2CAKA

1.27angstrom structure of rusticyanin from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
ALDTTWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHGKKNPTLDIPGGATVDVTFINTNKGFGHSFDITQKVPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cakA00
2FQEA 3AG3B 3X1EA 2EIKB 3ABKB 1OCZB 3ZIYA 1NPJA 2YAQA 1FFTB 4YL4A 1N68A 4HZ1A 3UABA 2MTAA 4YVUA 2UXFA 4QKTA 1JZIA 1W6WA 3NJNA 1X9UA 1OCCB 5D4IA 4E9SA 1NWPA 2B08A 1JXGA 3T6ZA 2HX8A 2XVBA 3S3BB 4YSOA 1L9TA 1AANA 1NICA 4GY4A 1PNDA 4YVNA 1JZFA 3EH5B 4YSQA 1T5KA 1PZCA 3KW7A 4GP4B 3WG7B 2DYSB 3H4FA 3S3CB 2CBPA 2OV0A 4ENZA 2CUAA 5I6LA 4AKPA 4G7RB 2IDUA 1NIAA 2BW4A 2PCYA 4Q89A 3C75A 1QHQA 1RCYA 3BVDB 4UF7C 1GS8A 4YSRA 1BXVA 3NSFA 2FWLB 2IWFA 2A3TA 1WS7A 4DP8X 3IE9A 1M56B 1JVLA 4HCGA 2CCWA 3TBBA 4BXVA 1AZNA 1M57B 1BQRA 1RZPA 1AZCA 1E5YA 3N55A 4E9WA 2OJ1A 4GP8B 1CURA 2HX9A 2IH9A 3FQYA 3FYIB 3WKQA 1A4AA 1NPNA 3CDZA 2MRYA 1IKOP 1ETJA 4KNSA 1CYWA 3NT0A 1E67A 3ZDWA 2HX7A 1WA0X 2PPEA 2DYRB 4A2GA 2WO3B 4AKQA 1MZZA 2QDWA 2DWTA 1BQKA 3EH3B 2BZ7A 3WI9A 3NJFA 2VM3A 2R7EA 5F7AA 2GI0A 1JZHA 1DZ0A 3H4HA 4A2FA 3FT0A 3IN2A 3OMAB 5E9NA 1AS6A 3BQVA 1AZUA 2AANA 2BP0B 3FYEB 4A2EA 2I85A 2VSMB 5PAZA 2VW7A 3QQXA 4AX3A 2OCCB 1M9WA 3U25A 1W6LA 2VW6A 3QJVB 4ZK8A 2W8CA 3SBRA 6PCYA 2JKWA 1BYOA 4M3HA 3ABLB 3IN0A 3UAAA 8PAZA 4P5SA 1OOWA 5D4JA 1NZRA 3T6XA 4YSEA 4BWUA 1PCSA 2H3XC 3FU7B 2GC4C 3AG2B 5B1KA 1FWXA 1AG6A 2HRHA 2PPDA 1OE1A 1GS6X 4A67A 1IBZA 1URIA 1HFUA 1SHXA 1SF3A 5AZUA 2P80D 1B3IA 1RZQA 3CVBA 1HAWA 1DYZA 3QPKA 1PY0A 2NRDA 6PAZA 4P5RA 1GYCA 4HIPA 3IBOA 3NJJA 1OE3A 2IWEA 3ASOB 1AS8A 2PPFA 1AAJA 3GXUB 1GY1A 2BWDA 3AY2A 3OQRA 2XV3A 1AR1B 1L9OA 1IBYA 1PAZA 3NYKA 5B3SB 3PCYA 1I53A 1FA4A 2XXFA 3HB3B 4YSDA 1JVOA 4F2EA 1A65A 1ZDSA 4JHUA 2FJSA 1ZIAA 3NSYA 2QT6A 2YAPA 2ZWNA 1GW0A 4X4KA 3ZBMA 2IDTA 2GSMB 1BXUA 3T9WA 1GS7A 1MZYA 1GSKA 1PF3A 2HXAA 4KOCA 7PCYA 3X1FA 2AZAA 3NJKA 9PCYA 3S8GB 3UGEA 4E9TA 1XB3A 2GHZA 4NB7A 2I7OA 3D12B 2FT7A 3X1GA 4DPAX 2CALA 1J5DA 2B3IA 5B1AB 1PZAA 5LDUA 2TSBA 1AG0A 2XWZA 2IWKA 3FSWA 3GDCA 1W8EA 2AZUA 1WAEA 1YLBB 2PLTA 1JXDA 3H56A 1ID2A 5I28A 2LLNA 1NIDA 3GYRA 3MX0B 3CDZB 2GB2A 1ADWA 1OCRB 3UAEA 2FNWA 3G5WA 1JOIA 2QDVA 3ABMB 4DP7X 2PCFA 2J56A 4G7QB 3FS9A 3S8FB 4CSPA 2GC7C 2FQGA 4BDVB 3SQRA 4PCYA 4BK5C 3X1BA 2BO0A 1CUOA 2EIMB 2YAMA 2J57A 2DWSA 4HHWA 2ZONA 1WA1X 1R1CA 2YXVA 3T6VA 1V55B 2GBAA 2VSKB 3FSAA 2XX1A 1RKRA 2UX7A 4E9XA 1KDJA 1PZBA 1L9SA 4G7SB 1KCBA 2XXGA 2UX6A 4FA7B 1PNCA 4AZUA 4MFHA 4DP1X 1PMYA 2DY2A 3DTUB 5PCYA 3ASNB 2BW5A 4CSZA 1N70A 1ET5A 4G70B 4PAZA 3FPYA 1MG3C 1GR7A 3FPXA 1NIFA 4BWWA 2IAAC 3AZUA 3NSDA 1E65A 2YARA 1OCOB 2PP7A 2CAKA 1AZBA 2YAHA 2PPCA 2WSDA 3NJMA 2I7SA 2DV6A 3FQ1A 3PXLA 3JT2A 1BXAA 1BYPA 1A3ZA 3NP3A 1J9QA 4A2HA 4DP2X 1V54B 4WKXA 3FSZA 1E5ZA 1SJMA 4M4RB 4HCFA 3ZX1A 4DPCX 1L9PA 2QPDB 2VM4A 1SHWA 1ILSA 2UXVA 1A4BA 4HAKA 1J9SA 2VN3A 3JTBA 4NERA 3CZUB 2H47C 3UACA 2J5WA 4YSAA 7PAZA 4A68A 3QJRB 4YSCA 4DP6X 1J5CA 2EIJB 3T71A 1OF0A 1A8ZA 5IY5B 2Q5BA 3SBPA 1JZJA 1X9RA 2IH8A 1AZRA 4JHVA 2PPAA 2ZXWB 4KNUA 1JERA 3FQ2A 4G72B 3TASA 5B1JC 1AACA 3OD3A 1TKWA 2YAEA 2YXWA 1V10A 1SFDA 2BP8A 1SDDA 4L0PB 2X87A 2PP9A 1BEXA 3NSCA 5B1JA 3EHBB 1EZLA 3NJHA 3ABGA 3CG8A 3ERXA 1QLEB 2BP0A 1PLCA 4E9QA 4F7KA 1UATA 3NJIA 3OMIB 2P80A 1L9QA 2ZOOA 4AI7A 1WA2X 2FQFA 4N8UA 1OE2A 5I6OA 1MG2C 1F56A 4KO5A 4DP0X 4E9VA 1AIZA 1ET8A 2HLEB 4HHGA 1XMEB 3S3DB 5I5JA 2X88A 3L45A 4JKNA 1QNIA 3X1NA 1WS8A 2FTAA 1KCWA 3FU7A 3PAUA 4G71B 2CJ3A 3QJSB 1BQ5A 1NTDA 1GY2A 5AKRA 1ZPUA 3WKPA 1BAWA 3NJLA 4YSTA 3SBQA 2Y1AA 4DP9X 1KDIA 4DP4X 1JZGA 4N4YB 1KBWA 2PP8A 5A7EA 4KO9A 4E9YA 3DIVA 4UANA 1MDAA 3WNIA 1SFHA 1KBVA 2FQDA 4K9JA 4QLWA 2IDQA 1KGYE 1KYAA 2BZCA 3TA4D 1ZDQA 4BXSV 2Q9OA 2GIMA 3QJUB 3UADA 1KV7A 2HZHA 5AFAA 4Q8BA 5EHFA 4DP5X 2BHFA 3NJGA 2FT6A 5F7BA 4KO6A 3WIAA 4W9ZA 1IUZA 2YAOA 1OV8A 2R7EB 3CVDA 2UXTA 3PPSA 4DPBX 4KNTA 3FU9A 5I26A 3N2JA 4TXVB 4W1TA 5I6MA 3EF4A 2XUWA 5I6PA 1HAUA 4UAHA 4GYBA 1SF5A 2W88A 3AG4B 3EH4B 2AFNA 4YSPA 1JZEA 2TSAA 3WNJA 1AQ8A 1NDTA 2XV2A 1E30A 1L9RA 3PAZA 4KOBA 5B1BB 4GXFA 1ET7A 4KO7A 1NINA 2Y69B 3CVCA 1J9TA 3QJQB 1ASQA 4HALA 2J55A 1ASPA 3T6WA 3PAVA 2EINB 2XYBA 4RH4A 2AVFA 4EF3A 1AOZA 2YAFA 1XB8A 4F2FA 4A2DA 1ASOA 3HEIB 5ANHA 4YSUA 3MBWB 3IEAA 4BDVA 4FAAB 3PLYA 2N0MA 2JFCA 2XX0A 4GP5B 5FC9A 1NIBA 3OM3B 2QPEB 3AW5A 3RYMA 3X2QB 4E9RA 2E86A 2IDFA 2BP8B 2WO2B 1SDDB 3OMNB 2VMJA 5TK2A 3DKHA 5I6NA 5D4HA 1CYXA 1ILUA 1PLBA 1TU2A 2BWIA 2XLLA 3V9EA 4BWTA 4WTQA 2RACA 1TEFA 2H5UA 2VW4A 4A66A 1NWOA 5I6KA 2EILB 1SNRA 2JXMA 5I5MA 1XB6A 2HRGA 2FT8A 1TEGA 1EHKB 3AG1B 3FU8A 3QJTB 3V9CA 1ZV2A 3NP4A 4NAJA 5TK4A 1ZIBA 5I5IA 5B7FA 1PLAA 4YSSA 2IDSA 2UXGA 5B7EA 2XV0A 3TU6A 1NIEA 1JXFA 2XU9A 1IC0A 1VLXA 4HCIA 5B7MA 1AS7A 2YQBA 1CC3A 4AKOA 1A4CA 1J9RA 3KW8A 3FSVA 3TBCA
chains in the Genus database with same CATH superfamily
5LWYH 2FQEA 4Y1SA 3DOHA 4PMEA 3UZEC 1ZGLP 4X5RA 3U6RB 3SDXE 2OQJA 2CD0A 4U6HB 4NZUH 1M6OA 1SEQH 2MTAA 5C09B 4LLVA 3O3UN 3B9KA 2CBMA 5D93B 3UJIH 1CF1A 1ZHKA 2X1WL 1O0VA 4AC4A 1MPAH 5ESQB 4BRJA 4NZRL 1E6OL 1JXGA 1R17A 2W0FA 3V55A 3VI3E 4HXAL 1AD9B 2R0ZL 1CGWA 1QO3A 2D31A 5F7FA 1FFPB 3EUDA 3NGBC 3U4BH 4KU1A 3TGXA 1FJ1B 1FL3B 2VXSH 3MCLH 4LP8A 4PRIA 4OCWH 4ZMNA 3UAJD 4WI4A 1A7OL 2OV0A 4XN9A 1TFPA 5AVUB 4LNRA 4S11A 4XNUH 4ZMPA 4L18A 4OFKA 1T0NB 1JYNA 5IBLC 1ZLSL 1QG3A 2MCMA 1RP8A 4WTZG 2YBGA 1T80A 3BPNC 3SBWA 4NKMA 3MRMA 3ZZ1A 4B9YA 1WVZA 5E7BA 4TSBH 2W5PA 4OIFA 1JVLA 4HCGA 3QFJD 1PIFA 1V05A 1N59B 1S7VB 3FUNA 3QCTL 3QXVA 1HHGB 1GC1H 1JNHA 3UTQA 1F4YL 3GSNA 4X7CC 4WV1A 1UGKA 2V37A 3L3GB 4UQ2A 5DZNA 5HDQH 1DQQB 1HN1A 5E24E 2DTSA 2D3VA 3INUL 2HX9A 1DBMH 3DGDA 4IRSA 3VTAA 4DEPC 1TCRA 4B5EA 1S3KL 2MRYA 3D0VA 1TOXA 3NIFE 3MV9A 3K0WA 3SCMD 5IJKA 1AXSA 1JNLL 1MUJB 3BAXA 4R8WH 4M8UA 4PRAB 4LZKA 3WFCL 1XMWA 4GRWB 3DHPA 3TH3T 1WHOA 4R6UA 2BC4B 3CHSA 2HG0A 5E6UB 1NMCB 2C1OA 3NEEA 1J11A 4S1RH 5C9JA 4WI0B 2QBWA 1F6LL 3D0AA 3PHOA 3WOVA 4ZUTA 3TT3H 5KBKA 3F7YA 5JOPD 3P9MA 3D2UD 2L3BA 5B3JE 2GI0A 1MCEA 2NXYB 4U0RB 4X6CF 2APFA 1X3DA 3D69A 5IUCA 4TSAH 3NDZE 1YUKB 1ZRUA 4CC0A 2NYYD 1XVSA 2VW7A 3U9PH 3N42F 3QEGL 2DTMH 4AXWB 4FFYL 4R84A 1J05B 3HTLX 5D7SL 1TQBC 4L4JA 4H13C 5IV2B 3IN0A 3S98A 3P54A 2EDOA 4OCRH 4Y8AA 2JCCA 4WHTA 3WE6A 3SE3C 3T6XA 1KXHA 4FCHA 3KPSD 4H0IA 2GUOB 3SJVB 3QQNA 4MB5A 1HESA 1QSEE 1EFQA 3KJ6H 3MRKB 4N2NA 1VADB 3OL2A 4BFKA 3MPCA 5T3XL 4LEOA 4XPHH 3O0RL 3U83A 1DBBL 2I27N 1JHLH 2J4WL 1IBZA 5T1LA 4BKLB 2RCSL 4HBQA 3HNSL 5DK0B 3OSVA 1Z7JA 4OUOA 1K4CB 1S7WB 1MVFA 5KBPA 3H55A 2B1AL 3O9WB 4AMXA 3V6ZB 2AK4B 3IBOA 3VGEA 1EAPA 1HH9B 2ZXEB 1AKJD 3CWGA 5G5DB 5HY9B 1A9BA 4XB8A 2X6AA 5B39G 3H3PL 3VI4B 4HWBH 3NFNA 1ETA1 3BVTA 2NNAA 3C2AL 3LX9A 4NKIL 3VGFA 4WEMB 4WO4B 4M6NL 4V33A 4IRJD 4PJDA 1MJ7L 4I5BB 4LASL 5GJSL 3ARYA 1UA6H 4F2EA 4LSPH 4OZ4B 4RFEB 1GJIA 3QWRD 2VLRA 2FJSA 4NQVB 4HLJA 2Y07L 3GI8H 2YAPA 2ZWNA 3I50H 3OXRB 3ZBMA 4RMWA 4ZSOA 2W94A 4NJAH 1F2QA 3IDJA 4K5LA 9PCYA 5IG7A 2VR5A 2AJZB 3SPHA 1UA3A 4P46B 4XCNB 3MV8D 3CCHA 4RISL 1V3MA 1NCNA 1CCZA 4X6CA 3HC0A 1R3HA 4ZUUB 1EDQA 5D6CB 3VDAA 4YZFF 1TJGH 4ETQB 3BKML 4OD3L 3TO2A 2AJUL 5L0QB 1B0WA 3UAJA 4WFHE 1RMFH 3CDFA 1L0XA 4HF5H 35C8H 4YR6B 5IHWA 1HCVA 3CBKB 2I26N 3HS0A 1V3KA 1RZJL 2GC7C 2JI3A 1PD0A 2FQGA 5I1GH 4RWYL 4G9DA 5I76B 3IJSB 5FGRA 3WMSA 5L2JA 5FF6B 1ZY9A 32C2B 4NHCH 4OD1L 4PJXE 1B4LA 4DGWC 4P9HL 4I8DA 4KK6C 4TS6A 2ZKXA 4AYFB 4FZEL 4LCCA 1D5BA 1J1PH 4LSVL 4BK5A 3APDA 3L3HB 3HC4H 3QFJA 4C57C 1DBKH 1PZBA 4H5SA 3B6SB 1CFSB 3ET9F 3SE8H 3P9LB 1TU2B 4PJBE 2XXCB 3OB0K 4FEMA 4PI2A 4MTMA 1AZZC 2WBJC 5AQ0A 2MOGA 3MLZL 4I0CC 5JHLL 3WN5B 4QUOA 2OI9C 4C56B 2QADB 2NOYA 3PFQA 1LK2A 1YYLH 3AS1A 4QY8A 2XI9A 1KYFA 5JOEA 3LIUA 1SYVB 1MNUH 3SCMA 2GJRA 4PBDA 2E0PA 1D7DA 1G0YR 1MFBL 1XCWA 4ZW6A 2PUQT 3BYYA 1TNNA 2UZYA 1EVUA 1BYPA 3AB0B 3T3ME 3BIKB 4LEEA 1T22A 1AI1H 4U4IA 3FO2B 4M8QA 3D2UA 3D06A 3U82B 4HC1H 4FQIH 4FNLH 3WY3A 3RGHA 2VLLA 3MXVL 1M42A 1UM4H 5I74C 1T03L 4BH7A 1YHPA 4PREA 4XBGB 3H7BA 4GAFB 5CILH 5A2AA 3NA9H 4AT6B 2XNAB 3FUKA 4L1DA 3QUXB 4ONFL 3JBG7 1IAIH 2K4WA 4ZNCD 1MH5A 4IM8A 5TGBA 3DJSA 4KH2A 2OW7A 5K33A 4N2CA 1KIPA 1X9RA 3WMPA 4KNUA 1HINH 2QQNH 3CZGA 1AACA 3KPSA 4HWUA 2IANE 1KXTA 1VFAA 3EJRA 3AQYA 1SDDA 1G6VK 1P7QB 5GHWL 5CEYA 3SDXF 4UAOB 1EZLA 3CZLA 4PLNC 4FXKB 3GXFA 1OAZL 2VXVL 3VXUB 3UYRH 3PDGA 5D4QA 4LAQH 4EZMA 2FO8A 1G7MA 3L7EB 5IB5B 3VI3F 1QSFB 2XTSA 4FXGA 2B16A 4JHWL 3EZ8A 1AKJA 1MY7A 2P8PB 4MA3A 2QLVB 4KK8C 2ATKB 4JG9A 3L45A 1M53A 2ENYA 3WJMA 3KYMA 3FL7A 5AW5B 1EAJA 3BP5A 3WTVA 3NRFA 4FABL 3QNXA 3FQWA 2JKLA 2G75A 5CP3H 4WO0A 3P0VH 4XNMA 3NJLA 4OZHB 1YPZE 4YDJA 3V52L 3QWRA 3DYPA 2J43A 4O02B 4UINL 4Q6KA 3MGOA 1YEGL 4QAWA 2G2PA 4LU5H 2AW2A 2FHBA 3M88A 1VPOH 1UKQA 4WDIA 4DN4L 2CK2A 4BXSV 5ACZA 2Q9OA 4KI1A 1IZKA 2ICEC 3UADA 1Z2KA 1P4IH 3BO8B 5K9KA 2WLZA 2FL5A 2I9LB 3TCTA 2RB8A 1RFDH 2OR9L 1SY6A 4PJEE 2VKXA 3NJGA 1A1MB 1MI5E 4Z6AT 4NC1E 2DLIA 4Q14A 5FYJL 1FFRA 2EUZA 1SRDA 4IGBB 4MJ6B 4GRLC 2JIXA 3RPIA 3SYQA 3P4NA 2G2RB 2D7PA 2XWJA 4YAQA 4OCSH 4K71B 4QRQA 1R75A 4OU3A 3QO1A 5DRNA 3IDNA 1AQHA 3EYVB 1QI3A 4MJ2A 3RI5K 1ZS8A 5E4OA 2ZX8A 2TSAA 3DSNB 3WNJA 5DC4B 5B3JF 4KXDA 1MVUB 3MLRL 5TE6H 2XQBL 4B97A 3EDDA 1A1NA 4KO7A 2R4SL 1NINA 5EZOL 3VYOA 4O02L 2MKLC 4OM0H 4X6DB 1MWAA 3VG9B 2R1WA 2DWXA 1NBYB 1JUFA 1QLRB 3HN8A 4FZ8H 5TFSL 4ESKA 4EDXB 1CFTB 4Y2OA 4L37A 4AM0A 4W9EC 1XIWC 3D4ZA 4NQCB 1BFOB 4G5ZH 4Z3HA 7FABL 3GRWA 3DVIA 3HC2A 3OJDB 3BGMA 1AO7B 4YDMA 2WGXA 8FABB 3F6IA 1CGYA 4HK3J 3QJHB 1I8AA 3TTYA 1ED3A 1NFIA 4DZ8A 3TL5A 4MMXA 3ZY7A 3OM3B 3POHA 4BFEA 4RIRB 2BSDA 4JZNA 2ZXCA 1YEFH 3HE7B 4YO0A 1S7RB 3UYOD 1SLUA 3VH8G 2OTWB 4H20H 5TQ2H 1GTNA 3QNFA 4PYGA 4Y5XC 3LCYA 1UB5B 4IIZA 4QKXB 1PLBA 4GB9A 3F83A 2ICWA 4U4BA 3HBPA 1BF8A 4OD2B 4YGVA 3QG7H 2RACA 1IGYB 4X9BA 3TBVB 4PS4H 3FHEA 3PQYB 4PJ8B 3GXNA 2OS7A 2AEOA 4XBMA 4K9EC 1A4JB 2O5NA 3FQXA 1JIBA 3RB7A 2JNZA 3HRZB 5LDSA 1CFNB 1NMBL 4G80A 1WZ1L 1XF4A 1IGCL 1HZLA 3V0VA 4JO8A 4GOSA 3PXHA 5KUKA 1VFMA 1LP9E 4N8VA 2HRPH 3G6AA 3RFZA 2ZP0T 3VMNA 5B1CA 3BKYL 4Q7DA 3WJLA 3DO7A 4Y19E 4XC3H 2XU9A 3DXAB 4UIKL 5D1XD 5EH1A 2YD5A 4F33A 2KQNA 1JPGB 4OGZA 3BKJL 3DUSA 2HB0A 4ES8A 1CC3A 2MQGA 3CLFH 2BOBA 3IGAA 2IPTL 4JG0H 3OSKA 3FAXA 3KW8A 4WWKB 3QYMA 3NESA 4MA1B 3TBCA 3QEQE 2MTPA 1R5WA 3CFNA 3GSNH 5TE4L 4UV7H 1E4KA 3C5SB 4P2OD 1RZ8B 3ZIYA 4W4OC 1NPJA 2EH8H 4NPYA 4N2EA 1MCCA 2XFXA 4O5LH 3PF2A 2XY1A 3LVEA 1I1YB 1KGUA 5GRVK 2ATPA 4CKVX 1FVDA 5E6YA 3ZLQC 2JKRM 2W80C 2B08A 1OGPA 1ZSDA 2ZX5A 5JYLA 1CFVL 2BOLA 3EJQA 4R0LB 3MRHA 4YXHH 4NZFA 1PNDA 3EIFA 5JMOC 1OF2B 4AIZB 4JGUA 2DQTL 4TOYH 4G9FE 3UBFA 1QSEA 2JJUA 4PJXF 4MZRA 5GGRA 4ISVB 3W39A 2CUAA 1WD9A 1DVFD 3UTZA 1KLGA 1S9YB 3WHXB 2MJWA 4UTAA 2E56A 2RD0A 3K46A 5ICZB 2PCYA 3GHBH 1T1YB 1U36A 4DT2A 3KLKA 2AQ1A 4PJGB 3CZFB 3PWJA 4PWKA 1B0IA 1UYWL 4XPBL 4S0HA 1OSPH 1P4UA 4Y4HD 2VDPB 2DQHH 4AZ8A 1JRHL 4Y9BA 3S35H 1S7TA 1U8CB 2B20A 4BXVA 2GITB 1AZNA 5FYKL 4X7FC 3B37A 3ROOB 5I75C 3N1FC 1FNSL 3A47A 3JTTA 1IGTA 2BVQA 2OULB 2B2XL 3T3MF 3S9DB 1J5HA 2L7EA 1LE9B 5EU6B 2UZPA 4HHAA 5I1HH 1IKOP 3NT0A 4D0CA 2CHZA 3TZVD 1NEZA 2HX7A 3HZKB 4P0DA 3ARFB 3H0TB 5F7NC 1X5ZA 4W9GC 3V0WL 3ZYOA 3EYQD 3CFBA 1MLCB 5E9DB 3SKOA 3VG0L 3KDMB 3DURB 5EZIH 1JZ8A 1XCQB 3LKQB 4FMKA 3WTXA 1U6AH 2R7EA 1FGVH 1F8TL 3RDTD 2FLMA 4MVBD 5FW7A 1PVHA 1TNMA 4UOZA 3BUDA 3OQ3B 1IVLA 4YFLF 5BZWB 3FT0A 4F1ZA 3ILPA 3ULSB 1CD1B 3OHMB 4IDLA 2X3AA 5T1DH 2OK0L 5E9NA 3MTXA 5IF0A 1NKRA 4L8SB 4MJ4A 2I85A 3IU3A 1E4XL 3MRQB 4EN3A 3G08A 3RU8H 5EIIB 1QOKA 1AGCA 1KUMA 4BCYA 3VSQA 5EO9A 4ZMTA 1T1XA 2W8CA 3EJCA 4G7VH 3FONA 4GUOA 5FR3A 1FLRH 2A9CA 1KCSL 1Q9KB 3BFOA 3EDJA 4L8CA 3IF1B 3UTTE 2EDEA 4HIIA 4NO3B 1MHHB 1ETZA 4YSEA 4B7LA 1RK1B 3FRPB 4PJXA 4H8PA 4M6AA 2XG4B 1T4KB 3QPXH 5TE7L 2ADIB 1NANH 3JUYA 4Z7NB 1GAFH 2Y36L 3UPAA 2F5AL 2ZJSL 1HFUA 4PJBA 5SWSE 1RZQA 2R0KL 1AQKH 1QD0A 3CVBA 4FDWA 4CDHA 1JN6A 1C9SA 1IQDB 2Y6SC 2VUOA 4IBZA 1BVLA 5INCA 4BGLA 1R5IA 3IM1A 4HEMA 4IOFD 1YPZF 4D9QE 1MFEH 3ASOB 1AAJA 3PWNA 5CO1A 2YPLE 1RU9H 5CEXA 2N4IA 2P47B 3V10A 3QPQD 4Y88A 3O2VH 1HZHL 1QRKA 2OCFD 2HLAA 3HJ0A 2OSLB 5TF0A 4YSDA 3QS3A 4TMPA 5DJYB 1UWYA 2YUVA 1S5IL 3IPEA 1HSAA 2IDTA 4P2OA 3LVTA 3BXNB 4UU9B 4QHUA 3BQUA 5CR1A 1PZ3A 3LQAH 1ZHLA 5I1DB 2DLTA 2BS8A 1YYML 4PLKC 3FUJA 4U1KB 4XBPA 2PXYD 3QDGE 2BVOB 5T1KB 4ZOAA 3LEYL 4YDIL 1MCDA 3GLDA 1G5AA 4O51B 4UYQA 2JB5L 2R23A 3KXFB 1NCDL 4YHYB 4K5OA 4OM1H 1JWMB 2AZUA 4OSUL 1CS6A 5HHQA 1LE5B 1K72A 4I3SH 2PLTA 2IANA 3HI6L 4L0YA 1A6UL 1F42A 1N9PA 4H25A 4Y16B 1X5KA 4Y19D 4Z95L 3V0EA 1I75A 1ZT7A 3WLBA 4DOHE 1ADWA 2MMXA 3HA0A 1DVFA 1WWBX 4PV8B 4DP7X 3WL9A 3E1ZA 3IJYA 3RZCC 2AVGA 1IC4H 3LQZB 4H0HB 1ECZA 5CJ5A 2IADA 1F3JB 3QEQD 1YRKA 3BGAA 3GXIA 4WIQA 5E2VL 3ZDZE 5CIPA 4HJUA 3RVTC 4Y4HA 4HHWA 5I6XC 2YQGA 5EPMB 2Y7QB 3LEXA 2FX7H 3U4EB 2EE6A 1P6AB 2WK2A 4GG8B 3L7FB 5SX4H 2WO4A 3DMMD 4F8LA 1N5YL 1NLBL 1DBJL 1FIEA 5IQ9B 1G87A 4NP4H 1E3ZA 2EYRA 2P28B 5EOTA 2X2YA 2XETA 4XMWA 4FFZL 4LLYA 5KANG 1NUFA 3G6JE 3DTUB 3X13B 2NDGA 1NUDA 4G42A 4M61B 4U6TA 5GRVL 5TDNB 1ET5A 4YHNA 3TN0D 3WKYA 3AS0A 5IEKB 1D6VL 3DARA 3HC3L 3L4CA 4HUUB 1SJEA 4IRZA 4BWWA 3O3AA 3T8VA 3O3DB 4G9FD 4QRUA 3V4VB 3FAWA 3QORD 1NGYB 3EYUH 4Z8FH 2A6KB 3WS3A 4KGLA 1A3ZA 4ZYKA 5BV7B 1QFWL 3CMOL 1A14L 4EXKA 4ZZKA 3RDTA 3Q06A 1KNOA 3AU0A 4IU2A 1GH7A 2VM4A 1BD2E 2OFQA 4IMLA 2EDWA 4N9OB 2NLJA 4ODSL 3M17B 4HFUH 4OLEA 1U8QB 4PSRA 3S3PA 4PJEA 4EZJA 2A0LC 1A4BA 5BCAA 2KH2B 2VMEA 2XACC 4XPTL 2NY7H 5DHMC 2PCPA 7CGTA 1LLAA 2HWZH 5L2KE 4WKZA 2F7OA 2YSTA 3LNGA 1OP9A 3QJRB 4K3GA 4KHXL 4YSCA 3QRGH 2XQYA 1WBZB 4L9LB 2BXZA 4XCEA 5F0JB 2IH8A 4G8FB 4PCKA 4C47A 3LS4L 1AD0B 4RMVA 3HPLA 5IB3A 4XMKL 1WSST 4WFEE 4QOKE 2IXQA 3L5WB 4IIQB 1L9MA 2X4TB 2VN4A 1SY6H 5B1JA 1PLGL 3FB6A 1R9FA 5D2NE 1T04A 3V4VL 4YDKL 1AIFA 4OFQA 4J3OD 5J57B 5HI3C 2O5YH 5BW7C 2UUDK 1P5UB 1C16A 3N9GH 4X80H 4RDQF 5LG6A 4G6FD 3E0GA 3WKMH 5BV7L 1BOGB 2R51A 4AYSA 2WBXA 4ODHH 5DHEA 4HMEA 2A9BA 4P9ML 5HGBA 4OBRA 2CUHA 1A5FH 5AAWA 5CP7A 1U3ZA 2WYTA 2X88A 4HPYH 4JN1L 4C4KO 4R5TA 5K59E 3QIWD 3T0WA 1L6PA 1DQLH 1NGXA 2XN0A 4LCIH 3FU7A 5CCKH 1HILB 4CKQA 3IMWA 5ABDE 1HEZB 3FB7B 3SPIA 1T21A 3ZK0A 1MWAH 4M1CC 1P1VA 1AR1D 5I1LA 3UJTH 1XEUA 4LIQL 3TBSB 3DROB 5BOJA 1SN2A 4Z0BL 4KI5E 1MW3A 2H9GB 3GRWH 4U1GB 2EYSA 4AYGA 4AGLA 1ZDQA 2GIMA 3LMJH 5BS0B 2PXYA 4KKNA 4DGUA 2E5EA 3ISYA 2EXTA 3KPQB 1I7TB 4E68A 3CDCA 3ARPA 4PG2C 3QIUD 1J0HA 1KFAH 4I0PD 3L3IA 4DP5X 1HHJB 4OGXL 3GQFA 4PRHB 1CLVA 5JO5B 4JDEA 4QCIB 1LP9A 5E0QA 2MCAA 4D9QD 4MGXA 5JA9A 3CHOA 2AQNA 2WUBL 5H37A 1DQDL 3AROA 4FI7A 3O3BA 2P24B 3KYOA 2Z64C 1XX9C 4Y19A 1MEXH 3PWUA 2LFGA 4J3WA 3GM8A 5EN2A 3RE0A 4UZSA 4S1DD 4YFDB 3N06B 3IDMA 3C6LD 1SF5A 3IWUA 3QXAA 2H26B 5FGBA 3QEQA 3UTPD 5J06A 4K15A 3PAZA 2X53A 5E8EA 1BBDL 4MSWB 4GXFA 3C9NB 3DMMA 4I2XB 3JUZA 4WU5A 1J9TA 1FLTX 2J8UF 3QDGD 4PH8A 2XTLA 3HNVL 1Q38A 1T0OA 4JKPL 3NTCH 3VA2C 2VTFA 3PAVA 5CGYD 3T1WA 2EINB 3VB8A 2RFXA 4U3SA 4V1DB 1G7IA 2FAUA 2WNGA 4X2UA 4F2FA 3UCRA 3VWKC 3DWTA 4A2DA 3RFRA 2GSIA 1GJWA 4TQEL 4XVUD 4BDVA 3BH4A 1MAKA 4AQ1A 4G9FA 3K1KC 1N6QH 2ZXAA 4PJHB 3LRSA 4BCXA 4E5XG 4HISA 3QORA 3I6GB 3ZYJA 1ZTXE 1PEZA 4XNZB 3U4BL 2Y5TA 1WJ3A 1IQWL 3CK0H 3OAYK 3RWJA 3DIFA 5DUPH 4XN2A 4HV8B 1HH6A 1VGKA 1T1WB 1LDPH 2PR4L 5BO0D 2VRQA 2R9HD 1SEBA 2CLRA 1JZ7A 5IVXE 3LNEA 4NPJA 2JTDA 5GS0L 3KS0J 1E43A 3VXPB 4KQ0A 5KAQF 5D7KE 2O26U 5ERWA 5DFVC 2DQIH 5D7JC 3W9DB 4AQ8A 2NY3D 1T0PB 4UTAH 4LVNC 4HP5A 4AJ0A 3B2UC 4XNDA 5B7EA 3GJEA 2Z65C 4PP1C 4ZAKC 4BGDA 4L1TA 3W56A 5LAXA 1GZPA 5DUML 3BKCL 4R2GD 1EEYA 3BUYA 4M93C 5CBEA 3Q5TA 1A3LH 4J2XA 1F6AB 4ODXA 2GBVA 3RVVD 3CSBA 4H0LC 2BSRA 1PL3A 3MRBA 4NSKB 1BG1A 4XPFL 2A4ZA 1A3QA 2EIKB 4JRYE 5I2IB 3ABKB 4MRCA 2AQRA 2R1XB 1YDPB 4J1UB 4HUVA 4QT5B 4X8CA 3AU1A 3ZDYE 3QSKB 1HKLH 3NJNA 3QIWA 5DFTA 4J6RH 1QUPA 1PIGA 1E4WL 1IAOA 3O4LB 4MMZC 3X12A 1ZT1B 5D72H 2V9TA 3PDOA 4QIRA 1FZMB 3UTTA 3AFLA 4HJTA 2YLKA 3REWB 4GI8A 2DTML 3LDBB 3EH5B 3GMNA 4J2QA 1ULVA 4LLDB 4QXGH 3SEPA 4QOKD 4AVKA 1E42A 4FCAA 2HKHH 4MA8L 5LGYA 5D7IF 1MELA 5LBSA 1NEZG 1S7XB 2WNKA 4HH8A 4LMQI 4QRBA 1C1EH 1N64H 1LGVA 1LWHA 2CBPA 4R4ND 4ZFOB 1KEGL 3BCDA 1LDSA 2JKJA 4L29A 1ZOXA 2JF1A 3E6HA 1NIAA 2C7UA 1CVSC 2ADJB 1UUSA 2CPUA 3II1A 3JT0A 4WEBH 1KC5L 3GPSA 5HI4C 2HT3D 1MWOA 3G6JF 3QIUA 4PFEA 1K3IA 3ZHKA 1Y0LB 4I0PA 2HKFH 3QNYB 3OKKA 5CS7A 2Q2EB 3LPOA 3UIYA 4FX5A 4KVNH 3IDUA 5FKPB 1PJWA 1ZTMA 2YPVA 2YPLA 2CCWA 2TAAA 3D52A 4EDWL 1YEDB 4R5VA 3OPZL 1OAJA 2F53B 4K0OA 4JZJB 4ZQTA 5DJ6B 4U1MA 1RZPA 3BVXA 3FCUB 4ODUB 3SDDB 4D7BA 2PABA 4OFDA 5M95B 3CIAA 5CN2A 1L0QA 5HVHB 1N8ZA 5SWZE 3RWGB 1RJCA 1WRFA 2F74A 2OP4L 3JWOH 2ZWKA 3S0PA 4B50A 1IZJA 5AUMB 5J6GB 1WA0X 3C08H 2O6CA 3DX9B 4FYTA 4GW5B 3MC0A 4QXUL 2IFFH 3HNTL 3ZTNL 2DWDA 3BWUF 2IBZY 4U1NB 5EIIG 2WN3A 3MOBL 4KMLB 1DJWA 3QDGA 2G3NA 4ZFOL 3CZSA 5EFIB 1PKOA 1JZ4A 2J1ZA 5C0EB 5JORA 2CLVA 2ZQKA 3SKNB 5IW1B 2YBRB 1F90H 5JQ6L 2Y7SA 2FCBA 3V6FA 4HKJB 2E7HA 2OR8A 5PAZA 1B6UA 3BDXA 4UNUA 5IMMA 4AMKL 2P4AB 1KCLA 1U8KA 4NFBA 3CQQA 3G6DL 5FLVA 1QLEH 5FWRA 5DGQA 5IMOA 5HHNB 1G0DA 5C3TA 2VE6B 4KDTA 5GS1B 1K8IA 3MV7B 3PHQB 4Q4IA 2E27H 5F7KC 3SODB 3BLKA 4Z7WE 4TSCH 1B0RA 4L8BB 1FH2A 4MKTA 4EIGB 3MO1B 2WXJA 5AVZB 3HMXL 3KBHE 4XP5H 3BRFA 2J5LB 2NY4D 1UT2A 5KYWB 5FM4A 3FT2B 4Y2DC 3L3KB 4A67A 3KPNA 4P3DB 4XN7A 1JYWA 5EZLB 1BQHA 3VXRE 2EDHA 4I1NB 2VAJA 4Q56A 1JE6A 5AZUA 3MMEB 1I1AA 5DJCB 1P7KA 3A3YB 5D71L 5IQ7H 2ZG3A 2CHNA 4H8WL 4YE4H 2H45A 4M43L 1Q0YH 2Q3ZA 5E6ZA 3F3HA 1CDYA 4ZFZB 4YNYB 4DCQA 4M6MH 3AY2A 3CDYA 3GPEA 3K6DA 3PUUA 1BFVL 4KI5F 4CVWA 1YMME 5CIPH 3LPGA 1PFCA 4XAWL 2ZUVA 2HCZX 4F58L 4U1LA 4MAYC 3DJRA 1XGTA 4JRWA 3MROA 3P0GB 4LOUD 4EEEA 1ZHNB 3V5HB 1AMYA 1A7NH 4O58H 3U7AA 1J8SA 3MJ6A 3GLAA 4NXSA 4XMPL 5ICYA 1BD2A 2QT6A 3GS0A 5J3HC 1DVZA 4JS7A 4PW9A 3Q43A 3PE9A 4KAQL 4X6FA 4EI5B 1HI6B 3TX4A 3CZEA 3H9YA 7PCYA 1NMAL 1N2RB 4QHLB 3IT8D 2OSWA 3NEXA 4IRZH 4OLXH 4P2QE 4KVCH 4PTUA 3OMZA 1JFQL 1X9LA 3PL6C 3QZBA 5EBMA 4F15C 1BV8A 2NDFA 4S0SD 3CNKA 4LEXL 1S7QA 4MJ5A 4KRPC 3BSZA 3D87B 1NGZA 3WS6A 1H6FA 3FSWA 5GGTA 1W8EA 1PTZA 3TA3B 3K80A 4L2YA 3C5ZB 1BVOA 4HKBA 4QOKA 1UXWA 3HZVB 4WK4B 2YR3A 1I3GL 4JVUA 4W81A 3VFPA 4RNRB 5CLZA 5KVMC 4I4WA 3ABMB 5DO2C 3VFSA 1ZGLA 1T0MA 4DGYL 4Y1AE 3N40P 2CJUL 1XDTT 2VISA 2VQ1A 2YD1A 3RL1B 5GZOA 3X1BA 4JRYD 4LF3A 2H0JA 2P9RA 3H54A 2C9AA 3QNZA 1WBXB 2CK0L 4M4PA 4PJFE 2VXQL 3KWTA 3T6VA 2YXVA 3EGXA 4QJ5B 3G5XA 2XJLA 2WJ7A 3R1GL 2XX1A 2UX7A 5D96C 1N8OE 2H6OA 3HS9A 1FIGL 1GMIA 3L4XA 3SY6A 4OCYH 1QFWM 3ZGIA 4GIAA 2WM0A 1ACYL 5EO0B 1UD5A 3MRRB 2D9CA 3F7RA 5BRZB 2VB5A 4JN2B 3FPYA 3MQIA 4U1HB 2GSGA 3BAYA 4W6WB 5JDJA 1I9JL 2VQTA 2MFNA 2Q7YB 4FQJH 4BBWA 1N7ML 1AZBA 3X3FH 3HBQA 5IVXF 3DUHA 3H2WA 3EO9L 3W11C 3DX4A 1EA9C 3FQ1A 4K3HA 3FXIC 4DP2X 1DANU 4GI9A 4R4BB 1GSMA 3GNMH 4JVWA 1S9VB 4X50A 4F7MB 5HHVL 5IESH 5K39A 3NN8A 4YHPB 2QPDB 2PO6C 3BP6A 3O2DL 1OP4A 2A38A 3O3EB 3PRZA 3NH7L 2A6DA 3LRGA 5J1AA 5IB2B 1CICC 5A6LA 1KSRA 3O6ML 3E8UL 1KB5L 2BDNH 1KCVH 1F13A 3UDWC 4PV9B 2VDOB 1E5CA 3D30A 3MRCB 1ZCRA 1QMUA 3GTVA 3STBA 4ABWA 1DUYA 4CC1A 1EUUA 1RFDL 3SGJC 1QW8A 4I9WE 1O75A 4UNVA 4WCYH 4N0CD 1IAKA 3CFTA 4K7PL 2Q5BA 1E0OB 3GZKA 1T2QH 2OQJB 1BFSA 4RGOL 3ATFA 3A6CH 2PPAA 5EOQL 1M6OB 5HJGA 3RLSA 2X44D 3FQ2A 4Y4KB 5E99H 3IJ8A 3WDIA 4IBVA 3OD3A 1ZHKB 2DQ6A 3QCUH 3CC1A 2ERJC 2Y1ZA 1AGFB 4QRRD 4IKIA 3GRBA 3S4SA 1UZ8B 2F8VA 1WTLA 4L8DA 3ULVC 4OAWA 4R90H 1EZVX 5H37H 3ZDYF 4F7KA 1CG9A 4PRIB 1QFHA 2ZOOA 1ZLEA 2C3HA 1DR9A 5DMGC 3ZJAA 1U2HA 4BD4A 5JR1L 5L88H 3Q1SH 4IK7A 2A6JA 4JG1H 5D5MF 4FZ8L 3DI3B 1OB1A 4TF4A 3LRMA 4XXDA 1MIMH 1QRNE 5H37G 2XWRA 3PWVA 3TYFB 2VC2H 4LSDA 3ZMRA 3NVQA 5ADOH 1KLUA 4ODWB 3GS7A 4U1IA 5I19H 2VDOL 2KERA 5B8CA 3QIBB 3QJSB 2Q8AL 3AM8A 4FQLH 1UENA 2ZCHH 3COOA 2P8MA 2E47A 4NUGL 1BGXL 1WFTA 4H26A 2JJSA 1RH8A 1YEIL 1I9RH 4JO2H 4PP2B 4G1MA 1OCWH 4I85A 5IVXA 5J1TC 4HJJL 4AENA 1Y6KR 4XGZB 1G9NC 1HU8A 3ZSSA 4O2CB 1C5BH 5I9QB 4RGNB 4YN3A 3VXRD 2MPAH 2H1XA 4F8NA 5IB4A 3G5ZB 4WU7A 3D0VB 3FFCE 4PJIE 4ZBJA 1GXEA 1AXSB 5JPMA 4XCYB 2J88L 2ODIA 4L3EE 3O6KH 5IBLD 2GJPA 3THML 1QFUL 5ESAA 2QTVA 2B0SH 2XPGA 4GAJL 5AYUH 1PPIA 2AQ3A 3GK8H 4UMSA 3WIAA 4XOBA 3ZQWA 2XN9E 3PHOB 1YMMD 1BDYA 1PZ2A 2WXPA 3GGWA 3F7YB 3GSXA 3PPSA 3SE4C 3ZYZA 1H6EA 3OKDB 1QBML 4HOXA 3OAZK 3UGXA 1TJMA 2OZ4L 1J0ZA 3HZ3A 3Q6GL 2AJYH 2ZG1A 4OV6F 4XP6H 5MP6H 3X14A 1VGEH 1AGBB 1DEEA 2BRQA 4PGEB 1NCWH 4JRYA 4F2MB 4AOFA 4F7CA 1H6TA 2EDDA 4TRPH 1UXLA 2OLDA 3FT1A 2QTEA 2WLMA 1X4ZA 3QDJE 4P2QD 1XTLA 4PRDA 1IC1A 5I8OH 4WHTB 4BQBA 3WE6B 2X2JA 2DD8H 4M7KL 5GXBB 1HDMA 3F01A 4LP5A 2Y25A 1LYQA 1YVLA 3S34H 4YBLB 3VFGH 4LEOB 3QWOA 4Z7WF 4J3OH 2UYLA 4N2LA 1KG0A 5CLTA 5DRWA 4YXLH 1JK8A 4AVJA 2FGZA 4XNQB 5C08E 1NCCH 2M83A 2EO9A 4G7YL 3KDPB 2ZZUT 5C0FA 3MJ7A 2G60L 1KYOK 2X2HA 3GKWH 2JE8A 3DX6B 3UG5A 1A4KA 2ICES 3V0GA 5TK2A 1MJUH 1D5XA 4P5MA 4Y1AD 4J3OG 5AW6B 5GSRB 3KPMA 5EF0A 4TNEA 1A9BB 3GSWB 2XVGA 2BJML 2VL5A 3NFNB 3U7WL 2O5XL 3V9EA 4DKEH 5IREA 3RX9A 5H4YA 4ZRGA 5HGHB 2CBTA 2EILB 1SNRA 1BZEA 4PJ7F 5CFHA 4BSJA 4XPAL 1EHKB 3KGRA 1L7TL 2P8LB 4NM4H 3SY0A 5GS3A 4NAJA 3VMOA 4GPVA 1JD9A 3KPPA 5ECJE 5LBSH 1XGYH 1EEZB 2VH5H 3B9DA 4D9RE 5KSBF 3DRQB 4NFCA 1N5AA 3G5VB 1GMEA 3MLYL 4B9GA 4JO3L 2GCYB 5SWZA 5T33H 4LE8A 3QO0A 4QI3A 5IVOA 2BNRE 3GB7B 2FDBP 3LZQA 1WICA 4UOJA 4QRRA 1HCZA 3US1A 5DO8A 4ZMQA 1F11A 4HCIA 4IKLA 1UZ6E 2D7TL 4X6CB 1K6QL 3HC0B 4D9LH 1MRFH 2YPVH 5AW0B 2EIZB 3K4ZA 1EJ6A 3QUZA 1MF2L 1RZFH 1ORSB 1FL5B 2RJMA 3AG3B 3BWAA 3N42B 4LSUH 5KVFE 2DYPB 2FO4B 3EOTH 1FGVL 2HUHA 5KSVB 4OZFA 2R0LH 2V2XA 1NAMA 1RD6A 3LH8A 4I89A 3UZEA 3L9RB 2CKNA 4IEFA 5IOKA 3ATBA 2IH3A 5TDOA 5L2JB 5L8JB 1DQJA 3SDYH 4JREC 2VERA 5AG9A 4PB0H 1L9TA 3H9SD 1AANA 3RNKA 3KBEA 3QCVL 4JY6A 4QYOB 5TPWL 2GTWA 3K81A 4Y4FB 3EF7A 5HHME 2DQEH 2YRLA 4CMHB 1C8QA 1K2DA 2J12B 2WLYA 4PJFF 4HDIA 4K94H 1FO0L 1E50A 1MREL 1UACH 4JZOB 3VFUA 4AKPA 2VDNH 3FT4A 2IOIA 2ZCKL 4G59C 2BSSA 3GSQA 3VXRA 5HHOB 2CBQA 2C3XA 4QY8B 3HHRB 1ZVYA 2EE9A 4ZOBA 3K2UH 1J5OL 4Y8DC 4YSRA 4QD2E 4W9IC 4YH6A 1RIUH 4DSYA 3GBMH 5E1IA 3T8XA 2UZYB 1MRDH 4IOIB 1DL7H 2X4PA 2YN5A 4ZFQA 1M56B 4LRIC 3IFNL 1CDIA 5TTRA 2WZPD 5EBWA 2CKBB 1YMMA 4KK6D 4PG9A 5E4AA 5DWUH 1VZGA 4ILDA 4RX4D 4X5XB 2Y9RT 4NT6A 1H3WM 5AALA 3S96A 2VLLB 3MRLA 3WY2A 2NUPB 3INOA 4XT1C 1JJUA 2EEFA 2PTVA 2H32B 3H7BB 3ECVA 5BJTA 4KJWC 2OJ1A 4GP8B 3Q7JA 1D6EA 3TC9A 4WTWA 2WBJD 4AUUA 3QFDB 1MJJA 1QPKA 3OKOB 5AW3B 5GGSA 3TPUA 1IGIH 3FUFA 5JQIB 1TMCB 3ZDWA 1XBRA 3SO3B 2WO3B 2ITCA 2H1PH 1SOXA 5TGBB 1AE6H 3MCYA 1OWRM 4P2QA 4NC2B 2QEJA 4F7TA 1M71A 5IFAH 4GAYB 3U30C 1DEDA 2HMIC 2V3DA 3UX9B 1RJZB 1I7RA 2CBOA 4L3ED 1E28B 1ZJAA 5CEYB 1FN4B 3QZWG 3OMAB 3FN9A 4PJ9A 1G7HA 5C6TL 2EICA 1AZUA 3FYEB 4G8GE 1U3HC 4OQTL 4B96A 2J20A 1R3IL 3MTRA 2Z93B 4R97C 2ADYA 1M9WA 1W6LA 1HWGB 5IW3A 4KZDH 2BPBA 2JKWA 2F54E 2IPKB 3B56A 3BAEL 1LHZA 1UWXK 1Y6NR 2CKBL 3BGFC 3EOYG 3T3PE 4OBSA 1I4FA 2AEQH 1R3KA 2F58L 4XXWC 4Y1AA 1DVQA 1RSYA 3L1OL 1D5IL 3HI5L 4OJDH 4GAAA 4LLQB 3WJMB 3LN5B 1R3LB 4JHAL 4DHLA 4FLQA 2V9UA 2E6QA 3NG5A 3BSZH 4NQDB 2OYKA 5GGTH 3SE3A 4D0BB 3ZL4L 3FQWB 2G75B 3QDJD 1S46A 2VLME 4XNMB 1WCBB 4ZPTB 5DZPA 1EAOA 3A22A 4XMTA 5E7FA 1MCOH 3IFLH 1CPUA 2DDQL 5F3HB 2HJFA 5ENWA 4EBQL 3MGOB 4GO8A 1OTSC 1QUNB 2XXMB 2VZUA 2QZ5A 4C83B 2ETWA 1HCYA 3AACA 1LEIA 5DS8A 3BPLB 1URLA 4MX7A 4TM9A 5SWQA 1CXEA 5C08D 5K9KB 4ZG1A 5K9QI 1DQVA 2Z1KA 2BXYA 3GD1C 2X4NB 1BQLH 1BREA 5F88B 2IV8A 4KK8D 1F6FB 3EHBC 4ZFFA 2XXFA 3HB3B 1XT5A 3P40A 2HPTA 4PJIF 1UH3A 4GMSH 4O9HL 2HVJA 2JIXB 5F1NB 5LAPA 4Z8FL 1WEJL 2Y23A 4AK1A 3MNDA 4YAQB 4LSQL 4NAQA 4AL8C 3CDGB 1UM5L 1TZGL 4QRQB 4JLRB 5DRNB 3QUGA 5C2BL 4O2FB 3NJKA 4EQ3A 3HG1E 4E9TA 4KUCF 2WYHA 3Q2CA 1TYRA 1IU1A 3VFMA 3NIGE 1CLOH 3E9TA 3PGCB 4S0TD 4CAGA 4D9RD 2R1YB 4JUSA 2DEYX 3SO5A 4FP8L 2BFVH 1RSFA 4URKA 3SDXB 4AQEA 3WDJA 5CGBA 3H9SA 3IMUA 4FG0A 5AOLA 2DI8A 1C8PA 4CVUA 1JUFB 1JF6A 2A77H 2BNRD 3QRGL 4HXBH 4QTFA 5J4MA 4Y2OB 3GYRA 4AM0B 5A6IA 2DMBA 2FYYA 1XHHA 3U7YH 1PG7W 3VI3B 5F6IB 2FNWA 3G5WA 2BWQA 4LCWE 3BGMB 2PCFA 4GRLD 1EJOL 3MRGA 3QA3A 4BK4A 4X6BB 43CAB 1JZ2A 2WLIB 2AXGA 2QR0B 4PJ5E 1ED3B 1U95B 4RAVB 2VSCA 4DZ8B 5F7WC 3DPBA 1YJDL 3ZZSA 1FAIL 2EC9T 4JZNB 1UJTA 2A9NL 3T2PA 1QRNA 3QHZH 5G4NA 4Q0XL 2WZPA 3CPLB 4ZMZA 3PJLA 4OLWH 2EH7H 5JPNB 3WEXB 2HN7B 4BQ6A 4WK0B 3ZKXB 4ES9A 3N41F 2OMXB 4RX4A 4FA7B 1I8MA 2ICWB 3FCTB 2FBJH 1ECYA 1PMYA 2FD6H 1LK3H 4YGVB 1EDYA 2R8SL 2GKIA 3KM2A 3N85H 4G70B 1IL1A 1KN4L 4XP9L 5I17A 4JFDB 5E2WL 4BQCA 1XIWD 1A3RH 4LNVA 5AOZA 4PVBA 4UT9L 1B9KA 3E6FA 4FQQB 2DQDH 1CFMA 1J8RA 2ADGA 2WSDA 4N0YH 3VFNB 4YXKL 1U8JA 3MLXH 1BZ9A 2QV4A 2HG5A 1SMDA 3PABA 1TQVA 1P9MC 4GJTB 3IETB 1C12B 3KEHA 1RAMA 1NC2D 2X0WA 4NUJA 4EAEA 1YEKL 3B83A 5FFOA 5MI0B 1AC6A 4PJIA 4POYA 2NX5D 1MVYA 5L4FA 2IAMA 5IK3A 3DO7B 3G9VA 4L3EA 2AKRA 5F7YC 3VW3H 4NENA 1YNTA 2VMFA 2VZVA 2YEVB 4JFQB 1ONQA 1KN2L 2H47C 3IGAB 3UACA 2XN9A 1JPFA 2PW1A 1G7PB 3UZQB 2WINB 4DTGL 4HGKC 3I02B 1BHGA 1TZIB 5DRZB 1RUQL 1V5JA 1G7LA 1E7UA 5IVNA 1CBVH 1A6VH 2YKKA 3SOBH 2AC0A 4KROC 4MDJA 3LKPB 4TULL 2Y06L 3TASA 5CLWA 1TKWA 2W07A 2V9RA 4LL9A 2JMRA 1S9WB 4M5YL 2CRIA 3BH9B 1OGTA 2ZUSA 4LK4A 3VA6A 2ZSVA 1GZHA 2BY1A 4ORGA 4KX9A 3QDJA 3QW9A 3CG8A 3MRHB 4BFOA 1PLCA 2TRHA 4L5FE 3FZUC 2VL4A 1M7IB 2W9DL 3CFEA 1IJ9A 1O5PA 4MDRA 4F7EB 3MJ8A 4S1SH 1DDHB 5F6HI 1QSEB 5E70A 3EGDB 4GUPB 1KJ2A 5GGRB 1J0KA 3W82A 5GRZA 1PG7H 2H0EA 5MEQA 4YX2H 4CGTA 25C8L 2YD3A 3TONA 3W2DL 1ZKAA 3ARBA 5BO1L 3X1NA 2G30A 3KYNA 5IHUH 5C08A 4OLUH 4ZTPH 3PWJB 1ESOA 4EOWH 1KCWA 5F7EL 1TO4A 4GNKB 1H6UA 4ZX3A 2AHIA 1ZHBB 1KXQA 1GY2A 3WEBA 3S5LA 3PP3K 3Q3GA 3DSFL 4LCYA 1S7TB 3QUMB 3OV6A 3X3GL 4N0UB 1RJLB 3II2A 2YD8A 4JPKH 2YKLH 2FQDA 1CGSH 3ZUCA 1DSWA 3ZGHA 3BJ91 2EKSA 3TA4D 3VQ2C 1BZ7B 2VLMD 1FFQA 1F18A 1XF3B 4Z7VB 2R56H 5IQMA 4H8QA 1B4TA 5D93C 5BQDA 4HHAB 5AD0B 3K4AA 4D0CB 4MA7L 3VRIB 3LHPL 4O2EA 2ICEA 1E5BA 1WK0A 5D2LE 4K8RH 3FN0L 4LSRL 4DN3L 1DQMH 3P73B 4X99A 2BNRA 2R7EB 3EH1A 3RKPA 2YWYA 4XZUA 2FECL 2FH6A 3U0PA 4W1TA 2DKSA 1FV1B 4ZW5A 4GRLA 2VCOA 1GIGH 1QSVA 2CRMA 5J0BA 4ZMOA 3BT2L 5IF0B 2OBGA 1BVZA 1OEZW 3E3QE 3IU3B 1M1SA 3MCKA 4XNYL 5T1MB 4EN3B 3G08B 3EXJA 4P2AA 3EFOA 1AGCB 3QUML 2CGRL 5HGAB 4AGOA 4BELD 3FONB 2CIIA 2DS4A 3MUHL 3CVCA 3HG1D 3P2BA 3VQLA 2EVIA 3RJQB 1UD8A 3JV4A 2GJ6B 3MRDB 4JE0A 5I1AB 2J72A 1SJHA 2JTYA 1NUNB 2PWDA 4CJ1A 4KMTL 3LKSA 1X5GA 1ETZB 2BCMA 5C97A 2VO8A 4PJXB 1H5BB 3I9GH 3T3PF 2ZOUA 1JDAA 1WG3A 3HN5A 4CVXB 1XIWA 1DFXA 3UBXG 4L1LA 4X7SH 3D6GA 2VRKA 2CDEA 1XL6A 3IAQA 4R7DA 4X7DC 1E90A 4JDVA 3WY1A 2P5ED 1SHMA 5HI5C 3MXWL 3AREB 5FHBL 3FH5A 3GMOA 3RYMA 2MNWA 1QACA 2X6BA 3ASWA 4LCWD 2BFGA 4OZFH 2VDMH 3VU2A 1NAMH 5I6NA 3Q13A 3P2DA 4IBTA 1NMCC 3EJTA 2VMDA 3LJ3A 4GKOA 2GJJA 4PJ5D 4C4BA 5CEZD 5JIQA 1UXMA 1W15A 2IBGA 4XNXH 4E0RA 4HCRH 3V5KB 4OTXL 4R7XA 4AEHH 4Y5XA 1M1XB 1TZAA 2NXYC 3BUTA 4M03A 4U0RC 3BW9B 2EJ1A 4K3EH 1OAYL 3LIZL 4MD5B 3T3MB 2HRGA 2F7QA 3BJLA 1N4XL 5AOMA 4XO4A 4ODTH 2AJXH 5C0BE 3KCWA 2P5WE 5E94B 3R19A 3D85B 3MSPA 3GM0A 4QHUB 3BQUB 2FX8H 4V11A 2QMJA 1N3NA 1D9KB 2AV1A 2R29A 1RUPH 4ZO9A 3M1CA 2WKOA 5AVRB 4HLEA 2WXNA 1YEEH 5BQ7A 4XBPB 5E0FA 5AW1B 3WUWA 2Y6SD 4UIMA 5DD1H 3UTSE 4EUPA 4RQQB 3NOIA 2FJHA 4FS0A 5C0IA 3D0LA 4W9HC 1LNUA 4KNQA 3GMMA 4NZDA 4YHKL 4S1QL 2WIMA 3LZRA 4UTBA 4AIOA 3T77A 5DTFB 1YEJH 1WAAE 4ELME 4UMGA 3ZDXF 2IANB 5EO1A 1JNNH 3JWDL 2B9AA 3ZXAC 5K9JL 3UPRA 3MZTA 3UJJH 3PNWA 4JRXB 4PGBA 1SDYA 3O9WC 5EUKA 1RURL 2CLZA 3MJWA 1OAQL 4KK9C 1KPVB 3IJYB 4G8GA 2XG5B 4WHDA 1UGNA 2AQSA 4W4OA 1PAMA 1F90L 4JAMA 2H1LM 1FVCA 4QO1B 3UO1H 2VLJB 1E4JA 3HS8A 4PLKD 3O6FB 4WO4C 1RZJC 2BIIA 2HVKA 3M86A 5CINL 3U4KA 2XVBA 4ZNEA 1DSFL 2CIKB 3IXTB 5KYUB 3FCGA 1KJVB 3VXTA 4OGYH 4P9HC 3DI2B 2L4OA 3WD5L 3KW7A 2O5ZH 4D94A 1FFOA 1BIIB 1R46A 1BJ8A 1LO4L 2FEDC 2XKSA 4G42B 2ENPA 3T4YA 2B77A 3F7VA 1BVNT 4HFWB 1YPZB 5GJTL 3ZZLA 5AB1A 2KLTA 4LGSB 5H35B 3BH8A 4P46C 1VHPA 4QRUB 1GYWA 1SPDA 1KGCE 4H0GA 3RZCD 3BRDA 3IPBA 1WBYA 4FFTA 4A6YH 4YHZH 2IEPA 4NM8L 2GJZA 5JA8B 4MNQD 1Q9OB 3RVTD 4CUCA 4UUJA 3EFFB 2PYFA 4JB9L 2RA1A 5L0QC 4IU2B 5GZNC 3ZKQD 4IMLB 4JFOB 5E6IC 4RFOH 5E8PA 4Q6IC 3D9AH 4DAGH 2QQKL 1MI5B 3WTSA 1NQBA 2BS71 2GFBA 3D8MA 3KNBA 4KBPA 5EMYA 3Q9PA 2WVUA 4PY7A 2AQTA 2Q1EA 4WKZB 1TLKA 3BDYL 3SD5A 1CK0H 5IB1A 4LHJB 4PRPE 4AKQA 1UCBL 2YA2A 3ML8A 2AABH 4XCEB 3HG1A 3I84A 2N0KA 1KPRB 3GXTA 4M48L 5D8JH 3HPJB 5FO7A 3P77B 3PAYA 3T2QA 5GS2D 4MDIA 5IB3B 5DHXB 3JQOB 1UKTA 2JSFA 3QDHA 2FNBA 5J7CC 2OMZA 2E3VA 5KS9F 3IN2A 3FB6B 3B5GA 3WN5C 5FA4B 3RJOA 1T04B 2QADC 3UIZA 1J8HE 4RRPG 2NT0A 4K7FB 3OZ9L 2O6FA 2X28A 5CKAA 4C4KT 2A0LD 1RZIA 1CMOA 2R2CA 1C16B 2B59B 4OF6A 3K74B 4LCWA 5ANME 3RHWF 1V8HA 3TVMB 2I5YL 3KCPB 3O4OB 4OZGE 2YJLA 4PD4K 1DVXA 1PKQB 4MXWH 4BM7A 3AB0C 4PJ5A 4QWWC 1CE1H 1WIUA 1NZRA 5CP7B 4ZD3H 1NCBL 1WWWX 3FF8A 3M46A 3MU3A 5DXWA 1S78C 2W9EH 5DR5L 2NNCA 4YHML 5ICXB 3RWCA 1NGXB 1PZDA 3FU7B 2QQLH 3V79C 3WE1A 5B1KA 2ZPKL 5F9OH 3WSQH 4RMSA 4M4RA 2PPDA 1GS6X 2EQDA 2VWEC 2YMXL 1XEDA 2NSMA 4DGIL 1RI8A 5I1LB 3I85A 1JRHI 3QXDA 1SF3A 3VWJB 2NTFA 3WXWH 3W0WD 3QUXC 5DJ8A 3S48A 1AXTH 2KUTA 1WGVA 3CX2A 1E8ZA 4P5RA 1EVTC 5HI3D 2MNJB 4LKCB 2EYSB 3Q8FA 3U6XA 1OE3A 4JG5A 3U0TA 5F6HJ 3OAUL 1ERNA 4R7NA 3G3LA 3IVKA 4NJ9L 3CVHB 4RRPM 1AZVA 4JGMA 1WFJA 4LCVA 5I66A 2LLLA 3N1QC 3HR5B 3QZOA 5CZVH 1Q0XL 4UAOC 2AMUA 3QXUA 4JPVL 2DMHA 1QKZH 1YO4A 1J86A 4FXKC 1DBAL 1A6ZB 1INDL 1RUAL 5FFGA 2WP3O 4H88L 2N1TE 5BXFA 4M1CD 4YL9A 4DQOH 5D2LF 4IJ3B 3TNMB 3A67H 3OC5A 2XTJE 4WQOA 3UGEA 1JZ5A 3HHSB 3IDMB 3JWNG 4DKFH 1INEH 3VE0A 1G1YA 2WTPA 2P5WD 3MGAA 3EOBB 5AVXB 1E4XI 3GIZH 5I73B 4QDGA 4RLDA 5EG6C 1ZJBA 3UAFA 3VQMA 1QYGH 2G9KA 3GWJA 5DQDH 1FBIL 2X2IA 3CHXA 1G9ML 4WUKH 2HVBA 3KR3H 2DL2A 1A6AA 4UDUB 4RAUA 2Z31B 5AKTA 3T2OA 2F1EA 3RIKA 1OGAD 2N7AA 4U3SB 1G7IB 1JGLH 5E99L 3IGLA 1B0GB 2KLSA 3VRJA 5I15L 5C8JB 3CVHL 2R15A 1AC0A 4HUKB 4BDVB 1QI4A 1JWUB 2AAAA 4U6YB 4AQ1B 1X5IA 4LPTA 2YC1B 3RZCA 3W5NA 4HD9A 3OKMA 2AS5M 4FJ6A 1OSEA 4WWOA 1JG9A 3I6SA 2Y5TB 1AJ7L 1NC4B 4NRZB 5EU4A 1ITCA 4L2LA 3IKCA 2QGDA 3LYRA 5DEFB 3DIFB 3T04D 3CFKA 3IDGB 1VGKB 4IGBC 4AZUA 5EEVA 5DJ2B 2CO7B 4MASA 4Z3EA 5F1OB 4K71C 4YDZA 3S37H 4I18B 1MG3C 4FG6C 4FMFA 1A7QL 1B9ZA 2IAAC 1FPTH 5ERWB 2PR9A 4OLYL 2Q76B 1H8LA 4ZW7A 3VWKD 1R6VA 2BCKA 1TEYA 3RA7L 2PPCA 1ZLWH 1KJ2H 1OW0A 1IT9L 5JW4Q 4BSWB 3WAJA 2X0VA 1JGDB 1I9RL 1J9QA 4HJ0C 3P0YH 4JM2F 4LP4A 4AQZA 3VG9C 4K3JH 2HJLA 4ONGL 5KJ7E 4DKTA 3F58H 4NCDA 1FZJA 1GZPB 2WTRB 3VXNA 5KJRL 2J6EL 4U6VH 5D2LA 5MERA 4XMXA 1EEYB 2YIHA 3BUYB 1A0QL 4WEUD 3CZUB 5JW5A 4G1EA 5DJXA 2ZSWA 4GSRA 4RZCA 1PS3A 2I25N 3MRBB 2I60H 4UDTA 2LW3A 1BAGA 3QUYA 3FMGH 1MHCA 4I87A 1KZQA 2ROYA 3DK0A 2EC8A 3RBGA 1HSBA 1NDGB 3HE7C 1H0DA 4FGMA 3BLPX 2UWEE 5DFVD 1WAAF 4XC1L 6CGTA 5D7JD 2J8UB 2FIKA 1V10A 3B2UD 3LEVH 5EUOE 5HGDB 1BZ8A 4RBPH 3WCYA 4PP1D 4KZ0A 4ZAKD 1NGPL 2Z8VC 3IJEA 2YPKB 5DEGB 1T89C 4PJ8C 4RWHA 1G4RA 4KTYA 3UTTB 3MNVA 4E9QA 4NZTH 5LGHH 1GYVA 2DF3A 1A6TB 2XT1B 3FHQA 3S3SA 3UBGA 3P3RA 3CXDH 4AI7A 3RWFA 3HRZC 4N8UA 1IC5L 5K9OB 3DBSA 4HK3N 4A37A 4AGPA 2AAVA 3B1UA 5I1IL 1GVIA 1AIZA 3KYKL 1U58A 2DWYA 2XKUA 4DW2L 5BW7A 4IHOA 3K6SB 3VD9A 2CO4A 2APBA 4JFYB 5SWSB 5CXPA 5KVFH 1WD8A 2FTAA 5CGMA 3ML9A 1OAUH 3VFGL 1AQMA 4J3VA 3B4NA 4FJYA 3OKKB 4KRNA 4UWQB 5I1JH 2BMKB 3PU7A 3TIDB 2YEZB 1BM3L 1YA5A 2Y1AA 4DP9X 5FPIA 5DLMH 2YPLB 3QRFM 4MS6A 1X5FA 1KACB 4WWKC 1H8OA 1QFWI 3BD5A 5IHLB 4MA1C 3NFPA 4AV4A 5BUPA 2IDQA 1KGYE 1Z3GL 1JK9A 4BA0A 3BVUA 2VO5A 2J25A 1KV7A 4GAGL 1N8ZB 4HZAA 3KH3A 4F9LC 2P5WA 5IR1B 4KJYA 4GUCA 4XE0A 2D7OA 4Y2LA 5MENE 3KLAB 5I82A 1H9DA 5HI4D 1U8HA 4PG2A 4R0LC 1A2YA 3IGFA 4K7PY 1R5VB 3PFUA 1NDMA 4GO9A 3WMQA 2HFGL 1SUHA 2BSCA 3UTSA 5JORB 1G6RA 2I24N 4HPOH 4ZPVA 1HHHB 1OGAA 1IBBA 3AUVA 3QYCA 4EI6A 1M2OA 4JM4L 4TXVB 4AE1A 1EHLH 4B3EA 1WAAA 1EXUA 2ED6A 4GYBA 3TO4B 3D05A 5D7LD 2WBKA 4Y0GA 1AP2B 4BV1A 5C92A 1KTDA 3N5AA 4D2NA 5IMLA 4R96B 4BHUA 4K9EH 4DOHB 5I1CL 1U8KB 1AFVH 2MCPL 1L9RA 5AVVB 4M9OA 2VDKH 3E8VA 2R29H 1K8IB 1TQCC 2NW2B 2PYEE 1JF5A 3K7UA 2W91A 3LKNB 4GG6A 3CFDB 4OIBA 2OL3B 1ASPA 3EOTL 5HJ3A 2RTTA 3ARZA 3DYOA 5D7IB 4EUPH 3NCYS 2EDNA 5FS5A 3ULVE 4YBQC 2YAFA 1OKEA 3QK0A 4YQXL 2IH1B 2BIOA 5AL0A 3SE9H 3TBTA 5DRXA 3KPNB 3FF7A 3P4LA 1BQHB 3WUWG 5DJAB 2XYCA 5EF2A 2O1AA 3VWKA 5IIEA 1I1AB 1A6PA 5F93C 4JR9H 3G6JB 1IX2A 5GGUA 2E86A 2NY3B 2BP8B 5J13C 1WGOA 2OXHA 2COVD 4HSQA 1XBDA 2LGNA 3LV3B 3BPCB 3L5HA 4M3JA 4X42A 2BWIA 3ZT5A 1MFAL 4AG4L 2VRAA 3SDCB 1UXSB 4U1LB 2ZWLT 4HS8H 2JXMA 4X7TA 4PPTA 1UH4A 4KPHH 3CSGA 1KV3A 3TBWA 1KCKA 3I9IA 4L8SC 5KN5B 2H8PA 1D2OA 1ZIBA 2Q6WA 1BD2B 3U2SA 4Y2DD 2P5PA 2YGVA 4UT6L 1NCIA 4X6FB 4XVSH 4AJWA 3SYAA 2OL3L 1Y1DA 2UXGA 1MFMA 5D7JA 3F5WA 1IFHL 2AK1L 5L2KB 4BFIB 2CMRH 5HYIA 1FE8H 1S7QB 4L4TD 4PRPA 4TQ8A 1F5WA 4JY5L 4OFYD 4ZAKA 1NGZB 1YNKL 4ODVH 5CGTA 2ZNWA 1DVSA 4AKOA 3O81A 2F61A 2XZAH 3U0WL 1NBVH 1RULH 3TFBA 2XWTA 4KKQA 4NQSA 5FGCE 5ID0B 5D1XC 4HKBB 5CAYB 2AXFA 3MLVL 4MAYD 1TITA 2UVFA 2ESVB 5IFHH 5EA0H 4ONHA 3GO1H 5DD5H 3VFPB 1IMHC 5DJDB 4I4WB 3VXMD 3LSOA 1F00I 5D2NB 3VFSB 4FTVD 1T0MB 2NSXA 1ZGLB 5J3HD 5D70H 1NFAA 4ZI8A 1CXIA 2QFPA 1C08A 5HDOA 4MZ2A 1NFDE 3AQXA 2OMUB 5ANMA 2Y0SA 3RWDB 1I8IA 3KL3A 2FB4H 3MNWA 1X6LA 4OZGA 3PL6D 2I9TB 1FNEA 2KDYA 1XF2A 3HAEA 3FOLA 4MMZA 4KRPD 1J1OL 1GTFA 4KKZA 3L81A 3FKUS 3SQOL 5IHHA 3W38A 4GIPD 4MNGB 1BECA 3Q6FA 4ENZA 1UWGH 2AEQL 5J12B 3HRPA 4J7RA 1LVEA 2EIBA 5AKSA 3I6KB 4DF9A 4GKSA 3C75A 3HG3A 4N2FA 4AH2A 3FDWA 3WFEL 4JM0A 1ZT4B 1QHOA 2Z8RA 2X1XR 5DO2D 4KY1H 3OKYA 3MBXL 1AH1A 2FWLB 4NO5A 1SOQA 2EKJA 1IM9B 2X4QB 3IXAA 3K8KA 2X9WA 4YHYC 3MI6A 3CFJA 3S36X 5CEZH 5IQNA 5DI8A 1OAKH 1T83C 2WUCL 3BI9X 4Y16C 5K39B 1JMXA 3NABL 5GRYA 2DMCA 5KVGL 3IMSA 3DDGA 3RGBA 4E9WA 5D7LA 1QBLH 2RIKA 4JPIB 4ZTOH 5FYLL 5ETUB 1NPNA 5ALBL 4JFXA 3ZRSA 2FEJA 2IG2H 3MRIA 4FI8A 3MREB 4HZLA 3BFWA 3F64A 4Q9CA 2BK8A 2GK2A 4KUZH 4ANXA 3NJFA 3N04A 4M1GL 3QRBA 4P04A 4XVOA 2O61A 1BX2A 3GMQB 3W11D 5AWNH 3CU7A 3NJXA 2C4XA 4IKNA 1DZ0A 2BERA 3LN9A 3S4SB 2Z92A 3L3OB 5IEHB 2UWEF 3ZYIA 2FK9A 3QAZB 3UG4A 4L8DB 2PO6D 5JW3H 2JLLA 1CLOL 5A2CA 3DX8B 1MCSA 3QI9C 2ZIDA 5EUOF 1CICD 12E8L 4BZ2L 3MRPB 3QJVB 1IAMA 4D0DA 3B7UX 1MY5A 2EXSA 5A2BA 1LEGB 4LARH 4MQTB 1CL7L 1VA9A 1LO2L 4K55A 4HXBL 2A4CA 2EEXA 1SYSA 2PNDA 3H42H 3O6LL 3FUDA 4ZS6C 5BV7C 4JO4H 1CZ8H 1WFOA 3AMKA 2JJTA 1I8UA 4WI6A 1KLUB 4U1IB 3AG2B 1FC2D 3BISA 2PYED 2OMYA 2HRHA 3K6FA 2WLNA 3A6BL 1DFBH 4WW2F 4O4YL 4YK4B 2HH0L 4QF1B 2D03L 3HBGA 3HMWL 3M7OA 3QPKA 4P23A 4Y2DA 5HYJE 3ULVD 1N18A 2H6PA 1GYCA 4FULA 4ABVA 4L9LC 5DMGD 4QXVA 3SPVB 2FZ3B 1M3JA 4WWID 4Z7UE 2YEQA 3KG5A 1CLYH 1QI5A 3JSSA 3VD4A 5IB4B 3VNZA 1R0AH 4L4TA 4WU7B 4AEIH 1I1CA 2ITFA 1MCHA 4IIQC 2JKTM 4OFYA 1ZLVK 5L6YH 3O2WH 3LRHA 4LLUA 1BEYL 2VLKB 1JVOA 4XN4A 2XPGB 4GQRA 3ZHLA 2CDFB 5JIHA 5LHDA 1UHVA 3GSXB 1P5UC 5CFAA 1YEHH 1K5NB 1A7BA 1MZYA 4LDEB 4G8IB 1JV5B 4BZ1A 1F4XH 3GMLA 3HG0A 4FTVA 4O00A 4B60A 1GGCL 3F12B 4CSTA 2IALB 2ARWA 3V6OE 1XB3A 1INQA 1DEEB 1XH3A 1ZTXL 2GHZA 3OWEA 1WUZA 3KLSA 4LSSH 5C0JA 2XZCH 5T5NF 4FXLA 3X1GA 1S3RA 4F7CB 1GJUA 3FO0L 1RZKL 1ZMYA 3MR9B 2UWEA 2V2WB 1NM4A 1WITA 3REVB 1CGUA 5GS2H 3TTSA 3C5JA 4PRDB 5KBDA 1YLBB 1T20A 3ZDYB 1KPUA 3AXLA 3MX0B 3CDZB 4NKOB 3U9UA 2XWCA 4K23H 4H4NA 2XN2A 4U1GC 4S2SA 5D5MB 3L95A 1Q1JH 4EVNA 2P45B 3BE1H 3EH2A 3VVWA 1KG0B 2LE9A 2WQRA 1PDKB 1QBAA 4HUCA 1XTMA 3ULVF 3C8KB 1O7DE 2M1KA 4FNQA 2UVEA 2WWMC 5C0FB 4XMLL 3LS5H 4NUPA 1IBHA 3PWPD 4JRLA 3O45B 2KT6A 2WTOA 3KPMB 1G7QA 3OKNA 3QDMD 1HVXA 2DLFL 1PG7L 1S5HB 4HIEA 2CHDA 5PCYA 1RZGB 2ZAIA 4DVRH 2O4EA 1CVRA 1EMTL 4IKKA 1FCGA 1F4WH 1FGNL 2FJGB 3TV3L 3GZOA 5BMFL 3WJJC 2R2BA 5A43C 1V7ML 1P4LA 1QASA 2XCMC 4TUOA 3RWEA 1HQ4A 1QVOA 1UJ3C 3ROLA 2C9RA 2BY0A 1EBPA 4OLZH 4QJ4B 3SD2A 2OMVA 5GS0C 3IAPA 3NAAH 2NR6C 2D2CC 3H8NA 4QTHB 2HT4C 3NMEA 4PGCA 4TNVK 4QHMA 3FT3A 1ADQL 2VDLB 4X9FA 5IHBA 3FN3A 2FLBT 1JBJA 5F3BA 1FZOB 5SWZB 5EU5A 5BPPA 2BNUA 2GT9A 3TWCL 5IW6A 2AJVL 1GGBL 3VSUA 5MENA 3EYOA 4JCWA 4E2OA 3ZE0F 4NERA 1EO8L 3KS0H 2PO6A 4NQEE 4FQCH 4OV5A 5IVZA 1T5XB 3QUZB 3C09B 3ME0A 2GAZA 1CICA 1RK0B 3HLAB 3BWAB 2XOTA 2ZXDA 3KPRE 3PJNA 4K8RL 2R0WH 3UDWA 4LHUB 1F02I 5FW6A 1A8ZA 4KKPA 4JFEB 3B9EA 1JZJA 3RPBA 4XNZC 3TS8A 4OZFB 1G9EA 1NAMB 4PMFA 5FDWA 4YPGA 3Q44A 2ZKHH 2YAEA 4OFVA 5L4MA 2DEWX 3I2CH 4L0PB 4MLSA 4G2AA 5LNGA 3JVGA 2YSSA 2YUZA 2PYEA 1HWHB 1JS4A 4N0FB 4Z7WB 1P1ZA 1ORQB 2F18A 3HZMB 2B15A 3EO0A 5TF1L 3B2DC 3OMIB 2VDLL 4A7VA 3ZMEA 1NFDF 1G6RH 6FABH 1NJ9A 5FHAL 4P4KA 1MXGA 5CN1A 1T2XA 3WNNA 3NFSL 5E8NB 2G3XA 3NGBB 2QKIB 3RL2A 3BAWA 3GSQB 4PRBA 2RQ8A 3DO3A 4JKNA 3SZKC 2AEWA 3FQTA 1YN6B 5FM5O 4FFWC 2DOCA 4KKCC 5AOJA 5BVJB 2LU3A 3B2MA 5SX5H 1PQZA 1YMHA 5IBTL 3NZ8A 1UASA 5CJQL 4PTTA 5LCVA 4PJ7B 4DP4X 5DQ9A 5GRJH 3B2VH 3A21A 2JKIS 3DX0A 1FL6A 4DK6A 3H9HA 5CZKA 2VT0A 4J27A 3AQZA 3EOAB 4B41A 2VOTA 5KSBB 4P8QA 5KYXA 3MRLB 1KYAA 1RXLA 3STLA 4N8CL 1U8NA 3DX7B 4TQHA 3WEOA 3VSVA 1WZLA 5IOPB 2MNUA 4QAMB 5GGSB 3TPUB 4LL4A 5B38A 5HYJD 4ERSH 4K3EL 4JNXA 2CM5A 5IJCC 5ISZD 4MCZA 1A9VA 1IGMH 1L5GA 1K5WA 2EDMA 2XWBB 3BIBX 4G6MH 3HUJE 1S2EA 2VN6A 4QRPE 2YK1L 3P69A 15C8H 5CSGA 4OVVA 4F7TB 4W9ZA 3CLEH 3LDBC 3CVDA 3S36L 4P5TB 4BFBD 1Q72H 2LU7A 2O6EA 4PIBA 1WTGT 4JL2A 1X5HA 5I6MA 2VQUA 2MQCA 3PP4L 4WRLA 2KL6A 4PJ9B 4NIKB 3GLEA 2B1HL 2W88A 4R3SA 3VXOA 5DD1L 3SE4A 5D1ZC 2IWGA 3SDAB 2IGFL 3PV6A 2OSXA 2PWGA 5BZXA 2OJZL 2MOQA 1RZ7L 1SOKA 1I31A 3FTWA 3R7RA 3HKZA 4KJWD 5C6WH 3MDJA 4UM8B 3TEXA 4DZBB 4U6XA 3DUUB 1FHGA 2OMWB 3QJQB 5A2LH 1X5JA 2ZE0A 3OVUB 1NFDA 2VJ8A 4HWEL 4XR8C 1Q94A 3MLSH 4J3XA 4PJFB 2Y4SA 2V7HA 4X8JA 1MJ8H 3AT9A 1PSKL 3M1BA 5KVEH 5ITFA 3SDDC 5LKNA 2HMID 4AJVA 1AR2A 2J8HA 3ESOA 5JXAL 2IGTA 4GH7B 5HVHC 4UT7L 3QWQB 1JGEA 3AJ7A 1J0JA 5ENWB 1QZNA 2FUQA 2DMKA 2DLEA 4WTZA 3KMDA 2DKUA 4YHLL 3BP4A 1U3HD 1NOFA 2QSCH 3OMNB 3QUKA 5DA4A 4FC3E 4KHTH 1IGFH 3F8UB 2AJ3A 3KGSA 1DN0A 3S88L 3JV5A 3MA9H 4MX7B 3RB5A 4H8WC 3WFBH 5SWQB 1T1ZA 4OF3A 1EZSA 5TD4A 3WBDA 4Q9QL 3AITA 3UP1A 1E9PB 4ZTEA 1KJ3L 3GMRA 1OP5K 2PTTA 1T6WA 3L5JA 3HAEH 4Z7UF 3QJTB 3C6SA 2ZUQC 4FLOA 1ZV2A 2ZYRA 5GGRY 5B7FA 1Q0EA 3CXFA 3RBSA 4LPCA 1DANT 4HH9A 3AADB 4XH2B 5GS1C 2Z91B 9CGTA 2XV0A 1OTSD 1KJMB 4FQHB 5T5FA 1A9EA 4HS6A 1BBJA 5FUOH 4HG4K 3J2PA 3PJSB 3KPLA 4TUJA 4NOBA 3UO8B 3IDIB 3VFMB 1T2JA 2DM4A 1CU4H 4OZIE 1JVKA 1C5DB 2D7QA 2J5LC 5CCJA 2EXWC 3P30H 2BSBA 2DIJA 1CK0L 4NQXB 5DURD 3QEUA 4WI5A 3O41A 5AB2A 1Q9LA 4RFNB 3ARDC 1RIHH 3WIHA 3EHBD 4X9YA 2RHEA 1B2WL 1OCZB 4YL4A 3KPOA 5ACMA 1WC7B 5JIKA 3MRGB 4NQED 1MFVA 2Z1PA 2ZXQA 4L3FA 4QRTB 4QKTA 5HHXH 2V2TA 1JZIA 4JPWL 4LLMA 3KPRD 3L8QA 2ZOLB 5DMKB 4HS3A 3MRJB 1HIML 4HUMB 3QVAA 3DPBB 2IBZX 3I6LD 5M94B 3T6ZA 3MV9E 2ORBL 2JK5B 2J2ZA 1RHFA 2AXHA 4NBZB 5E4EB 1QRNB 4MQXC 1U3YA 1JZFA 3L5XL 3KL5A 3MLWH 4OJFL 4XP1H 3Q0HA 3ULUL 3NSJA 4LRNH 4EKXA 3NCJL 5EBGA 1FQ9C 5GISH 1J87A 4EI5C 1RUMH 3NIDE 5I17B 1G5GA 4HMDA 4YZWA 3LH2L 5ITBH 3GUTB 4Q2ZB 3RVWC 5T3XE 4NNXA 4MD0B 2QQLL 2VITA 4UBDC 2AF2A 3AS3A 4MQSB 5B39A 2YFOA 3E6FB 5HPMA 5HYJA 1URZA 4ZDHA 5C0GB 4GW1A 5ISZA 1I9IL 1CFQA 3KHQA 5J11B 4KXBA 3UZVB 2HFFA 3QH3A 2K70A 4TVPL 4Z7UA 1BPVA 3LB6C 4E41B 3TA3C 5M7QA 3C5ZC 3BVNA 3FFCB 4M7LL 5I8KH 5JUEH 1FRGH 2JCCE 2IAMB 4G3YH 4LRIA 2AKRB 1GGUA 2F7RA 4NENB 4HUWA 3TLRA 3CVIL 3FQRA 4OGQC 5A16A 4Y7MA 3P4MA 4NDMA 2XN9B 4NBYB 3CFCL 1CYWA 4CMMA 2X70A 2YS4A 5CSZB 5AW8B 1KT2A 3N43F 2E6JA 5ESVA 2YJQA 1MHPH 2WLHA 1MCBA 5KG9A 3SJVE 3OKLA 1WP6A 1Z5LA 3QZNA 5DHVA 4J4PC 1IKFL 4I3GA 1NCOA 1SOSA 2C4FU 1OGTB 3P4OB 1F4HA 1NOAA 3CQFA 1FYTD 4LDOB 2C5DC 1CJYA 4OIIH 2IDCA 3QDJB 1FH5H 4UM9B 5I6XB 3TM6A 4XCCL 4OUUB 4G6JH 3H7LA 4YDVA 3MJ8B 2D9QB 3D18A 2VW6A 5C9KA 2XFGB 4JE4B 4XRCA 4BZ1H 4EJ1C 2FEEI 3Q9QA 2AGJH 2BRRL 4WHCA 3D39D 1HXMB 3ARBB 5C0NC 5F7DB 4UQ3A 2Z9TA 4KROD 1TR7A 3N41B 1UWEH 4MCYB 1W72B 2KKQA 4R26L 1SN0A 2R27A 2GC4C 4GXVL 3BVVA 1E27A 2NY5L 3T2NL 5CWSA 1JCVA 1NL0H 3S5LB 3ZL1A 1URIA 2FX9H 2K78A 4LCYB 3M8OH 1JD7A 1MKFA 4JY4B 1OGSA 2A1WH 4A7TA 2R69A 3QC6X 2X4OA 2GY7B 3K2IA 2V5MA 3FZUD 3ECBA 3EO1B 2EKSB 4FKEA 1SHSA 1A1OA 1LO0L 1XGUB 4DVBB 3GXUB 4Y4KC 4ZFGL 5E5LA 1TVBA 4UQAA 2HJKA 1Q4NX 3RP1A 2RQEA 3PIQA 3S37L 4QPEA 4JKWA 1NSNL 1TSHA 2YD9A 5H94A 2H4EA 4CNIB 4XBEL 3OXSB 1SBSL 3NSYA 1IRAY 2DQMA 4RMTA 5I8EB 5DD3H 1I8KA 4M1DH 3U46A 4HJEA 3U0PB 2DBJA 2AEIT 3RTQA 5MHSD 3JZ7A 4PJAF 5CJOL 4NQEA 2V17L 3X17A 5DJ0B 1ND0A 5KYYA 3TT1L 1W72L 2KHAA 1XGRA 3KPRA 1A6WL 1DJXA 3HZYA 4U6VL 4L0ZA 3IJHB 2AI0L 1G94A 4LKXA 4X83A 2B3IA 2EEBA 3EFOB 4DFIA 3LKOA 3SBWC 1CGVA 3GDCA 3QIBC 4UILH 2XBZA 4MCMA 5K1VA 2BVPA 2DM7A 3NUKA 4