA 4K4VA 1HI1A 1N33J 2JL9A 4AD6A 1FXLA 1N34J 2D3OR 4NLSA 4YB6A 3G71S 4QZVB 2B6AB 2G0CA 2XWXA 5K5MA 1X4AA 1LWCA 4QR1A 4BWJA 3TJ9A 1AFJA 3MR7A 3PXGa 4DQPA 1ACMB 4CTAB 4JB8B 1OPIA 5AE2A 2RRBA 3HDSA 2FVQA 3CMES 4ECYA 1HMVB 4IOAQ 2ZDPA 2WVEA 4JI6F 2DR6A 8AT1B 2I9SA 2PA8D 1JXEA 4K5RA 3NLCA 1N6QA 4Q43A 2KELA 1SKRA 3GYGA 4QR0A 4NI2A 2XGQA 3TP2A 4I67A 2RJZA 3EJMA 2HQCA 1QTMA 3DU5A 4CLYA 2HNDB 3ZXWA 3NMAA 3N79A 3T1YF 4C2MA 3HO1A 2YQ1A 4EUVA 4DR5J 1JLGB 1RT1A 4F36A 5JVGQ 3D68A 2H1YA 4R0JA 2A18A 3W2WB 2QA4S 1RLCL 2DJWA 4X4PA 3L09A 2JX2A 4LF2A 2KZZA 3MMBA 2XO7A 2VQFJ 1T8EA 4NXMF 2RS2A 2HQIA 4HI1A 2AT1B 3EDRB 2DPJA 4CO2A 2RH3A 1L5UA 5IT0A 4G1QA 1S1VB 4IO9Q 2WVCA 2MZSA 4Z2XA 1RBLA 1LFWA 4MH8A 2XHWA 3HFVA 2F63A 4DG1A 4KBIA 2DR8A 4Q7AA 1KVJA 3B6BA 1R8CA 4HEA9 2GJFA 2AD9A 2EG2A 3NL0A 4ED2A 2XMUA 3BSOA 4DV1F 3JS9A 2VPXB 1RK8A 2R8GA 4X4NA 1X7VA 2BQ3A 1U1OA 1HWLA 5B08A 2QC3A 5F8HA 2BKNA 2EPIA 2QMUB 4FF4A 4KY3A 2DB1A 4HI2A 1U2FA 4Y2IA 5E3AA 3R2CJ 3PKYA 2J5AA 2R7UA 2PSZA 3DLKB 1ARRA 4CP5A 4B3MJ 5L38A 2ZH7A 1CLFA 5FJ4A 2GNKA 5A8WA 1R0BG 3A4TA 2DRDA 2HHUA 1C0TA 1VRQC 4OZLA 1LNQA 3DXSX 2XYHB 4DV3F 2R7OA 1DLOA 2NUUG 3DOKA 3CD7A 4ES1A 4RNOA 4P73A 1WSVA 1S1TB 3OFEA 4TQSA 5DDRC 4LVOP 1S97A 2EKYA 4DXLA 2VL1A 3RJMB 5L1IA 3M1VB 3C14A 3CIZA 1QSLA 2VHGA 4KO0A 2KM8B 3NAIA 4L3NA 3PKMA 3BPSP 3KK2B 4E2FB 4OX7A 4C8YA 3US5A 1JLQB 2P9GA 5HANA 3G82A 2FC9A 5JVHQ 4O3RA 4WP9A 2QFIA 1ARQA 1SIWA 1RA6A 1U0HA 3HXMA 2VC1A 5CYJA 1B0VA 1FO1A 1T7PA 1NPPA 1S76D 2DGQA 5CZXA 2OPPB 2YH1A 1ITPA 4ZN3A 4USHA 3HSZA 4UF4A 4UUXA 2EXUA 2CQ2A 4QWCA 4F25A 2FQQB 2ALYB 1AUDA 1VQ6S 1KLMB 3MCSA 4DFPA 1XR5A 5L1LA 4DCJB 2AGOA 4DR3F 2E5JA 2G4BA 2EFGA 3DYAB 3QIPB 1CJUA 3BQ2A 4ZLNA 2CJBA 4WU2A 3PR4A 2F8EX 1PILA 3H5XA 4J9MA 2P2CB 4RKUC 1YJWS 1YBUA 5D77A 2A6OA 3DRYA 3MOZA 3W5XA 5FD1A 5LXRA 3EGNA 3Q8PB 2HVZA 1LW2A 3LP2B 2MKYA 1Y4ZB 3IM8A 7FDRA 5KG4A 3KJNB 2YNFA 1NKBA 1R31A 2QT7A 4WKRA 2Q66A 5D4OA 1BE4A 4HH1A 3BS9A 5GAEI 4KT0C 5HBMA 4DV0F 5K8OA 3DM2B 5H9FJ 4MKBA 3FC9A 1MU2B 2WSCC 2ZE2B 2VC0A 1J5EJ 3JSBA 3PW4A 4C97A 4YHHF 2JH3A 5IXUA 4LRFA 3KK1A 1FTCA 1C0UA 3QNWB 2EFOA 2D74B 3KLEA 3NOCA 2HGMA 3NXZA 2CPHA 2DNKA 2HQDA 2BX6A 3NGRA 2VBYA 3OBIA 1TKTB 1NM2A 4NOHA 1TL7B 4A8WA 3VQTA 1XR6A 2UV8G 3GCXP 2PT0A 2R8HA 2MGZB 4CWBA 4MIBA 2HWTA 2OFGX 1SKSA 1EKSA 1CULB 1I51B 4YY3F 1QUVA 3C46A 2HS4A 2F65A 4TLQA 1FEHA 2UUAJ 3BSNA 5SUHA 3IWLA 4USWA 5BJRA 1RAOA 3N6LA 1TUGB 3PO4A 1F5CA 1J2VA 4RUCA 2C2ZB 2IYGA 3AY0A 3DGVA 3VR1A 1ELOA 5J2PB 2KT3A 4DJBA 2IJFA 3CJKB 3G2XA 2EFVA 3QT5A 3VAJA 3OTEA 4M5NA 4BS2A 4ZP8A 3D2WA 3GV5B 3OTDA 2NSCA 2AJ4A 1W26A 1MW7A 4M5KA 2G0JA 2A2CA 2ZBCA 2V4JA 4ED4A 1K0VA 1OYDA 3CF5Q 4Y2KA 4HHJA 3PRVA 3LO3A 2OEMA 3KYLA 4X64F 4DPXA 2WB1D 4W92B 4M5IA 2R4FA 4OIXA 2DISA 1OWXA 3A8IA 1UWAA 4QU6A 3X3UA 2HMIB 5A2QY 1YJRA 3K58A 3EGZA 4P71A 3EX7B 2YWWA 2ZM6F 2CVEA 2XMWA 5L9NA 5ETLA 3BBFA 4F50A 2JOQA 1HPZB 2ADCA 3JTNA 1RAHB 4ZS6A 2R7WA 2W01A 2YTCA 5LOQA 3FBCA 4DR4F 2DXFA 5DDPC 2RUGA 3Q8YA 3VAHA 1WOSA 2LQ8A 3IBFB 2DNHA 2CFXA 3R7SB 2OSQA 3DDIA 1WKLA 2NQPA 1TU0B 1FT8A 5KFQA 1YRUA 2YWGA 3TW0A 1JLAB 5D6GA 1OS5A 4ME7E 4RW7A 2XZTB 2O01C 3GJSB 1LXJA 2VG7A 1NNDA 4K2XA 4LFAJ 4DEZA 1LWCB 3IO1A 1ZAWA 2YH0A 2UXCF 1DZ5A 3HHLD 1RBAA 4P74A 1T02A 3P6YC 2Y0BB 2OAUA 5CAAA 2OELA 4AQYJ 4L3KA 4ZPAA 3JSMA 1YJTA 1RT3A 2XS2A 4ZLPA 1HNZF 2RQCA 4DR2J 3WHIA 3UDLA 4O4GA 4CLSA 4UY85 4RW6A 1N6QB 4XIUA 2WTFA 1YTYA 3JTPA 4LBIA 3E3XA 5EX0A 3CCVS 3CJ0A 4NI2B 3ZC4A 2FHJD 1S72S 1AROP 1GK8A 2ZH9A 4JI4F 5E3RA 5KOXA 2MQLA 2Q43A 1QM9A 4LF9F 2AHOB 1GQEA 1NH8A 4X4QA 1UVLA 2HHSA 3P3DA 4PYDA 3NG8A 2VA3A 1RT1B 3GIMA 5BYQA 1YKWA 3CO0P 1FDAA 3KNAA 1L3TA 3H0PA 3MMBB 3OSNA 2ZKUA 4H4OA 1N52B 3I5AA 2BKOA 2XI2A 3DGPA 2Z0GA 2AJFE 1EB0A 2YWFA 2VF3A 5GVQA 4G1QB 1UETA 3HFKA 4Q2LA 1MNTA 4XPCA 1WOPA 2BW2A 2KU7A 3KHLA 4I6YA 1L3UA 2CNOB 2QL5B 3GONA 2XLJA 4JI7J 2MKJA 2APOA 4DG1B 1KQFB 4CO3A 5IC6B 1NLAA 2M7SA 5HSPA 1VQ7S 1KOOA 2CQIA 2BANB 1JLCA 1UPMB 1B7FA 1A6LA 3KHHA 3BJYA 1F9HA 1P1LA 4A46A 2FLPA 2QMXA 2ASYA 2JLFA 3AHPA 1F1BB 1UVJA 3A13A 1SL2A 2MJNA 1T9XA 1CSJA 2Z2MA 2FVSA 1UJ5A 3HHNB 2V9WA 1FJEB 2CJKA 3OFHA 4UZCA 2ZWOA 1AYEA 3BQ0A 2BYCA 3Q8RB 4OV6A 5HL7Q 4X65J 4UQTA 3MD3A 4ES3A 1F2HA 4Y2AA 3N6NA 4JYAF 2W8KA 1NH7A 4PRFA 5KG3A 5IQQA 3QSIA 5A8WB 4NLOA 2HVEA 1V5VA 4M94A 5B7WA 4U95A 2H51B 1QAYA 5D0GA 5IS2A 3BSCA 1C0TB 3THPA 1U1RA 4DR6F 3CO9A 3HD2A 3PO5A 2RAQA 1ZTTA 3PV8A 4IQMA 1DLOB 4O44A 3DOKB 3JSRA 4YR0A 1T9VA 5HQMA 4BDPA 3K7RA 2JFDA 1S6OA 1U1LA 3W62A 4LRBA 4DL5A 4DN0A 4ECZA 1SXLA 3WQPA 4LR9A 3C14B 2VPZB 2DGVA 1RXOB 3VAFA 4RWWA 3I56S 4KO0B 3EUNA 2MDAA 2WK4A 2RNEA 3MMJA 2UXBJ 5IM0A 4RLEA 4A8MP 4B9LA 3QMQA 1BQXA 3G82B 5F41A 2K7KA 1N8RT 3P96A 2ALZA 4NMLA 2JSXA 1SIWB 1U0HB 2ADBA 2QLJB 2L08A 4LSLA 3G8TA 1SI9A 2OEKA 2UUBF 2OP5A 5KT4A 1S1XA 4NLWA 5DZ7A 2AZ1A 4B9UA 1FRKA 4MKAA 3OLAA 1LEOA 3MI7X 2DXDA 3NMRA 1WNEA 3A3NB 4GKKF 3QSYB 3CJ3A 2FYXA 5EN1A 2BEFA 1RP5A 3S01A 3QJPA 2KDOA 4ECTA 2WAQD 1FD2A 3BKFA 4ECUA 2J8AA 3W8PA 4ZN1A 3D66A 3OUYA 1Q16A 1WG1A 1SJFA 2FHMA 1CJUB 2OPRA 3NGTA 2KHCA 3F56A 4DZDA 3H87C 3GYNA 3RB0A 4WFZA 2U1AA 5ETTA 2OUGA 1U8WA 2LDYA 2ZH6A 4B3TF 2RF2B 3F44A 4DFMA 5B0AA 1QLNA 4RUAA 5F9NA 2JXHA 2XCPA 2P6TA 3FCVA 1RI7A 1LW2B 1BDTA 4MJKA 3K0JA 5G4DA 2IRXA 2YNFB 3H5UA 3MM6A 3MOJB 1SQGA 4FVMA 1OYEA 3SSQA 1A9NB 4JI3F 4LF4F 2PN6A 4UOFA 1FDDA 4IRKA 4B9VA 4NLXA 5CD4A 2IVFB 4OJGA 2ZBPA 1B28A 4LIRA 3GR1A 2B8QA 5AJ3F 3KK1B 2RB7A 2R8JA 4N76A 3AA9A 1R8BA 2PDAA 2DH7A 1M5HA 1X4BA 2MJUA 1U6BA 4JI1F 3RB6A 1WC5A 3JB9k 3OT9A 5J1NA 3HT3A 4MKVA 3M9NB 2GVZA 4EYIB 3B82A 5LMUJ 3SZ2A 2OD6A 1NJIT 3PJ9A 2GW8A 4HR2A 2MPUA 2UUCF 2KXNB 2C3YA 2B4UA 1X9WA 4NA2A 2LFVA 3UD3P 2GVDA 1V3ZA 4ZVSB 4WFAQ 2FLLA 2QV6A 4ID5A 2LDIA 3BGOP 1VQLS 2D3ZA 2XM3A 3BGRB 3H42A 5EDWA 2M2BA 2J8SA 1Q8KA 2Z58B 2F7VA 2J7WA 4PWUA 4CLKA 3F41A 4J5OA 1R43A 5I3PA 4OLOA 2DGUA 3QAEA 3K5MA 2K3KA 4X4OA 1KTQA 3AOBA 2XY5A 2XNQA 3LH2S 3DKDA 4OL8A 2V4JB 2JVRA 2VFSA 4ILLA 4ZP6A 1XWLA 5KFTA 3H25A 1I94F 4PXBA 5U47A 1JKHA 1SIZA 4CYUA 3GPAA 3MFIA 1U25A 2C22A 3PR5B 1XERA 1ICEB 2L3MA 4RNHA 2H9ZA 5KG6A 1VI7A 3KG1A 3H4DA 5D78A 3LGMA 2DT9A 3RRKA 4KH1B 2ZH2A 2HK2A 4NZ0A 3HZEA 2XQCA 5SZTA 2V2ZA 3EZ5A 1FX2A 3D1QA 3QT7A 1S1WA 1S57A 3IBCB 1Z4UA 4WIQA 5KFLA 2XI3A 4JI6J 2K3IA 1X4DA 2CQDA 1OSDA 4WIIA 4DV7F 2KKEA 3HJVA 3L7PA 4USKA 4RW7B 4DUZJ 2HG4A 4ECQA 2LYVA 2VQEF 1U7LA 3I4PA 2C2DA 2RQKA 4KHPF 1HR0J 1S0NA 4RW8A 5F8NA 5I3UA 1NDLA 2ZKTA 1U4BA 4DFJA 1RCXB 1VQ4S 2DEIA 1YITS 1EZZB 2R2UA 2P6SA 3JSMB 1RT3B 1WEZA 4ED5A 1NKCA 1GFWB 2R2SA 4A8YA 1CJKB 3ZNUA 1LWEA 3TQ1A 2FJEB 2E7VA 4O3QA 1V6HA 4B3RF 3CC7S 2J76E 1U47A 4IRCA 1K1QA 2PO4A 3UDCA 3PX4A 4AFFA 5KFVA 2IY5B 4GVBA 2CQGA 2VUGA 2ZITA 2R7XA 2W9CB 2CWKA 1DURA 4ZVQB 3T9ZA 3KUGA 4RU2A 2AIRB 1TELA 1K8AT 2AEFA 2WW4A 4IYQA 3TVKA 3CE8A 3O6QA 2H5JB 3HVAA 1S77D 1FRHA 2LXIA 4NCGA 5JMNA 4CH1A 3EGVA 1PKUA 3VV2B 4U9RA 1KFDA 4H4OB 2HSEB 4U8YA 1B0TA 4N47A 3MMAB 3BKTA 3DGPB 1VLOA 1HHTP 2JVOA 1FE0A 2XULA 2RDJA 4MK7A 2QA2A 4DV1J 3K17A 5CA5A 4F3QA 4N56A 3M4XA 4YFUA 4Y2MA 4FPIA 3EVOA 2COLA 3QJJA 4DU7A 5KG2A 2R7VA 3CULA 1W25A 4ZJOA 4K4SA 4ZVFA 2J9DE 1EX8A 2XY6A 1AUSL 2HEKA 1OIAA 4FNIA 4DL2A 2EW9A 2UP1A 1HWUA 3QO9A 1IBLF 3AAWB 2KVQE 4LMZA 2XZWA 3D6FB 2OPQA 4RW4B 3HSGA 1NU4A 3TO8A 3OVSA 1JLCB 1IXKA 1BQNA 1F3FA 3NNCA 1T03A 2WCXA 3HHEA 3RBXA 1UA0A 3AB4B 1YJ7A 2MY7A 2ADLA 3FT7A 2QSWA 4ZA1A 2PIIA 2PI4A 2YKQA 4CIOA 4DV2F 3EGWB 1V3RA 2CAXA 2FGOA 4DSKA 4F0MA 2VQFF 1H7XA 4MIWA 4JP8A 3CJQA 3R27A 1VC6A 3V6JA 1U24A 3D4JA 1YJ9S 4ECVA 1LK7A 4A47A 3JQJA 3GV7B 1XNRF 4DFKA 1N36F 4D8JA 1KLNA 1Q95G 4K4ZA 5ETOA 5KFJA 3B4MA 1PYTA 2ZH4A 5H1SV 4O44B 3R7BB 2YKOA 1GT8A 2G9OA 5K8NA 2H4YB 1C1BA 5EWGA 2C2OB 4AYBD 1VC5A 2QYCA 3W66A 4HHUA 4KHRA 3CCZA 1VJQA 4AXIA 2E7WA 4F4YA 3ETOA 2LA4A 2KVIA 3EXCX 2KFNA 4XDCA 3LGHA 3TUZC 2HQFA 5IM0B 1Y00A 1NO8A 5DO2A 3W60A 5IT9U 1N32J 1M1HA 2BRKA 3MGJA 3RB4A 4ZLLA 1F6TA 4NPOA 3VAGA 3UI3A 3V5RA 3TRGA 4JOUA 4LBPA 2HHPA 3CMAS 3A8EA 3EMTA 2ZUGA 2Q1LA 4JUZA 3RW6A 4ZCMA 3SCJE 2C2NA 3MECA 2YKNA 2CQCA 4RJVA 4LSLB 3QZ8A 1CJVA 1VJWA 4J9SA 2OGUA 1MWZA 1S1XB 2AW0A 4WFXA 3SV4A 4B3MF 4JV5J 4OZ5A 1OY9A 1ZYQA 1HBUA 3MD1A 3K5NA 3GIIA 1SC3B 3ILJA 4BC9A 7AT1B 4TQRA 3OPKA 4TKTA 2ILYA 2DRAA 4DBQA 2P5VA 2BKPA 4DV0J 3OUYB 1Q16B 2FHKA 2NZCA 2ERRA 1B01A 2OPRB 3CDAA 5DLGA 2DGXA 4WYLA 3OJSA 2PMHA 3UO0A 1Y5LB 4YHHJ 4FVCA 3U27A 5KFRA 4YB7A 4LF7F 1GXUA 1BUXA 3MDFA 3JQKA 2AU0A 1FKPA 2RHSB 4GC6A 4NCBA 1TL1A 1VS3A 3GSIA 2GS8A 1SH2A 3DMJB 4HHHA 4GMKA 3O2IA 5ETRA 4A8FA 2E66A 3KUEA 2K1RA 3RGIA 1VQNS 3ULHA 5CYQA 1QAIA 3EXYA 2CZ9A 4KGKA 2EC2A 2MZJA 4YMEA 1BQMB 3N5BA 2Q6CA 4XTTA 4M5MA 4YY3J 3QQCD 2L9NA 3AJ1A 1IBCB 1NPRA 3N0VA 3UR3C 3BKUA 4L6V3 4ECWA 2HNYA 2GO8A 4DQRA 1QUPA 3OW2R 3RBDA 4ZVGA 1RTDA 1PAEX 1TAQA 4Z37A 3UN5A 1SCJB 1U09A 5E0OA 2N7CA 2GVZB 5C25A 1FRIA 4P7VA 4K7QA 1KD1T 2JDJA 2DNGA 1FD8A 1N48A 3G87A 2CPYA 3OD2A 4CLUA 2DR9A 3IBWA 1VCTA 3V4IA 2DGOA 1QY7A 9RUBA 3H2UB 3QLHB 4ID5B 3R5DA 4OHXA 3KDOA 1RHMB 1UJ4A 2RKIA 4X64J 4TLRA 2F4VJ 5HVHA 4RWXA 2A3JA 5I4MA 4WBFA 3M32A 1NXIA 2GMLA 3CB4A 3R2DJ 4UTGA 5C42A 4LFBJ 4DPYA 1Z2LA 5HMXA 4V19J 3V6HA 2BR0A 3QWPA 4RNNA 2I2YA 4NL5A 1QJHA 2IPOB 4DU8A 3FBFA 4OYIA 3EYZA 1H72C 2A10A 3P8BB 4D3HA 3QIDA 1TKZA 4DR4J 3VAKA 4LF8F 2EWHA 1JKHB 4ZVRB 2AEJA 2HVIA 4CYUB 2RHQB 1B99A 2YBVA 5E5NA 2D3O1 4PQUB 1LW0A 2FUG9 2B51A 4PWDA 5ETPA 3GJQB 3G9CA 1PC5A 3NCRA 2I8EA 2W9AA 2NR0A 2KZMA 1N5VA 4K4TA 3H5YA 3QWUA 3V6DA 3C19A 1Q7LB 4ECSA 1OQ3A 2UXCJ 2RE1A 4KSEB 4PYAA 1S1WB 2VU5A 5ADZA 4MAKA 2ZZNA 3T1HJ 4C7QA 4HACA 5LJ5Y 4DX5A 1HNZJ 2KB2A 2HFOA 1SV5A 5CXTA 2H3AA 2XMJA 4F02A 2VA2A 3PJWA 2LQ5A 4QYRA 1SC1B 2B3TB 2MHNA 5G0RA 5I3UB 1Q86T 1T11A 4JI4J 4B08A 4RU9A 1CVJA 2VFRA 3BPDA 3EE3A 4FYDA 3MTKA 5GMDA 4C0OC 2B7BB 3BH7B 2B4OA 1HLWA 4QWBA 4OHYA 3IRXA 1TMJA 4CO0A 5LSLA 1VMBA 1RABB 4OI1A 2OFHX 2B6AA 3BB5A 2MYFA 3OHAA 1LWEB 2CDQA 2BRLA 3SQOP 4TYBA 5GMEA 2EFNA 2CPIA 5T14A 4USJC 2DNLA 5KFDA 1UCNA 2I0XA 4IG3A 1KHVA 4UUWA 4GVBB 1MMNA 4FF1A 3CW2C 2LVWA 3HSJA 1MYKA 5D0RA 4DSEA 2IRYA 2K1OA 5IT9Y 1Y3JA 4I6AA 4C0HA 3FSIA 2X3DA 5AE3A 2XWYA 4CLWA 4C3KA 2ZH5A 4NCGB 3NNHA 1A0OB 3LJPA 2YKMA 3D1HA 4FXVA 1IBKF 1X5PA 2GO9A 2R3VA 3M2RA 2UV8A 4TU7A 1RBOB 4KKOA 1YDLA 3HHLC 4AQYF 2CUYA 1XEZA 3NOGA 4CT9A 3HVRA 2P9EA 3T5HA 4F2SA 3FQLA 4KFBA 2N7YA 1TUWA 2DHHA 1Y10A 3TVYA 1TZ0A 3TYTA 1VQYA 1WC1A 2NREA 4C98A 1EHWA 4HV0A 1F3VA 4CO1A 4EO8A 1S6UA 1MN7A 4ECXA 2RSQA 3V6KA 3Q83A 4UOGA 1BQNB 1UA1A 1S1VA 1H98A 5EUHA 1T03B 2J6UA 3L4BC 3H98A 4K59A 4IOBA 1FRJA 1FHTA 3POTA 4XDDA 1WHXA 2YQ0A 2DPIA 4DR6J 4V1Ak 4YOEA 4NLRA 2B8PA 1Z1ZA 1NK0A 2NPFA 1DQAA 2AN7A 2ZEJA 5B0BA 2LMIA 4K2JA 1U48A 2LXFA 3I5CA 2BJ9A 3M8SA 4M63A 3EZOA 2QX0A 3WBZA 2VASA 1DTTA 3RB3A 4DDFA 4HT7A 4IG0A 4CT8A 2W4PA 2VFTA 4LR8A 1GNKA 3GR0A 2YNGA 3BREA 1HQEA 1TL5A 4NA3A 4DUTA 3IRWP 1FJCA 5DDQC 4Q2MA 4YN3B 1C1BB 3C66A 4USVA 3PHTA 2UUBJ 5DZ6A 3KHRA 2MB0B 2HHWA 3RBZA 2W1BA 3OXGA 2EKNA 3E2EA 3D6MB 2CQ1A 4P10A 1X0PA 2IM2A 5BYRA 1XMBA 4NZ6A 2R7SA 4GKKJ 3G6YA 3J7AN 1PC4A 2BACA 2C3MA 4TY9A 2B9YA 4TU9A 3OTOJ 4C8MA 2R8KA 1ZH5A 2PMWA 3GJRB 4CZCA 2VIHA 1AB8A 4DQQA 1AW0A 2DH8A 2DGSA 2V5HG 4DQIA 3KUHA 4AL7A 4WK1A 4DV5F 2YKNB 4B3TJ 4CCHA 1T94A 1CJVB 2PE8A 2VPWB 3M1VA 3CEDA 4P72A 5KFYA 4LIWA 1RAGB 2KHDA 3CD6S 5MAOA 1HBUB 1JLQA 1S4FA 2CNLB 5K14A 4TU8A 4RNMA 1UP1A 3K8WA 4P75A 1NDCA 1B70B 4WFBQ 4DCPB 4QJVA 4KPYA 1URRA 5KFEA 2CQ0A 4ENOA 4DR1F 1O5JA 3UW1A 2HHVA 1MYLA 1QSSA 4CNZA 3KJQB 2W2PP 2GQ2A 1VHIA 2OPPA 2RD5C 4O3PA 1RAIB 3TEHB 1YBTA 3TA2A 3PVXA 5JJBA 2G2ZA 4JI1J 3BGFA 1FKPB 4EBEA 1TL1B 5GAHU 1X9SA 4H54A 2Y8YA 2DEJA 2K1RB 3M9OB 5CYQB 5KTQA 2UUCJ 1MG7A 2VFUA 1DRZA 3CCES 3FZ2A 1S99A 5K20B 3AXKA 4NASA 4L74A 5D0EA 2ZJRQ 4LREA 1YSJA 3TNVA 3J7A1 2JHEA 5B0DA 1TK0A 3RZAA 2E7XA 1RTDB 1OY8A 2B9XA 3HKWA 2XMTA 1T9YA 4IFVA 3RRGA 2J6SA 5C25B 1HA1A 3I5BA 2ZE2A 3MM9A 5KFZA 1SH3A 2PEHA 2FY1A 1F9EB 5KFBA 4FS1A 2QZ8A 3CJ8A 4ICLA 1IQTA 3KG4A 2E44A 3VF0B 3L3CA 2PMZD 2B43A 2ASJA 1Q53A 3IN5A 3V4IB 3LPYA 4C6AA 2KRRA 2HLUA 4FN5A 1F5BA 3U7JA 4G6VB 1TKTA 3OFGA 1R3NA 2B0GA 2RKIB 3ZZRA 1NK5A 1VRTA 3HJFA 1TK5A 2DRBA 2OLWA 1FRXA 1GX5A 3M32B 3ISZA 4TN2A 5IOLA 1EARA 4QWDA 3WX8A 4QQBA 2CPZA 5C42B 2Y9HA 3AQPA 4RBTA 3R5JB 2N4DA 4DV4J 2KFYA 4R5PA 4ZIVA 2MSTA 2E9ZA 3D0GE 3QT6A 1I3OB 4DWIA 4OYMA 5HVGA 1C1CA 3TI0A 1TKZB 5D4PA 2D3UA 1Y5IB 4NA1A 4JBCA 2UUWA 4DF8A 4EK2A 4B9SA 1NHKL 4DV7J 5AT1B 2FJDB 1LW0B 2HGLA 4ZDNA 4PWDB 3UPFA 1FWPA 1RJJA 2ZOMA 5HMYA 4IKAA 2V2KA 4BHQA 1U2RA 2Q79A 4KV8B 2UUTA 2VQEJ 2JEFA 1SQFA 1M5OC 3V6DB 1Y11A 4KHPJ 1WEYA 4F04B 1NUEA 1PAUB 3W61A 1AFIA 1RAAB 1LOUA 4WXWA 2B9WA 1U8SA 2AY0A 2AYBA 3KHGA 2HMIA 5LSRA 3MURP 5KFXA 4HACB 2V69A 4CLFA 1OQ6A 2IVYA 3C16A 3QAUA 3UNYA 2LEAA 1S4EA 2Q2KA 1B3TA 1SV5B 2X1GA 4J37A 1Q7YT 1G7CB 3ENQA 4U7CA 1RTHA 1SQEA 2VODA 1YZ7A 2HBYB 3LANA 4YDXA 4B3RJ 1LK5A 5G0RB 2FJVA 1OSCA 3IGVA 2PD1A 3PIPQ 4ATNA 2IYIA 4KR0B 4M95A 4OZ2A 2YNHA 2BOAA 1ZA1B 2DBBA 2RILA 4C8OA 4LRAA 3TVZA 2JRSA 5F3ZA 1S0VA 3CCTA 4ZPDA 1JJ2R 2V68A 3IS9A 2B4VA 3OL9A 4OJHA 4KGZB 2D9PA 3IRXB 5HAOA 4NEYA 2B56A 2RDDA 4A8SA 3LWLA 2IVMA 2ZFHA 3RU0A 3MPYA 3DLHA 1RYRA 4USIA 3K2YA 4QIVA 1FESA 5MLCV 1REVA 1X0FA 4M5JA 2BXJA 2CZVC 3ETMA 2XEXA 4IG3B 2JNJA 1LXNA 4DN9A 5BR8F 3KMQA 1YHQS 2XMAA 2DNRA 5C2GA 1RWMB 4N7TA 3ELHA 1HHSA 1NBEB 4L75A 4DL6A 1IBLJ 4DUZF 1UEUA 4Q8FA 5L8RC 1HR0F 4NX9A 4QOTA 2YKMB 2BBEA 1S0OA 1JNRB 5JXSA 3M2RB 3RUBL 4ZOSA 4F0HA 3OHBA 3KLFA 4P6QA 4KKOB 2E1RA 3HD1A 4HH0A 3R1LA 4CLTA 4JV0A 5HLFA 2R7TA 1X4HA 3Q24A 4KFBB 3E01A 2YY3A 2DNNA 3HHLA 4ED7A 5E3QA 5B0CA 4C8NA 3MUTP 3C6TA 4DV2J 2O66A 1DQ9A 3C3LA 2ZBQA 1H7WA 1M5KC 3I31A 1WF0A 3ZTQA 4MTPA 5B0FA 3HLUA 3QFWA 5A2QU 3WZ0A 2PFFB 4C8ZA 1ZPWX 2DYAA 2DK2A 1YG0A 4CH0S 4QYZJ 3GIKA 2J9EA 2MKIA 1XNRJ 3LWMA 1NAQA 1N36J 3POTB 2FHJA 3AH6A 5IV3A 3PFOA 1XBWA 4BC7A 1KSPA 2DNOA 3Q89A 3QPIA 4K8RA 1T95A 2EBEA 3DLLQ 1U6ZA 2P9CA 1S9FA 3GFZA 4ETZA 5AE1A 2BJ8A 1ZM4A 3TZWA 3AD7C 5A8KA 2BANA 3QFHA 4Q8EA 1RB0A 1I5OB 1MLAA 3PNIA 1DTTB 4H4MA 3RW7A 3K57A 3SMZA 4N77A 1HNXJ 4IG0B 3PG9A 4NXNF 3GLJA 2XB2D 2W2QP 2DNQA 2G2YA 2M8DB 3IR7A 2YNGB 2AJ2A 1HQEB 3QGHA 2ZD1A 1VQSA 2XMKA 1H2VZ 5KFHA 4P9SA 1FJGF 2C1EB 3M8ZA 2W8LA 1VIXA 2X3GA 2ZBRA 4F4KA 1CG2A 1FEEA 2DCUB 4F4WA 4EGLA 4GC7A 1H73A 4LT6A 3JYTB 4DSJA 5HP1B 2WB4A 3M6UA 1YGYA 5K9FA 2RU9A 1V9OA 4DL0C 2EBGA 4Y34A 2EK1A 1I1GA 1TR0A 4ERDA 1NHVA 1RDRA 5J2MB 1HFEL 4GKJF 1QDUB 2JXIA 1ZM3A 2GV1A 4HKQA 2V8DA 2RRNA 5M2UA 5KFAA 2BJDA 1CQNA 3B4DA 4LF7J 2FPHX 1UFWA 3BR8A 1UVIA 3PEHA 1VC0A 3BBCA 5K14B 3CIMA 2FY8A 4MYTA 3ILIA 2V2VA 5FLXY 2C3OA 2QJ3A 2EI5A 2DO0A 1S7HA 6FDRA 5DQGA 1O51A 2BABA 5F8LA 3ZO7A 1WTFA 3B54A 4M5DA 4FXDA 4KGVB 3CCLS 2CYYA 4J9PA 4ZVHA 4J9UE 5ETQA 4EYHB 5DQHA 4H4KA 4W90B 3H2VE 2OIHA 2J0QD 2F40A 3CSKA 2HS0A 4PUOA 5HJXA 1N32F 1Y0HA 2FD2A 3E51A 3SQGB 1WG4A 2NXUA 4F3OA 1NJYA 1QAJA 2ZHBA 1VBKA 4Z7CA 2VFVA 4YR3A 5B0GA 4X4SA 4FYXB 4J7CA 4ZJLA 2RF2A 2F9DA 2LXUA 2K06A 2V67A 4OJ3A 1RA7A 3FCWA 4F26A 1SJQA 2JEIA 1U45A 1S79A 4JV5F 3SCLE 2QGFB 2MQPA 1KONA 1L3SA 1IR2A 2NUHA 3NP5A 2VPYB 3PYEA 3VHQA 1ZOTA 2EFQA 1R6YA 3PACA 2FJBB 2QRRA 4IFVB 2DGTA 1IR0A 1KVKA 4CO5A 2UXDJ 2YX4A 4Q44A 2QFJA 3MM9B 4J9OA 3DOLA 2MZQA 3BN4A 5H9EJ 1NKEA 1HBMB 4LF5F 3D67A 4ICLB 2Z4PA 3MEGA 3R3TA 3WDOA 1RAJA 4XO0A 4I7FA 2HFSA 1WC6A 3FMWA 4QU7A 3HHDA 4TVAB 1FFGB 3FSXA 1C4CA 4DR7F 2E1MC 2MLYA 3G5OA 4K0KF 4LF8J 3PEJA 2BQRA 3AD8C 2BA9A 3CDWA 1WOOA 1VRTB 3PW0A 2OJ3A 2HIYA 2ZBIA 2F3JA 1RADB 1UL3A 1FWKA 1Q5VA 1M1KT 2U2FA 1HQ2A 5GAGU 4F3MA 2LCWA 2ZC3A 3DLGA 1ZM2A 5F8IA 1PJ7A 4R5PB 3W5ZA 2CIMA 1SL0A 2IM3A 1N5TA 1YJVA 3LQVA 1C1CB 3BGRA 2PFDA 1G1XA 2QEXS 4NE9C 1FRMA 2CVIA 2O3DA 3KDNA 1Y7PA 2MQNA 2VKZG 3CTRA 1WC4A 3D7SB 1YQHA 4FNHA 1RWNB 1HNIA 2XC9A 4ZCLA 2EFPA 2IM0A 3CJRA 3ENAA 2HRYA 5JUMA 2UU9F 4OZ0A 1R27B 2RMLA 2C2RA 2YXLA 2OKQA 3GIRA 5B0EA 3Q0AA 1NSQA 1F2GA 2CQ3A 4ZCKA 3ENVA 1N5YA 4ILRA 5KT5A 6AT1B 2V6AA 1KDNA 3S1TA 3T9NA 4JI8F 3PZPA 2F4VF 1MMDA 4NLQA 3BGUA 3FNNA 3VW4A 1NMEB 1KN6A 3RAMA 1IKXA 2QE5A 3CJ2A 5DG8A 3C16B 4LFBF 3U1LA 3NS5A 1U2CA 1D8YA 4O3OA 3TA1A 3N6MA 2KG1A 1HD1A 2V8PA 1RTHB 1RT2A 2KN4A 4EWTA 2FVCA 1ZETA 5DGAA 2G13A 2CJXB 1O0PA 3I87A 4ELTA 1TAUA 3CUNA 3BM7A 2YNHB 2AQ4A 1BAZA 1Z2ZA 4K4UA 4DI6A 1JLBA 4I68A 1VQPS 2O1PA 2L9WA 1IRQA 2VOPA 3TARA 4FYWB 4ITSA 3MR2A 4ANDA 2QTWA 3IS9B 2AGPA 2E5GA 1VBZA 1NEEA 1WHYA 5D8HB 3IP0A 1ZAXA 2Y8WA 4ED3A 3DCAA 4M8LA 5ETVA 5HK4A 3MPDA 3DHWC 2NPIA 4DQSA 4YB5A 1IBKJ 3LUYA 2DH9A 2VG5A 2DHGA 2WONA 1IUJA 1REVB 1C2PA 1P8GA 1YVFA 3TR5A 4FF3A 4OYZA 1XNQF 4DPOA 3CJTA 4ANEA 2GA7A 3M05A 3T1HF 2JLGA 1S7IA 1UFKA 2FLOA 2GJ2A 1NSKL 4QBUA 2DIUA 3PM9A 1RCOB 1IR1A 2H48B 1CJKA 2P8IA 1RYSA 4OI4A 3P5TL 2W7AA 2F8MA 3MPUB 4ZPBA 2EVZA 3BO2A 4KTQA 3IC1A 1P9YA 1VQOS 1BD6A 4FDFA 5LL6d 4RBUA 3FBBA 3Q86A 2W9CA 1PCAA 3KLFB 2VDHA 2GCFA 4O3SA 3K59A 4WTOB 5DDOC 3UCGA 4ER8A 5HLFB 1M5VC 1WDTA 4QW9A 4CH7A 1K44A 5GAHI 4OHWA 3E01B 1IVZA 3HHLB 4LRCA 4PXCA 3C6TB 1NJZA 3O1LA 3I55S 3OQ2A 1OO0B 1VK8A 4WP8A 1Y9OA 4AXJA 3D1OA 3MMAA 3M8PA 3HF5A 2XNRA 4E0DA 3N5FA 1HQUB 4P2MA 5DS7A 2GAHC 4TY8B 4PR6A 3R1HA 4U7UD 4NZ7A 4UQGA 4IFYA 1VOMA 4DV6F 4FKYA 2YPZA 4NYPA 4CLPA 2AMCB 3VZIA 3W9JA 1CPZA 3UN3A 2LQBA 4FYYB 1SH0A 2HW3A 1R89A 2MKSA 1JJ4A 1UFLA 5HN0A 2Q6BA 3FDSA 1BWEA 2J0SD 2W4DA 1TV6A 4RO0A 3VALA 2OD4A 2AZ3A 2HWHA 3GP9A 2W2OP 4LBHA 4RW4A 2Z2YB 5RUBA 5A8KB 2YKPA 4ZP9A 4BLGA 1QVFR 4HDGA 2J7KA 4NMXA 4USMA 1RGVA 1FDBA 3RAQA 1M90T 4DX6A 5J1EA 4ED0A 5E33A 3AA8A 2BJ1A 4H4MB 2N3OA 1QTGA 3HZGA 1RTJA 1KC8T 1U1PA 2CWXA 2ZVSA 1ZAVA 4QIEA 1KTVA 3IR7B 2AKWB 2MZTA 3SV3A 2D1CA 2SXLA 2ZD1B 5F0UA 4ECRA 1AT1B 1T9TA 3PFEA 1D9DA 3R5GA 3DNCA 4DV5J 4USTA 4G65A 1IBMF 1K0TA 5ETKA 4PG5A 1NB7A 1WKJA 3WX4A 1ZBTA 2CNNB 1ROFA 2X1FA 4NLTA 3ILLA 3QBCA 1KRPA 4DS5A 1SB6A 3U1MA 5HMWA 3G8QA 2A6MA 4JI2J 3PRBA 1JJCB 3J80U 3TAQA 4YR2A 2VJUA 2ZNZA 3T3FA 3ADAC 5C24A 2HBRB 4WF9Q 1VISA 3GXQA 1YRTA 1U0SA 4KB7A 1FWLA 1HI8A 5J2NA 4DR1J 3OV7A 2E1CA 2V0NA 4B02A 2LKZA 2XTJP 2OMLA 2M5YA 5THWA 5KFCA 3P4UB 4IH6A 3CCWA 5KFPA
chains in the Genus database with same CATH topology
1IRQA 2BJ1A 1QTGA 2CAXA 3H87C 2BNWA 2CAJA 3BKTA 2WVBA 2WVEA 1ARRA 2WVCA 2K6LA 4HV0A 2GPEA 2CPGA 2JXHA 2Y3YA 1MYLA 2BJ8A 3FMTA 3PHTA 2K5JA 2H1OE 2CADA 1X93A 2WVFA 3VEBA 2BNZA 2RBFA 1MYKA 1BDTA 2JXIA 4ME7E 1Q5VA 3VW4A 2CA9A 1U9PA 2K1OA 2KELA 4D8JA 3BKUA 1PARA 2JXGA 2FGCA 2PC6A 2WVDA 2BJ7A 2NZCA 1B01A 2HZVA 1EA4A 2F1FA 3GXQA 3VEAA 1B28A 1MNTA 1BDVA 2K29A 2AY0A 2K9IA 2BA3A 3QSIA 2BJ9A 3LGHA 2BSQE 2BJ3A 1BAZA 3OD2A 2HZAA 3FT7A 3QOQA 1ARQA 4FXEA 1Q5YA 3BKFA 1P94A 1NLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRQ A;  2BJ1 A;  1QTG A;  2CAX A;  3H87 C;  2BNW A;  2CAJ A;  3BKT A;  2WVB A;  2WVE A;  1ARR A;  2WVC A;  2K6L A;  4HV0 A;  2GPE A;  2CPG A;  2JXH A;  2Y3Y A;  1MYL A;  2BJ8 A;  3FMT A;  3PHT A;  2K5J A;  2H1O E;  2CAD A;  1X93 A;  2WVF A;  3VEB A;  2BNZ A;  2RBF A;  1MYK A;  1BDT A;  2JXI A;  4ME7 E;  1Q5V A;  3VW4 A;  2CA9 A;  1U9P A;  2K1O A;  2KEL A;  4D8J A;  3BKU A;  1PAR A;  2JXG A;  2FGC A;  2PC6 A;  2WVD A;  2BJ7 A;  2NZC A;  1B01 A;  2HZV A;  1EA4 A;  2F1F A;  3GXQ A;  3VEA A;  1B28 A;  1MNT A;  1BDV A;  2K29 A;  2AY0 A;  2K9I A;  2BA3 A;  3QSI A;  2BJ9 A;  3LGH A;  2BSQ E;  2BJ3 A;  1BAZ A;  3OD2 A;  2HZA A;  3FT7 A;  3QOQ A;  1ARQ A;  4FXE A;  1Q5Y A;  3BKF A;  1P94 A;  1NLA A; 
#chains in the Genus database with same CATH topology
 1TKX A;  1S0M A;  3T6B A;  3IGN A;  1HNV A;  3PCO B;  4OYO A;  1EP4 A;  1MRO A;  4X66 F;  1KKH A;  3H4B A;  3K5O A;  3LOU A;  1KQG B;  3VVT A;  2F9J A;  3M6X A;  3TZY A;  3W9I A;  2LEC A;  4FZV A;  2GIR A;  3UD4 P;  1FK9 A;  4OYX A;  3E8O A;  4N41 A;  4OYW A;  4EEY A;  3VTI A;  2HRT A;  4M5D B;  3W63 A;  5A6P A;  4XK8 C;  4LQ9 A;  3A3O B;  4NLG A;  2RS8 A;  1B64 A;  1W2I A;  2HNZ B;  3SXL A;  3OTO F;  1RWV B;  4PUO B;  1BC6 A;  4I56 A;  5KG7 A;  1J27 A;  1KS2 A;  3GZ7 A;  1GXL A;  1GEH A;  2K29 A;  1RWO B;  4OYP A;  1EJ7 L;  1RT6 A;  3ZZU A;  3S6E A;  1RAE B;  3LAL A;  3LA0 A;  3HPO A;  2FVP A;  2ASL A;  3O44 A;  9ATC B;  4EFA C;  3CVK A;  1U26 A;  1FXD A;  5L39 A;  3DI6 A;  4LF1 A;  2FZK B;  2R2R A;  2OI2 A;  5KG1 A;  2HBZ B;  1K9M T;  1MSW D;  5IQ6 A;  1MN9 A;  3JTO A;  2MQ8 A;  4ZVP B;  4UOH A;  3RRH A;  1UPP A;  1R7I A;  3DMJ A;  4LVN P;  4CLL A;  4RR5 A;  2DNY A;  1DBD A;  2CA9 A;  1D0E A;  1E6Y B;  3MTJ A;  3M8Y A;  4E98 A;  1BQM A;  3DOL B;  3OXF A;  1S1U A;  3DRX A;  4PG8 A;  2IA0 A;  3MEG B;  2OTJ S;  3BBB A;  3M2U A;  4I7F B;  2B7C B;  1HWK A;  5A0Y A;  2HBQ B;  4OV1 A;  2Z8Q A;  2GGP A;  1FE4 A;  2WZ1 A;  4N5S A;  3ZFV A;  3R8Y A;  4PG4 A;  4WWS A;  1XR7 A;  1B4S A;  3TEG A;  1GAO A;  4B9M A;  2VBW A;  1VR6 A;  5FDL A;  3W64 A;  1KR4 A;  4P52 A;  2MLZ A;  3MF5 A;  3UR0 A;  2W2N P;  3DLG B;  4FBT A;  3FEY B;  3FK4 A;  4MKY A;  1U49 A;  3ET6 A;  2DO4 A;  3VQS A;  3GMG A;  5BXI A;  1IKW B;  1Q4R A;  2K6L A;  4BCA A;  3QLH A;  3F73 A;  4OI3 A;  3DDN A;  3G8S A;  2OSR A;  5J2Q A;  3EZU A;  1R0A A;  2DHA A;  2KJV A;  4QIW D;  2XGP A;  2R9L A;  5KT7 A;  4KAI A;  4DUY J;  2V2Q A;  1YWX A;  2ZOG A;  2DNZ A;  2AJ0 A;  3AT1 B;  4NLP A;  2V8V A;  1IKV A;  4KE5 A;  4UZB A;  2ZC4 A;  4PG6 A;  2KJW A;  3ZTS A;  1HNI B;  3D0H E;  3BO3 A;  2NCK L;  5DLF A;  2OTL S;  3OR1 A;  2AEM A;  2QA1 A;  2HK3 A;  3HI9 A;  4L72 B;  1VBX A;  1X4F A;  3ZZY A;  3SEO A;  4F4A A;  1N5Y B;  4B3O A;  1HHQ A;  1WF1 A;  2BM0 A;  3LP1 A;  1CJT A;  3FFI A;  1HD0 A;  2KTQ A;  1D8Z A;  4DLG A;  4JI0 F;  1RWK B;  1P94 A;  3T6J A;  3ZZP A;  1IKX B;  1TMM A;  3K89 A;  4PQU A;  5CD4 H;  2QLB B;  3J81 U;  1N54 B;  1R8A A;  4PXE A;  2C3P A;  3VAM A;  1S12 A;  4JI5 J;  4DV4 F;  5F8J A;  3SCK E;  3OTC A;  1RT2 B;  2V63 A;  2NZ4 A;  2WVF A;  2QN6 B;  2FHO B;  4O23 A;  3O3L A;  5KG0 A;  2RIJ A;  2BE7 D;  4OZ3 A;  3Q23 A;  2XBP A;  4P2X A;  4RL1 A;  4I4B A;  5BR8 J;  2CQB A;  1JLB B;  2GIF A;  2N3L A;  3H7H B;  2M88 A;  1VYA A;  2OHD A;  4ZLJ A;  3OTB A;  2CPX A;  3AD9 C;  3ZZT A;  1HL6 A;  1XMQ J;  2MZ1 A;  2JC1 A;  3A8J A;  1P27 B;  4BBY A;  3NAH A;  3C15 A;  2VG5 B;  2IBO A;  3NWR A;  2BMB A;  1XMO J;  1OPZ A;  2WON B;  2B5J B;  1TK8 A;  4PPD A;  2AWZ A;  4NRT A;  1RAC B;  4LRV A;  2VV5 A;  3H40 A;  4ALZ A;  1KFS A;  3J80 Y;  1PJ5 A;  3AJD A;  4HYK A;  3DOM A;  4FYV B;  3IWX A;  2IJR A;  2HHT A;  3MHY A;  1N4L A;  2FTR A;  1X5S A;  1WSR A;  4CM2 A;  3SSR A;  3NRB A;  4DZ6 A;  3AQO A;  2ZWP A;  1GMU A;  1ZTW A;  3UE2 A;  3KK3 A;  4PEO A;  1KHW A;  3RBE A;  3GSD A;  4CRJ A;  2VDI A;  1TQL A;  1VK3 A;  3HHK A;  1IKY A;  2D41 A;  4ZPT R;  5KFI A;  3W2V A;  4DX7 A;  4R0E A;  3NKY A;  1UMJ A;  1RU2 A;  4DHV A;  1O8B A;  3NS7 B;  1WOR A;  3CNQ P;  1NK8 A;  1KQK A;  1F60 B;  3IA0 A;  2Y1R I;  1RWP B;  1U1M A;  3W9H A;  1YK9 A;  4NLU A;  3MAA A;  2EG1 A;  3WIU A;  3PHE A;  2IJN A;  1U1K A;  1FRL A;  3M8P B;  4F4X A;  3QRQ A;  2GHW A;  1DFD A;  5L1J A;  4URQ U;  3D5M A;  2VD3 A;  1T3N A;  1PGZ A;  5KFG A;  2DTJ A;  1SBR A;  4HTI A;  4IFY B;  2O67 A;  4J9Q A;  2CPD A;  4KGM A;  3FJ2 A;  1DHM A;  3D28 A;  1SVD A;  5EGY A;  4MIA A;  2BDP A;  2DXE A;  4NXN J;  1H3D A;  2ZVI A;  3TJA A;  4QWE A;  1FJG J;  5BYS A;  2FLN A;  1S6Q A;  3IXQ A;  1TV6 B;  3VEB A;  1TVR A;  2RBF A;  1UTA A;  2NXC A;  5GAD U;  5IT4 A;  3BV8 A;  4C48 A;  3DRR A;  2YKA A;  4F2R A;  5J1E B;  2ROE A;  4C8L A;  3IR6 B;  1B7Y B;  1TTH B;  1OMS A;  3V81 A;  2PA3 A;  4CLZ A;  1GXT A;  2K7J A;  5LMN J;  1RTJ B;  2DCL A;  4DSL A;  5E41 A;  2IAJ A;  3KWM A;  1HKA A;  4B3S J;  2M0G B;  3BZQ A;  3ZZZ A;  1XC9 A;  1RSC A;  3OSP A;  3ICL A;  5GAG I;  3ISN D;  3DLJ A;  2XS5 A;  3UQS A;  2VB6 A;  3BQ1 A;  1KNZ A;  3HVT A;  3Q8V A;  5EWE A;  4GKJ J;  5T7L A;  4IDK A;  3FCH A;  3R5A A;  4C11 B;  2GHV C;  4ZVU B;  1GMW D;  4WP3 A;  1PJ6 A;  4WZM A;  2FJA B;  2Y1L B;  5E3C A;  2A1B A;  1ZPV A;  5C24 B;  4PPZ A;  2HFN A;  4WPA A;  3KLG A;  1RT4 A;  2CQP A;  5J2N B;  2XO6 A;  1FNO A;  3DN9 A;  4MK8 A;  4PWW A;  4UOC A;  3OR2 A;  4Q45 A;  2HVD A;  3KNG A;  2G0I A;  3EVW A;  4QYZ K;  3DRP A;  1RWX B;  1KQS R;  1TKX B;  4K5S A;  3DDK A;  1HNV B;  1HNX F;  2IA6 A;  1EP4 B;  1MRO B;  4W4M A;  5ETN A;  2RQ4 A;  3GFY A;  3QRP A;  5LM7 E;  1UZD A;  4HLB A;  2E5I A;  2JEG A;  1BWV A;  5IWA J;  2NXN A;  4U96 A;  4I2P A;  1FK9 B;  4FXW A;  5F0W A;  2KG0 A;  1L3K A;  1UW9 A;  3FRY A;  3BDE A;  2H54 B;  3U1N A;  2PEB A;  1D09 B;  4LF6 J;  4FP9 A;  4J9L A;  2KXF A;  3CD5 A;  3OVA A;  2RT3 A;  4I1T A;  4MMO A;  2G1H A;  2QG9 B;  4X4R A;  2XYG B;  5DG7 A;  2MY8 A;  4F4Z A;  2YX1 A;  1YZ6 A;  5HI7 A;  2V4Q A;  3AFG A;  1CS4 A;  1RT6 B;  2J0W A;  5HQ8 A;  2IBK A;  3MED A;  1UKU A;  3QAT A;  3TAM A;  1HBN A;  3MPW A;  2AYE A;  3KMS A;  2ZHO A;  1G3O A;  3R5C A;  3UCU P;  3TJ8 A;  3M8R A;  2V4R A;  1ZM9 A;  4LF5 J;  3J81 Y;  4DX8 H;  3DI6 B;  4TXS A;  4WKY A;  4ZPV R;  3I0S A;  1L3V A;  2DD8 S;  3SSS A;  4UW2 A;  1H0H B;  1T9W A;  4IH7 A;  4Y2C A;  4DR7 J;  5J1P A;  2BE9 B;  4LSN A;  4FBU A;  4K0K J;  1RE1 B;  1XIQ A;  5KFS A;  2W25 A;  3D0I E;  1FDN A;  3UNG C;  1E6V A;  3J81 j;  1RHJ B;  1R8P A;  5C7P A;  2ILZ A;  3PY8 A;  1SC6 A;  5M2P A;  4IRD A;  5C5J A;  1JJH A;  1QSY A;  1UVM A;  4MK9 A;  4AUK A;  1K1S A;  1S1U B;  1T3O A;  2M9K A;  3CC2 S;  2FB0 A;  2W7P A;  1YJN S;  3M2U B;  1T9U A;  2VOO A;  4K4W A;  3ZTP A;  3DLE A;  2ATL A;  5A0Y B;  4EZ6 A;  4I69 A;  1TL3 A;  2GGP B;  2XLI A;  4IR1 A;  2C2E A;  4EU0 A;  3NEK A;  2A2B A;  4ED1 A;  1KVI A;  2IMO A;  2ASD A;  3A3P B;  4OX8 A;  5FDL B;  1Q81 T;  2Z30 B;  1X9M A;  3BSA A;  2CKW A;  3W3S A;  3M2V A;  2OPS A;  4Z7Y A;  2MKC A;  3VZH A;  2UU9 J;  3ET6 B;  1YX2 A;  4DPT A;  4LJM A;  4EMD A;  1X31 C;  2J6T A;  1WUU A;  3CT9 A;  4ZPW R;  4YP3 A;  3MWB A;  5J2Q B;  2QIF A;  4I2Q A;  3W7B A;  1R0A B;  4JI8 J;  2HHQ A;  1NSP A;  3BGL A;  1YBA A;  2YWH A;  3IR5 B;  1SKU B;  3F0N A;  2ACY A;  2Q3P A;  2UXD F;  2VON A;  5AXM A;  4A48 A;  1IKV B;  3D54 A;  5A8R A;  4QPT A;  3OLB A;  3ITH A;  3OFF A;  2UVR A;  1APS A;  5AXL A;  2QLF B;  1NDP A;  3AOD A;  5L9X A;  1EAY C;  4LFC F;  1IM6 A;  3OR1 B;  5FII A;  4U6P A;  1D9A A;  1FKO A;  1T05 A;  3GJT B;  3SYZ A;  1A7G E;  5H9F K;  3MMC A;  4HVZ A;  4W98 A;  3MUM P;  5KFN A;  4B3O B;  4C9D A;  3I32 A;  3LP1 B;  1CJT B;  3FFI B;  4LUB A;  4ES2 A;  5H9E K;  4UY8 T;  2Z2Z A;  1DJ0 A;  4YB1 P;  3R6L B;  1WI6 A;  3M7V A;  3QJL A;  1WEL A;  3LGN A;  3MCM A;  2GZO A;  4ZIT A;  1JLF A;  3MR5 A;  3N28 A;  3CC4 S;  4WE1 A;  4KV8 A;  1WTB A;  2LU2 A;  2HHH F;  1N0U A;  4LRD A;  3UDV A;  3GG0 A;  3PW7 A;  3KJV A;  1WAC A;  1WI8 A;  2V94 A;  1Q5Y A;  2VZ9 A;  4WXO A;  2V34 A;  1XNQ J;  4WZQ A;  5LXY A;  3AOC A;  3M6V A;  1WKK A;  3IG1 A;  4N8N A;  4PAB A;  2HFZ A;  4DL3 A;  2IC3 A;  3SDE A;  4V19 X;  2HRU A;  3VCD A;  3EDQ B;  1NK6 A;  2WW8 A;  4KPC A;  1OHN A;  4NLV A;  2H4W B;  2MQM A;  4RUB A;  5KFF A;  3BN7 A;  1CC8 A;  2LEB A;  3J7Z 5;  3R6G B;  1FNX H;  1JMT A;  3C15 B;  3OJU A;  2VIC A;  1UEK A;  1KWM A;  3TAP A;  1F5A A;  2ROG A;  4KHM A;  2MLX A;  5AXK A;  4F7V A;  1RIS A;  2YNI A;  3I9Z A;  3LAK A;  3TZZ A;  3DOM B;  2BUN A;  1F9F A;  1FKA F;  4OX9 J;  1HNW J;  1S9E A;  2KL8 A;  1K73 T;  1FX4 A;  1SJR A;  1CC7 A;  3BR9 A;  1X4E A;  8RUC A;  2BSQ E;  2MTL A;  1S5Z A;  1UVK A;  1R8H A;  3KK3 B;  3RTV A;  3D6T B;  1X5O A;  2MKK A;  1R6V A;  4KQZ A;  3MR3 A;  3UCZ P;  1IKY B;  3W2V B;  1HBO A;  2H3E B;  3VGU A;  4DV6 J;  4WYW A;  4WFN Q;  1MWQ A;  1PYO B;  1VDH A;  1HAR A;  2QL9 B;  2FC8 A;  2R8I A;  2E1P A;  3HT0 A;  4OHV A;  1NDK A;  5EHH A;  3NY0 A;  5B09 A;  4G1I A;  4RW9 A;  3IAS 9;  3MAA B;  3AJ2 A;  4NEZ A;  2KO1 A;  3P49 B;  4DMZ A;  3G96 A;  1FF2 A;  4DL4 A;  4CI0 B;  1IN0 A;  5HQL A;  2G2O A;  2HFU A;  3DRS A;  3Q8S B;  3QT8 A;  3LW5 C;  1X8D A;  3J7Z T;  4WTY A;  3NGD A;  4J90 A;  1CQM A;  3T5L A;  3A12 A;  3B8H A;  3C2P A;  1NK7 A;  1QD1 A;  2R7R A;  5HBM B;  1FXR A;  1S6Q B;  2PGC A;  1IBM J;  2V9K A;  5AXN A;  4NCA A;  1TVR B;  2E9R X;  1M1G A;  2WBM A;  1YJU A;  1EQM A;  5E7O B;  2VBZ A;  1VGY A;  3FUY A;  1QTN B;  4QIF A;  5HRO A;  1BHN A;  2EEY A;  2VKR A;  3DRR B;  1S6P A;  1C0U B;  2BNW A;  3KLE B;  3V81 B;  1RWW B;  2VG6 A;  3I0R A;  3LPE A;  2GX8 A;  2IAJ B;  2GMJ A;  2C28 A;  1ZZF A;  4X84 A;  5IFM A;  4I64 A;  1XQI A;  3Q2T C;  3VAI A;  4WCE Q;  2F4F A;  1BY9 A;  5M2R A;  3GWC A;  3HVT B;  3BEG B;  5LJ3 Y;  3HK2 A;  4WJB A;  1IJE B;  1FTR A;  1WJ9 A;  1LKZ A;  4OJ1 A;  5T7L B;  3V4M A;  2V8G A;  2LA6 A;  4IDK B;  3R7N B;  1UWB A;  1RWU A;  2MZR A;  3NWG A;  2LQ9 A;  4FKX A;  4AL6 A;  2HVH A;  3QGP A;  1HWI A;  2BVZ A;  4X66 J;  5CCM A;  4J9N A;  2KYX A;  5A6W A;  3KOA A;  1S59 A;  3X1L B;  1SJ1 A;  3I4H X;  1DTQ A;  3KLG B;  1RT4 B;  4U8V A;  4R25 A;  1UZH A;  3OR2 B;  1SJ4 P;  4EBC A;  4QCL A;  2OO4 A;  3BH6 B;  3JYT A;  4PKD B;  3DC2 A;  2ZOF A;  3Q8Q B;  4QR2 A;  5HP1 A;  3DRP B;  3R9L A;  3CJ4 A;  3EVM A;  5DQI A;  1U1Q A;  4OLP A;  1NLK L;  2E5L F;  1HIY A;  3CDU A;  3HSD A;  4JV1 A;  5C2C A;  4URS A;  5J2M A;  3ZNJ 1;  2DIV A;  2RUS A;  2GIQ A;  2YVS A;  4I2P B;  1PAR A;  2LQJ A;  1REG X;  3HX9 A;  4JI2 F;  2KOE A;  2JLE A;  1NPK A;  3OVB A;  1D1U A;  2C3U A;  4ZIW A;  5HMZ A;  1UEV A;  5CHC B;  1OY6 A;  2DKO B;  1UJ6 A;  3G4S S;  1BXN A;  4A8X A;  2V8H A;  5L46 A;  2A2D A;  3MM7 A;  3J7Y U;  4H4K C;  2A0F B;  1CS4 B;  1PBA A;  2W2M P;  1UW4 A;  2ZUA A;  3MED B;  4FXE A;  1SC4 B;  4M1K A;  3FVY A;  3TAM B;  1HBN B;  5KOW A;  4GO5 X;  3D6H B;  3B78 A;  3DLB A;  3TX0 A;  2J9D A;  1Q79 A;  2O5D A;  3MM5 A;  4ILM A;  1AZS A;  3IFE A;  3I0S B;  4NWB A;  4WFY A;  2VG7 B;  4OYA A;  1RLD A;  2MEW A;  4OFZ A;  3SQG A;  4B9N A;  2KFZ A;  5K8P A;  3SFU A;  4LSN B;  2BOP A;  4LQ3 A;  3K5P A;  5D3G A;  3GYX B;  1E6V B;  2AGQ A;  2D69 A;  3HCX A;  5IC4 B;  2M52 A;  4IOC Q;  4ZP7 A;  5HJY A;  2PC6 A;  1YI2 S;  3T1Y J;  4X4U A;  2HQ3 A;  4URG A;  3ZTR A;  1MWY A;  4M5G A;  4WK3 A;  2MHE A;  3HP6 A;  3LP0 A;  2EC0 A;  4OYB A;  2WSF C;  5KT3 A;  4ETX A;  2HAF A;  3K5L A;  4ZKA A;  4O0I A;  4O4G B;  3T1A A;  1FJ7 A;  3RAX A;  2JC0 A;  1BDV A;  3GV8 B;  4RW6 B;  3N01 A;  4X62 F;  4NXM J;  3DLE B;  1WHV A;  3PYD A;  4YS2 A;  2BJ3 A;  1TL3 B;  3TWZ A;  1S9G A;  3QOQ A;  1XN9 A;  2RDI A;  2YQ3 A;  3KTQ A;  1VQ8 S;  3JAM U;  1ZZN A;  1SUQ A;  2HPU A;  4PXD A;  3PX0 A;  2ACM A;  1XTZ A;  4OZJ A;  4KGX B;  2AYM A;  5ITH A;  4L73 A;  3M2V B;  2OPS B;  1HBM A;  4ID8 A;  1RHR B;  2WHO A;  5D15 A;  4Q0B A;  1N33 F;  4IQX A;  1DAX A;  3LAM A;  2IDL A;  1N34 F;  1RT5 A;  1WDD A;  3GQC A;  2UZA A;  1Q78 A;  1KP6 A;  1JLE A;  5KAK A;  2CPE A;  3TQE A;  2ROP A;  1X4C A;  2W7O A;  5DG9 A;  3OL7 A;  2DHS A;  4I2Q B;  1U6F A;  2KT2 A;  2E1A A;  4F67 A;  2GFF A;  4USU A;  3U02 A;  4JI0 J;  2MKH A;  1RTZ A;  2WVD A;  3QZ7 A;  2VH7 A;  5ETS A;  2BJ7 A;  2CDR B;  2V50 A;  1H38 A;  4B17 A;  4HT5 A;  2HZV A;  3H59 A;  4Y65 A;  5L1K A;  4OI0 A;  2DGW A;  5A8R B;  4O0N A;  1WG5 A;  3ITH B;  2J0X A;  2WRM A;  1EET A;  3L7O A;  4GRS A;  2RRA A;  5GAD I;  4DCO B;  4MT1 A;  1FKO B;  1T05 B;  4DL7 A;  3G86 A;  3VGV A;  5FLX U;  2IRU A;  3MMC B;  5DGB A;  2JWN A;  3FMB A;  1JQG A;  2X1A A;  2B4P A;  5T41 A;  3FGV A;  5KFM A;  4MJW A;  1WEX A;  3IAM 9;  3CCU S;  1YLX A;  4R8U A;  4YUD A;  4KYZ A;  2CAJ A;  5EWF A;  1JIH A;  2NS1 B;  2I38 A;  4U67 Q;  4DR5 F;  3OXL A;  3NBP A;  4G3I A;  4DV3 J;  4TYA A;  2W9B A;  3C6U A;  3H20 A;  2XS7 A;  3H5S A;  1JLF B;  3I82 A;  4WE1 B;  2KYZ A;  2X1B A;  4RBV A;  2Y0S D;  3MAQ A;  2H5E A;  3L7U A;  3UN2 A;  3KJV B;  3T5J A;  2GHP A;  1SPB P;  2L41 A;  1GTH A;  4DUY F;  4ELU A;  2ATC B;  3RG6 A;  2J7U A;  1RHQ B;  1VIO A;  1SL1 A;  3GCW P;  2AV5 A;  3TX8 A;  3IG1 B;  4F0K A;  3IMQ J;  3PYG A;  2IC3 B;  3SDE B;  2Z2L A;  3EPG A;  3M8Q A;  4ZMM A;  1RTI A;  3MXH P;  4YQW A;  2ZZM A;  2HHX A;  2MMY A;  3W8G A;  3Q2S C;  2F8H A;  5EX3 A;  3NS6 A;  2DHX A;  3CGI A;  4RX6 A;  5LT5 A;  3CJ5 A;  2BE2 A;  1VRU A;  3QGI A;  4HTJ A;  1UVN A;  5DJB A;  4NRU A;  2F5G A;  2GJI A;  3CXC R;  2IMW P;  5DM6 Q;  2YNI B;  2D9O A;  5KT6 A;  4FS2 A;  1R0C B;  2RQM A;  1JXL A;  1M5S A;  4DR3 J;  1S9E B;  4JI5 F;  3CCQ S;  1WC3 A;  1Y5N B;  1JB0 C;  1D9F A;  1NCL A;  4A8O A;  4LSZ B;  2XMM A;  5CAB A;  3UD5 A;  2KM8 C;  3ZZO A;  2FZC B;  2ZH8 A;  2B9E A;  1VQ5 S;  4KRW A;  1HW8 A;  1HBO B;  2ZHA A;  2LLZ A;  1EA4 A;  2UVW A;  5CYM A;  3KLH A;  2ZDO A;  1XJW B;  1LWF A;  2CJA A;  3N9U C;  3VWS A;  1XMQ F;  2HZA A;  4RW9 B;  1RQ0 A;  3PW2 A;  4DSI A;  3WC0 A;  3MM8 A;  1S49 A;  5KFW A;  3KLI A;  3KKF A;  1NSA A;  2WOM A;  1LQ9 A;  1XMO F;  1VQ9 S;  2H65 B;  3NNE A;  3DRS B;  3T5K A;  2AJ1 A;  2QLX A;  2QA4 G;  2YX7 A;  2XHC A;  4AAI A;  2KXH A;  4A8K A;  5HAT A;  3BF4 A;  1KOH A;  3HM9 A;  2KH9 A;  3MM6 B;  4UT4 A;  3KJF B;  4Q5V A;  2KKH A;  4IH5 A;  5F8M A;  1OG7 A;  4PQA A;  3NNA A;  1WWH A;  3LTO A;  4C8K A;  1TUV A;  3WC2 A;  4ANC A;  1HQU A;  4G1P A;  1TL4 A;  4TY8 A;  4X2B A;  1PYS B;  4ZPC A;  2HYI B;  5HRO B;  3KFW X;  1T0T V;  4CQ1 A;  4OI6 A;  1S6P B;  4OZN A;  1X5T A;  5F8G A;  3VEA A;  5I3Q A;  4RUH A;  2AP6 A;  3LF0 A;  4ZHR A;  4J91 A;  2VG6 B;  1VFJ A;  3I0R B;  2R42 A;  2UVU A;  4B9T A;  1NRK A;  3Q22 A;  1UAW A;  3V2U C;  1RU1 A;  1G2E A;  1H2U X;  3ZZ0 A;  3CCS S;  2HQG A;  1Y3K A;  2DNM A;  5IV4 A;  4O4R A;  2KRB A;  1LFP A;  2I5J A;  4F8R A;  1KBR A;  1H2T Z;  2GQQ A;  1EQ0 A;  2WVB A;  3IWN C;  1UWB B;  4ED8 A;  4J9V A;  3RR8 A;  1TP7 A;  2GVD B;  3SCI E;  3N4W A;  1CBK A;  3MFH A;  3FMT A;  1GMV A;  2OEJ A;  3PTW A;  4CM0 A;  3BYP A;  3SFG A;  2H1O E;  4JV2 A;  4KJI A;  1FFS B;  4ZK7 M;  4PZV A;  3BYR A;  3ONQ A;  1DTQ B;  3CMQ A;  1ZA2 B;  3JAM Y;  2XSJ A;  5E3P A;  4OX6 A;  5CQG A;  3I6P A;  1J5E F;  3G6V A;  2ZM6 J;  2XY7 A;  5K8M A;  1GTE A;  4Y3C A;  2LEP A;  3UVJ A;  4DF4 A;  2CPF A;  4PCQ A;  4D3G A;  1ZS6 A;  3CD0 A;  2AF6 A;  5LMN F;  3T41 A;  3FQK A;  4EO6 A;  2BJE A;  4B3S F;  1RT7 A;  1JK9 B;  3M30 A;  1DY3 A;  4OZ1 A;  2HS3 A;  5CH7 B;  2HIQ A;  5CZV A;  4YDD B;  3D9B A;  5GMK a;  3ISN C;  2IHR 1;  3P5B P;  2QYG A;  1P1T A;  1FA0 A;  4K4X A;  2HFV A;  1EKR A;  4C0B A;  3ENW A;  4DPU A;  3GIL A;  2WSE C;  4MFB A;  1YIJ S;  2DR7 A;  2ABY A;  2UUA F;  1HYS A;  3JXO A;  2MQQ A;  3O5T B;  3I96 A;  4KC5 A;  3W1Y C;  5I42 A;  1U9P A;  5ETM A;  7FD1 A;  1BGX T;  3EM1 A;  3MM7 B;  3GG1 A;  3CJS A;  2OMO A;  1QE1 A;  2QMW A;  1J5O A;  2MSS A;  3GFX A;  2NYI A;  3JSY A;  1VQM S;  4NYO A;  3TA0 A;  5F9L A;  3I9V 9;  5HVF A;  2AX0 A;  1F0X A;  2HNZ A;  3MM5 B;  1WC0 A;  1VHF A;  1AZS B;  5KT2 A;  2K8G A;  1AA1 B;  3H90 A;  1LWX A;  1WD6 A;  1SJ3 P;  2HGN A;  4RW8 B;  5D3G B;  2C2M B;  3PW5 A;  3BDP A;  2CQ4 A;  3RYL A;  3W65 A;  5IWA F;  3MEE A;  2J9C A;  3CCM S;  3O8W A;  4LF9 J;  1G6B A;  2AX1 A;  2CQH A;  1N5S A;  4IO1 A;  1IWA A;  3WIV A;  3LP0 B;  2QO3 A;  2Y3Y A;  3M8W A;  4LF6 F;  1Q8B A;  1YRX A;  3CWJ A;  4XAK A;  4DS4 A;  1U1N A;  1X60 A;  3EIC A;  3KLV A;  2E5H A;  1TFY A;  4S0M A;  4CTA A;  5HO4 A;  2AJQ A;  3PDN A;  1S9G B;  3THV A;  2HKE A;  2XYP B;  2VBX A;  3RR7 A;  4EI2 A;  1ULR A;  1HMV A;  1SUQ B;  5IZH A;  5GAE U;  4A8Q A;  1MNE A;  4P2S A;  1E6Y A;  4KH0 B;  3VGS A;  5CCL A;  3HUL A;  4E8U A;  4N8O A;  4Q0B B;  1WHW A;  4QWA A;  3UFC X;  3TAN A;  4LFC J;  3QYY A;  1RKI A;  3PIO Q;  3VGT A;  3EPI A;  1RT5 B;  2R2T A;  2FJW A;  1S48 A;  2PI5 A;  4DPW A;  3AB2 B;  3QGG A;  1JLE B;  3NGS A;  2CG8 A;  2HWI A;  4EBD A;  4LFA F;  2FVR A;  1GX6 A;  1RHU B;  1IWG A;  3MCO A;  2NXJ A;  1M0S A;  2HND A;  3TUI C;  3PX6 A;  1DQ8 A;  1WF2 A;  4RNF A;  1FVQ A;  2BZ2 A;  2CG4 A;  1NK9 A;  2DIT A;  2OH2 A;  1NJX A;  3VVU A;  1JLG A;  3NCP A;  4WU3 A;  4DR2 F;  3SIP B;  1N0V C;  1EET B;  1IKW A;  3IM9 A;  3W2W A;  3S8S A;  1FI4 A;  2HHH J;  3QO9 B;  3L95 X;  1HW9 A;  4O3N A;  2Y1J A;  2DY9 A;  2OPQ B;  4FPR A;  1DAR A;  5KFO A;  1X4G A;  4EZ9 A;  2IFX A;  3TUJ C;  2RU3 A;  2X51 A;  4OI2 A;  5DET A;  4JYA J;  2CNK B;  2KI2 A;  3PJX A;  5DRK A;  4DOZ A;  3TZX A;  4R8U B;  2FJX A;  3MEK A;  4Y28 C;  3G6X A;  2EK6 A;  2BA3 A;  4TNO A;  3NBP B;  2W9B B;  3C6U B;  2GC8 A;  2IIH A;  3KXD A;  1W2B R;  4X4T A;  2X7I A;  1G4C A;  3NGU A;  1Q0N A;  1NZA A;  3PYF A;  4Y6I A;  1URN A;  2YWK A;  4C3M A;  2M70 A;  4P2F A;  3ZTO A;  4IR9 A;  2ZZT A;  4I0W A;  1JNZ B;  1BLU A;  2CJ9 A;  2XZD B;  1SKW A;  3M8Q B;  4QIG A;  1HI0 P;  4JI7 F;  5F3T A;  1RTI B;  3GFH A;  2CPJ A;  1PO6 A;  1FFW B;  1PBU A;  4IUF A;  5KG5 A;  3KG0 A;  4CO4 A;  1QVG R;  5LSO A;  2JFK A;  4X4V A;  3CDE A;  1NK4 A;  2ZH3 A;  1JXV A;  4AT1 B;  3GE9 A;  1NZ8 A;  2BE2 B;  3DLK A;  1VRU B;  1N5Q A;  1N88 A;  2XCA A;  3HVW A;  2F1F A;  4L76 A;  4I6W A;  3OL8 A;  1IQZ A;  2K9I A;  1H74 A;  3DHX A;  3HKZ D;  4GVL A;  1VQK S;  2ZNY A;  1RUS A;  1FVS A;  3Q8U A;  2JEJ A;  2ZJP Q;  2ZH1 A;  3AXM A;  4RZR A;  1S1T A;  4C4W A;  1P6T A;  1K47 A;  3GTY X;  3MEC B;  3NCQ A;  1U02 A;  4X65 F;  2NXE A;  2B5J A;  2DR5 A;  3FSY A;  4KIA A;  3DXB A;  3KK2 A;  1P9Q C;  2IM1 A;  3DU6 A;  4M5H A;  2GPE A;  1XK8 A;  5CYM B;  3KLH B;  3NGK A;  3J7Y I;  3CCR S;  1LWF B;  2CAD A;  1Q8I A;  1VLY A;  2FIU A;  1BMQ B;  3FBE A;  4JI3 J;  4LF4 J;  2CJQ A;  1IM4 A;  2W4C A;  2L48 A;  3MM8 B;  3DFE A;  3KLI B;  4M5L A;  3BO4 A;  2WOM B;  4OHZ A;  4CNY A;  5AJ3 J;  2WBR A;  2M4M A;  1RKJ A;  4DLE A;  3GIJ A;  1KEK A;  5KFK A;  5DM7 Q;  2JZ5 A;  2BM1 A;  4QW8 A;  4K50 A;  2UXB F;  2H5I B;  2JJ4 D;  2R7Q A;  3A1Y G;  1FCA A;  2QLW A;  1C4A A;  1KLM A;  2DY1 A;  2ZJQ Q;  3THT A;  3R97 A;  2BV3 A;  4OX9 F;  1HNW F;  3DYA A;  3QIP A;  1Q1K A;  3G6E S;  1IJF B;  4XPE A;  4FF2 A;  3FKB A;  2L9D A;  4CDI A;  4RPF A;  2XMV A;  3FZB A;  1EIY B;  2Z56 B;  4J9K A;  3MCN A;  2NLW A;  1D3W A;  3LP2 A;  4OMF G;  3HFZ B;  4ZJQ A;  3D3C J;  2LU1 A;  1GH8 A;  1X93 A;  2HNY B;  4ZHR B;  2BQU A;  2KT5 A;  2M8H A;  5D4N A;  2QSF A;  3MPV A;  3T19 A;  1PG5 B;  1RAF B;  3SI8 A;  1JWW A;  1I6J A;  3DM2 A;  2NSB A;  1MU2 A;  2FZG B;  5A76 A;  2QL7 B;  4Y00 A;  4ZCI A;  3W5Y A;  1CEZ A;  4HL9 A;  2I5J B;  2IDE A;  4HDH A;  4NLY A;  2C42 A;  3NO7 A;  2CJY B;  1LV5 A;  2FDN A;  4PG7 A;  2I1R A;  3JQM A;  2E5L J;  4QPX A;  3CDB A;  4NYZ A;  1I94 J;  3EWG A;  1TL7 A;  3ILO A;  2D7S A;  2E29 A;  1NB2 A;  2Y1I A;  3L9Z A;  2BW7 A;  3D3B J;  1NJW A;  4ZVE A;  1O6X A;  2XSJ B;  1HWJ A;  2MGZ A;  2UVV A;  2G1D A;  1TFW A;  2AYG A;  2HLT A;  3UWT A;  1VBY A;  4C11 A;  2HZC A;  2CPG A;  1CUL A;  3UVJ B;  4AL5 A;  3MUV P;  1MML A;  3CPW R;  2K5J A;  1QAX A;  1M5P C;  3QRR A;  2YPY A;  2N4C A;  2NYH A;  2Z57 B;  3P45 B;  1JX4 A;  2I6W A;  2DVI A;  1TKD A;  2W24 A;  4K4Y A;  1RT7 B;  6FD1 A;  2XG8 A;  1NHU A;  4U7U K;  3M30 B;  3AOA A;  3H2L A;  5J2P A;  2FGC A;  5LMU F;  2N82 B;  3CJK A;  8ATC B;  1PSD A;  1W7W A;  3GU0 A;  2XLK A;  2XSF A;  3TUP A;  4LR7 A;  3M9M B;  4MYU A;  4ZVO B;  3PRD A;  1Q8L A;  1OJ4 A;  2CZ4 A;  4MFB B;  3MAH A;  4NLD A;  3TOQ A;  2K2P A;  3GB0 A;  4P7T A;  3OL6 A;  1HYS B;  5D4L A;  3CCJ S;  2GMH A;  5D0H A;  5I42 B;  3HMJ G;  1S10 A;  2GAG C;  1GMW A;  2HAI A;  1B0P A;  1N56 A;  3FEZ A;  4J9R A;  5E2Q A;  3M6W A;  1QE1 B;  1J5O B;  3K8V A;  4C3L A;  3S7R A;  4AE5 A;  3SBM A;  3FEX B;  1FER A;  3C8Y A;  1V5I B;  4PAA A;  2CRL A;  1HPZ A;  1RHK B;  1Q82 T;  1H6K X;  2VJV A;  2MXY A;  4BWM A;  3H8Y A;  2BNZ A;  4YEA A;  2GQC A;  3FRZ A;  1V3S A;  3MR6 A;  4ELV A;  4ZVT B;  2C2K B;  4Y0F A;  2YWE A;  3MZI A;  4X62 J;  2HUR A;  1FNM A;  2E9T A;  4GO7 X;  3UDE A;  1RZM A;  2JXG A;  3A8K A;  2CXE A;  2DNP A;  4OQJ A;  3MEE B;  4A4J A;  2LP4 A;  2RVJ A;  4ED6 A;  5KFU A;  2JBV A;  2M3D A;  1PIE A;  4DSF A;  1AXQ A;  3R5B A;  1JLA A;  2MQO A;  2POK A;  4K4V A;  1HI1 A;  1N33 J;  2JL9 A;  4AD6 A;  1FXL A;  1N34 J;  2D3O R;  4NLS A;  4YB6 A;  3G71 S;  4QZV B;  2B6A B;  2G0C A;  2XWX A;  5K5M A;  1X4A A;  1LWC A;  4QR1 A;  4BWJ A;  3TJ9 A;  1AFJ A;  3MR7 A;  3PXG a;  4DQP A;  1ACM B;  4CTA B;  4JB8 B;  1OPI A;  5AE2 A;  2RRB A;  3HDS A;  2FVQ A;  3CME S;  4ECY A;  1HMV B;  4IOA Q;  2ZDP A;  2WVE A;  4JI6 F;  2DR6 A;  8AT1 B;  2I9S A;  2PA8 D;  1JXE A;  4K5R A;  3NLC A;  1N6Q A;  4Q43 A;  2KEL A;  1SKR A;  3GYG A;  4QR0 A;  4NI2 A;  2XGQ A;  3TP2 A;  4I67 A;  2RJZ A;  3EJM A;  2HQC A;  1QTM A;  3DU5 A;  4CLY A;  2HND B;  3ZXW A;  3NMA A;  3N79 A;  3T1Y F;  4C2M A;  3HO1 A;  2YQ1 A;  4EUV A;  4DR5 J;  1JLG B;  1RT1 A;  4F36 A;  5JVG Q;  3D68 A;  2H1Y A;  4R0J A;  2A18 A;  3W2W B;  2QA4 S;  1RLC L;  2DJW A;  4X4P A;  3L09 A;  2JX2 A;  4LF2 A;  2KZZ A;  3MMB A;  2XO7 A;  2VQF J;  1T8E A;  4NXM F;  2RS2 A;  2HQI A;  4HI1 A;  2AT1 B;  3EDR B;  2DPJ A;  4CO2 A;  2RH3 A;  1L5U A;  5IT0 A;  4G1Q A;  1S1V B;  4IO9 Q;  2WVC A;  2MZS A;  4Z2X A;  1RBL A;  1LFW A;  4MH8 A;  2XHW A;  3HFV A;  2F63 A;  4DG1 A;  4KBI A;  2DR8 A;  4Q7A A;  1KVJ A;  3B6B A;  1R8C A;  4HEA 9;  2GJF A;  2AD9 A;  2EG2 A;  3NL0 A;  4ED2 A;  2XMU A;  3BSO A;  4DV1 F;  3JS9 A;  2VPX B;  1RK8 A;  2R8G A;  4X4N A;  1X7V A;  2BQ3 A;  1U1O A;  1HWL A;  5B08 A;  2QC3 A;  5F8H A;  2BKN A;  2EPI A;  2QMU B;  4FF4 A;  4KY3 A;  2DB1 A;  4HI2 A;  1U2F A;  4Y2I A;  5E3A A;  3R2C J;  3PKY A;  2J5A A;  2R7U A;  2PSZ A;  3DLK B;  1ARR A;  4CP5 A;  4B3M J;  5L38 A;  2ZH7 A;  1CLF A;  5FJ4 A;  2GNK A;  5A8W A;  1R0B G;  3A4T A;  2DRD A;  2HHU A;  1C0T A;  1VRQ C;  4OZL A;  1LNQ A;  3DXS X;  2XYH B;  4DV3 F;  2R7O A;  1DLO A;  2NUU G;  3DOK A;  3CD7 A;  4ES1 A;  4RNO A;  4P73 A;  1WSV A;  1S1T B;  3OFE A;  4TQS A;  5DDR C;  4LVO P;  1S97 A;  2EKY A;  4DXL A;  2VL1 A;  3RJM B;  5L1I A;  3M1V B;  3C14 A;  3CIZ A;  1QSL A;  2VHG A;  4KO0 A;  2KM8 B;  3NAI A;  4L3N A;  3PKM A;  3BPS P;  3KK2 B;  4E2F B;  4OX7 A;  4C8Y A;  3US5 A;  1JLQ B;  2P9G A;  5HAN A;  3G82 A;  2FC9 A;  5JVH Q;  4O3R A;  4WP9 A;  2QFI A;  1ARQ A;  1SIW A;  1RA6 A;  1U0H A;  3HXM A;  2VC1 A;  5CYJ A;  1B0V A;  1FO1 A;  1T7P A;  1NPP A;  1S76 D;  2DGQ A;  5CZX A;  2OPP B;  2YH1 A;  1ITP A;  4ZN3 A;  4USH A;  3HSZ A;  4UF4 A;  4UUX A;  2EXU A;  2CQ2 A;  4QWC A;  4F25 A;  2FQQ B;  2ALY B;  1AUD A;  1VQ6 S;  1KLM B;  3MCS A;  4DFP A;  1XR5 A;  5L1L A;  4DCJ B;  2AGO A;  4DR3 F;  2E5J A;  2G4B A;  2EFG A;  3DYA B;  3QIP B;  1CJU A;  3BQ2 A;  4ZLN A;  2CJB A;  4WU2 A;  3PR4 A;  2F8E X;  1PIL A;  3H5X A;  4J9M A;  2P2C B;  4RKU C;  1YJW S;  1YBU A;  5D77 A;  2A6O A;  3DRY A;  3MOZ A;  3W5X A;  5FD1 A;  5LXR A;  3EGN A;  3Q8P B;  2HVZ A;  1LW2 A;  3LP2 B;  2MKY A;  1Y4Z B;  3IM8 A;  7FDR A;  5KG4 A;  3KJN B;  2YNF A;  1NKB A;  1R31 A;  2QT7 A;  4WKR A;  2Q66 A;  5D4O A;  1BE4 A;  4HH1 A;  3BS9 A;  5GAE I;  4KT0 C;  5HBM A;  4DV0 F;  5K8O A;  3DM2 B;  5H9F J;  4MKB A;  3FC9 A;  1MU2 B;  2WSC C;  2ZE2 B;  2VC0 A;  1J5E J;  3JSB A;  3PW4 A;  4C97 A;  4YHH F;  2JH3 A;  5IXU A;  4LRF A;  3KK1 A;  1FTC A;  1C0U A;  3QNW B;  2EFO A;  2D74 B;  3KLE A;  3NOC A;  2HGM A;  3NXZ A;  2CPH A;  2DNK A;  2HQD A;  2BX6 A;  3NGR A;  2VBY A;  3OBI A;  1TKT B;  1NM2 A;  4NOH A;  1TL7 B;  4A8W A;  3VQT A;  1XR6 A;  2UV8 G;  3GCX P;  2PT0 A;  2R8H A;  2MGZ B;  4CWB A;  4MIB A;  2HWT A;  2OFG X;  1SKS A;  1EKS A;  1CUL B;  1I51 B;  4YY3 F;  1QUV A;  3C46 A;  2HS4 A;  2F65 A;  4TLQ A;  1FEH A;  2UUA J;  3BSN A;  5SUH A;  3IWL A;  4USW A;  5BJR A;  1RAO A;  3N6L A;  1TUG B;  3PO4 A;  1F5C A;  1J2V A;  4RUC A;  2C2Z B;  2IYG A;  3AY0 A;  3DGV A;  3VR1 A;  1ELO A;  5J2P B;  2KT3 A;  4DJB A;  2IJF A;  3CJK B;  3G2X A;  2EFV A;  3QT5 A;  3VAJ A;  3OTE A;  4M5N A;  4BS2 A;  4ZP8 A;  3D2W A;  3GV5 B;  3OTD A;  2NSC A;  2AJ4 A;  1W26 A;  1MW7 A;  4M5K A;  2G0J A;  2A2C A;  2ZBC A;  2V4J A;  4ED4 A;  1K0V A;  1OYD A;  3CF5 Q;  4Y2K A;  4HHJ A;  3PRV A;  3LO3 A;  2OEM A;  3KYL A;  4X64 F;  4DPX A;  2WB1 D;  4W92 B;  4M5I A;  2R4F A;  4OIX A;  2DIS A;  1OWX A;  3A8I A;  1UWA A;  4QU6 A;  3X3U A;  2HMI B;  5A2Q Y;  1YJR A;  3K58 A;  3EGZ A;  4P71 A;  3EX7 B;  2YWW A;  2ZM6 F;  2CVE A;  2XMW A;  5L9N A;  5ETL A;  3BBF A;  4F50 A;  2JOQ A;  1HPZ B;  2ADC A;  3JTN A;  1RAH B;  4ZS6 A;  2R7W A;  2W01 A;  2YTC A;  5LOQ A;  3FBC A;  4DR4 F;  2DXF A;  5DDP C;  2RUG A;  3Q8Y A;  3VAH A;  1WOS A;  2LQ8 A;  3IBF B;  2DNH A;  2CFX A;  3R7S B;  2OSQ A;  3DDI A;  1WKL A;  2NQP A;  1TU0 B;  1FT8 A;  5KFQ A;  1YRU A;  2YWG A;  3TW0 A;  1JLA B;  5D6G A;  1OS5 A;  4ME7 E;  4RW7 A;  2XZT B;  2O01 C;  3GJS B;  1LXJ A;  2VG7 A;  1NND A;  4K2X A;  4LFA J;  4DEZ A;  1LWC B;  3IO1 A;  1ZAW A;  2YH0 A;  2UXC F;  1DZ5 A;  3HHL D;  1RBA A;  4P74 A;  1T02 A;  3P6Y C;  2Y0B B;  2OAU A;  5CAA A;  2OEL A;  4AQY J;  4L3K A;  4ZPA A;  3JSM A;  1YJT A;  1RT3 A;  2XS2 A;  4ZLP A;  1HNZ F;  2RQC A;  4DR2 J;  3WHI A;  3UDL A;  4O4G A;  4CLS A;  4UY8 5;  4RW6 A;  1N6Q B;  4XIU A;  2WTF A;  1YTY A;  3JTP A;  4LBI A;  3E3X A;  5EX0 A;  3CCV S;  3CJ0 A;  4NI2 B;  3ZC4 A;  2FHJ D;  1S72 S;  1ARO P;  1GK8 A;  2ZH9 A;  4JI4 F;  5E3R A;  5KOX A;  2MQL A;  2Q43 A;  1QM9 A;  4LF9 F;  2AHO B;  1GQE A;  1NH8 A;  4X4Q A;  1UVL A;  2HHS A;  3P3D A;  4PYD A;  3NG8 A;  2VA3 A;  1RT1 B;  3GIM A;  5BYQ A;  1YKW A;  3CO0 P;  1FDA A;  3KNA A;  1L3T A;  3H0P A;  3MMB B;  3OSN A;  2ZKU A;  4H4O A;  1N52 B;  3I5A A;  2BKO A;  2XI2 A;  3DGP A;  2Z0G A;  2AJF E;  1EB0 A;  2YWF A;  2VF3 A;  5GVQ A;  4G1Q B;  1UET A;  3HFK A;  4Q2L A;  1MNT A;  4XPC A;  1WOP A;  2BW2 A;  2KU7 A;  3KHL A;  4I6Y A;  1L3U A;  2CNO B;  2QL5 B;  3GON A;  2XLJ A;  4JI7 J;  2MKJ A;  2APO A;  4DG1 B;  1KQF B;  4CO3 A;  5IC6 B;  1NLA A;  2M7S A;  5HSP A;  1VQ7 S;  1KOO A;  2CQI A;  2BAN B;  1JLC A;  1UPM B;  1B7F A;  1A6L A;  3KHH A;  3BJY A;  1F9H A;  1P1L A;  4A46 A;  2FLP A;  2QMX A;  2ASY A;  2JLF A;  3AHP A;  1F1B B;  1UVJ A;  3A13 A;  1SL2 A;  2MJN A;  1T9X A;  1CSJ A;  2Z2M A;  2FVS A;  1UJ5 A;  3HHN B;  2V9W A;  1FJE B;  2CJK A;  3OFH A;  4UZC A;  2ZWO A;  1AYE A;  3BQ0 A;  2BYC A;  3Q8R B;  4OV6 A;  5HL7 Q;  4X65 J;  4UQT A;  3MD3 A;  4ES3 A;  1F2H A;  4Y2A A;  3N6N A;  4JYA F;  2W8K A;  1NH7 A;  4PRF A;  5KG3 A;  5IQQ A;  3QSI A;  5A8W B;  4NLO A;  2HVE A;  1V5V A;  4M94 A;  5B7W A;  4U95 A;  2H51 B;  1QAY A;  5D0G A;  5IS2 A;  3BSC A;  1C0T B;  3THP A;  1U1R A;  4DR6 F;  3CO9 A;  3HD2 A;  3PO5 A;  2RAQ A;  1ZTT A;  3PV8 A;  4IQM A;  1DLO B;  4O44 A;  3DOK B;  3JSR A;  4YR0 A;  1T9V A;  5HQM A;  4BDP A;  3K7R A;  2JFD A;  1S6O A;  1U1L A;  3W62 A;  4LRB A;  4DL5 A;  4DN0 A;  4ECZ A;  1SXL A;  3WQP A;  4LR9 A;  3C14 B;  2VPZ B;  2DGV A;  1RXO B;  3VAF A;  4RWW A;  3I56 S;  4KO0 B;  3EUN A;  2MDA A;  2WK4 A;  2RNE A;  3MMJ A;  2UXB J;  5IM0 A;  4RLE A;  4A8M P;  4B9L A;  3QMQ A;  1BQX A;  3G82 B;  5F41 A;  2K7K A;  1N8R T;  3P96 A;  2ALZ A;  4NML A;  2JSX A;  1SIW B;  1U0H B;  2ADB A;  2QLJ B;  2L08 A;  4LSL A;  3G8T A;  1SI9 A;  2OEK A;  2UUB F;  2OP5 A;  5KT4 A;  1S1X A;  4NLW A;  5DZ7 A;  2AZ1 A;  4B9U A;  1FRK A;  4MKA A;  3OLA A;  1LEO A;  3MI7 X;  2DXD A;  3NMR A;  1WNE A;  3A3N B;  4GKK F;  3QSY B;  3CJ3 A;  2FYX A;  5EN1 A;  2BEF A;  1RP5 A;  3S01 A;  3QJP A;  2KDO A;  4ECT A;  2WAQ D;  1FD2 A;  3BKF A;  4ECU A;  2J8A A;  3W8P A;  4ZN1 A;  3D66 A;  3OUY A;  1Q16 A;  1WG1 A;  1SJF A;  2FHM A;  1CJU B;  2OPR A;  3NGT A;  2KHC A;  3F56 A;  4DZD A;  3H87 C;  3GYN A;  3RB0 A;  4WFZ A;  2U1A A;  5ETT A;  2OUG A;  1U8W A;  2LDY A;  2ZH6 A;  4B3T F;  2RF2 B;  3F44 A;  4DFM A;  5B0A A;  1QLN A;  4RUA A;  5F9N A;  2JXH A;  2XCP A;  2P6T A;  3FCV A;  1RI7 A;  1LW2 B;  1BDT A;  4MJK A;  3K0J A;  5G4D A;  2IRX A;  2YNF B;  3H5U A;  3MM6 A;  3MOJ B;  1SQG A;  4FVM A;  1OYE A;  3SSQ A;  1A9N B;  4JI3 F;  4LF4 F;  2PN6 A;  4UOF A;  1FDD A;  4IRK A;  4B9V A;  4NLX A;  5CD4 A;  2IVF B;  4OJG A;  2ZBP A;  1B28 A;  4LIR A;  3GR1 A;  2B8Q A;  5AJ3 F;  3KK1 B;  2RB7 A;  2R8J A;  4N76 A;  3AA9 A;  1R8B A;  2PDA A;  2DH7 A;  1M5H A;  1X4B A;  2MJU A;  1U6B A;  4JI1 F;  3RB6 A;  1WC5 A;  3JB9 k;  3OT9 A;  5J1N A;  3HT3 A;  4MKV A;  3M9N B;  2GVZ A;  4EYI B;  3B82 A;  5LMU J;  3SZ2 A;  2OD6 A;  1NJI T;  3PJ9 A;  2GW8 A;  4HR2 A;  2MPU A;  2UUC F;  2KXN B;  2C3Y A;  2B4U A;  1X9W A;  4NA2 A;  2LFV A;  3UD3 P;  2GVD A;  1V3Z A;  4ZVS B;  4WFA Q;  2FLL A;  2QV6 A;  4ID5 A;  2LDI A;  3BGO P;  1VQL S;  2D3Z A;  2XM3 A;  3BGR B;  3H42 A;  5EDW A;  2M2B A;  2J8S A;  1Q8K A;  2Z58 B;  2F7V A;  2J7W A;  4PWU A;  4CLK A;  3F41 A;  4J5O A;  1R43 A;  5I3P A;  4OLO A;  2DGU A;  3QAE A;  3K5M A;  2K3K A;  4X4O A;  1KTQ A;  3AOB A;  2XY5 A;  2XNQ A;  3LH2 S;  3DKD A;  4OL8 A;  2V4J B;  2JVR A;  2VFS A;  4ILL A;  4ZP6 A;  1XWL A;  5KFT A;  3H25 A;  1I94 F;  4PXB A;  5U47 A;  1JKH A;  1SIZ A;  4CYU A;  3GPA A;  3MFI A;  1U25 A;  2C22 A;  3PR5 B;  1XER A;  1ICE B;  2L3M A;  4RNH A;  2H9Z A;  5KG6 A;  1VI7 A;  3KG1 A;  3H4D A;  5D78 A;  3LGM A;  2DT9 A;  3RRK A;  4KH1 B;  2ZH2 A;  2HK2 A;  4NZ0 A;  3HZE A;  2XQC A;  5SZT A;  2V2Z A;  3EZ5 A;  1FX2 A;  3D1Q A;  3QT7 A;  1S1W A;  1S57 A;  3IBC B;  1Z4U A;  4WIQ A;  5KFL A;  2XI3 A;  4JI6 J;  2K3I A;  1X4D A;  2CQD A;  1OSD A;  4WII A;  4DV7 F;  2KKE A;  3HJV A;  3L7P A;  4USK A;  4RW7 B;  4DUZ J;  2HG4 A;  4ECQ A;  2LYV A;  2VQE F;  1U7L A;  3I4P A;  2C2D A;  2RQK A;  4KHP F;  1HR0 J;  1S0N A;  4RW8 A;  5F8N A;  5I3U A;  1NDL A;  2ZKT A;  1U4B A;  4DFJ A;  1RCX B;  1VQ4 S;  2DEI A;  1YIT S;  1EZZ B;  2R2U A;  2P6S A;  3JSM B;  1RT3 B;  1WEZ A;  4ED5 A;  1NKC A;  1GFW B;  2R2S A;  4A8Y A;  1CJK B;  3ZNU A;  1LWE A;  3TQ1 A;  2FJE B;  2E7V A;  4O3Q A;  1V6H A;  4B3R F;  3CC7 S;  2J76 E;  1U47 A;  4IRC A;  1K1Q A;  2PO4 A;  3UDC A;  3PX4 A;  4AFF A;  5KFV A;  2IY5 B;  4GVB A;  2CQG A;  2VUG A;  2ZIT A;  2R7X A;  2W9C B;  2CWK A;  1DUR A;  4ZVQ B;  3T9Z A;  3KUG A;  4RU2 A;  2AIR B;  1TEL A;  1K8A T;  2AEF A;  2WW4 A;  4IYQ A;  3TVK A;  3CE8 A;  3O6Q A;  2H5J B;  3HVA A;  1S77 D;  1FRH A;  2LXI A;  4NCG A;  5JMN A;  4CH1 A;  3EGV A;  1PKU A;  3VV2 B;  4U9R A;  1KFD A;  4H4O B;  2HSE B;  4U8Y A;  1B0T A;  4N47 A;  3MMA B;  3BKT A;  3DGP B;  1VLO A;  1HHT P;  2JVO A;  1FE0 A;  2XUL A;  2RDJ A;  4MK7 A;  2QA2 A;  4DV1 J;  3K17 A;  5CA5 A;  4F3Q A;  4N56 A;  3M4X A;  4YFU A;  4Y2M A;  4FPI A;  3EVO A;  2COL A;  3QJJ A;  4DU7 A;  5KG2 A;  2R7V A;  3CUL A;  1W25 A;  4ZJO A;  4K4S A;  4ZVF A;  2J9D E;  1EX8 A;  2XY6 A;  1AUS L;  2HEK A;  1OIA A;  4FNI A;  4DL2 A;  2EW9 A;  2UP1 A;  1HWU A;  3QO9 A;  1IBL F;  3AAW B;  2KVQ E;  4LMZ A;  2XZW A;  3D6F B;  2OPQ A;  4RW4 B;  3HSG A;  1NU4 A;  3TO8 A;  3OVS A;  1JLC B;  1IXK A;  1BQN A;  1F3F A;  3NNC A;  1T03 A;  2WCX A;  3HHE A;  3RBX A;  1UA0 A;  3AB4 B;  1YJ7 A;  2MY7 A;  2ADL A;  3FT7 A;  2QSW A;  4ZA1 A;  2PII A;  2PI4 A;  2YKQ A;  4CIO A;  4DV2 F;  3EGW B;  1V3R A;  2CAX A;  2FGO A;  4DSK A;  4F0M A;  2VQF F;  1H7X A;  4MIW A;  4JP8 A;  3CJQ A;  3R27 A;  1VC6 A;  3V6J A;  1U24 A;  3D4J A;  1YJ9 S;  4ECV A;  1LK7 A;  4A47 A;  3JQJ A;  3GV7 B;  1XNR F;  4DFK A;  1N36 F;  4D8J A;  1KLN A;  1Q95 G;  4K4Z A;  5ETO A;  5KFJ A;  3B4M A;  1PYT A;  2ZH4 A;  5H1S V;  4O44 B;  3R7B B;  2YKO A;  1GT8 A;  2G9O A;  5K8N A;  2H4Y B;  1C1B A;  5EWG A;  2C2O B;  4AYB D;  1VC5 A;  2QYC A;  3W66 A;  4HHU A;  4KHR A;  3CCZ A;  1VJQ A;  4AXI A;  2E7W A;  4F4Y A;  3ETO A;  2LA4 A;  2KVI A;  3EXC X;  2KFN A;  4XDC A;  3LGH A;  3TUZ C;  2HQF A;  5IM0 B;  1Y00 A;  1NO8 A;  5DO2 A;  3W60 A;  5IT9 U;  1N32 J;  1M1H A;  2BRK A;  3MGJ A;  3RB4 A;  4ZLL A;  1F6T A;  4NPO A;  3VAG A;  3UI3 A;  3V5R A;  3TRG A;  4JOU A;  4LBP A;  2HHP A;  3CMA S;  3A8E A;  3EMT A;  2ZUG A;  2Q1L A;  4JUZ A;  3RW6 A;  4ZCM A;  3SCJ E;  2C2N A;  3MEC A;  2YKN A;  2CQC A;  4RJV A;  4LSL B;  3QZ8 A;  1CJV A;  1VJW A;  4J9S A;  2OGU A;  1MWZ A;  1S1X B;  2AW0 A;  4WFX A;  3SV4 A;  4B3M F;  4JV5 J;  4OZ5 A;  1OY9 A;  1ZYQ A;  1HBU A;  3MD1 A;  3K5N A;  3GII A;  1SC3 B;  3ILJ A;  4BC9 A;  7AT1 B;  4TQR A;  3OPK A;  4TKT A;  2ILY A;  2DRA A;  4DBQ A;  2P5V A;  2BKP A;  4DV0 J;  3OUY B;  1Q16 B;  2FHK A;  2NZC A;  2ERR A;  1B01 A;  2OPR B;  3CDA A;  5DLG A;  2DGX A;  4WYL A;  3OJS A;  2PMH A;  3UO0 A;  1Y5L B;  4YHH J;  4FVC A;  3U27 A;  5KFR A;  4YB7 A;  4LF7 F;  1GXU A;  1BUX A;  3MDF A;  3JQK A;  2AU0 A;  1FKP A;  2RHS B;  4GC6 A;  4NCB A;  1TL1 A;  1VS3 A;  3GSI A;  2GS8 A;  1SH2 A;  3DMJ B;  4HHH A;  4GMK A;  3O2I A;  5ETR A;  4A8F A;  2E66 A;  3KUE A;  2K1R A;  3RGI A;  1VQN S;  3ULH A;  5CYQ A;  1QAI A;  3EXY A;  2CZ9 A;  4KGK A;  2EC2 A;  2MZJ A;  4YME A;  1BQM B;  3N5B A;  2Q6C A;  4XTT A;  4M5M A;  4YY3 J;  3QQC D;  2L9N A;  3AJ1 A;  1IBC B;  1NPR A;  3N0V A;  3UR3 C;  3BKU A;  4L6V 3;  4ECW A;  2HNY A;  2GO8 A;  4DQR A;  1QUP A;  3OW2 R;  3RBD A;  4ZVG A;  1RTD A;  1PAE X;  1TAQ A;  4Z37 A;  3UN5 A;  1SCJ B;  1U09 A;  5E0O A;  2N7C A;  2GVZ B;  5C25 A;  1FRI A;  4P7V A;  4K7Q A;  1KD1 T;  2JDJ A;  2DNG A;  1FD8 A;  1N48 A;  3G87 A;  2CPY A;  3OD2 A;  4CLU A;  2DR9 A;  3IBW A;  1VCT A;  3V4I A;  2DGO A;  1QY7 A;  9RUB A;  3H2U B;  3QLH B;  4ID5 B;  3R5D A;  4OHX A;  3KDO A;  1RHM B;  1UJ4 A;  2RKI A;  4X64 J;  4TLR A;  2F4V J;  5HVH A;  4RWX A;  2A3J A;  5I4M A;  4WBF A;  3M32 A;  1NXI A;  2GML A;  3CB4 A;  3R2D J;  4UTG A;  5C42 A;  4LFB J;  4DPY A;  1Z2L A;  5HMX A;  4V19 J;  3V6H A;  2BR0 A;  3QWP A;  4RNN A;  2I2Y A;  4NL5 A;  1QJH A;  2IPO B;  4DU8 A;  3FBF A;  4OYI A;  3EYZ A;  1H72 C;  2A10 A;  3P8B B;  4D3H A;  3QID A;  1TKZ A;  4DR4 J;  3VAK A;  4LF8 F;  2EWH A;  1JKH B;  4ZVR B;  2AEJ A;  2HVI A;  4CYU B;  2RHQ B;  1B99 A;  2YBV A;  5E5N A;  2D3O 1;  4PQU B;  1LW0 A;  2FUG 9;  2B51 A;  4PWD A;  5ETP A;  3GJQ B;  3G9C A;  1PC5 A;  3NCR A;  2I8E A;  2W9A A;  2NR0 A;  2KZM A;  1N5V A;  4K4T A;  3H5Y A;  3QWU A;  3V6D A;  3C19 A;  1Q7L B;  4ECS A;  1OQ3 A;  2UXC J;  2RE1 A;  4KSE B;  4PYA A;  1S1W B;  2VU5 A;  5ADZ A;  4MAK A;  2ZZN A;  3T1H J;  4C7Q A;  4HAC A;  5LJ5 Y;  4DX5 A;  1HNZ J;  2KB2 A;  2HFO A;  1SV5 A;  5CXT A;  2H3A A;  2XMJ A;  4F02 A;  2VA2 A;  3PJW A;  2LQ5 A;  4QYR A;  1SC1 B;  2B3T B;  2MHN A;  5G0R A;  5I3U B;  1Q86 T;  1T11 A;  4JI4 J;  4B08 A;  4RU9 A;  1CVJ A;  2VFR A;  3BPD A;  3EE3 A;  4FYD A;  3MTK A;  5GMD A;  4C0O C;  2B7B B;  3BH7 B;  2B4O A;  1HLW A;  4QWB A;  4OHY A;  3IRX A;  1TMJ A;  4CO0 A;  5LSL A;  1VMB A;  1RAB B;  4OI1 A;  2OFH X;  2B6A A;  3BB5 A;  2MYF A;  3OHA A;  1LWE B;  2CDQ A;  2BRL A;  3SQO P;  4TYB A;  5GME A;  2EFN A;  2CPI A;  5T14 A;  4USJ C;  2DNL A;  5KFD A;  1UCN A;  2I0X A;  4IG3 A;  1KHV A;  4UUW A;  4GVB B;  1MMN A;  4FF1 A;  3CW2 C;  2LVW A;  3HSJ A;  1MYK A;  5D0R A;  4DSE A;  2IRY A;  2K1O A;  5IT9 Y;  1Y3J A;  4I6A A;  4C0H A;  3FSI A;  2X3D A;  5AE3 A;  2XWY A;  4CLW A;  4C3K A;  2ZH5 A;  4NCG B;  3NNH A;  1A0O B;  3LJP A;  2YKM A;  3D1H A;  4FXV A;  1IBK F;  1X5P A;  2GO9 A;  2R3V A;  3M2R A;  2UV8 A;  4TU7 A;  1RBO B;  4KKO A;  1YDL A;  3HHL C;  4AQY F;  2CUY A;  1XEZ A;  3NOG A;  4CT9 A;  3HVR A;  2P9E A;  3T5H A;  4F2S A;  3FQL A;  4KFB A;  2N7Y A;  1TUW A;  2DHH A;  1Y10 A;  3TVY A;  1TZ0 A;  3TYT A;  1VQY A;  1WC1 A;  2NRE A;  4C98 A;  1EHW A;  4HV0 A;  1F3V A;  4CO1 A;  4EO8 A;  1S6U A;  1MN7 A;  4ECX A;  2RSQ A;  3V6K A;  3Q83 A;  4UOG A;  1BQN B;  1UA1 A;  1S1V A;  1H98 A;  5EUH A;  1T03 B;  2J6U A;  3L4B C;  3H98 A;  4K59 A;  4IOB A;  1FRJ A;  1FHT A;  3POT A;  4XDD A;  1WHX A;  2YQ0 A;  2DPI A;  4DR6 J;  4V1A k;  4YOE A;  4NLR A;  2B8P A;  1Z1Z A;  1NK0 A;  2NPF A;  1DQA A;  2AN7 A;  2ZEJ A;  5B0B A;  2LMI A;  4K2J A;  1U48 A;  2LXF A;  3I5C A;  2BJ9 A;  3M8S A;  4M63 A;  3EZO A;  2QX0 A;  3WBZ A;  2VAS A;  1DTT A;  3RB3 A;  4DDF A;  4HT7 A;  4IG0 A;  4CT8 A;  2W4P A;  2VFT A;  4LR8 A;  1GNK A;  3GR0 A;  2YNG A;  3BRE A;  1HQE A;  1TL5 A;  4NA3 A;  4DUT A;  3IRW P;  1FJC A;  5DDQ C;  4Q2M A;  4YN3 B;  1C1B B;  3C66 A;  4USV A;  3PHT A;  2UUB J;  5DZ6 A;  3KHR A;  2MB0 B;  2HHW A;  3RBZ A;  2W1B A;  3OXG A;  2EKN A;  3E2E A;  3D6M B;  2CQ1 A;  4P10 A;  1X0P A;  2IM2 A;  5BYR A;  1XMB A;  4NZ6 A;  2R7S A;  4GKK J;  3G6Y A;  3J7A N;  1PC4 A;  2BAC A;  2C3M A;  4TY9 A;  2B9Y A;  4TU9 A;  3OTO J;  4C8M A;  2R8K A;  1ZH5 A;  2PMW A;  3GJR B;  4CZC A;  2VIH A;  1AB8 A;  4DQQ A;  1AW0 A;  2DH8 A;  2DGS A;  2V5H G;  4DQI A;  3KUH A;  4AL7 A;  4WK1 A;  4DV5 F;  2YKN B;  4B3T J;  4CCH A;  1T94 A;  1CJV B;  2PE8 A;  2VPW B;  3M1V A;  3CED A;  4P72 A;  5KFY A;  4LIW A;  1RAG B;  2KHD A;  3CD6 S;  5MAO A;  1HBU B;  1JLQ A;  1S4F A;  2CNL B;  5K14 A;  4TU8 A;  4RNM A;  1UP1 A;  3K8W A;  4P75 A;  1NDC A;  1B70 B;  4WFB Q;  4DCP B;  4QJV A;  4KPY A;  1URR A;  5KFE A;  2CQ0 A;  4ENO A;  4DR1 F;  1O5J A;  3UW1 A;  2HHV A;  1MYL A;  1QSS A;  4CNZ A;  3KJQ B;  2W2P P;  2GQ2 A;  1VHI A;  2OPP A;  2RD5 C;  4O3P A;  1RAI B;  3TEH B;  1YBT A;  3TA2 A;  3PVX A;  5JJB A;  2G2Z A;  4JI1 J;  3BGF A;  1FKP B;  4EBE A;  1TL1 B;  5GAH U;  1X9S A;  4H54 A;  2Y8Y A;  2DEJ A;  2K1R B;  3M9O B;  5CYQ B;  5KTQ A;  2UUC J;  1MG7 A;  2VFU A;  1DRZ A;  3CCE S;  3FZ2 A;  1S99 A;  5K20 B;  3AXK A;  4NAS A;  4L74 A;  5D0E A;  2ZJR Q;  4LRE A;  1YSJ A;  3TNV A;  3J7A 1;  2JHE A;  5B0D A;  1TK0 A;  3RZA A;  2E7X A;  1RTD B;  1OY8 A;  2B9X A;  3HKW A;  2XMT A;  1T9Y A;  4IFV A;  3RRG A;  2J6S A;  5C25 B;  1HA1 A;  3I5B A;  2ZE2 A;  3MM9 A;  5KFZ A;  1SH3 A;  2PEH A;  2FY1 A;  1F9E B;  5KFB A;  4FS1 A;  2QZ8 A;  3CJ8 A;  4ICL A;  1IQT A;  3KG4 A;  2E44 A;  3VF0 B;  3L3C A;  2PMZ D;  2B43 A;  2ASJ A;  1Q53 A;  3IN5 A;  3V4I B;  3LPY A;  4C6A A;  2KRR A;  2HLU A;  4FN5 A;  1F5B A;  3U7J A;  4G6V B;  1TKT A;  3OFG A;  1R3N A;  2B0G A;  2RKI B;  3ZZR A;  1NK5 A;  1VRT A;  3HJF A;  1TK5 A;  2DRB A;  2OLW A;  1FRX A;  1GX5 A;  3M32 B;  3ISZ A;  4TN2 A;  5IOL A;  1EAR A;  4QWD A;  3WX8 A;  4QQB A;  2CPZ A;  5C42 B;  2Y9H A;  3AQP A;  4RBT A;  3R5J B;  2N4D A;  4DV4 J;  2KFY A;  4R5P A;  4ZIV A;  2MST A;  2E9Z A;  3D0G E;  3QT6 A;  1I3O B;  4DWI A;  4OYM A;  5HVG A;  1C1C A;  3TI0 A;  1TKZ B;  5D4P A;  2D3U A;  1Y5I B;  4NA1 A;  4JBC A;  2UUW A;  4DF8 A;  4EK2 A;  4B9S A;  1NHK L;  4DV7 J;  5AT1 B;  2FJD B;  1LW0 B;  2HGL A;  4ZDN A;  4PWD B;  3UPF A;  1FWP A;  1RJJ A;  2ZOM A;  5HMY A;  4IKA A;  2V2K A;  4BHQ A;  1U2R A;  2Q79 A;  4KV8 B;  2UUT A;  2VQE J;  2JEF A;  1SQF A;  1M5O C;  3V6D B;  1Y11 A;  4KHP J;  1WEY A;  4F04 B;  1NUE A;  1PAU B;  3W61 A;  1AFI A;  1RAA B;  1LOU A;  4WXW A;  2B9W A;  1U8S A;  2AY0 A;  2AYB A;  3KHG A;  2HMI A;  5LSR A;  3MUR P;  5KFX A;  4HAC B;  2V69 A;  4CLF A;  1OQ6 A;  2IVY A;  3C16 A;  3QAU A;  3UNY A;  2LEA A;  1S4E A;  2Q2K A;  1B3T A;  1SV5 B;  2X1G A;  4J37 A;  1Q7Y T;  1G7C B;  3ENQ A;  4U7C A;  1RTH A;  1SQE A;  2VOD A;  1YZ7 A;  2HBY B;  3LAN A;  4YDX A;  4B3R J;  1LK5 A;  5G0R B;  2FJV A;  1OSC A;  3IGV A;  2PD1 A;  3PIP Q;  4ATN A;  2IYI A;  4KR0 B;  4M95 A;  4OZ2 A;  2YNH A;  2BOA A;  1ZA1 B;  2DBB A;  2RIL A;  4C8O A;  4LRA A;  3TVZ A;  2JRS A;  5F3Z A;  1S0V A;  3CCT A;  4ZPD A;  1JJ2 R;  2V68 A;  3IS9 A;  2B4V A;  3OL9 A;  4OJH A;  4KGZ B;  2D9P A;  3IRX B;  5HAO A;  4NEY A;  2B56 A;  2RDD A;  4A8S A;  3LWL A;  2IVM A;  2ZFH A;  3RU0 A;  3MPY A;  3DLH A;  1RYR A;  4USI A;  3K2Y A;  4QIV A;  1FES A;  5MLC V;  1REV A;  1X0F A;  4M5J A;  2BXJ A;  2CZV C;  3ETM A;  2XEX A;  4IG3 B;  2JNJ A;  1LXN A;  4DN9 A;  5BR8 F;  3KMQ A;  1YHQ S;  2XMA A;  2DNR A;  5C2G A;  1RWM B;  4N7T A;  3ELH A;  1HHS A;  1NBE B;  4L75 A;  4DL6 A;  1IBL J;  4DUZ F;  1UEU A;  4Q8F A;  5L8R C;  1HR0 F;  4NX9 A;  4QOT A;  2YKM B;  2BBE A;  1S0O A;  1JNR B;  5JXS A;  3M2R B;  3RUB L;  4ZOS A;  4F0H A;  3OHB A;  3KLF A;  4P6Q A;  4KKO B;  2E1R A;  3HD1 A;  4HH0 A;  3R1L A;  4CLT A;  4JV0 A;  5HLF A;  2R7T A;  1X4H A;  3Q24 A;  4KFB B;  3E01 A;  2YY3 A;  2DNN A;  3HHL A;  4ED7 A;  5E3Q A;  5B0C A;  4C8N A;  3MUT P;  3C6T A;  4DV2 J;  2O66 A;  1DQ9 A;  3C3L A;  2ZBQ A;  1H7W A;  1M5K C;  3I31 A;  1WF0 A;  3ZTQ A;  4MTP A;  5B0F A;  3HLU A;  3QFW A;  5A2Q U;  3WZ0 A;  2PFF B;  4C8Z A;  1ZPW X;  2DYA A;  2DK2 A;  1YG0 A;  4CH0 S;  4QYZ J;  3GIK A;  2J9E A;  2MKI A;  1XNR J;  3LWM A;  1NAQ A;  1N36 J;  3POT B;  2FHJ A;  3AH6 A;  5IV3 A;  3PFO A;  1XBW A;  4BC7 A;  1KSP A;  2DNO A;  3Q89 A;  3QPI A;  4K8R A;  1T95 A;  2EBE A;  3DLL Q;  1U6Z A;  2P9C A;  1S9F A;  3GFZ A;  4ETZ A;  5AE1 A;  2BJ8 A;  1ZM4 A;  3TZW A;  3AD7 C;  5A8K A;  2BAN A;  3QFH A;  4Q8E A;  1RB0 A;  1I5O B;  1MLA A;  3PNI A;  1DTT B;  4H4M A;  3RW7 A;  3K57 A;  3SMZ A;  4N77 A;  1HNX J;  4IG0 B;  3PG9 A;  4NXN F;  3GLJ A;  2XB2 D;  2W2Q P;  2DNQ A;  2G2Y A;  2M8D B;  3IR7 A;  2YNG B;  2AJ2 A;  1HQE B;  3QGH A;  2ZD1 A;  1VQS A;  2XMK A;  1H2V Z;  5KFH A;  4P9S A;  1FJG F;  2C1E B;  3M8Z A;  2W8L A;  1VIX A;  2X3G A;  2ZBR A;  4F4K A;  1CG2 A;  1FEE A;  2DCU B;  4F4W A;  4EGL A;  4GC7 A;  1H73 A;  4LT6 A;  3JYT B;  4DSJ A;  5HP1 B;  2WB4 A;  3M6U A;  1YGY A;  5K9F A;  2RU9 A;  1V9O A;  4DL0 C;  2EBG A;  4Y34 A;  2EK1 A;  1I1G A;  1TR0 A;  4ERD A;  1NHV A;  1RDR A;  5J2M B;  1HFE L;  4GKJ F;  1QDU B;  2JXI A;  1ZM3 A;  2GV1 A;  4HKQ A;  2V8D A;  2RRN A;  5M2U A;  5KFA A;  2BJD A;  1CQN A;  3B4D A;  4LF7 J;  2FPH X;  1UFW A;  3BR8 A;  1UVI A;  3PEH A;  1VC0 A;  3BBC A;  5K14 B;  3CIM A;  2FY8 A;  4MYT A;  3ILI A;  2V2V A;  5FLX Y;  2C3O A;  2QJ3 A;  2EI5 A;  2DO0 A;  1S7H A;  6FDR A;  5DQG A;  1O51 A;  2BAB A;  5F8L A;  3ZO7 A;  1WTF A;  3B54 A;  4M5D A;  4FXD A;  4KGV B;  3CCL S;  2CYY A;  4J9P A;  4ZVH A;  4J9U E;  5ETQ A;  4EYH B;  5DQH A;  4H4K A;  4W90 B;  3H2V E;  2OIH A;  2J0Q D;  2F40 A;  3CSK A;  2HS0 A;  4PUO A;  5HJX A;  1N32 F;  1Y0H A;  2FD2 A;  3E51 A;  3SQG B;  1WG4 A;  2NXU A;  4F3O A;  1NJY A;  1QAJ A;  2ZHB A;  1VBK A;  4Z7C A;  2VFV A;  4YR3 A;  5B0G A;  4X4S A;  4FYX B;  4J7C A;  4ZJL A;  2RF2 A;  2F9D A;  2LXU A;  2K06 A;  2V67 A;  4OJ3 A;  1RA7 A;  3FCW A;  4F26 A;  1SJQ A;  2JEI A;  1U45 A;  1S79 A;  4JV5 F;  3SCL E;  2QGF B;  2MQP A;  1KON A;  1L3S A;  1IR2 A;  2NUH A;  3NP5 A;  2VPY B;  3PYE A;  3VHQ A;  1ZOT A;  2EFQ A;  1R6Y A;  3PAC A;  2FJB B;  2QRR A;  4IFV B;  2DGT A;  1IR0 A;  1KVK A;  4CO5 A;  2UXD J;  2YX4 A;  4Q44 A;  2QFJ A;  3MM9 B;  4J9O A;  3DOL A;  2MZQ A;  3BN4 A;  5H9E J;  1NKE A;  1HBM B;  4LF5 F;  3D67 A;  4ICL B;  2Z4P A;  3MEG A;  3R3T A;  3WDO A;  1RAJ A;  4XO0 A;  4I7F A;  2HFS A;  1WC6 A;  3FMW A;  4QU7 A;  3HHD A;  4TVA B;  1FFG B;  3FSX A;  1C4C A;  4DR7 F;  2E1M C;  2MLY A;  3G5O A;  4K0K F;  4LF8 J;  3PEJ A;  2BQR A;  3AD8 C;  2BA9 A;  3CDW A;  1WOO A;  1VRT B;  3PW0 A;  2OJ3 A;  2HIY A;  2ZBI A;  2F3J A;  1RAD B;  1UL3 A;  1FWK A;  1Q5V A;  1M1K T;  2U2F A;  1HQ2 A;  5GAG U;  4F3M A;  2LCW A;  2ZC3 A;  3DLG A;  1ZM2 A;  5F8I A;  1PJ7 A;  4R5P B;  3W5Z A;  2CIM A;  1SL0 A;  2IM3 A;  1N5T A;  1YJV A;  3LQV A;  1C1C B;  3BGR A;  2PFD A;  1G1X A;  2QEX S;  4NE9 C;  1FRM A;  2CVI A;  2O3D A;  3KDN A;  1Y7P A;  2MQN A;  2VKZ G;  3CTR A;  1WC4 A;  3D7S B;  1YQH A;  4FNH A;  1RWN B;  1HNI A;  2XC9 A;  4ZCL A;  2EFP A;  2IM0 A;  3CJR A;  3ENA A;  2HRY A;  5JUM A;  2UU9 F;  4OZ0 A;  1R27 B;  2RML A;  2C2R A;  2YXL A;  2OKQ A;  3GIR A;  5B0E A;  3Q0A A;  1NSQ A;  1F2G A;  2CQ3 A;  4ZCK A;  3ENV A;  1N5Y A;  4ILR A;  5KT5 A;  6AT1 B;  2V6A A;  1KDN A;  3S1T A;  3T9N A;  4JI8 F;  3PZP A;  2F4V F;  1MMD A;  4NLQ A;  3BGU A;  3FNN A;  3VW4 A;  1NME B;  1KN6 A;  3RAM A;  1IKX A;  2QE5 A;  3CJ2 A;  5DG8 A;  3C16 B;  4LFB F;  3U1L A;  3NS5 A;  1U2C A;  1D8Y A;  4O3O A;  3TA1 A;  3N6M A;  2KG1 A;  1HD1 A;  2V8P A;  1RTH B;  1RT2 A;  2KN4 A;  4EWT A;  2FVC A;  1ZET A;  5DGA A;  2G13 A;  2CJX B;  1O0P A;  3I87 A;  4ELT A;  1TAU A;  3CUN A;  3BM7 A;  2YNH B;  2AQ4 A;  1BAZ A;  1Z2Z A;  4K4U A;  4DI6 A;  1JLB A;  4I68 A;  1VQP S;  2O1P A;  2L9W A;  1IRQ A;  2VOP A;  3TAR A;  4FYW B;  4ITS A;  3MR2 A;  4AND A;  2QTW A;  3IS9 B;  2AGP A;  2E5G A;  1VBZ A;  1NEE A;  1WHY A;  5D8H B;  3IP0 A;  1ZAX A;  2Y8W A;  4ED3 A;  3DCA A;  4M8L A;  5ETV A;  5HK4 A;  3MPD A;  3DHW C;  2NPI A;  4DQS A;  4YB5 A;  1IBK J;  3LUY A;  2DH9 A;  2VG5 A;  2DHG A;  2WON A;  1IUJ A;  1REV B;  1C2P A;  1P8G A;  1YVF A;  3TR5 A;  4FF3 A;  4OYZ A;  1XNQ F;  4DPO A;  3CJT A;  4ANE A;  2GA7 A;  3M05 A;  3T1H F;  2JLG A;  1S7I A;  1UFK A;  2FLO A;  2GJ2 A;  1NSK L;  4QBU A;  2DIU A;  3PM9 A;  1RCO B;  1IR1 A;  2H48 B;  1CJK A;  2P8I A;  1RYS A;  4OI4 A;  3P5T L;  2W7A A;  2F8M A;  3MPU B;  4ZPB A;  2EVZ A;  3BO2 A;  4KTQ A;  3IC1 A;  1P9Y A;  1VQO S;  1BD6 A;  4FDF A;  5LL6 d;  4RBU A;  3FBB A;  3Q86 A;  2W9C A;  1PCA A;  3KLF B;  2VDH A;  2GCF A;  4O3S A;  3K59 A;  4WTO B;  5DDO C;  3UCG A;  4ER8 A;  5HLF B;  1M5V C;  1WDT A;  4QW9 A;  4CH7 A;  1K44 A;  5GAH I;  4OHW A;  3E01 B;  1IVZ A;  3HHL B;  4LRC A;  4PXC A;  3C6T B;  1NJZ A;  3O1L A;  3I55 S;  3OQ2 A;  1OO0 B;  1VK8 A;  4WP8 A;  1Y9O A;  4AXJ A;  3D1O A;  3MMA A;  3M8P A;  3HF5 A;  2XNR A;  4E0D A;  3N5F A;  1HQU B;  4P2M A;  5DS7 A;  2GAH C;  4TY8 B;  4PR6 A;  3R1H A;  4U7U D;  4NZ7 A;  4UQG A;  4IFY A;  1VOM A;  4DV6 F;  4FKY A;  2YPZ A;  4NYP A;  4CLP A;  2AMC B;  3VZI A;  3W9J A;  1CPZ A;  3UN3 A;  2LQB A;  4FYY B;  1SH0 A;  2HW3 A;  1R89 A;  2MKS A;  1JJ4 A;  1UFL A;  5HN0 A;  2Q6B A;  3FDS A;  1BWE A;  2J0S D;  2W4D A;  1TV6 A;  4RO0 A;  3VAL A;  2OD4 A;  2AZ3 A;  2HWH A;  3GP9 A;  2W2O P;  4LBH A;  4RW4 A;  2Z2Y B;  5RUB A;  5A8K B;  2YKP A;  4ZP9 A;  4BLG A;  1QVF R;  4HDG A;  2J7K A;  4NMX A;  4USM A;  1RGV A;  1FDB A;  3RAQ A;  1M90 T;  4DX6 A;  5J1E A;  4ED0 A;  5E33 A;  3AA8 A;  2BJ1 A;  4H4M B;  2N3O A;  1QTG A;  3HZG A;  1RTJ A;  1KC8 T;  1U1P A;  2CWX A;  2ZVS A;  1ZAV A;  4QIE A;  1KTV A;  3IR7 B;  2AKW B;  2MZT A;  3SV3 A;  2D1C A;  2SXL A;  2ZD1 B;  5F0U A;  4ECR A;  1AT1 B;  1T9T A;  3PFE A;  1D9D A;  3R5G A;  3DNC A;  4DV5 J;  4UST A;  4G65 A;  1IBM F;  1K0T A;  5ETK A;  4PG5 A;  1NB7 A;  1WKJ A;  3WX4 A;  1ZBT A;  2CNN B;  1ROF A;  2X1F A;  4NLT A;  3ILL A;  3QBC A;  1KRP A;  4DS5 A;  1SB6 A;  3U1M A;  5HMW A;  3G8Q A;  2A6M A;  4JI2 J;  3PRB A;  1JJC B;  3J80 U;  3TAQ A;  4YR2 A;  2VJU A;  2ZNZ A;  3T3F A;  3ADA C;  5C24 A;  2HBR B;  4WF9 Q;  1VIS A;  3GXQ A;  1YRT A;  1U0S A;  4KB7 A;  1FWL A;  1HI8 A;  5J2N A;  4DR1 J;  3OV7 A;  2E1C A;  2V0N A;  4B02 A;  2LKZ A;  2XTJ P;  2OML A;  2M5Y A;  5THW A;  5KFC A;  3P4U B;  4IH6 A;  3CCW A;  5KFP A; 
#chains in the Genus database with same CATH homology
 1IRQ A;  2BJ1 A;  1QTG A;  2CAX A;  3H87 C;  2BNW A;  2CAJ A;  3BKT A;  2WVB A;  2WVE A;  1ARR A;  2WVC A;  2K6L A;  4HV0 A;  2GPE A;  2CPG A;  2JXH A;  2Y3Y A;  1MYL A;  2BJ8 A;  3FMT A;  3PHT A;  2K5J A;  2H1O E;  2CAD A;  1X93 A;  2WVF A;  3VEB A;  2BNZ A;  2RBF A;  1MYK A;  1BDT A;  2JXI A;  4ME7 E;  1Q5V A;  3VW4 A;  2CA9 A;  1U9P A;  2K1O A;  2KEL A;  4D8J A;  3BKU A;  1PAR A;  2JXG A;  2FGC A;  2PC6 A;  2WVD A;  2BJ7 A;  2NZC A;  1B01 A;  2HZV A;  1EA4 A;  2F1F A;  3GXQ A;  3VEA A;  1B28 A;  1MNT A;  1BDV A;  2K29 A;  2AY0 A;  2K9I A;  2BA3 A;  3QSI A;  2BJ9 A;  3LGH A;  2BSQ E;  2BJ3 A;  1BAZ A;  3OD2 A;  2HZA A;  3FT7 A;  3QOQ A;  1ARQ A;  4FXE A;  1Q5Y A;  3BKF A;  1P94 A;  1NLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...