2CAKA

1.27angstrom structure of rusticyanin from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
ALDTTWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHGKKNPTLDIPGGATVDVTFINTNKGFGHSFDITQKVPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Atomic Resolution Crystal Structures, Exafs, and Quantum Chemical Studies of Rusticyanin and its Two Mutants Provide Insight Into its Unusual Properties.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2cakA00
4AKPA 3NJIA 3H4HA 3MBWB 2VSMB 3PAZA 1XMEB 4UAHA 3WNIA 4YSCA 1R1CA 4KOCA 5I6OA 1BYPA 1X9RA 5B7EA 2IAAC 2UXFA 2HX9A 3U25A 1OE3A 5I5IA 2BW5A 4BXSV 4G70B 2AZUA 1BYOA 2IDUA 6PCYA 1SHWA 5E9NA 3L45A 4L0PB 2OCCB 4HALA 1ET7A 3CVBA 3FQYA 4BDVB 4F2FA 2DY2A 1DYZA 1I53A 1SDDA 1WS7A 2J56A 2CAKA 3ABGA 3QJVB 1MG2C 3WKPA 1HAUA 1ZV2A 2YQBA 3CDZB 3H4FA 1E67A 1OF0A 1SNRA 5PCYA 2A3TA 1NTDA 1CYWA 1KDJA 4GP4B 1KBWA 5B1BB 4HHWA 3IN0A 3V9CA 1QLEB 1KV7A 1ZDQA 2UXTA 1SF5A 2BWDA 4X4KA 2DYSB 1J9TA 3AG4B 2IH9A 5D4HA 2VMJA 4HCIA 1AIZA 3SQRA 4PCYA 1ID2A 4P5RA 4AX3A 1AZBA 4YSQA 3S8GB 4DP4X 4E9TA 3EH4B 2PPFA 2LLNA 5PAZA 3X1EA 3WKQA 1SDDB 2P80D 1NWOA 5F7BA 2WSDA 1FA4A 1MDAA 3AG1B 2QDWA 7PCYA 4NERA 3NSYA 1L9RA 1RCYA 4YSUA 1PZBA 2EINB 1JXFA 1NZRA 3ZX1A 2BP0B 3G5WA 3KW8A 3GYRA 2QPEB 2AVFA 1M57B 2CALA 2AFNA 2HRGA 5D4IA 1SF3A 1AAJA 4ZK8A 3T6XA 1TEGA 2Y1AA 1JOIA 4HHGA 3H56A 2TSBA 2XXFA 1WS8A 3CVDA 3TBCA 1PZAA 2YAOA 3AY2A 3NJKA 2PP9A 2IDFA 2QT6A 4JKNA 4JHUA 3BQVA 3S3DB 3N2JA 1A4CA 3WI9A 4E9WA 8PAZA 3X1BA 3QJTB 3PXLA 2BHFA 4YSAA 2XV3A 4E9RA 2UX7A 1PMYA 2AZAA 1GS8A 1OCOB 3FSZA 4GY4A 4F2EA 1ETJA 1IC0A 4YSRA 2GBAA 5B1AB 1OE1A 4NAJA 1T5KA 2PP8A 3BVDB 4Q8BA 4QKTA 2Y69B 5D4JA 2P80A 3IEAA 2JKWA 1AZNA 5A7EA 1XB3A 4A2DA 1CYXA 2XUWA 3UADA 1PY0A 4JHVA 3ASNB 2ZWNA 2VW4A 2PLTA 2GI0A 3EH5B 1J9QA 4HCGA 2PPCA 4BWWA 1AQ8A 1OE2A 2W8CA 2XXGA 3SBPA 4G72B 3X2QB 1YLBB 5I6KA 2HX7A 2Q9OA 1BXUA 3ZDWA 5B3SB 1EZLA 3QPKA 1L9TA 1MZYA 3T6WA 1TKWA 4QLWA 4EF3A 2VSKB 4DP2X 1V54B 3FT0A 4F7KA 3HB3B 1GW0A 4M4RB 4DPBX 1GR7A 2FQFA 3CZUB 2EILB 2EIMB 1BXAA 1EHKB 4A2HA 1BQ5A 1KGYE 1JVOA 4GP5B 1JVLA 2EIJB 4WKXA 5I5MA 2XLLA 2UXVA 2BW4A 4BXVA 2ZOOA 3AW5A 4CSPA 4G7QB 3IN2A 2GB2A 1WAEA 3NJMA 1NWPA 1AG6A 1L9SA 2BZ7A 1SFDA 1N70A 1ASPA 4E9QA 2I85A 2FQDA 3N55A 2FTAA 2VW6A 1OOWA 5TK2A 1IUZA 2JFCA 2XV2A 1GS7A 3MX0B 1JZJA 5LDUA 4DP7X 4N4YB 3JTBA 4E9YA 2IWFA 1GY2A 3OMNB 2XWZA 3FSVA 3FS9A 4KOBA 4FAAB 1AS6A 1PLCA 3DKHA 4HZ1A 3QJRB 2B08A 1VLXA 2R7EA 2PCYA 3EF4A 1IBYA 5ANHA 2DWTA 3NJLA 4HAKA 1PF3A 1OCZB 1J5DA 2HX8A 2J55A 4KO9A 5AKRA 5EHFA 6PAZA 3ABLB 1FFTB 1BQRA 3T9WA 3NSCA 5B1KA 2NRDA 2B3IA 2XU9A 1WA2X 3NJNA 1NIFA 4HIPA 2WO2B 1SHXA 1B3IA 4YSSA 3EHBB 3ZBMA 2BZCA 2CJ3A 1BAWA 3S3BB 2J57A 4YSPA 2H47C 2IDQA 1ZPUA 1A3ZA 2YXWA 3NP4A 1KCWA 1OV8A 1PLBA 2MRYA 4YVUA 2VM3A 1AACA 2I7SA 4K9JA 1GY1A 2FT8A 2R7EB 2UX6A 5TK4A 1CC3A 1JZEA 1TU2A 1URIA 1JXDA 1CURA 4A2GA 4W1TA 2HRHA 5I6LA 5AZUA 2XV0A 3S8FB 4BWTA 1NIAA 4UANA 2BO0A 3FYIB 1NICA 2BP8A 3QJQB 2UXGA 2PCFA 4DP5X 4AKQA 1JZIA 1PZCA 3NJFA 2W88A 4YSEA 1BXVA 2HXAA 2QPDB 3TA4D 2TSAA 2X88A 1ADWA 1ILSA 3CG8A 1L9QA 5F7AA 1PLAA 1HAWA 2VN3A 4FA7B 2EIKB 2H3XC 2WO3B 4KO7A 1F56A 2FT6A 4E9SA 3AG2B 1E30A 1FWXA 2CCWA 2YAPA 4AZUA 1PNCA 1A65A 2YAFA 1AS7A 3EH3B 4MFHA 1IBZA 2FQEA 4GYBA 3TBBA 1JZGA 3OQRA 3T6VA 3AG3B 4A2FA 4KNTA 3TASA 4DPCX 2FQGA 1KDIA 4UF7C 4A2EA 2YAHA 3FU8A 4E9VA 1CUOA 2YAQA 2ZXWB 5I28A 1AR1B 3HEIB 4Q89A 3SBRA 4DPAX 3QQXA 4KO6A 1GYCA 2GC7C 1PNDA 3WG7B 1DZ0A 2GSMB 5I6NA 3PCYA 2BWIA 2BP8B 1J9RA 2RACA 2XX1A 1WA0X 2AANA 1GSKA 2YAMA 1JXGA 2PPEA 3AZUA 3PPSA 1E5YA 2HZHA 4N8UA 1KBVA 1AZRA 4YVNA 1AS8A 3NYKA 3T6ZA 3ZIYA 7PAZA 2Q5BA 4P5SA 1ILUA 1NIEA 2OV0A 1UATA 1N68A 4DP6X 4W9ZA 3FU9A 3X1GA 3OMIB 4ENZA 3ASOB 2VW7A 3UABA 9PCYA 2J5WA 1BQKA 2FNWA 1ZDSA 2E86A 2CBPA 1IKOP 1ET5A 5B7MA 1MZZA 3PAUA 4DP8X 3CVCA 4M3HA 2IDTA 3TU6A 3FPYA 1W6WA 1AOZA 1X9UA 1NIDA 1E5ZA 2X87A 4G71B 2IWKA 5FC9A 3FSWA 1A8ZA 1RZPA 5I5JA 3PAVA 2IDSA 2BP0A 2DYRB 1M9WA 1ASOA 4NB7A 1V10A 4KNSA 1W8EA 1QNIA 1ZIAA 2GIMA 3FU7A 3GDCA 3X1FA 4AKOA 5IY5B 1SFHA 1XB6A 4YSTA 2PP7A 4DP0X 2IWEA 1AZUA 2N0MA 3ABMB 3S3CB 3DTUB 1GS6X 2H5UA 1XB8A 2HLEB 1PCSA 1KYAA 1JERA 4YL4A 2YXVA 4A68A 3NJJA 1NDTA 4WTQA 3UAAA 3IE9A 3JT2A 1ZIBA 4A66A 1BEXA 3UGEA 3IBOA 3NSFA 2XX0A 1NINA 1NIBA 3ABKB 3ERXA 2GC4C 3FQ2A 3D12B 5I6PA 1QHQA 2CUAA 3OM3B 4YSOA 3NJGA 3UACA 3NP3A 1AANA 2JXMA 2QDVA 3FU7B 4PAZA 5B1JA 4AI7A 5B1JC 5I6MA 1J5CA 3FPXA 1PAZA 1AG0A 1L9PA 1HFUA 1SJMA 4G7RB 2XYBA 1OCRB 3FQ1A 2DWSA 1L9OA 2DV6A 3GXUB 1M56B 1JZHA 3NSDA 4GP8B 2YARA 2I7OA 2PPDA 2MTAA 1V55B 4A67A 4E9XA 3QJSB 2GHZA 2VM4A 4TXVB 2XVBA 3WIAA 1RKRA 4G7SB 4BWUA 3PLYA 2PPAA 1TEFA 1JZFA 4KNUA 1ET8A 1KCBA 3NJHA 3X1NA 3QJUB 1A4BA 3T71A 3OD3A 2IH8A 3KW7A 3OMAB 2YAEA 1NPNA 3FYEB 1W6LA 4HCFA 1RZQA 1MG3C 3UAEA 3RYMA 3WNJA 2ZONA 3NT0A 1AZCA 4KO5A 4BDVA 3FSAA 4CSZA 3C75A 2FWLB 5I26A 1ASQA 1WA1X 2OJ1A 1J9SA 3V9EA 4DP1X 4RH4A 1NPJA 2FJSA 1E65A 3SBQA 4YSDA 4DP9X 5B7FA 2FT7A 4GXFA 1OCCB 3DIVA 3CDZA 5AFAA 1A4AA 4BK5C
chains in the Genus database with same CATH superfamily
2QMJA 4XN1A 3MUJA 5I76A 2YPVL 4MASA 1D5BA 5JNYA 3ZQ9A 3H4HA 3SDDC 2FWOB 3NZUA 3KYOA 5C09A 2VLJD 5CJOH 4QJ4B 3ZDXE 5E9AA 4BKSC 1HEHC 3UBFA 5D7IA 5IQOA 4M5YH 1ETB1 4KTEH 4QYOA 3OQ3B 3SDCD 4XXWC 3ESUF 3FQUA 5D2NC 4BV1A 4ZQTA 5E9DB 6PCYA 5ITFA 5CGTA 1RK0B 3CMOH 2OCCB 4FG6D 3GGWB 4L0PB 3F04A 5E6IA 5J57B 2A38A 2BNRA 2AV7A 4X7DC 4BH7B 1C16A 1SVCP 1MCQA 3PV7A 5J06A 1AQKH 1HXYA 3JV6B 5J12C 1F4AA 5CCHE 3PWPE 4ONOA 1BZ9B 3QEQB 5C9KA 1CGYA 5A6LA 2A3TA 4JAMA 4WTZA 1X44A 1W72H 2FR4B 4R3SA 4NC1E 3X3GH 1X6NA 4M8VA 4Y19D 1I1AC 1SHSA 3SPIA 4KX7A 1SF5A 4GOSA 5I1AA 5I75B 1DQLL 2R9HD 1EAOA 1MI5A 1MSPA 1ZPLA 4LLDA 1NJ9B 7CGTA 4PGCB 1JL8A 1ZT4B 4IK7A 4PV9B 4NZTL 5LGJB 1E6JL 1I1CA 4MDJA 1RJCA 1U8HA 1Y6NR 2WBJC 4JRLA 2R4SH 1JI1A 2J8UE 2WUBH 5E03A 5CILH 2GAZB 2VDQH 4U6VL 2IOMA 5ALCH 1K4CB 5EFIA 1N0LA 2YQ3A 3DROA 2CCLA 1GZQA 4LP8A 3D34A 2J21A 3K72A 3ETBF 3EJSA 5CWSB 1KLFA 3N04A 4RQQA 4NO3A 5FYJD 4PJIE 3Q0HA 3KBEA 5DC4B 2P43B 4BQBA 4LLWB 4N2OA 3NCYS 2WSPA 2IQAA 5GGQL 3T6XA 3SE8H 3HKZA 3IJEA 3AAZB 3BSZL 4PRPA 4UIMB 2ZOTA 2D7NA 4XGZA 4GSQA 5JR1L 4HSCX 3RX8A 2P3YA 4QOKE 3S34H 2ZUTA 2GTZB 3HS0A 1YNTB 5J6GB 1F4XL 3D33A 5H37H 2R0WH 3CLEH 4F7TB 4JHUA 3OAYK 3O2DH 4NENB 4Y9FA 4CUCA 5MHSE 4WFED 2H0EA 3DXAE 4XP1H 4ODSH 2IH1B 3LNIA 2AHIA 1FO0B 1PMYA 2EDDA 4PP1C 1MRCL 3DX4A 5I1IL 2WXPA 4OZGB 1P7QD 4E68A 4GIPD 3H85A 3PREA 3QXDB 4X0KB 3L4XA 1KGIA 2CUIA 1ZLWH 1HZHH 4N5EC 4MTMA 3CLWA 5IV2B 4AW4A 1GGUA 3FTVA 1MUJA 4GT0A 2ZKMX 4NKQB 1AGDA 4JM2F 1DBMH 3T2QA 3UADA 4JY5H 4NNPH 1S2EA 4FQCH 4OCNC 4I2XA 2X2UA 3EH5B 4BWWA 2IVFC 4Y5YA 1JBJA 2FX9L 2PR4H 3PP3H 4HWZB 2X4RB 4B27A 1WIPA 2Q0ZX 3T4AB 3KJ4C 3WSQL 5FKAA 1QRNA 4XNMB 2XOTA 1S7VA 1FF5A 2VSKB 4MYWB 1ORQA 3VFTB 1GW0A 4XNXH 4MZRA 1Q9LB 3UTQA 2NY6D 4BYHA 2HFFA 3KL3A 4KY1L 4WUUE 5DJAB 2WQUA 5C2BH 2W60A 4H40A 2XQBH 4MNGB 5BMFH 3T0ED 1NGZA 2DTML 3TZVA 4HEME 4OAWB 3HHRB 4TLUA 4AT6A 4FNUA 1F0LA 5DMKA 2ZOOA 4LKCB 5DD3H 4G7QB 4QRRB 4HMCA 4XVTL 5I1KH 1NGQL 5JDSA 2VDPL 1VSCA 3INOA 2CM5A 4RBPH 3MNZA 4MJIA 4PG9A 4ZO7A 5HI4C 1SFDA 2DWDB 4C56A 2OR7A 4RRPG 3RVWD 2BP5M 3V6FB 5K5YA 1NL0H 5GHWH 2VW6A 2WYHA 3CXDL 3UGUA 2WLKA 3GBNL 2FEDC 3DO7B 3FT4A 1A3QA 3IVKB 3RBSA 3VW3L 2FUQA 4TNVF 3WAKA 2A9ML 1OAKH 5F9WC 4LLAA 5LGYA 3UTSD 2V2WB 3LKQA 1BGXH 3RVTC 2D3LA 3Q5OA 1Q1PA 1GMEA 3DPBA 3AY4C 4CJ0A 3M1BA 3QK0A 4G1EA 4X6CE 5BZDA 1HKLH 3SOBH 4EBQL 1XTLA 1T5XB 3BGFC 3C6EA 2V5RA 4FJYA 3HE7C 3ZR6A 1KXQE 3L3DB 2WLZA 4F24A 2GIXA 3B83A 3VFUA 4XOBA 3SDXB 5I24A 2D31A 1KG0A 2ARJB 6PAZA 2DQDL 5B8CA 4BZ1H 1ZEAH 4J7RA 3F85A 3VXUD 4RMTA 1XT5A 5GS0L 3ARFC 2YA0A 3LKPB 1EO8H 3ORJA 4JMXA 4WWKB 1NCWL 5ENWA 3R7RA 4EDWH 4R7VA 4BUHA 4D94A 4X7FC 3WTTA 2XA8H 3IBEA 3O6FC 4ZS7L 1KTCA 3TEXA 2IGTA 3EIFA 3I6SA 3TTSA 3WJJC 1LWJA 4QJ5B 3DX7A 2MSPA 1Z3GL 3IMUA 4OIIL 4UT9A 2UWEF 1TQCB 3CU1A 3OKLB 1BD2E 3AS1A 3MBXH 4YWGL 2AQPA 1VF5C 4JFOA 2FT8A 3CC5A 1X4YA 4GLRI 4NN7B 4AE0A 3QDJD 1I8AA 2A77H 1LO4H 2IXQA 3DK0A 4NZ8A 2VDLB 1FN4A 2W9LA 1MCWW 2Z92A 4Y19A 5L88L 4XN9A 2I07A 3NA9L 1MNUH 1U91B 3EDEA 5JUEH 1WV7T 1BPVA 4XH2B 4ODXB 1OGAB 4OT1H 3HN3A 4UANA 3QUYB 1GPOH 4NQDD 2BOCB 4NUPA 3MJ6A 2RHEA 4ELMB 4B41A 2H3KA 1WDAA 4OZ4A 1BX2B 2HXAA 3U4AA 3GSXB 2GCYA 2AQ2A 3HBZA 4KTDL 4BSJA 5C86A 5EUOF 3F7YA 2VN3A 3QUML 4QYAA 1QPKA 2WO3B 4G8AC 3D7PA 5C0BE 4NNYA 2NY3C 4UUJA 4RDQF 4XBGA 2VDRB 1XWVA 4Z77B 5F1NA 5JPMC 3JTTA 3VXSB 4IU2B 3BO8B 3GKZA 5DD5L 4G3YH 1F8TH 1ZS8B 4DW2L 4KRPB 1I1YB 3JWNE 3FQTA 3REWA 2QPFA 5D7JB 1IL1B 3VD9A 3K8MA 4X80H 2WXKA 2TRHA 2YSTA 1Z9LA 2X4NA 3IDYC 1MF2H 1DZ0A 1T0MA 3KVQA 3BHBB 3MKGA 4ONFL 4Q14A 2F5BL 1VCBC 2ZNXA 4GAAA 1I8LA 5EOTA 2Q87A 1N19A 5DJ2B 4NM4H 1U4FA 1NFDE 3NIGF 1TXKA 3MLRL 2PPEA 3FCSB 3PPSA 4WFFE 4NN5B 5A7BA 1UYWL 3L95B 1OAYL 1NMCC 4YGVA 2EE6A 4FF9A 5C0EA 5LGHL 2C9QA 1OP4A 2D2CC 3CBJB 2DQUL 3UC0L 2YWZA 1F3RB 1N68A 1RK1B 5FW8A 4QXTB 4CDGC 5F9JA 1G9NL 4UM9D 3VU2A 1I9JH 4HUVB 3BN9D 3BAYA 1MJ8L 5DWUL 3V0HA 3VG9C 2C4XA 5EA0L 4C57C 2E86A 2XN9D 2AGJL 3QCUL 4CU8A 5LBSH 3ARDA 2VDOL 4M5SA 4WI8A 4YHNA 3FFCE 2JB6B 3CVCA 2SEBA 1W6WA 3MNMA 1X9UA 4LVEA 3EH1A 2ZKWA 5DRXB 3S5YA 3L9BA 3ZMRA 3MC0A 4DGUA 4QJ3B 2CBQA 4I18A 4FKKA 2WXQA 4P4KD 1H8LA 1QBBA 4WU5B 5LQBH 2G75A 4FKEA 4JRFA 4RAUB 4NB7A 4ONHB 4U1GB 3H2QA 5FM5O 3S2CA 3WN5B 3GDCA 1KB5H 2QVMA 1UA3A 2LLLA 4WV1A 4X6FB 3UTOA 2YQGA 3MDJA 1XGUA 4NUQA 4YPGA 5D7LB 15C8H 2X1QA 3RY6C 2FJHB 1U3JA 3OZ9L 4DEPB 2ZP8A 2HA1A 1QZ1A 3ZUCA 2WZ0A 5GSVA 4NKMB 3MBEA 2XWCA 4YL4A 3BX7C 4IBYA 4ELKA 3F58L 1VAHA 3MCLL 4X7SH 4L1LA 5F7UA 1W0YT 2OSWA 1IC4L 4WW1A 3H42H 3UGEA 1JGUH 4RMRA 2EE3A 3F7PC 4LSRH 4U1LB 4ZW7A 1XFPA 2HLFC 4PRAB 1YEFL 2WLMA 1AGBA 3TBVB 3ERXA 4LOUC 1FGVL 4TQHA 5EMYA 4YXHL 3UYRL 3N40P 1Z6JT 3MKKA 4JPKH 4NOFA 3WDHA 3FO2A 5I23A 2VISA 2YWYA 5FW6A 3MRMA 3SDDD 1YEDB 3GMPA 3FU7B 3DX6B 5E1GA 2BRRH 3WMPA 4PMFA 5EZJB 4NDMA 2P24B 2FLRT 2IO5A 5ICXA 2NX5B 4Y5VB 4WUKL 3PGFL 1SDYA 3CUPB 3ZE1E 2ICCA 3S6CA 1L9OA 4HGWB 2G2PA 4K71C 4M5ZH 1BREA 3HFML 4RX4D 5F8RC 2HRLA 3A3YB 3ELQA 5DJ8A 1PS3A 4E9XA 4TNGA 3DSNA 4YOKA 2XVBA 3C5ZA 1R33A 3FMGH 1JNNL 3EZ8A 1U8LA 1P7HL 4N0YH 3RUGB 2CR6A 3ZIMA 5ANMB 3V0DA 4ZOAA 2X6UA 5C0IA 1R3LA 1O6TA 3VFSA 2NXYB 3UJTH 5GRVK 2H6OA 3FO1B 4WCYL 2VRQA 3WNJA 3IDIB 2VMEA 3H3PL 2NTFB 3OJDB 4KO5A 2Y7OA 3D8MA 1YCSA 3UMTA 3HE6B 1NCAH 2F0CA 1W91A 5E7FA 4KI1A 1I1AD 3WHE0 1E65A 4MD0B 4RRPA 3AXLA 3D39A 1F6AA 4YSDA 5D5MF 3GMLB 4W9CC 5EB9A 1HE8A 5L9DH 4GT7A 2ISDA 4D8OA 2AK4D 5DD6A 4PJEB 1Z66A 5I1JH 3NCCB 1CL7H 1BP3B 4IOSD 1RURL 3NJIA 3VFNB 4HIXL 2QSCH 4TUOB 3FT3B 5D93B 5ID0B 2G5BB 4NYLA 2J5LC 3KPPB 2WBJD 1NFAA 5DT1H 4IDJH 2RALA 5C0CB 4MCZB 2MNUA 3MV8D 2VIRA 3UPAA 4GSDL 2EEFA 5KYWA 4LVHB 3W2DL 1Z0MA 1SJHB 5LXGH 3T1WA 4GO8A 4HDIA 3TFBA 4PJGF 1I8MA 5JIHA 3U82B 5CHNB 4EO5A 4PGEA 3M6DA 1FE8H 1Y18A 1WGVA 2JQMA 3TNMA 2BXZA 5GGTH 3QRFM 3CIAA 4JDVB 1RZ8B 4YK4B 1TJXA 2BY2A 4BDVB 4F2FA 1IEBB 3I3DA 2F6AA 2FGWL 4Z7VA 1KB3A 3QNZB 5GXBB 1QSEA 3MLTA 2WQAA 4XCFH 5DA4A 4UILH 5CEZH 4XT1C 4RIRA 1KIQB 1F97A 2Q86A 3EBGA 1NGXA 1XF1A 2CIIA 3APNA 3KLAB 3QC5X 4X5PA 5CMAA 1JPSH 3LRGA 1CFQA 4OKVA 4PGBB 5BO1H 2AQQA 3DARA 2NLJA 3NTCL 1J5OH 2R29H 1PBYA 3CFKB 3U30C 1TZGL 1SZNA 4JE4B 3D3VA 1DVYA 3L4VA 3P69A 4NZDA 4LSQL 2CCVA 1G5AA 3D0VA 2MNWA 3ZO0A 5IW1A 5TDOA 1OF2A 1PW3A 4U1JA 5ESVB 4PP1D 2BSRA 2I5YH 3BYYA 3I02B 5D1XE 2W0FB 4P5RA 3VRIA 4DKFL 1AZBA 5IMMA 3L7EA 2XN1A 3IU3A 1AXSA 5G55A 4N5ED 2LLNA 2GJ6A 1OLLA 4W9FC 4TL4A 1DO6A 1ZLUK 2X7LB 3GUTA 3O3BA 1A6VL 2IANB 3OHXB 4NZRH 4M93B 1MDAA 3FNKA 2X4UA 4UNVA 4UM9A 4PJ7B 4UV7H 2DLFL 3GUTB 2JIXB 1PZBA 2EINB 2Z4TA 5H8DA 3IJSB 4YDIL 3F7LA 4Z3HA 2HG5A 3O2DA 4X5LA 1BOGB 3MACL 2XRAH 4GI8A 2CALA 3D2TA 3G5XB 3IFOA 5TDPA 3RJDA 2WXNA 1IGMH 1EJ6A 4OZHA 2J43A 2VMDA 5EBLA 1OW0C 3IE4A 1T1YA 3CZEA 5KZCB 4H8PA 3MOBL 2QT6A 4RAVA 3UROR 3G5YA 2J1WA 3DSFH 4XZUA 4GAGL 4TULH 5I74C 2VLJB 3GJFB 1X5IA 3LHAA 3N2JA 3QAZC 3NPZB 5HGHB 2B0SL 4P5MA 3U0WL 3SDCB 3OKMB 4PJDA 1YQVL 4ODBD 4XP6H 5HI4D 2WQRA 2BSEA 3JSSA 1DUYB 1XDTT 4YDZA 3SOTA 3TVMC 5C3TA 3QEUA 3CZNA 3W39A 3PHOA 2FEDD 1JPEA 5B3NA 3I6GB 1E8WA 2CXGA 1X5MA 5IFJB 3HG4A 9CGTA 2EABA 4XNBA 4N2AA 3RVTD 2HSIA 4HKJB 4HFUL 2V9QA 4P2QD 5HVFB 4KQ4L 1UFGA 1CLOH 3HZMB 1WBZA 1YY9C 3HE7D 1U92A 2IWGA 4J4PC 3SBPA 3L4TA 4OGAC 1G7MB 2WGNB 1BXUA 4QCIA 2VMFA 4R8WH 4ATTA 1S9YB 1UXSA 4S1SL 1Z5HA 2Y06L 4F7KA 1A8JH 2JB5L 2F7RA 4MXWH 3WFDH 3ARFD 5E1HB 3U2JA 4GUCA 1LL1A 4QLRA 3ULVC 1NAML 1VFOA 1EGJL 4GRLB 4TSAH 4Z18A 4JRXD 4IRZH 3O6FD 2AK1H 1CQYA 1R3KA 5HY9A 3S0PA 4A2HA 4PGZA 2DM7A 4NCC2 1FLRH 3FTWA 3K8LA 5HDRA 3UBHA 4Y2OA 1KY6A 4QPEA 1R5VB 3APCA 4LCIL 3ARXA 3BVXA 4LPVA 4EXKA 4L3EA 1KN4L 3NAAL 4PLNC 1YEGL 4H8WC 3QXWA 2ODIA 2A9BA 1VEMA 3DTXA 4HC1A 4ZRGA 4MX7A 2DWXA 3X14A 4HISA 5E1AB 2P5EA 1O9ZA 5TK2A 4AYGA 5BZWA 2JFCA 4RZKA 1JG9A 2EAEA 1LWHA 1RPKA 5DI8B 2ED8A 1WIUA 3OMNB 1CDBA 4QF1B 1PLCA 3EJRA 5ID1A 1D2OA 1EAPA 2XXMB 3SYPA 2G4GA 4F7CA 4GQZA 4HPOH 3R8BB 4P5TA 4E41E 4P59H 2HX8A 3HHSB 3CHPA 5AKRA 3EJUA 1A9BB 1YG9A 3T9WA 2HFGL 3KM2A 4HLZG 4O2FB 4YDVA 3UPCA 3HMXA 4U1IA 4HV8A 4PJAF 3AADB 1MCIA 2VQTA 4U6HB 2CSPA 25C8H 3P9WB 1S9WA 3TPKA 4IBTA 1BMGA 3B7SA 1YUKB 1RAMA 2QQQA 4XMUA 1P6WA 3WXWL 2JELH 1V5JA 2NY3D 3VUAA 2IC2A 1SM3L 2H47C 1U3HB 3HG2A 2GSIA 2J4WH 4YAQA 4ICXA 4FLRA 5JIIA 4AQ8C 2PTTA 1FNEB 5E6ZA 4Z8FH 3KYAA 1DJSA 1IM9D 3EGSA 4F37K 3MFFB 1OCWL 3D48R 4QI3A 1E27B 4AEEA 3RA7L 4WEBL 1B4TA 4PU2A 4APQC 2YN5A 1O9WA 3G6JE 1G7QB 1KTLB 3BZ4B 4DN3L 1Q72H 1CURA 5C0GA 1A2YB 4X6DE 5J11B 5D2LE 1SPDA 2Z8RA 3N9GH 4YC2B 4C55A 2ITCA 1BFVL 1UM6H 1XGPB 2NY6B 3D50A 4GI6A 5C0AA 4KX8A 1ZHBA 3S8FB 3SDYH 2NNFA 4H25A 2VJ8A 4XN4A 3RI5F 3U0TA 1EZVY 3UO1L 3CWGA 1QFWL 2VWEC 4AQ1B 3EJPA 4WKZA 4HKZB 3UO8B 4DP5X 5CEZD 1MH5B 1BBJB 4TQEH 3LPWA 1A7RH 2BDNH 1WWBX 2MTPA 3QG6B 43C9A 1ROCA 4OLVL 2C1PA 2FD6L 1EHLH 1USZA 1RSFA 1YEKL 3ZHNA 4L0ZA 3PWVA 5CD5C 1LGVA 3DECA 3IF1A 4KO7A 4MXVF 4E9SA 5BJTB 3US1A 3RVXC 3T2LA 2WKOF 3NCWA 3BCFA 4ZDHA 3VMPA 1MRFL 5DUBA 4U1SB 1MCSA 4OLYH 3MNVA 1J48A 1S7RB 1ZA3B 3DETC 4PJ5D 5EO9A 1HL5A 1HTYA 3TCLB 3UTSB 4EOWH 3DX8A 1CE6B 2PW1B 1C8QA 5TE4L 2EH8L 2BY1A 1I7TA 1MJJB 3KPOA 1LDPL 1FZOB 1Y0LA 1JPFA 4Q9RL 1C5BL 4KBPA 4HS3A 1E8ZA 2UV3A 2FATL 1E42A 4FFYL 3FQNB 4ZFOL 4JM2B 5LVEA 4NIKB 1E3FA 3GI8L 2PN5A 2R2HA 1D7DA 2C3WA 1GSKA 3HNTL 3RWGB 3M7OA 5I0VA 2H32H 3BIBX 4N8UA 1NC4A 2A74C 2HKHL 4I1NB 1IE4A 2OMUB 2OULB 3O3DB 4R26L 5HVGB 3O2WH 1TQUA 2G4EA 4G42B 1MCEA 3APDA 3ULVH 2E6PA 1U8QA 4W93A 4RFOH 1EO5A 2HLFD 3BZDA 4WLCA 3O9WA 1VDGA 4D9QD 2HJKB 3KM1A 4LOUD 1J8SA 5DUML 3MLWL 3KNBA 4XP5H 3GMMB 4NUJB 4DUVA 3VJ6B 4H8WH 2VJ0A 5DMGC 3BP7A 1KSRA 4W4OC 5F7FA 1QO3A 2Y7SA 3QDJB 2XA3A 4LRIA 3W9EB 1WEJL 2IDSA 3QI9C 5AUMA 5FFOA 2MCG1 2BP0A 1AY1H 2ZJSH 3RVUC 4TN9A 3LQAL 3EJYC 5HHXH 3BZFA 1RZJC 3UZQA 4Z3GA 3Q5TA 2VXQA 1AFVL 4KDTC 4KX9A 3T3ME 4FQ1L 4YBLC 2E9IA 4JRXA 3SCMB 5C9JA 1WAAF 3UCQA 5FUOL 3KPRB 3WNPA 3BFWA 1RIUH 4ZSOB 3ABMB 3T0XA 2N0MA 2HTLC 2NNAB 3MI6A 5KTEH 3SY0B 2WAQA 1E3XA 4Z95H 3TCXA 4BH8A 5SWZE 3JV4A 4A68A 1B0RB 1W72B 1NLBH 2WTRA 5KSVA 2OTPA 4F9LA 2ZXAA 4M56A 3UAAA 1CE1H 1JN6B 1O5DT 1ZIBA 5HJGA 1BEXA 2JJSC 1PLGL 4K3JH 2JKTM 3OXSA 1QWNA 1XH0A 3WDJA 4RSVA 2D0GA 5JIDA 1VPOL 3GXTA 4PS8A 5C3IA 4FFVC 1JYVA 3QRLA 3TN0B 5CSGA 3HVNA 1HOCA 3JVGC 3T65A 2XNAA 2OTUB 3EUUA 4IU3B 1KPVB 5INCA 1U8NB 2VDQB 3OM3B 3IFPA 2OMYB 1FHGA 1T5WB 4PAZA 3FQWB 4ETQB 2VLKB 2UWEB 5B1JC 4HXAL 3RWIB 3K2IA 1FGNH 1PJ9A 3DDGA 4JDEA 2ERJB 3RILA 5CZXC 1A6TA 1ADQH 5MEQA 1QHOA 3BRGC 1ICTA 4FXKA 1ZRUA 4HUUA 2ZG2A 1JNJA 5L4MA 2OMBA 4QAWA 1DSWA 5D7KE 2DAVA 3QJSB 2XWBA 2UY7A 5HP5A 2P8MB 4NPJA 4LCCC 1YNKH 3KYMA 1EPFA 3EYFB 1BQSA 4N9GB 1RZFL 4M8QB 1MFCH 4WO4A 4X4YB 5AOJA 1T7VA 4XWOC 3VI3E 3RL1B 4V1DE 2IGFL 3ZQWA 3G5VA 3EO9H 3GPSA 3L3OB 2YBRA 3V7AE 1JXKA 1IM9A 4OLWH 5KBMA 4BJLA 1R3IL 4DP1X 1QQDA 3BKJL 1A6WL 2Z93A 3CZLA 4X9HA 4TNWF 2X4PA 4TVPE 4P4KB 1W0WA 4C59B 1AXTL 3UPRA 4JS7A 4LASL 4BK5C 1VACB 2EIZB 3RJQB 3V0AC 4JFDB 5D55A 2V33A 1G9EA 4FQJL 5E23A 4HCRL 2CXKA 3DNKA 3D9AL 5I9QC 3IGUA 5G4NA 2Y5EA 5KVEH 1KMGA 3LD8B 1EEUA 5IQLA 4DFHA 4BQ9A 3KS0J 2NNXA 3KPQB 4OD2A 2ADJA 3RBGA 3QIUC 1FPTH 1TYEB 3S4SB 3LZFL 3T1FB 5ADPH 3NIGB 1PEWA 2VXTL 1A6AA 1ZWIB 4I85A 3NZHL 2R29A 3CVBA 3FQYA 4TVPL 4ODVL 1KXTA 3BLPX 3UZVA 5D7IF 4D9LL 4YEFA 4WW2A 3RFZA 3ULVF 1F00I 1OZUA 1YN7A 2MHAA 2MCAA 1N5YH 1E67A 5AW2B 3KXFE 1MFBL 3AVEA 3B2UC 1EANA 1CYWA 5E2UH 4RFEB 1XGYH 3DV6B 4GP4B 3SDDB 1KBWA 1G7IA 4JZNA 4O51B 4BGDA 2CDGB 1ETA1 2E4TA 3KPNA 1BAGA 3QZWG 1BJ8A 3VXNA 3B5TA 4XC1H 3B2VL 3MYJB 3QXUA 4JCWA 1QR1A 1U8JB 2VDKL 1X4XA 4BCXA 4GMSL 2J7LA 5D2NB 5I1LA 3OJMB 4U4BA 3LVEA 3H6JA 3HNSH 3BKML 3I75A 5DHYB 3TVMD 2A9AA 4P3CL 2CKBH 1MHEA 1REIA 1WZ1L 1GJUA 1RZJH 1X7QB 2Y07H 3H6AA 4O02L 3TWCL 1DJXA 4AITA 1CIUA 1A9EA 1NC2B 4Q6IC 3ZHDA 4DZBB 3HVDA 2CRZA 5E8OA 3WKQA 1UJ3C 1LMIA 1G6RH 3K80A 2BY3A 2E6QA 5F7BA 1PDKB 1FA4A 2XWTB 5J12B 1KT2A 3AS0A 4Q56A 3TBTB 2J1YA 2GYSA 3GIVA 1A1OA 1KLGA 2DDQH 3WTXA 1IQWH 1L6PA 1NZRA 1YY9D 4R4FH 4J4PD 3SO3B 4OGAD 3P0GB 3RPIA 3FO9A 3QEQE 1I1AB 2AFNA 1EEZB 2WVSA 4AEIH 1JV5A 1SY6H 3VG0L 5B39B 3PWJA 1H5BA 4FYRA 4XMLH 2EXYC 2R1XB 3AREC 4Y4HB 3L17A 1IAIL 3ULVD 2OL3H 3B6SB 3CH1B 1RZ7L 1PG7H 5IBUB 2WBJB 5HVHC 4L18A 4ZD3H 2AEPH 3OKOB 3BZEA 3MV8B 1RSYA 1UB5A 2F74B 3JWDL 5JHDD 5E6YA 4MA8L 4N8VG 2FK9A 3F62A 5HJ3A 2Y7NA 5JW4M 2R1WB 1FAIH 4E9RA 2F7IA 2AJUL 4HIHA 1CFNB 3HJEA 2X4SB 3US9A 1O5PA 3BGAA 3SGEI 5KUKA 3CFIC 1EA9C 3MRLB 1A21A 2A4EA 2GBAA 3NCBB 5BW7A 1GCYA 2PTUA 3IEAA 4X8JB 3I9IA 3F7RA 3VXQB 4NKIH 1MPAH 5FECA 3AFLA 4H0LC 4W9GC 4DKTA 5C0FA 4PBWD 1A7PH 4XX5A 1HHJA 2Q3ZA 3VB9A 4M1CC 2PLTA 4Y4KA 4PS7A 4RMWA 1OE2A 3PJSB 3QWOA 3CVIL 2BSSA 3V5HB 3X2QB 3LS4H 2C1OA 5DR5L 5AAWA 5L2KD 1BZ8A 1KEMH 3WFCH 5B3SB 2PYEB 1VB9A 3NPSC 5AB2A 1JWMB 4ZMOA 1VHPA 3PDOA 4PIRF 3L4WA 3EGDB 4O2CA 3JZYA 1LDSA 3L7FB 4JFYB 3SQOH 2YUXA 3ARBB 1DBAH 5D5MB 2F53A 4UT6A 5DYOA 5FKPB 1LHZA 4OB5H 2APVA 1X6LA 5FO7B 4AL8H 4FD0A 4CVXB 1B6UA 4LHUG 1F4HA 2ZWYA 4XNAA 5IT2L 2XLLA 3P0YH 2ESVA 2AXJA 3DTDA 4AIXA 2Y4SA 1NCCL 4AOFA 1RMFL 3HBQA 4WJKB 2VM9A 1DUZB 3CN3A 1Q0YL 1AG6A 2IJ0C 1N70A 4BSVB 5FK9B 1NSNH 3UEQA 3L1EA 3N55A 1RPUA 2VXVH 1NFIB 4E9LA 4ZNEE 2QV2A 1LO5A 4APQD 3L4ZA 4W4NA 3KJ4B 4N2KA 1A0QH 2CDFA 2IWFA 3MXWH 1I3VA 3ZJAA 2YPLD 1JDDA 5JDJA 1NMAL 4RFNC 1A4KB 1PG7X 3V4PA 4JQXA 4U05A 1T2QL 3BVNA 4HKBA 3GSUA 3WGUB 5EF2A 2XBZA 3Q6FA 2YPKB 2KKQA 4HIJB 4Z9KB 3W1ZA 4AMWA 2J55A 1QLRB 1FO0L 3HOGA 4KO9A 3NK3A 4XP4L 5D1QB 3ABLB 4JZJC 3WIHA 4F8TA 4FGMA 5EC1B 2BVYA 4M6ML 5DQ9A 4FADA 1M1XB 4PJ8C 3EKCA 3CV5A 3PGCB 1S9XB 4GKZA 4MNGE 4M62L 2WXLA 3CZJA 1NGWA 1FL6B 2NY0C 2NUTB 5CD5D 1MQ8A 3Q8FA 2C9XA 3GS4A 1UENA 5ETUA 3RVXD 1E6OL 4OJCA 5H4YA 4QRRE 5HDOA 5TE7L 1T83A 3LEVH 2EDNA 2V5SA 2VZUA 5F9WB 3DETD 1DHKA 4JRYD 4Q9QL 4MDIB 1AC0A 4P2QB 1F90H 1W15A 1LEKA 1WHPA 4XXCC 4K9JA 5J1AA 5KW9L 3BGFB 1JF5A 3EF7A 4BQ8A 3HE7B 3W3BA 4OCYL 1L7IL 1GOGA 5F21B 4WWPA 5T5NF 2EDQA 5IJBC 4XN5A 1RK7A 1MWAH 3CSFA 5FUCE 4JGUA 1S7QB 2HRHA 1OAQL 1E4KA 2DF3A 1LQSR 4NRZB 1GCFA 2XKNA 1E4WL 3ARFB 4PS3A 1CI5A 3SDXE 3VRJA 2OCJA 2F19H 4FFZH 4U6XB 4J3OC 1S7UB 3MLUH 1FYTD 1NCDL 1JPGA 5HGBB 2FECL 3O6FB 3B9EA 4MD5A 4NM8L 3O0LA 5GGRB 3NJXA 5G5DB 1WWAX 3QUXB 2AEQH 2FJFB 5TFSH 1DBBH 5IIEB 3TA4D 1ONQA 3H9SD 5DLMH 4ODTH 2ZCLH 1CXEA 5BS0B 3VWKB 2W80C 3W37A 5KWYC 1L9QA 2YHGA 1PD0A 4F57H 3MJ8B 5TH2B 5AW9B 1FIEA 2EIKB 1QTYT 1PFCA 2VRKA 2DQFB 3P4NB 3B8SA 4Z7UF 1QWUA 2ENJA 3TO4C 5DMGD 2F15A 3WKML 1JZGA 2NPLX 3T6VA 3VXOA 3MUY1 2JJTC 2QADC 4L37B 5C70A 3NH7L 3K71B 4P48A 3RWJA 2UZPA 3QI9D 1UVQB 2DQGL 2H32A 4DQOH 2OJEB 2CPCA 1MVUA 1QEXA 1A3RL 2CGYA 3RVUD 3W0WA 3VFOA 3EJYD 2VRAA 2ZXCA 3ISRA 3LN4A 4L05A 5H94B 1OTUC 2IPTL 4HX1B 2BC4A 3GSQB 5JYLA 1PZSA 2C5DC 4YX2H 1OB1A 2EIBA 1UA6L 2RACA 1U8PB 2Q7NA 4ZTEA 2XZQL 1A7OL 2DQCH 2YAMA 4XPAH 1OGAE 5CBEB 2HTLD 3CPLB 3C60B 5ESQA 4Y1SA 5CEXA 3KWXA 4I3GA 1M05A 1TTBA 4OLXL 1QBMH 2IAMB 3V55A 4ELME 3FOMB 2KZKA 3QZWA 3MRFA 4XBPB 4YDKL 2QLYA 2XWJA 3FFDB 5JLZA 4QXVA 4J12A 5LLIC 1F3DH 1W0VA 1R0AL 1MCOL 5DHDA 3V5DA 4MAYA 5E6UB 3DX3A 1CLZH 1NEZB 5JPMB 1EJOH 3LPFA 4PJBA 5DMYA 3CDGA 4N2HA 2WXMA 3UABA 1DL7H 2PW2A 2Z6FA 4FFVD 3HI1B 4BKLA 2VDLL 5BVPH 2B39A 3FUFA 3F7KA 5E5RB 5IB2A 4IIZA 3SJVD 3VXSE 1B0GB 3IDYB 1Q9OB 3FO0H 2B1AL 4JJ5A 3SZ6A 4AQAB 2K70A 3C5XA 5C8JB 5I71B 1RZPA 1A47A 5HJBA 4AMKL 2FIKB 1UXWB 5CZXD 4QHLA 1JZ7A 2CM6A 1I7ZA 4P3DB 4F3FA 1NCBH 1WG3A 2AV1B 4ADIA 1NH6A 2ZXBA 1VFAB 3RU8L 1DQMH 4K7PH 3GEFA 4WFHE 2AW2A 3MRGA 4PWIA 1NMCB 1OGPA 4OJEH 5IY5B 4G9FD 5IQ9B 5A2FA 1LK3L 1FFOB 4YSTA 3C5SB 4ZMWA 4FMFA 5MP6H 4XWOD 3CGTA 3B43A 3KLLA 2VDRL 2H5UA 2V5TA 1JERA 3GFUA 5GGUA 1SLWA 4DKAA 4G8IA 2APXA 4AIOA 3BGMB 4L8CA 2WM0A 2FLMA 4GW4A 5EU4A 1HK6A 5FHBH 4N8VA 5C6TL 2EO9A 4PJAB 1FVEA 5BOZG 1UQSA 3R7QA 1TZHA 2Q8AL 4JNXA 1MLBB 1ZXKA 3O0RL 1SOQA 4L23A 1F11B 5C07B 4PJ5B 3WGVB 3QG7L 1B4RA 2OSLA 3HCVB 4IMLA 3AWEA 2X12A 4R7LA 4I7ZC 4FRWA 4QNPE 1OL0A 5IEHA 1XBRA 3VXPB 5GS0C 1OGSA 1BBDL 1XCXA 2EDKA 4L4TD 2FGZA 5E94B 2AJZA 1OGTB 4JPQA 4KKZA 1FNGB 4I0PC 4PRHD 1DQLH 1H3PL 1O9VA 1ZT7A 2Y7QB 3NJGA 3O3UN 1JF1B 3L3GA 4CRPA 3WL9B 5I66B 2C9AA 1IGJB 1E6JH 1ZVSA 4K3GA 5E5UB 3P73B 2VLRD 1EXGA 4JPWL 1Q94B 2FZ3B 2XZZA 3BJLA 4LEBA 2DWSA 2XBDA 1E5BA 3C6SB 3QIUD 3JUZA 2GUOA 4OCWH 4TUKL 4AYMC 4U6VH 1IBGL 1WFUA 4N6RA 5AQ0A 4BSWB 4FQXC 1KJ2H 4QRPD 2WGXA 4F80A 4LCUA 3K0YA 2ITDB 4N8CL 2EH7L 3LXAA 4J3OH 4LCWD 1F3DJ 2CHZA 3ARRA 3BAXA 4FTVA 2JJWA 4HJJL 3ZKQD 3ARGB 3GJEB 2BERA 5FGRA 3RDTC 3IT8D 4JRYA 3F3HA 3VFVB 1M6UA 2K0RA 1K3ZA 4IKIA 4LHUA 4ZUTB 4B9JA 2R0KL 5IB5A 2EADA 3MOAL 3B2UD 2VC2B 4U1NA 5B22A 4LF3B 3BSZH 3O8XB 1HDMB 3FN0H 4N2DA 4F8NA 5JR1H 2V5MA 4IW4C 1YRKA 4FNPA 4ODUA 5ISZD 5HD8C 2X9YA 3P3SA 1ETZB 2ICWJ 1NLDL 1AMXA 2WLJA 1I3GL 1XMWA 5BOJA 3QO1B 2FX7L 1MCDA 4WDIB 4K71B 4H88L 4OCXH 4NEHB 4QKXB 4U2YA 1HU8A 3S96B 3MBWB 1RUAH 4N3TA 1ZGLA 4I5BB 1F4WH 3QE5A 3P3RA 3BKYL 2V2XB 3IETA 2NX5E 4JFED 3MGTB 1MRCH 4UINL 5I1IH 1FZMB 3FZUC 4ZFZA 4KROB 3KGRA 3S2AA 5I5IA 2W9DL 3SN6N 4HK3N 4WY7L 3H9SA 4FQ2L 4P57A 4JHWH 1EAQA 3BQUC 4JG1H 1JV2A 2O4EA 5C1MB 2JJUA 4U1HA 4UQ3B 3TESA 1HINL 3DO3A 2APSA 3RUGE 3QQ4A 5ANME 1MFVA 12E8L 4UQCA 2HP4A 2DPKA 4AVHA 4XP9L 2RGSA 5EBWA 2GTWA 5T3XE 1UB6B 4GAYB 4WZ9A 3QI9A 1JTTA 1HAUA 2VLLA 3H4FA 3WSQH 1L4IA 4PJCF 2EXYD 4AGOA 3ARED 4UMGA 2Z91B 4M1DL 1R5IB 5E5MA 1QP1A 3GMQB 2UZIL 4S1QL 3K3QA 4KY1H 3HUJF 4J6RL 2J5LB 3WJLC 4ODWA 3ZYIA 1N9PA 1A14L 3I9PA 1G6RA 4PJEE 4FP8L 3RWFA 2E9BA 1HHGB 1ECZA 5CUSH 2R0ZL 3JWNC 2K7QA 4JQIA 4N25A 1MY5A 1RULL 4W70A 4CAGA 3LKOB 2G5RA 1ZKAA 5C0CE 4DUXA 3UDWC 1BAFL 3PHAA 2IQ9H 1TTAA 4ZPTA 5T3XL 4X4ME 2H8PB 4YN3A 1KGCE 1U95B 2E4FA 1I8IB 4TKWA 1O7DE 2ENYA 1MCHA 4JFFD 1EZVX 1HILA 1RIVL 3GBNH 4JLRA 3SYAA 1S5IL 3VW3H 5DZLA 3ES6A 2XI9A 3KHQA 1FFQA 2LTQC 2LAGB 5D72L 2CR3A 3UTZB 2O5ZH 4NERA 4EIUA 3CSYA 1KTRL 4M1CD 3AT0A 2LOEA 2YXFA 4ZOEA 3ZKMC 3GSOA 1YDPA 4RZCB 2QHRL 2LFEA 8FABA 3OXRB 5HDWA 1D9KC 3UYPB 2APWA 2XFGB 2K6WA 1SXAA 1UGKA 4KKAC 4W9IC 3U30B 2HFEA 3SE3C 3ZTNH 2EVJA 2H2SC 4L29B 1A7QL 2E76C 3K1KC 1K5WA 2P9RA 1JOIA 1T7YA 1S7WB 1UT1A 2DQDH 4HHGA 5LCVL 1XGQB 4QRTB 4NO5A 5GS0H 1M3JA 1WVZA 1TNMA 4JEGB 2YMTA 4YIQB 5DJDA 1CVRA 3K5SA 4Q74A 4P23C 3V0JA 1NCWH 3IMBA 4M4RA 4OF8A 4PWFA 1HE7A 2JMRA 1A4CA 3DUSA 4Y1AD 1MEXH 4ZS7H 5K9OB 1UM5L 2AMUA 4RLDA 3MV9A 3PL6C 4E0RA 5IBLC 4XO9A 2UX7A 4KKQA 1OCOB 2F1AA 3PWNB 2XY2A 3KYKH 1BIIA 3VI4B 1GGCL 1Z3GH 1KLUB 2IANE 1BFOB 2DQTL 4OIIH 4Q8BA 3BUDA 3HBGA 4YWGH 1S7TA 4PJ7E 1QLFA 2ICWI 1TCRB 4YDMA 3RQ3A 4J3OG 1PY0A 4GRMA 4AZ8B 4EQ2A 4EKXA 1K5NB 3G3LA 4AH2B 5JXAL 2DKMA 3NA9H 5MI0C 4X0NA 4XN8A 1TJGL 4G72B 4UIKH 4ANUA 4OTXL 1CXFA 1YNLL 3DRTA 1SJXA 1RU9L 2BVTA 1L9TA 1PU0A 3AS3A 1V54B 1LK2A 4PJ8D 4DPBX 3OF6A 4WNQA 3TO2A 3CZKA 1XAUA 3KCWA 2D7TL 1DSFL 1OWWA 2BIOA 4N0FB 3LN9A 2NY0D 3FT2B 3TVMB 4BQCA 3U6RA 2VLJE 4KTDH 4JDTH 4LFHD 2DEYX 1KGYE 3QUMH 3MRPB 3OB0H 4CNIB 4DOHB 1QLEH 1UHVA 4ZO6A 4BFFA 3PJLA 3ZW3A 1NWPA 4WVRA 4XMPL 4NKOB 3KWWA 2FTAA 1J11A 3CQQA 3CXHJ 2ORBH 4AGLA 2BHYA 1Y1DA 3D6GA 4HWBA 4JO4H 1AHMA 2CHNA 1RHFA 4IRJC 5EH1A 4NQQA 1R4XA 3L3IA 1Y1UA 2APBA 4UTBL 3U9UA 3AACA 3KL0A 4O2EB 1TKWB 5JW3L 4KOBA 4ONFH 5I1DA 2F5BH 1XGRA 5IB4B 5D7IB 4OQTA 4JY4B 4OGYH 5ANHA 5JHMA 4J3OD 5EO1A 4J28A 3IWUA 1KGWA 1UYWH 5IF0B 3KYNB 1OAYH 4JFEA 5LGHH 1PJWA 1QPXA 4JHZA 5JHDB 1NA8A 3BDYL 1FFRA 5IQ7L 1HHIA 1E9QA 3DHPA 2PMZA 2DQUH 4ZFQA 2K4AA 1UUNA 1QSFA 2WO2B 3SPJA 1NAKL 3JWNH 3ZKXC 4IBZA 1OAXH 4FEIA 4GG8A 2HPTA 1YMHB 4LDCA 4ZMPA 3BRFA 4JJOA 1MJ8H 2D3JA 5DWUH 3TO4D 3G6DH 1JK9B 2AGJH 3QCUH 2AEWA 1IGTA 2VDOH 3B3IB 2QADD 5IR1B 5F88A 4ZFGL 4NXKA 4XO4A 4PTUB 4JKPH 2YD0A 5FYJE 3GTTA 2O6FA 4FFZA 4F27A 4MHHG 3RNKA 4HD9A 1OTUD 4JR9L 1AO7D 1MI5B 5E4IA 4A7QA 1U93B 2DQIH 5L2KB 3O45A 3N06B 2DQ6A 4MDJB 4H1LB 5FO9A 4CVUA 1JIBA 3ECQA 1WBXB 4XPGL 2L3BA 1P0SE 1DFBL 1XF3A 3TH2T 4JKMA 1D5RA 2A9NL 2D2OA 3B9KA 3HPJA 3O6LH 5KG9B 2WB7A 3L4YA 2AEIT 3SBWA 4K9EC 1HYSC 3V4UL 4IIQC 4OM1H 4GIAA 3F64A 3K72B 1GGIH 2ED6A 3RP1A 2RBLA 3F7VA 3P02A 4XWGH 1GZPA 1Y6KR 5MHSD 5JXEA 3F58H 3TT3L 3FT1A 4UZSA 5I8OL 2AQRA 5FYJL 2VE6A 1EDQA 3DWTA 1IC4H 1PLAA 5TF1H 5K9QI 4QRQA 3ZDZF 3SGKA 4K07A 3P4MB 5DZAA 5HHMB 2IQAB 2ATKB 4PY8J 1CQKA 3IJEB 1S3KL 2YD1A 5CIPB 4YXHH 3IYLW 1FGVH 3OVUB 1PZUB 4XHQA 2Z65C 5DJYA 5IKCB 3T2NL 3WY1A 2OS7A 4APQB 2J6EA 1QEWA 3EO0B 3HS0B 2OP4H 5MENA 4Z78A 4F2MA 3NIDF 4KHXL 4MMZC 1XZ0A 1XSIA 1E7UA 2YPLB 4OM0L 1AGFA 2ZX8A 2X4QA 4PJFF 5IHZB 3D0AA 2HH0H 4JFZH 4Y2LA 3QNFA 1SQ2N 2GT9B 2EYTA 2VXUL 3R4RA 4NSKA 4PPTA 4WUKH 1YEIL 2Z0UA 4G8EA 1PTZA 2KDYA 2QGDA 3GMNB 1J9RA 2AERT 2XN2A 3ROOA 5J6HB 1JXGA 1TVBB 1N5AA 3B2MA 3CFCL 3CHOA 2DMBA 1JNNH 4MHHI 4OD3H 1DANT 4A6YH 3CXHK 1BSIA 4P2CG 4JGNA 3U0PA 2Q3XA 1DJGA 3WE1A 1L6XA 1MUJB 5CM1A 4F7EA 1VRSA 1WCBA 4WSGA 2Q5BA 2YPVA 1HX0A 7PAZA 2ATAA 3GT6A 5I1HL 2ICWA 2PWFA 1IC7L 4I2XB 4KTYA 3K46A 3QFDB 3V0WL 3X1GA 3FTGB 4F7MA 3CU7A 3PQYA 4ZOCA 1UD3A 4A37A 1Q0EA 2AS5M 4CW1B 1WPCA 2J5WA 5LUMA 3LKSB 3U1PA 4G6ML 3V6ZA 3WLBA 3UAFA 5GS0D 2CBPA 4KVNL 5HHPA 4KKCC 1S7VB 1LE9A 2QHLA 1VZIA 4I0PD 4MB5A 3SKOB 4AG4L 1G4RA 1MHCA 2HFFB 3UTSE 5IB1B 1AD9A 1JHKL 4EDXA 1KCVL 1RURH 2NNRA 4LZKA 1KYFA 3QR2A 3Q13A 1S8DB 3TZVB 1E4XL 4YE4L 2WP3O 4KK6C 4GSDH 4LEEA 3SKNB 4BELD 2F8IA 1DE4A 3COOA 1ZHKB 2A74B 2F61A 4FQXD 5D1ZC 3U7YL 1FYTB 2VQ1A 1ND0B 4HH8A 4D0CB 3TIEA 1LD9A 1UWFA 4C56B 3HS8A 4XB7A 3KH3A 1P4LA 3ETTA 4IMKC 1ZK9A 3MCG1 3BWZA 4JX0A 1K4DA 3HZVB 1EEYB 3RDTD 3DV4B 3BKCL 4PQXA 2FGWH 5EDXA 3EYOB 2UY6A 4I3RL 1HNFA 5GS1C 3WNMA 2X6AA 2OI9C 2ZUVA 1RUQH 4JFVA 1HCFX 2D7PA 4FQLH 3JWNG 5MEPA 3NSFA 1CG9B 1D5IH 3RL2B 2BP3A 1NIBA 2XETA 5HD8D 3VFUB 4FHJA 1VEOA 3ARSA 2A73A 3PWPA 4ISVB 1KG0B 3WIFB 4ZZFA 3R19A 2QSVA 3D12B 4M43L 1KXHA 1BD2D 1GVIA 2ZYRA 4OI9A 2CKBB 5GISH 3ZY7A 3NBNA 5EU5B 2CMRL 2EXWC 3QDJE 4LSQH 2YKLH 2VN5A 3GMOA 5IFAL 4OFPA 1CO1A 4MD4A 4YBLB 5KSUB 2W07B 3TIDA 3BW9A 4PBXA 4P9ML 2BLFA 2CK0L 4DKFH 3FZUD 3BIKA 3OB0K 3QYCA 1QUPA 1HFUA 3UOAB 1N6QL 4X9YA 2XYBA 3MA7B 1PKQB 1BYNA 3AQXA 3NSDA 4GP8B 3BQUD 2K78A 3H9HB 4PJHB 4PY8I 1YC7A 3BSZA 3LPOA 3KPRE 3LH9A 4CGUB 5MERA 4ZSOE 2WXGA 3F05A 3L6FA 4BWUA 1LNUA 2ED7A 2J8UA 2PPAA 3LH8A 4RNRB 5CGBA 3V4VA 4K9EH 4X5RA 1DDHA 3ESNA 2DLFH 4KJYB 4ZFFA 5DO2C 4Y5XC 1OEZW 2WZ5A 4JFOB 3DOIA 4YDIH 2AKRA 3A6CH 4H13C 4TSCL 2V7HB 4M5YL 4KTEL 1S7SB 1SEBB 4PI2A 3MACH 4YHIB 2Z92B 3UTTD 2WW8A 1PAMA 5EEXA 2R23A 3TM6A 1QUNA 4WI0A 3EFFB 2IADA 2XACC 4PJIA 3SJVB 2PF6A 4DCQA 3CMOL 2V9UA 1UH3A 5GZNC 1CDHA 3UEZA 1CFBA 4GO9A 5IBTL 4CVZB 4N87A 3MREB 4QGTA 2YEVB 3MOBH 1I8KB 3QDHA 4Z7UB 1HHHA 3BN3B 2V8MA 4F37F 2FB4L 4GAGH 4X7CC 2C4FT 3SKJL 4KK9C 3H55A 3ZE0F 4QOKA 3U1QA 2VLKE 2UWEE 2B0SH 3FB5B 4JM4H 4PWJA 1J8RA 4G9FB 1YQVH 1W72L 3RTQC 4AQOA 1MW2A 1MHHA 1X9RA 2OMNA 5B7EA 1TJIH 1CR9L 5C0RH 5AKSA 3DXAA 4U6YB 1MJUL 4G70B 4MNQB 2BVPA 5I2IA 4PV8A 5DZVA 5F1NB 3LCYA 3KZ8A 1K8IB 5DURD 5GRUH 4X99A 4HFUH 3LYRA 3ZKMD 4B0MM 3IGLA 2Y22A 1E9PA 1DYZA 1SDDA 2NMSA 1INQA 5BV7C 1D9KD 1U8KB 1WBYA 2BIIA 3K74B 2WUBL 4R96A 2QQLL 2K4WA 5IHLB 4QTIL 2VDQL 4KKAD 2AJVH 2C9UA 7TAAA 1W8OA 2H2SD 2W65A 5F9AC 5ALCL 5LHDA 1MREH 2HN7B 1V3MA 3ALWA 1SN5A 4R6UA 2XT1B 4L4TB 3G7TA 3FFCD 5AD0A 1Q1JH 1IGFL 5BVJB 2WOYA 4PRHB 3ROLB 2JB5H 4XVSH 2RMNA 5DJZA 4P23D 5I9QB 1NAMH 1EGJH 4WW2F 3RB7A 1DN2A 5C0EB 5JPNB 1PEZA 5E6RB 2VLRB 2Y1YA 4JFDE 3PL6D 2VMJA 5IBLD 3EDFA 3E2HB 3L3JA 1V3KA 3QIUB 4J1UA 4KZCA 1CFSA 2EIEA 3MO1A 4NP4H 4PCYA 4WUUA 4LCIH 1QFUL 1KN4H 3K5RA 4QRPB 4N68A 3OKNA 2K6ZA 1C5DB 2HJFA 4HEMA 1S7XA 1FSKC 2HT4C 4LCWB 2P80D 1XSJA 2JI1A 2G9KA 3CLEL 3K2KA 2KLSA 3NIGE 1G0DA 5EU6B 4XP1L 4ODSL 3F6LA 3HLKA 1T4KA 2OSYA 1DVQA 3B1TA 4LO9A 3W56A 1ACXA 4YNYA 3HR5B 2G3MA 5EIIB 4WEEA 2W1NA 1Q4NX 3MRHB 5ISZB 2HAZA 3HZKA 4QRFA 1XGUB 1JPTL 4LDEB 1CBVL 4QRUA 5A2LH 3SB3A 4YPGB 4X6CA 5EOQL 3VFMB 3QDMD 1DBML 2FBRA 4I48B 4FQCL 4NNPL 2FNBA 4KJQC 3NDYE 4MQ7B 5DS1A 3VGAC 1KXQA 5KN5B 4BE5A 4HUNB 1KJMB 1HSBA 2V9RA 3STZB 3HG1D 4GQQA 3S5LB 2BJML 4Q6IB 4HUKB 1H0DA 1M7DA 3GF8A 4E9WA 1UJ3B 2FO4B 2BIHA 3CN4A 3MN8A 3OL2A 3UERA 1SM3H 5AOZA 4BE6A 4M9OA 2O6EA 4PVMA 5HI5C 1DBKH 1IC0A 5DRNB 5IW3A 5C2BL 2VR9A 1XHHA 4IRJD 2D7QA 1KXVA 3P11H 3S48A 3QW9A 4C4KO 1FDLH 1M2VB 1DLHB 1TZ8A 2JCCA 4N22A 4AEHH 4GKNA 5EN3A 5KUMA 1FNFA 1R24B 2I9LA 4HWEL 5F96H 5IM7B 1TMCB 2PYFA 1VFMA 4BZ2L 4DN3H 2CR0A 5I1KL 5EZPA 3G04A 5CD3A 5HYIA 2W8CA 1BD2A 3KCPB 3BPCA 3QPQC 4ANXA 4MWFA 3WTWA 3RZCC 3FDWA 4BGLA 5I6KA 3PNRB 1BFVH 3H7BA 1FUNA 1NL0L 4LVNB 5GHWL 5JOFB 2LU5A 4QLWA 3T6WA 3LZPA 5HVHB 4XCNA 3MNDA 3MRCA 5DJ8B 5E6SB 1OAKL 4MS6A 3DSNB 4NXSA 1U8LB 3DPDA 3UH8A 5DHVH 3CSPA 2IG2L 2WNXA 1CS6A 5C0IB 4OQ1A 1HKLL 3MV8E 3AS2A 3IGFA 1YEKH 4XO3A 4ZNCD 4WWID 3MNWA 1BVLA 3VFWB 1O6SB 3QUZC 1PQZA 4HXBH 3TV3L 3DMMC 4BK8A 4D7BA 1QRKA 1F18A 2B15A 1V3JA 2EE9A 4QDGA 2FVNA 3ILQC 1MRFH 1TDQA 3RHWK 4E9QA 2O5NA 5C0BA 1RZIA 1EO8L 3CFUA 2DRUA 5TE4H 1U30A 3GPEA 4FMKA 4EDWL 5L8LB 5CCGE 4W6YB 2LV4A 4Q9RH 2NY4C 2F18A 3NPSB 3L4UA 1ZA6A 1KUMA 5CNHA 5BV7H 5I73C 3QP3A 3U4EB 1HXKA 2YUWA 3VA6A 1TYJA 4PD4J 1F5WA 3EF4A 5EF3A 2OXGA 3HNTH 2PYEE 2C8NA 4HDIB 4R7NB 3ZGHA 1HYSD 4KH9A 2N4IA 3MBXL 2W0KA 3I85A 1TQVA 4PJCB 3FCGA 1JWSB 1X5FA 1Y18B 4OFYD 3DX2A 3GMRA 3TNMB 2A77L 6CGTA 2IBGA 1K8DA 1KPRB 4Y1AB 5D5ME 4GW1A 2ITEA 3HUJB 5LN4A 2XZCH 4A2LA 2NY7L 5A6IA 2HLAA 4GI9A 5JUEL 5T1JA 1SHXA 1FNAA 1CCZA 5DS8A 1G94A 4OT1L 2Z31B 1NPUA 1UH4A 2QVFB 1GPOL 3F12A 4UYPA 4HGKC 2H9GB 3QIBA 4FQPA 5LWYL 1IM3A 4OKVB 1I9RH 1TSHA 3WD5L 5CO1A 1PZ2A 2G3ZA 3KEHA 4PJGE 3EO1A 3L5XH 4YUEL 1HIMH 5K9KB 5CP3H 1XXDC 2VSDA 2X6MA 3Q6GL 1OT1A 3BP5A 5TDOB 1TU2A 3D85D 3F8UB 4JZJB 1AFVH 4A2GA 4FQ1H 3L7EB 3I6KA 3IU3B 4PJ8B 3GNML 2KERA 2ZG3A 3EGXA 5FUOH 5J7CC 3JXAA 4MA1B 4G3YL 1Q9WB 2WP3T 3R06B 1ZJBA 1T2XA 4P5KB 5D1QE 3LZQA 2C4FU 2NY0B 4L3FA 4S1DC 2BP8A 3C2SA 4X80L 4LARL 1T04A 4A7VA 5AW1B 3VXTB 1U58B 2MFNA 1MF2L 4Y4FB 4OF5A 3MMEB 2P47B 2TSAA 1INEL 4XE5B 5F3BB 3C09C 1QZNA 2FJGA 3QQDB 4LMQE 1FFNA 2CPUA 2YFOA 3VX0A 1OPGH 1XBDA 3ULUF 3ZL4L 4B7IA 5GRWA 4KKCD 1X5GA 4Y88A 4AZUA 3CE1A 1VPOH 3ZTEA 3U36A 2WIMA 5DVMA 1T6VN 3FU0A 4MRBA 3AG3B 5DZ9A 4P2QE 4PRNB 4FQQB 2L7QA 4Z1PA 3OJVC 4UNTA 3UJIL 2HFTA 1FFPB 1CIDA 3BPOC 3O11B 4FLOA 4ZQKA 3G5YB 4XVUC 1JGVH 1SBSL 1FZJB 4HXAH 5CSZB 1ZLSH 5IROC 1KJ2B 4KK6D 1I9JL 1T89A 1TYRA 4QO1B 4ILDA 3SBRA 7FABH 5D1ZD 3IKCA 5LBSL 3WG7B 2GC7C 4U1KA 4KKPA 1D5XB 3HPLA 1J1OH 1LEIA 3BVUA 3Q05A 5SWSA 1XZWA 2Y5TA 4PH8A 4QEGA 4KZEL 3GRGA 4RAHA 3ZT6A 3WEAA 4FXGA 1KIPA 1CXLA 3DYPA 4DVBA 2CRIA 1CICC 3LX9A 1DCEA 1TLMA 5I0XA 5I17B 4IKJA 2E5EA 1QPPA 5E5LA 3MFGB 1JWUB 1KBBA 2IGFH 4PY7B 5EIQA 2WVVA 4IKLA 4YBQC 4NAMA 3MRBA 5BQ7A 3U6XA 5B38B 5BS0E 1C08B 4TUJA 2Y2WA 5I8EB 4KKBC 3L2LA 3ZUNC 2QADB 1UA7A 1NCHA 4LLVA 3D30A 4PD4K 5K93A 4HUWA 4EN2A 1L5GA 1EMTH 3BKJH 1A6WH 4F33A 1M71A 4G1MB 2ZF9A 4PRDA 2EXWD 1WP6A 4ZUWA 5F1IB 2G2RA 4PV1C 1AO7B 1UUSA 1D5ZA 3IPEA 4JCMA 4LLUA 3UC2A 1UOWA 1YUHA 1HWHB 5KJ4A 4FQJH 3H42L 4PJBF 1JGUL 1XF5B 4HCRH 2ZNWA 5AAMC 5HY9B 3IDUA 4UQ2A 3RPKA 2D4FA 4DVRH 2F58L 2IV9A 4C58B 1CVSC 2D7OA 3EDKA 4AKOA 4DGWC 4JPKL 4E41D 5HDLA 2X1OA 3RWEA 1C5CL 3GXMA 1VJSA 3DGGB 2ALAA 2XHNA 4N0UB 3LZFH 3MRDB 4NZUH 1GYWA 4LLMB 1UG9A 5DO2D 2R69L 3L08A 4YQXL 1PCSA 2YBGA 5D7SL 4ODVH 4HD5A 2ROXA 4D9LH 5FV2A 4L1DA 1T6BX 4L5FH 3AU1A 4M5ZL 3BFQG 2ITFA 2NTSP 3MVSA 4G5AA 4L8SB 2I9TB 2H6PA 3S7GA 4K3DH 1NCIA 1NBVH 1GRWA 4JFXB 3LHPL 3SPVA 5GZND 5HYJD 1G7PB 3FMGL 4F7CB 3BPNB 3MGAA 3G9AB 4N0YL 1Z7JA 2BSTB 3ABKB 1QFWI 3F6JA 4N1CA 3BUQA 4QR7A 5A2KH 1X7TA 4WENB 1QTPA 2GC4C 1KULA 4CILA 4KK9D 4AK2A 4W9JC 3ATBA 1NMBH 5E8PB 3GB7A 1WO2A 3PY9A 4CC4A 1F6FB 1IU1A 1NCAL 4GMSH 3T77B 2XC8A 3SE4C 2QR0A 4WEMB 1QWHA 3BKMH 1RD6A 4P3CH 4KKNA 4NQXA 2EXTA 1WZ1H 4O02H 3NZSA 4G80A 3ZDYF 5K59E 5L9DL 3DRQA 2YK1L 1CWVA 3T4AC 1MJ7L 3DBXB 2XICA 2MTAA 5D1XA 3REVB 1CL7L 1DLFL 2CD0A 1WUZA 4FMVA 1QHPA 3GSNA 1R75A 1ET8A 5DT1L 1ZK5A 2GITB 3QA3B 2NW3A 2VCOA 3CN1A 4AJWA 1UD6A 5KBKA 2VR4A 4PJAE 5AOLA 4S1RH 2VH5H 5KYYB 3MQIA 3B1UA 1DN0A 3VG0H 5A2AA 4F7PA 1ML0A 2ITCB 1FE8L 5C07E 4PJ5E 4I0PB 3Q48A 3V9FA 1R47A 5GGTL 4M8RA 4GRWF 2ATPA 4OZFH 4ZAKC 3FOLA 3MRNA 4ZPVB 5DEFA 4YHKL 4WKZB 1MIMH 4XCFL 3T4YB 2BNUA 4HSQA 4UILL 3BLBA 2YD3A 2NYKA 4NC0B 4JANA 3JWDH 4OI8A 2W5PA 3NIDB 4MA8H 2C1PB 3S3PA 3PAZA 4FQXB 2RFXA 4PJFB 1JPSL 4YR6A 3UGXA 3IMSA 2AJUH 4XCYB 2YC1B 3IF1B 3E6HB 4P4RA 5FUCC 4YFEA 2HT4D 4FNRA 1JHLL 1WHOA 1J5OL 1G7HA 1IEAA 4KHTH 1OE3A 1XEUA 2JKJA 4Y16C 4B5EA 1GXEA 4Y2DA 4G5ZL 5C0RL 1WC7B 2L0DA 2OTWA 3RDTB 4IHOB 4HIIB 1SEQL 3APFA 5EO9B 5ESAA 1KJVB 3NRQA 3WUZA 4MQSB 1T2JA 1K2DB 2I5YL 4S11A 2DY2A 3KPOB 2F7QA 4XO8A 1L0YA 1JPFB 3GO1L 2LVEA 4WWKC 3CVIH 4C4KT 3D4CA 2YD6A 1JDAA 2J6WA 3FW6A 4XB8A 1BZEA 4F58L 1T0OA 3N1FC 3CDZB 3DOSA 4UBDC 4XOEA 4X4XA 2B1HL 5FLVA 1KDJA 2Z4QB 4KJQD 3SYCA 4MXVE 4PCTA 4UQDA 1RUPL 3C9NA 1A64A 5FOBA 1I3RB 4CADA 2WNKA 1QLEB 4Y8AA 1TTFA 1TQCC 4W9EC 2UXTA 1HEJC 4OLEA 3RJOA 2VZOA 1KF9B 3SHSA 1OM3L 3NN8B 2A5UA 4GEJA 1G0YR 2XRAL 3W38A 5DEZA 1P7KB 4GBXC 1IGML 1HQRA 3BQUB 5BPPA 1PY9A 1P9MC 4DETA 1T0NA 5L4IA 5I1CH 4X6EA 5HI5D 1EUUA 2PPFA 1Q0YH 3WEXA 1C12B 4PJ9C 5IW6B 2VC2L 4L8BB 2XZAH 3V7AG 3DSFL 2HMIC 4TULL 5TQ2H 3QUYC 4MXQC 3D25A 4PRID 4EI6A 3LSOB 4JDZA 2D03L 5C2UB 1EJ8A 2OM5A 4ALAC 4YSUA 2WLHA 3UTTB 3QPQD 4XP6L 2BP0B 1NMAH 3RZCD 3E8VA 2LHAA 3QHZL 3BZFB 2B4CL 3BEVB 2NCEA 3UZQB 3D87B 5FB8B 2VITB 2X9XA 1P5VA 3ZTCC 2IFGA 1DVFC 2Y23A 1AAJA 4KH2A 2BNQD 3V10A 1WF5A 4XP4H 4NC2B 3H56A 4M6MH 1VGKB 3F00A 3M45A 3U4BH 3BPLB 1R19A 4X5QA 1CLOL 1TVHA 3TBWA 1KIUB 4BH8B 4AYBA 4KRPC 2WTRB 3BQVA 1FRGH 5KSVB 3QUZD 3L9YA 1NFDB 3MLXH 4EZMA 3DMMD 3IFLL 3MJ7A 4P2OC 4R8WL 3DLQR 1E6OH 2AJYL 1DVTA 2O1AA 2N59A 3VXMD 3ILQD 2LTQB 4LBEA 1IFRA 3PG2A 5DURB 5IVXA 4MXWL 5H35B 2V2TB 1AGCB 2Y25A 1IJ9A 4TSAL 2OJZL 4NN5C 3BVDB 2OW7A 5GZOA 3TT1H 4NO0D 2AK1L 2NY4D 1D9KB 1WAAE 3R0NA 4JFPA 3INUL 2DIEA 2FH6A 4LP5A 4QRAA 4V1DD 4YL9A 4OCYH 2DLIA 5DHVA 5FA3A 1M53A 3STLB 2E7HA 3HC4L 2RJMA 5CEYA 3ESMA 4FXKB 1B2WH 1ZV5A 5AZ2H 3E1ZA 4QRSA 3G6JA 3Q2WA 4P23B 2XPGA 3RTQA 4B9GA 4Y0GA 1HH9B 5D2LA 1NCDH 5ERWA 1N64H 3IS0X 4NM8H 4Z3EA 5CJXA 3U2SB 3X12B 3PL6B 5FXCH 4WO4B 5CZRA 2CA3A 3FBQA 2QKIC 3PPEA 4R83A 5DHEA 2DW5A 1QMUA 4BCYA 3N41F 1NBYB 4FFYA 4XN7A 4AVJA 4N2IA 3QIWA 4WFGD 3P3TA 3E9UA 2CRMA 1QBAA 4N2GA 2NZ9C 4G83A 4LCVA 4FLQA 3NH7H 2X4PB 3EHBC 4H5SB 5HGAB 4D9RE 2WBXA 3C8KA 1XD0A 1SXCA 2HG0A 3A4DA 2JELL 3HG5A 3LDBC 3TYFA 3OG4B 2P8PA 4FQIH 4DGYL 2IPTH 5BZZA 1OSPL 1OT4A 4A6YB 1D5MB 3FS9A 1JD9A 3G6AA 3PHQB 1N67A 4AQZA 3DVNA 3L13A 1UA6H 2OCFD 3KXFD 4ZODA 3QDMB 3LZNA 2YD9A 2BMKB 4Z8FL 4JB9H 4OD2B 2ADJB 2PCPB 4S1DD 4J3UA 4MBOA 3SDAB 4LIQH 1N3NA 2QQNH 3FRPG 4OLXH 4UQIM 2VO8A 5B1CA 4G7YL 1P5UA 3HG1B 1OK0A 3FJTA 2FJUB 3GTNA 4Z3TA 2JE8A 1A6AB 4IRSA 4L4VA 2XU9A 4AMXA 4F92B 3ZE1B 1JE6A 4A7UA 1MCOH 3EYSL 3KDMB 3N9GL 2NY5C 4H8QA 4TTGA 4HSAC 3C12A 5KOMC 3N42F 3HZYA 1JNHB 1EIBA 5IEKB 1IGIL 4DKEH 1A3ZA 2XJKA 5IG7B 1WTGT 1IAII 1LO2L 3NP4A 2J73A 4G7VL 4WHYH 1XF2B 3TA3A 1A6PA 4MMYA 1YN6A 2P5WB 1WFIA 4XVUD 5FF6A 2B1AH 1TQBC 3RWHA 5J9PA 1EHLL 5IROD 3WJMB 4JVPA 3CMGA 5B4MC 5K69A 4UB0L 3PWUB 1RH8A 1OAUH 1SUJA 1XTMA 4HS6A 3SGDI 3U46A 1DEDA 4PB0H 5T1DL 5KJ7E 4BFBD 3EOBB 1YY8A 3QEQD 4ALAH 1I82A 3EOAA 5AENA 4UU9B 1MHEB 4FZEH 5D7IE 3EOYG 4M7ZC 4OLYL 2NR6A 3OKEB 3ULVE 1CLCA 5F7LB 1CICD 2XV0A 2NUPB 3CZGA 5JTWA 1XGTA 4KXBA 4BWTA 3ZKXB 4H20L 3FL7A 2WZPA 1BQHB 5GSRA 3GRBA 4YBQD 5JHDE 5EU3B 1PZCA 1A1OB 2A4CA 2XFXB 1KLGB 2PUQT 4AC2A 4JL1A 4KKBD 1BVKA 5C6TH 2JTDA 1OXYA 2Q8AH 5F7AA 2NYZA 2ZOLB 1UFUA 1VESA 5SWZA 3SQBB 4LVHC 1V3LA 5CLWA 1IBZA 1MCPH 1O7DC 1MVYA 4M6NL 1FV1B 1PCXA 3WFHA 3ULVL 5DD1H 4F15B 1XIWC 3IRCA 1H3PH 4KUCD 3HAEA 4RFOL 1G7LA 3ZMEA 1WFMA 2HKFH 5ABDE 3TF7C 1MI5E 2ZXWB 1U8OA 1XR8B 2G3XA 2BSDA 4DPAX 5BUPA 4OFIA 5KYNA 3A4AA 4IIQB 4XP5L 1U8IA 2YMXL 2OAAA 5DEJA 1IBGH 4J8RB 4MVBC 5T1MA 5JQIB 3NCYP 4KK5C 1IKNC 4ZUVA 3DMMA 4N8CH 3S3SA 5IESL 2EH7H 3L3KB 4QHUB 1GYAA 2ZXEB 2RB8A 1AY1L 2N01B 2ZJSL 3QZOA 3KWVA 5GRXG 5HHXL 3ZZLA 3MJWA 1ILUA 1J1XH 3LEYH 4XMXA 2AXGA 1S4IA 2OMWB 3PABA 4NQCD 1FLTX 2E59A 2CG9X 5DFVC 3V52L 4DP6X 1EFQA 1DVZA 2WPGA 3OR7B 3NEXA 2BSSB 3QWOB 5FIEA 4EUPH 2R2EA 5HHME 2BK8A 3E6FA 1AKJD 1HHKB 2CJSA 4MMZB 4YZFF 3AWFA 3LRHA 1J0HA 1XCQA 4R0LA 4RCAA 4N8PA 1MZZA 4NQEA 4Z95L 1ZVYA 2BCKA 1NLBL 1QW9A 1I3GH 3LZLA 3OHXC 2AEOA 4O2CB 4XB3A 3VYPA 1HWWA 4S0SD 3IDNB 1J5IA 5E7BA 1XQ4A 1EHXA 2YPLE 2F53B 1N2RB 5LG6A 2HVJA 4ABUA 3D85B 3NEEA 3QNYB 1WT5C 5L6YH 3BKYH 1QI4A 4K3JL 3UP6A 1W8EA 1KNOB 2CBOA 1SOSA 1ZIAA 3PGDA 3WS3A 4GG6F 2ESVB 4RETB 2GG1A 3D1MC 2D7MA 3MROB 4WY7H 4TVUA 3RY5A 43CAA 2J2ZA 2NSQA 2GK0A 5JORA 2EZ0C 3ZR5A 2KBGA 4GINA 1HINH 3DTUB 2GQHA 3ISWA 5DTFB 5SWQA 1ADQL 1NUNB 1QBLL 2FO8A 1A4JB 2CLRA 4IJ3B 4XP9H 5CLYA 3QORA 2B20A 4HUCA 3T09A 3STBA 1FNSL 1ZLEA 1FIGH 4I2XE 5LNGA 2CJTA 4IOIB 2NY5H 4JUTA 4QRRD 2Q8BH 1XF4B 3Q6FB 1JZ3A 3T2PA 4M1DH 5EUKB 4EEEA 2UZIH 4O02A 4ZAKD 1TTUA 3RNQA 2EDFA 1MFCL 4X8CA 2LT9A 3BH8A 1DVXA 2FECI 1A14H 4FP8H 5KVEE 3QQ3B 3RKDC 2R0LL 3NP3A 2HB0A 1PZDA 2JXMA 5CFHA 2WLLA 1K85A 2CBMA 1RULH 5DEGB 4AGNA 4X5XB 2A9CA 1EFXA 1BAFH 4K8RC 4G7RB 1IVTA 5T3XH 4Y16D 2CNYA 1RFDL 3FQ1A 4PVNA 4ZUUB 4N2EA 5HHQB 3VD5A 1MAMH 4GUQA 1FYTE 2FWOA 1FVCB 1RIVH 3DHJA 3EOTL 5GS1B 4C56E 3V6BR 2OI9B 1B9ZA 2OZ4L 1JZFA 2VZ1A 4I89A 2MOVA 2WIIB 4JHBA 1ZVHA 4KU1A 1M7UA 3QJUB 4WWKD 1G0XA 4G2AA 3MRRB 4GRLC 5E9DA 5KVEL 2ZPKH 4QAMB 1HEZB 1L0QA 1W6LA 3FH7A 3FYEB 3OAWA 3UAEA 3GGWA 4URKA 4UBDD 4BH7A 3D2UB 1JNLH 1HYRC 2GUYA 5IROA 2A9DA 2FWLB 5KSBB 3WAJA 2H0JA 1LO3H 3FUNA 2WMPB 5LCVH 3EBAA 3SBQA 1BZ9A 3VD4A 2HVKA 3E3QC 5AWNH 3GEWB 2PWHA 3PUUA 4MD5B 1A4AA 1FJ1B 4GBXD 2FR4A 3HRZC 2YRZA 5F89A 4AEFA 3B34A 3FCTA 3VGBA 4FNTA 1H19A 4HPYL 5E2UL 4PJ9D 3B7YA 1PKQE 4WO0A 3VU1A 1F3JB 3VYNA 3WDIA 1OGAD 2B59B 4DGIH 3HC0B 2HMID 1NJ9A 2C3VB 1GGCH 4PGCA 4PJHE 1CZ8H 1ZT4A 4PV9A 4Y5XB 5LGJA 3QUYD 4MXQD 3FRPA 1BYOA 5C08D 4XC1L 2AP2A 1DZBA 1OSEA 3RWJB 2GAZA 2VZTA 4B7LA 3HNSL 3W0WB 3VFOB 1WS7A 3LN4B 4CBPA 2CKBL 2CWRA 5JXAH 3GTVA 1DVFD 5HYJB 1TJGH 4G9DB 4OTXH 4U3HA 5CWSA 1YNLH 3CNKA 1CK0L 2KZ1B 1OF0A 3FB7B 2Y2YA 1OY3B 4WU7B 1U3HC 3SJVE 3WNLA 5KSAA 1H15B 3RG1C 2VERA 2BPBA 2ZP9A 1IQWL 4KMQA 1YYML 2D7TH 4Z7UE 4DH2A 3S35H 5A16A 3AAZA 3UG4A 4BA8A 4UIMA 1ZDQA 1UOVA 2B7DT 1U3ZA 2GABA 3S97C 3MR9B 4P46C 3FFOA 1YEEH 4P2OD 4Q2ZB 1W0VB 1VADB 2Y3NA 3CCHA 3QFJA 2GTZA 5J6GA 4Q58C 1R46A 4AEIL 2V7NB 2WN3A 4HIQA 4G9FE 3WKNA 5EC2B 3CDGB 1WFNA 5EZOL 4BFIB 3EH4B 4Y9BA 4F7TA 5AW6B 5J11C 4NENA 5GGRY 1I85C 3B9VA 2NY6C 4QWWC 5BV7B 4MNQE 2IH1A 5C6PB 4ZX4A 4ZD3L 1FO0A 4RRPM 4AQ1C 4EKJA 4OZGA 2IFFH 4JPVL 1XD1A 4TQPA 3QXDA 4X0KA 5AVZB 1EWHA 2Z7ZA 2WCGA 3BWAB 4PB9L 4NN6B 1FAIL 1BMWA 2WQSA 2YLHA 5JW3H 3BUTA 3KW8A 2VABB 5IV2A 3NSJA 4KXZI 1XL4A 3N43F 3WN6A 2WKLA 3S88L 4L4TE 1TEGA 1SXZA 3E38A 1MPAL 1TT6A 2E8ZA 3X3FH 1LE5B 4PRHE 1XX9C 2X4RA 1BVNP 1PZAA 1SGKA 4XCCH 1GW6A 5IQ7H 1MLCB 3OGCB 4XNMA 3RWDB 2VLRE 2N1TE 1NAKH 3LS4L 35C8L 4JG9A 1KEML 4N8VB 3WFCL 2QGBA 5FEBA 1FVEB 4A7GA 1WZKA 2X6CA 4J27A 5DJ6A 1DCLA 1KFAL 1LP9F 2NZ9D 4JM2C 4UQBA 4K8RH 4MNGA 4NNXB 1ETJA 4QRPE 4LL1A 3LXBA 4ZFGH 3VNZA 3EHBD 1CFMA 5IQMA 3SQOL 4LCWE 4OAWA 1DBAL 2FYYB 1DQDH 2PP8A 2O6DA 3QULB 4QKTA 1OWRM 4LKCA 4QRRA 4AYDC 1SDAB 2P26A 2UVFA 3GRWH 3P4OB 4LLQB 3MV7D 4XC3L 5EU6E 4AGQA 3PXHA 1BOYA 1ZSDB 2DWDA 3V6FA 5FYJU 4YH6A 2OMZB 4NRXB 3ZTJH 3IVKA 3DO7A 3FQRB 1XCTB 2K7PA 2YSSB 5ACZB 4XPGH 4K5MA 3FKUS 3RWCB 2EVGA 2V2WA 2A9NH 3TFKC 4LPWA 1HL4A 2GUOB 4N6RB 4EF3A 2JCCF 2EEBA 4MQXC 3FT0A 1J8HB 4PYGA 4LCUB 4Y8DC 1T5XA 4GRWB 4EVNB 2E9JA 3L3DA 5FDWB 3RGVA 1CTMA 4FTVB 3SDXA 1MCCA 4LAQL 2ARJA 3T5WA 3TH3T 2QGCA 4MDRA 4DO6A 2VAAA 4P8QA 1PYWB 2O6CA 4M7LT 1RVFH 1XH2A 5L8JB 3AGWA 4MZ3A 2JQAA 3VGHA 3IN2A 3SKMA 1MW1A 3