2CAMA

Avidin mutant (k3e,k9e,r26d,r124l)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
b'RECSLTGEWTNDLGSNMTIGAVNSDGEFTGTYITAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIDIN
publication title Biochemical characterization and crystal structure of a recombinant hen avidin and its acidic mutant expressed in Escherichia coli.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Glycoprotein
total genus 24
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2camA00
2C1QA 1VWFB 3X00A 1SRIA 4Z6JA 4BJ8A 3T2XA 1RAVA 1SLEB 1RSTB 1SLDB 1SRGA 3PK2A 4Z2VA 3RDMA 1SWGA 3EW1A 4CPHB 1VWBB 1LDOA 4Y59A 1HQQA 2GH7A 2OF8A 1SRFA 4Z2PA 3SZHA 1SRJA 1RXKA 4Z28A 1HXLA 1RSUB 3SZIA 3VHIA 4JO6A 4GJVA 3RDUA 3T6FA 1NDJA 3RDXA 2CAMA 2IZDB 4BX5B 3WYQA 1N7YA 1I9HA 3RE6A 1HXZA 1SWOA 3RDSA 2AVIA 5B5GA 2IZHB 1VWJB 5B5FA 2RTNB 4JHQA 1VWDB 3EW2A 1Y53X 1DF8A 1MM9A 5IRUA 4CPFA 1SWQA 3VGWA 1SWLA 2C4IA 4BX7B 4GGRA 1KFFA 1SWFA 5F2BA 2RTRB 1Y52X 1SWRA 3MM0A 1SLFB 1HY2A 4IRWA 1LELA 1VWPB 2BC3A 1VWIB 5IRWA 1SWCA 2Y32A 4I60A 3RY2A 1LCVA 1N4JA 3WZQA 1SWAA 3VHHA 1SRHA 4GDAA 1VWLB 1STSB 4U46A 4BCSA 5K67A 5L3YA 2A8GA 1VWMB 4BX6B 1VYOA 5CSEA 4CPIA 4CPEA 1WBIA 1SLGB 1KL5A 1SREA 2RTAA 3WZPA 1SWJA 2FHLA 5IRAA 2IZBA 1VWQB 1N43A 2RTLA 1SWSA 1VWHB 2IZLB 4EKVA 4Z2OA 1VWAB 2OFBA 3RDOA 2C1SA 3RDQA 4GJSA 2IZKA 1N9MA 1N9YA 4CPHA 1LDQA 2UZ2A 1MEPA 1SWBA 1KL3A 2IZGB 1VWRB 1LUQA 2JGSA 4OKAA 1SWNA 3T6LA 1MOYA 1NQNA 1VWGB 1KL4A 3WZNA 3WZOA 2RTHB 2RTFB 1SWHA 4BBOA 2OF9A 2A5BA 1LCWA 1MK5A 1RXHA 2IZEB 2RTEB 2WPUA 2UYWA 2IZIA 2RTDB 2RTKA 3VHMA 1SWTA 2IZJA 2RTGB 1STRB 1AVEA 2RTOB 2IZCB 3T2WA 1VWEB 5CHKA 2MF6A 4Z27A 1SWPA 2Y3FA 1SWDA 1SWUA 2RTPB 4BX6A 1VWNB 4BX5A 2OFAA 5JD2A 4YVBA 2RTMA 2QCBA 1RXJA 1VWCB 4GGTA 4JNJA 1PTSA 3WYPA 1NQMA 1STPA 1SWEA 1AVDA 1NC9A 2G5LA 5K68A 2ZSCA 1VWKB 2FHNX 2RTCB 1SWKA 1NBXA 2RTBB 3MG5A 3RY1A 3FDCA 4DNEA 4BX7A 3RE5A 2F01A 2RTIB 3SZJA 1Y55X 1VWOB 4GD9A 2RTJA 2Y3EA 2A5CA 4Y5DA 2IZAA 1IJ8A 1LCZA 2IZFB 4GGZA 2RTQB
chains in the Genus database with same CATH superfamily
1Y9LA 5HZQA 3STNA 1ICMA 3PP6A 3QKGA 4YKMA 1SRIA 2BLGA 4BJ8A 3T2XA 1EUOA 5FFHA 1FE3A 3PK2A 2HZRA 4Z2VA 4AW8A 3JSQA 1SWGA 3RDMA 1N0SA 5F6ZA 3O22A 4D6AA 1YUPA 3EMMA 2HLVA 2BS5A 5D47A 3BS2A 2GH7A 1Y9TA 4QZTA 1LIBA 4TKBA 1BJ7A 1GX3A 2JMBA 1SXXA 2QO6A 1SRJA 1RSUB 3VHIA 1OBUA 4EXZA 3STMX 3VE1A 1YWBA 4AZOA 1CBRA 1MX7A 2PI3O 2F73A 4NLIA 1Y0GA 4GUZA 5HCEC 3SLTA 2W2AA 5LKFA 3RDXA 5HZ8A 2CAMA 2GTLM 1RLBE 2WEWA 4MISA 4DCBA 2AT3X 1I9HA 3VG2A 4TJZA 4CDFA 4K19A 1LKEA 5B5GA 1S44A 4ZHDA 3FIQA 3WJDA 1GM6A 2CZTA 2RTNB 2GTLO 4OMXA 3K3LA 2JW1A 1MM9A 4CPFA 1B8EA 1FDQA 4M6SA 3ZW0A 4ORUA 1LFOA 3FA7A 1BRPA 1KXOA 1ACDA 3DTQA 1KFFA 2R74A 1GT3A 5F2BA 4YDAA 3MBTA 2QM9A 3MM0A 1EPAA 4OS0A 4IRWA 4QAEA 1LELA 1LIEA 1VWPB 3RWXA 3HWFA 4GETA 1BRQA 3TF6A 5LJKA 4ZFXA 3FIDA 1ZNEA 2P8GA 4PSQA 2CBSA 4QNIA 3RY2A 5B27A 2AKQA 3PDFA 3VHHA 5F7GA 3U9PC 4BCSA 1BM5A 3OJYC 1T68X 4FGIB 2ANSA 4YGGA 1L6MA 2JU3A 3TGAA 3E3CA 2KW1A 4YBPA 5LJEA 3OBLA 4KH8A 1SLGB 3RKGA 2CM9A 1K24A 3C76X 4OMWA 1G5WA 2I5ZO 5EPQA 4GH7A 1N43A 1SWSA 4DQ4A 1VWHB 2IZLB 1ALBA 1MVGA 4IB9A 1SY3A 3APXA 3ZW1B 1N9YA 4NNSA 1O8VA 4XMCA 1KL3A 2JGSA 3EBWA 1SY0A 2FS6A 2FKGA 1FTPA 1JJXA 1MOYA 1JYDA 4U8UO 1VWGB 4DQ3A 4AZNA 5KICA 1QFVA 2RTHB 1ZNKA 3CBCA 4L3RA 4U8UN 2A5BA 4L1NA 1CBQA 4BGFA 3FELA 2IZEB 4BBOA 2QOMA 2X34A 2UYWA 2RTDB 3GE2A 1VYFA 3L4RA 1SWTA 4NNTA 4IB7A 1BEBA 1STRB 5BYPA 2IZCB 5HAEA 1VWEB 1K3BA 1P6PA 3UEWA 3V8UA 2FRSA 4GE1A 3PH5A 2Y3FA 1SWDA 4ZCBA 5B29A 2OL8O 5AJBA 5IO7A 4BX5A 2OFAA 3OD9A 4YVBA 2NNEA 2FR3A 1QY1A 4FQBB 2QCBA 4I6SA 3ZW0B 1IKJA 4R0BA 1X8PA 3FR2A 3PECA 4IMNA 1PTSA 3RBYA 2X32A 4HPDA 4RUUA 1JIWI 3ZUIA 5LJBA 1STPA 2WWPA 1E5PA 1GT1A 4ORYA 4WFVA 3JQOA 2ZSCA 2RTCB 1SWKA 3MVFA 1RBPA 3KQ0A 3F6ZB 2X4MA 1QY0A 3FMZA 4A60A 5IO5A 1MX8A 3ZWEA 2KTSA 2RTJA 1EW3A 1FENA 1OPBA 4Y5DA 1E00A 2LBAA 4YGZA 1D3SA 1KT7A 2IZFB 5DG4A 4Y0RA 1FELA 3PQUA 3G7XA 4GGZA 2RTQB 4QGVA 3SLJA 2C1QA 1OPAA 1VWFB 2Q39A 2KTDA 2RCQA 2BSZA 4KC7A 1KZWA 1JJUA 3NQ9A 1RAVA 1RSTB 4IABA 3FA9A 4ORRA 1MUPA 4TKJA 4BQUA 1JQPA 4YFRA 3ZQ3A 1W5RA 1VWBB 3WJBA 3S5VA 1YP6A 1EQDA 2OY5O 2GC9A 4MEEA 4ODDA 3ZI8A 5HA1A 5HZ5A 2OF8A 1KT5A 1SRFA 3P6EA 4GNYA 3B2JA 2QO5A 1LIFA 2AF5A 2FT9A 3ZW2A 3KZAA 1A2DA 3SZHA 1G85A 4ZR2A 1RXKA 4HPAA 4ALOA 1KT4A 4JO6A 2BS6A 3KFHA 1CRBA 2ASNX 5B10O 5LJGA 3T6FA 4U9CA 4O3YA 4ON1A 3FEKA 1DC9A 1XKIA 4XMHA 1N7YA 3HPEA 4A1HA 4BX5B 3KFFA 2E4JA 2LFOA 1SWOA 1LIDA 3APWA 1I4UA 2IZHB 4AYHA 4AZMA 1VWJB 1XCAA 4GKCA 1H91A 3EBKA 2LKKA 4JGLA 4IB6A 1Y53X 1ZNGA 3FW4A 4HPBA 4IMOA 4CDEA 5CE4A 1X8NA 3CQRA 3AUMO 3HK1A 3D95A 3VGWA 1S7DA 4KIIA 3NX1A 3APUA 1IIUA 3BU9A 5F1EA 1SWFA 4O3XB 2Q2PA 3VG3A 1UREA 1ZNDA 2CBRA 2JU8A 2RTRB 4ZJ0A 1UZ2X 1I04A 3VG5A 1QG5A 1DZPA 2RD7C 2KD2A 2RN4A 1T8VA 2AMMX 4I60A 1LCVA 1N4JA 5D8JA 1STSB 2AT6X 3CQNA 3UAQA 1JYJA 1VWMB 1GT5A 2IFBA 1VYOA 3P02A 4Y0PA 1YIVA 1ZNHA 5AJCA 1DZMA 2Z4HA 2JU7A 4U3QA 3RZYA 5KHPA 5HTDA 1EPBA 2A2GA 2QO4A 3NR3A 4O3WA 5IRAA 2DJGA 3FW5A 3P6DA 1ML7A 2OFBA 5D48A 2C1SA 2XKLA 4CPHA 3N91A 1EIOA 3HTYA 3HWEA 1UYOX 1QWDA 1VWRB 2NNDA 1QY2A 1OSPO 3BY0A 3NADA 4ES7A 1DZKA 4EQAC 2OVSA 4GU8A 4GZVA 1E06A 1NGLA 1X8OA 2BHVA 4A1YA 1KZXA 1ERXA 3U03A 3P6GA 2L67A 4O4SA 4TLJA 1LCWA 1RXHA 4YCEA 5FQ8E 1HMTA 1PMPA 3CBSA 1GX8A 3TGCA 2IZJA 2RTGB 4CK4A 1AVEA 5CHKA 1A3YA 2DJFA 3B2LA 3FA8A 1SWPA 4I3CA 2RTPB 4MVKA 4BX6A 5HCCC 1JMZA 5FQ7E 1I78A 4CSBA 1RXJA 2LA7A 4GK9A 4IB8A 3KFIA 4GDZA 1HBPA 2JOZA 1KT6A 3WJCA 4NV8A 2WQAE 4ORSA 4I3DA 3PEDA 4U8UM 5K68A 2VFCA 1VWKB 4MVLA 4OS8A 3HOEA 2VFBA 2AL0X 2RTBB 3CKGA 3CR6A 3KVNA 4DNEA 1DZJA 1HBQA 2ZAGA 4FBVA 4GD9A 2AT8X 5LJHA 4XMFA 2A5CA 2HZQA 1GX9A 4ML7B 5CYBA 4ZGFA 4A8ZA 2AT5X 3Q6LA 1IJ8A 1MDCA 1LCZA 2ACPX 2R73A 3UEXA 3X00A 5FQ6E 3BDRA 3RSWA 3S60A 1X89A 2A0AA 4Z6JA 1SRGA 1SLEB 1ICNA 3BRNA 3EC5A 4GRJA 3I17A 5HZ6A 3WXQA 4CPHB 3EW1A 4BOEA 1Z24A 1LDOA 2LB6A 2X45A 1HQQA 4I95A 4UU3A 4Y59A 4FBRA 4IBAA 1KGLA 5BVSA 5DPQA 3VG6A 3BLGA 5L8OA 2FGSA 3H3IA 3ELZA 3ZUOA 3SZIA 2FKJA 5H9AA 3PH6A 3APVA 4GJVA 1G74A 2KT4B 3O19A 4NP1A 2X55A 3NP1A 1QABE 3FYFA 4WFUA 2IZDB 1DFVA 3WYQA 1OEJA 3RE6A 1AB0A 3MX7A 2MO5A 4AZRA 2XSTA 1CBIA 3PPTA 3RDSA 2AVIA 5B3MO 3Q34A 3B2IA 4B55A 1HN2A 1YWDA 2ZAIA 4XMDA 3HWGA 1YWAA 1YWCA 3D4RA 5H9KA 4ALBA 3WVMA 3UEUA 5IRUA 2WSJA 4IAXA 3BX8A 2A3FX 2OY7A 1SWQA 3NQ3A 1W6FA 2C4IA 1JMXA 3P6HA 5H9LA 4ARHA 1X71A 5LJCA 1X8UA 4ZGUA 5EDBA 5BVTA 1FEMA 1SXWA 1SWRA 2I5VO 1VPRA 4INNA 1GGLA 3P6FA 5IRWA 1JBHA 4EEJA 1JJJA 1SXYA 4TKHA 4O4UA 2AH7X 1SWAA 2N93A 1SRHA 4D6BA 2FR2A 4U46A 4LKPA 1TOUA 5H8TA 4MVIA 3O2YA 1G7NA 2HNXA 3FLLA 4ZH6A 3STKA 2OL7A 3VG4A 5K67A 1A57A 5EDCA 4O4OA 5CSEA 4CPEA 2OL6O 4YH0A 1NP4A 1KL5A 1OBPA 1LPJA 1HMSA 2RCTA 1B4MA 2RTAA 3KFGA 4XMGA 3WZPA 1SWJA 1VWQB 1AQBA 1LNMA 1W4TA 2Q9SA 4UU2A 1UYNX 4EKVA 4NYRA 1BSYA 1IW2A 1HMRA 2X8FA 3LTWA 1D2UA 4GJSA 2IZKA 3RDQA 2MWHA 1LDQA 3I0AA 5FENA 2IZGB 3C77X 3AKNA 1LUQA 3IA8A 4Y0QA 5H9NA 1PM1X 1TW4A 1GXAA 2HMBA 4LZVA 4YDBA 3SLOA 3T6LA 4ZHFA 4M7MA 1KL4A 3FA6A 1LF7A 4N7CA 3P6CA 1IFBA 4LQZA 3NPOA 1DV9A 2OF9A 2OY8A 3VE2A 2YMSA 3FENA 4O9SA 1MK5A 4QYPA 5EZ2A 1I05A 2WPUA 3VHMA 2IZIA 1ZNLA 2RTKA 3WZNA 2RTOB 2WEXA 5EEDA 3T2WA 3TZSA 4FBOA 4CDDA 3B2HA 3C78X 1GT4A 4O3ZA 1SWUA 1SY2A 1TXLA 3FR4A 3FEPA 1DF3A 2POAA 4GGTA 1AELA 2OFRX 4JNJA 4QZUA 5KIDA 1U0XA 1PBOA 1NQMA 1ERBA 1SWEA 1NC9A 2VDFA 2WQ9A 1AVGI 2RA6A 4EFGA 4YKOA 4HFOA 2X46A 5HCDC 3FR5A 3RY1A 3MG5A 5BVQA 2G8CO 4BX7A 3HOLA 3P24A 3RE5A 3VU1A 3D96A 2OFMX 3CKFA 1KOIA 2Y3EA 4O4XA 4BVMA 4YMYA 2FWVA 2NNQA 3AEHA 4NW4A 3WJGA 1ADLA 5EEEA 1KQWA 2ALLX 2BT9A 4KCAA 4COTA 2L5PA 5JR8A 3TGBA 2R56A 4LZUA 1BSOA 4YFQA 5AEOA 1BLRA 2OVAA 1SLDB 4RUNA 5HZ9A 2GTLN 3WBGA 3LV4A 2OY1O 1GKAA 2NP1A 4AZPA 4KC8A 4PJ2A 2G79A 3SAOA 1QQSA 1BWYA 4MVEA 5L8NA 4C5PA 4Z2PA 4ZHHA 4NYQA 1WUBA 4YBUA 4ZHGA 2CZUA 3QQ2A 1HXLA 2X8TA 4QRLA 4QYNA 5D4AA 4Z28A 4CV7A 4ZH9A 4ZHCA 5F58A 3D97A 4WHIA 1X8QA 1O1VA 4ID2A 4N7DA 3RDUA 2G7BA 1NDJA 1OBQA 4OEMA 1VYGA 1IFCA 3D9WA 2ACOA 2A2UA 2O62A 1HXZA 4NV7A 2X56A 4YFPA 5B11O 2FLJA 5IO6A 3AKMA 1U18A 1U17A 3S5XA 1KQXA 1BBPA 3DSZA 3S26A 5B5FA 3WOVA 4JHQA 3ZZVA 1VWDB 3EW2A 1JV4A 1DF8A 1S2PA 3UEVA 2X8SA 3B2KA 5LJDA 2OVDA 1SWLA 2RQ0A 4BX7B 5HA0A 3NX2A 2W2BA 2K23A 2F09A 1FJ1E 1Y52X 1B56A 2PY1A 4YGHA 1SLFB 1HY2A 3T1DA 2BC3A 3WJFA 1VWIB 2L9CA 1SWCA 2Y32A 1I06A 3JS1A 4NLJA 2W2FA 4I3BA 2YG2A 5B2AO 5HTEA 3WZQA 1PBYA 4QGWA 1B0OA 2MJIA 2WR6A 1VWLB 2GJ5A 3BU1A 4GDAA 4HWMA 4Y0SA 3NBXX 4I9SA 5L3YA 2A8GA 4TNNA 4BX6B 1BSQA 1LICA 3VG7A 4CPIA 1WBIA 1PEEA 1E2TA 2M4LA 2Q2MA 1SREA 3CMPA 4IAWA 5D45A 5HBSA 1GKAB 3ZW1A 2FHLA 2EU7X 2G78A 2IZBA 5LKEA 2QMIA 2RTLA 5AQ6A 2MM3A 2JN3A 2FTBA 4Z2OA 3BSZE 1VWAB 3RDOA 1KT3A 1EALA 1TOWA 3OE3A 2OYBO 1E02A 1N9MA 1SA8A 2UZ2A 1MEPA 1SWBA 4MIRA 1SY1A 4OKAA 3NQKA 4KT5A 1SWNA 1CJ5A 4TQ2A 1EI5A 1NQNA 4QGXA 2AT0X 1TVQA 1IKEA 4GNWA 2RTFB 1SWHA 1T0VA 4WBKA 4XMEA 3WZOA 5HWZA 2Z4IA 4GGRA 1OEKA 2RTEB 3HWDA 4OS3A 2CM4A 3F9DA 3ELXA 4I9RA 1R0UA 3F8AA 2MF6A 1SXUA 4Z27A 1NP1A 4ORWA 1YP7A 4EDEA 4AZQA 1VWNB 3GAQA 3PQSA 4HPCA 5JD2A 1EIIA 2K62A 1CBSA 3WJEA 2RTMA 4CDCA 1VWCB 2DM5A 1O1UA 1A18A 1SMPI 5IXGA 3WYPA 5F6BA 4OELA 3SOTA 3LHNA 1AVDA 3CWKA 4YCHA 2G5LA 2MHDA 2FS7A 2WUTA 2FHNX 4O49A 1OEEA 4ORXA 2OZQA 1HQPA 1NBXA 2L68A 3IFBA 3FDCA 5FAZA 2F01A 2RTIB 3SZJA 5K06A 1Y55X 1QFTA 1VWOB 2GTFX 2HYSA 2Q4NA 3VPJE 2HKDA 5C0NA 3BX7A 2QOSC 3EM0A 2IZAA 1JZUA 5L8IA 4LKTA 2LBVA 3U0DA 1EXSA 2OVEA 1ZRYA 4QQ1A 3EYCA 2A13A
chains in the Genus database with same CATH topology
2C1QA 1VWFB 3X00A 1SRIA 4Z6JA 4BJ8A 3T2XA 1RAVA 1SLEB 1RSTB 1SLDB 1SRGA 3PK2A 4Z2VA 3RDMA 1SWGA 3EW1A 4CPHB 1VWBB 1LDOA 4Y59A 1HQQA 2GH7A 2OF8A 1SRFA 4Z2PA 3SZHA 1SRJA 1RXKA 4Z28A 1HXLA 1RSUB 3SZIA 3VHIA 4JO6A 4GJVA 3RDUA 3T6FA 1NDJA 3RDXA 2CAMA 2IZDB 4BX5B 3WYQA 1N7YA 1I9HA 3RE6A 1HXZA 1SWOA 3RDSA 2AVIA 5B5GA 2IZHB 1VWJB 5B5FA 2RTNB 4JHQA 1VWDB 3EW2A 1Y53X 1DF8A 1MM9A 5IRUA 4CPFA 1SWQA 3VGWA 1SWLA 2C4IA 4BX7B 4GGRA 1KFFA 1SWFA 5F2BA 2RTRB 1Y52X 1SWRA 3MM0A 1SLFB 1HY2A 4IRWA 1LELA 1VWPB 2BC3A 1VWIB 5IRWA 1SWCA 2Y32A 4I60A 3RY2A 1LCVA 1N4JA 3WZQA 1SWAA 3VHHA 1SRHA 4GDAA 1VWLB 1STSB 4U46A 4BCSA 5K67A 5L3YA 2A8GA 1VWMB 4BX6B 1VYOA 5CSEA 4CPIA 4CPEA 1WBIA 1SLGB 1KL5A 1SREA 2RTAA 3WZPA 1SWJA 2FHLA 5IRAA 2IZBA 1VWQB 1N43A 2RTLA 1SWSA 1VWHB 2IZLB 4EKVA 4Z2OA 1VWAB 2OFBA 3RDOA 2C1SA 3RDQA 4GJSA 2IZKA 1N9MA 1N9YA 4CPHA 1LDQA 2UZ2A 1MEPA 1SWBA 1KL3A 2IZGB 1VWRB 1LUQA 2JGSA 4OKAA 1SWNA 3T6LA 1MOYA 1NQNA 1VWGB 1KL4A 3WZNA 3WZOA 2RTHB 2RTFB 1SWHA 4BBOA 2OF9A 2A5BA 1LCWA 1MK5A 1RXHA 2IZEB 2RTEB 2WPUA 2UYWA 2IZIA 2RTDB 2RTKA 3VHMA 1SWTA 2IZJA 2RTGB 1STRB 1AVEA 2RTOB 2IZCB 3T2WA 1VWEB 5CHKA 2MF6A 4Z27A 1SWPA 2Y3FA 1SWDA 1SWUA 2RTPB 4BX6A 1VWNB 4BX5A 2OFAA 5JD2A 4YVBA 2RTMA 2QCBA 1RXJA 1VWCB 4GGTA 4JNJA 1PTSA 3WYPA 1NQMA 1STPA 1SWEA 1AVDA 1NC9A 2G5LA 5K68A 2ZSCA 1VWKB 2FHNX 2RTCB 1SWKA 1NBXA 2RTBB 3MG5A 3RY1A 3FDCA 4DNEA 4BX7A 3RE5A 2F01A 2RTIB 3SZJA 1Y55X 1VWOB 4GD9A 2RTJA 2Y3EA 2A5CA 4Y5DA 2IZAA 1IJ8A 1LCZA 2IZFB 4GGZA 2RTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1Q A;  1VWF B;  3X00 A;  1SRI A;  4Z6J A;  4BJ8 A;  3T2X A;  1RAV A;  1SLE B;  1RST B;  1SLD B;  1SRG A;  3PK2 A;  4Z2V A;  3RDM A;  1SWG A;  3EW1 A;  4CPH B;  1VWB B;  1LDO A;  4Y59 A;  1HQQ A;  2GH7 A;  2OF8 A;  1SRF A;  4Z2P A;  3SZH A;  1SRJ A;  1RXK A;  4Z28 A;  1HXL A;  1RSU B;  3SZI A;  3VHI A;  4JO6 A;  4GJV A;  3RDU A;  3T6F A;  1NDJ A;  3RDX A;  2CAM A;  2IZD B;  4BX5 B;  3WYQ A;  1N7Y A;  1I9H A;  3RE6 A;  1HXZ A;  1SWO A;  3RDS A;  2AVI A;  5B5G A;  2IZH B;  1VWJ B;  5B5F A;  2RTN B;  4JHQ A;  1VWD B;  3EW2 A;  1Y53 X;  1DF8 A;  1MM9 A;  5IRU A;  4CPF A;  1SWQ A;  3VGW A;  1SWL A;  2C4I A;  4BX7 B;  4GGR A;  1KFF A;  1SWF A;  5F2B A;  2RTR B;  1Y52 X;  1SWR A;  3MM0 A;  1SLF B;  1HY2 A;  4IRW A;  1LEL A;  1VWP B;  2BC3 A;  1VWI B;  5IRW A;  1SWC A;  2Y32 A;  4I60 A;  3RY2 A;  1LCV A;  1N4J A;  3WZQ A;  1SWA A;  3VHH A;  1SRH A;  4GDA A;  1VWL B;  1STS B;  4U46 A;  4BCS A;  5K67 A;  5L3Y A;  2A8G A;  1VWM B;  4BX6 B;  1VYO A;  5CSE A;  4CPI A;  4CPE A;  1WBI A;  1SLG B;  1KL5 A;  1SRE A;  2RTA A;  3WZP A;  1SWJ A;  2FHL A;  5IRA A;  2IZB A;  1VWQ B;  1N43 A;  2RTL A;  1SWS A;  1VWH B;  2IZL B;  4EKV A;  4Z2O A;  1VWA B;  2OFB A;  3RDO A;  2C1S A;  3RDQ A;  4GJS A;  2IZK A;  1N9M A;  1N9Y A;  4CPH A;  1LDQ A;  2UZ2 A;  1MEP A;  1SWB A;  1KL3 A;  2IZG B;  1VWR B;  1LUQ A;  2JGS A;  4OKA A;  1SWN A;  3T6L A;  1MOY A;  1NQN A;  1VWG B;  1KL4 A;  3WZN A;  3WZO A;  2RTH B;  2RTF B;  1SWH A;  4BBO A;  2OF9 A;  2A5B A;  1LCW A;  1MK5 A;  1RXH A;  2IZE B;  2RTE B;  2WPU A;  2UYW A;  2IZI A;  2RTD B;  2RTK A;  3VHM A;  1SWT A;  2IZJ A;  2RTG B;  1STR B;  1AVE A;  2RTO B;  2IZC B;  3T2W A;  1VWE B;  5CHK A;  2MF6 A;  4Z27 A;  1SWP A;  2Y3F A;  1SWD A;  1SWU A;  2RTP B;  4BX6 A;  1VWN B;  4BX5 A;  2OFA A;  5JD2 A;  4YVB A;  2RTM A;  2QCB A;  1RXJ A;  1VWC B;  4GGT A;  4JNJ A;  1PTS A;  3WYP A;  1NQM A;  1STP A;  1SWE A;  1AVD A;  1NC9 A;  2G5L A;  5K68 A;  2ZSC A;  1VWK B;  2FHN X;  2RTC B;  1SWK A;  1NBX A;  2RTB B;  3MG5 A;  3RY1 A;  3FDC A;  4DNE A;  4BX7 A;  3RE5 A;  2F01 A;  2RTI B;  3SZJ A;  1Y55 X;  1VWO B;  4GD9 A;  2RTJ A;  2Y3E A;  2A5C A;  4Y5D A;  2IZA A;  1IJ8 A;  1LCZ A;  2IZF B;  4GGZ A;  2RTQ B; 
#chains in the Genus database with same CATH topology
 1Y9L A;  5HZQ A;  3STN A;  1ICM A;  3PP6 A;  3QKG A;  4YKM A;  1SRI A;  2BLG A;  4BJ8 A;  3T2X A;  1EUO A;  5FFH A;  1FE3 A;  3PK2 A;  2HZR A;  4Z2V A;  4AW8 A;  3JSQ A;  1SWG A;  3RDM A;  1N0S A;  5F6Z A;  3O22 A;  4D6A A;  1YUP A;  3EMM A;  2HLV A;  2BS5 A;  5D47 A;  3BS2 A;  2GH7 A;  1Y9T A;  4QZT A;  1LIB A;  4TKB A;  1BJ7 A;  1GX3 A;  2JMB A;  1SXX A;  2QO6 A;  1SRJ A;  1RSU B;  3VHI A;  1OBU A;  4EXZ A;  3STM X;  3VE1 A;  1YWB A;  4AZO A;  1CBR A;  1MX7 A;  2PI3 O;  2F73 A;  4NLI A;  1Y0G A;  4GUZ A;  5HCE C;  3SLT A;  2W2A A;  5LKF A;  3RDX A;  5HZ8 A;  2CAM A;  2GTL M;  1RLB E;  2WEW A;  4MIS A;  4DCB A;  2AT3 X;  1I9H A;  3VG2 A;  4TJZ A;  4CDF A;  4K19 A;  1LKE A;  5B5G A;  1S44 A;  4ZHD A;  3FIQ A;  3WJD A;  1GM6 A;  2CZT A;  2RTN B;  2GTL O;  4OMX A;  3K3L A;  2JW1 A;  1MM9 A;  4CPF A;  1B8E A;  1FDQ A;  4M6S A;  3ZW0 A;  4ORU A;  1LFO A;  3FA7 A;  1BRP A;  1KXO A;  1ACD A;  3DTQ A;  1KFF A;  2R74 A;  1GT3 A;  5F2B A;  4YDA A;  3MBT A;  2QM9 A;  3MM0 A;  1EPA A;  4OS0 A;  4IRW A;  4QAE A;  1LEL A;  1LIE A;  1VWP B;  3RWX A;  3HWF A;  4GET A;  1BRQ A;  3TF6 A;  5LJK A;  4ZFX A;  3FID A;  1ZNE A;  2P8G A;  4PSQ A;  2CBS A;  4QNI A;  3RY2 A;  5B27 A;  2AKQ A;  3PDF A;  3VHH A;  5F7G A;  3U9P C;  4BCS A;  1BM5 A;  3OJY C;  1T68 X;  4FGI B;  2ANS A;  4YGG A;  1L6M A;  2JU3 A;  3TGA A;  3E3C A;  2KW1 A;  4YBP A;  5LJE A;  3OBL A;  4KH8 A;  1SLG B;  3RKG A;  2CM9 A;  1K24 A;  3C76 X;  4OMW A;  1G5W A;  2I5Z O;  5EPQ A;  4GH7 A;  1N43 A;  1SWS A;  4DQ4 A;  1VWH B;  2IZL B;  1ALB A;  1MVG A;  4IB9 A;  1SY3 A;  3APX A;  3ZW1 B;  1N9Y A;  4NNS A;  1O8V A;  4XMC A;  1KL3 A;  2JGS A;  3EBW A;  1SY0 A;  2FS6 A;  2FKG A;  1FTP A;  1JJX A;  1MOY A;  1JYD A;  4U8U O;  1VWG B;  4DQ3 A;  4AZN A;  5KIC A;  1QFV A;  2RTH B;  1ZNK A;  3CBC A;  4L3R A;  4U8U N;  2A5B A;  4L1N A;  1CBQ A;  4BGF A;  3FEL A;  2IZE B;  4BBO A;  2QOM A;  2X34 A;  2UYW A;  2RTD B;  3GE2 A;  1VYF A;  3L4R A;  1SWT A;  4NNT A;  4IB7 A;  1BEB A;  1STR B;  5BYP A;  2IZC B;  5HAE A;  1VWE B;  1K3B A;  1P6P A;  3UEW A;  3V8U A;  2FRS A;  4GE1 A;  3PH5 A;  2Y3F A;  1SWD A;  4ZCB A;  5B29 A;  2OL8 O;  5AJB A;  5IO7 A;  4BX5 A;  2OFA A;  3OD9 A;  4YVB A;  2NNE A;  2FR3 A;  1QY1 A;  4FQB B;  2QCB A;  4I6S A;  3ZW0 B;  1IKJ A;  4R0B A;  1X8P A;  3FR2 A;  3PEC A;  4IMN A;  1PTS A;  3RBY A;  2X32 A;  4HPD A;  4RUU A;  1JIW I;  3ZUI A;  5LJB A;  1STP A;  2WWP A;  1E5P A;  1GT1 A;  4ORY A;  4WFV A;  3JQO A;  2ZSC A;  2RTC B;  1SWK A;  3MVF A;  1RBP A;  3KQ0 A;  3F6Z B;  2X4M A;  1QY0 A;  3FMZ A;  4A60 A;  5IO5 A;  1MX8 A;  3ZWE A;  2KTS A;  2RTJ A;  1EW3 A;  1FEN A;  1OPB A;  4Y5D A;  1E00 A;  2LBA A;  4YGZ A;  1D3S A;  1KT7 A;  2IZF B;  5DG4 A;  4Y0R A;  1FEL A;  3PQU A;  3G7X A;  4GGZ A;  2RTQ B;  4QGV A;  3SLJ A;  2C1Q A;  1OPA A;  1VWF B;  2Q39 A;  2KTD A;  2RCQ A;  2BSZ A;  4KC7 A;  1KZW A;  1JJU A;  3NQ9 A;  1RAV A;  1RST B;  4IAB A;  3FA9 A;  4ORR A;  1MUP A;  4TKJ A;  4BQU A;  1JQP A;  4YFR A;  3ZQ3 A;  1W5R A;  1VWB B;  3WJB A;  3S5V A;  1YP6 A;  1EQD A;  2OY5 O;  2GC9 A;  4MEE A;  4ODD A;  3ZI8 A;  5HA1 A;  5HZ5 A;  2OF8 A;  1KT5 A;  1SRF A;  3P6E A;  4GNY A;  3B2J A;  2QO5 A;  1LIF A;  2AF5 A;  2FT9 A;  3ZW2 A;  3KZA A;  1A2D A;  3SZH A;  1G85 A;  4ZR2 A;  1RXK A;  4HPA A;  4ALO A;  1KT4 A;  4JO6 A;  2BS6 A;  3KFH A;  1CRB A;  2ASN X;  5B10 O;  5LJG A;  3T6F A;  4U9C A;  4O3Y A;  4ON1 A;  3FEK A;  1DC9 A;  1XKI A;  4XMH A;  1N7Y A;  3HPE A;  4A1H A;  4BX5 B;  3KFF A;  2E4J A;  2LFO A;  1SWO A;  1LID A;  3APW A;  1I4U A;  2IZH B;  4AYH A;  4AZM A;  1VWJ B;  1XCA A;  4GKC A;  1H91 A;  3EBK A;  2LKK A;  4JGL A;  4IB6 A;  1Y53 X;  1ZNG A;  3FW4 A;  4HPB A;  4IMO A;  4CDE A;  5CE4 A;  1X8N A;  3CQR A;  3AUM O;  3HK1 A;  3D95 A;  3VGW A;  1S7D A;  4KII A;  3NX1 A;  3APU A;  1IIU A;  3BU9 A;  5F1E A;  1SWF A;  4O3X B;  2Q2P A;  3VG3 A;  1URE A;  1ZND A;  2CBR A;  2JU8 A;  2RTR B;  4ZJ0 A;  1UZ2 X;  1I04 A;  3VG5 A;  1QG5 A;  1DZP A;  2RD7 C;  2KD2 A;  2RN4 A;  1T8V A;  2AMM X;  4I60 A;  1LCV A;  1N4J A;  5D8J A;  1STS B;  2AT6 X;  3CQN A;  3UAQ A;  1JYJ A;  1VWM B;  1GT5 A;  2IFB A;  1VYO A;  3P02 A;  4Y0P A;  1YIV A;  1ZNH A;  5AJC A;  1DZM A;  2Z4H A;  2JU7 A;  4U3Q A;  3RZY A;  5KHP A;  5HTD A;  1EPB A;  2A2G A;  2QO4 A;  3NR3 A;  4O3W A;  5IRA A;  2DJG A;  3FW5 A;  3P6D A;  1ML7 A;  2OFB A;  5D48 A;  2C1S A;  2XKL A;  4CPH A;  3N91 A;  1EIO A;  3HTY A;  3HWE A;  1UYO X;  1QWD A;  1VWR B;  2NND A;  1QY2 A;  1OSP O;  3BY0 A;  3NAD A;  4ES7 A;  1DZK A;  4EQA C;  2OVS A;  4GU8 A;  4GZV A;  1E06 A;  1NGL A;  1X8O A;  2BHV A;  4A1Y A;  1KZX A;  1ERX A;  3U03 A;  3P6G A;  2L67 A;  4O4S A;  4TLJ A;  1LCW A;  1RXH A;  4YCE A;  5FQ8 E;  1HMT A;  1PMP A;  3CBS A;  1GX8 A;  3TGC A;  2IZJ A;  2RTG B;  4CK4 A;  1AVE A;  5CHK A;  1A3Y A;  2DJF A;  3B2L A;  3FA8 A;  1SWP A;  4I3C A;  2RTP B;  4MVK A;  4BX6 A;  5HCC C;  1JMZ A;  5FQ7 E;  1I78 A;  4CSB A;  1RXJ A;  2LA7 A;  4GK9 A;  4IB8 A;  3KFI A;  4GDZ A;  1HBP A;  2JOZ A;  1KT6 A;  3WJC A;  4NV8 A;  2WQA E;  4ORS A;  4I3D A;  3PED A;  4U8U M;  5K68 A;  2VFC A;  1VWK B;  4MVL A;  4OS8 A;  3HOE A;  2VFB A;  2AL0 X;  2RTB B;  3CKG A;  3CR6 A;  3KVN A;  4DNE A;  1DZJ A;  1HBQ A;  2ZAG A;  4FBV A;  4GD9 A;  2AT8 X;  5LJH A;  4XMF A;  2A5C A;  2HZQ A;  1GX9 A;  4ML7 B;  5CYB A;  4ZGF A;  4A8Z A;  2AT5 X;  3Q6L A;  1IJ8 A;  1MDC A;  1LCZ A;  2ACP X;  2R73 A;  3UEX A;  3X00 A;  5FQ6 E;  3BDR A;  3RSW A;  3S60 A;  1X89 A;  2A0A A;  4Z6J A;  1SRG A;  1SLE B;  1ICN A;  3BRN A;  3EC5 A;  4GRJ A;  3I17 A;  5HZ6 A;  3WXQ A;  4CPH B;  3EW1 A;  4BOE A;  1Z24 A;  1LDO A;  2LB6 A;  2X45 A;  1HQQ A;  4I95 A;  4UU3 A;  4Y59 A;  4FBR A;  4IBA A;  1KGL A;  5BVS A;  5DPQ A;  3VG6 A;  3BLG A;  5L8O A;  2FGS A;  3H3I A;  3ELZ A;  3ZUO A;  3SZI A;  2FKJ A;  5H9A A;  3PH6 A;  3APV A;  4GJV A;  1G74 A;  2KT4 B;  3O19 A;  4NP1 A;  2X55 A;  3NP1 A;  1QAB E;  3FYF A;  4WFU A;  2IZD B;  1DFV A;  3WYQ A;  1OEJ A;  3RE6 A;  1AB0 A;  3MX7 A;  2MO5 A;  4AZR A;  2XST A;  1CBI A;  3PPT A;  3RDS A;  2AVI A;  5B3M O;  3Q34 A;  3B2I A;  4B55 A;  1HN2 A;  1YWD A;  2ZAI A;  4XMD A;  3HWG A;  1YWA A;  1YWC A;  3D4R A;  5H9K A;  4ALB A;  3WVM A;  3UEU A;  5IRU A;  2WSJ A;  4IAX A;  3BX8 A;  2A3F X;  2OY7 A;  1SWQ A;  3NQ3 A;  1W6F A;  2C4I A;  1JMX A;  3P6H A;  5H9L A;  4ARH A;  1X71 A;  5LJC A;  1X8U A;  4ZGU A;  5EDB A;  5BVT A;  1FEM A;  1SXW A;  1SWR A;  2I5V O;  1VPR A;  4INN A;  1GGL A;  3P6F A;  5IRW A;  1JBH A;  4EEJ A;  1JJJ A;  1SXY A;  4TKH A;  4O4U A;  2AH7 X;  1SWA A;  2N93 A;  1SRH A;  4D6B A;  2FR2 A;  4U46 A;  4LKP A;  1TOU A;  5H8T A;  4MVI A;  3O2Y A;  1G7N A;  2HNX A;  3FLL A;  4ZH6 A;  3STK A;  2OL7 A;  3VG4 A;  5K67 A;  1A57 A;  5EDC A;  4O4O A;  5CSE A;  4CPE A;  2OL6 O;  4YH0 A;  1NP4 A;  1KL5 A;  1OBP A;  1LPJ A;  1HMS A;  2RCT A;  1B4M A;  2RTA A;  3KFG A;  4XMG A;  3WZP A;  1SWJ A;  1VWQ B;  1AQB A;  1LNM A;  1W4T A;  2Q9S A;  4UU2 A;  1UYN X;  4EKV A;  4NYR A;  1BSY A;  1IW2 A;  1HMR A;  2X8F A;  3LTW A;  1D2U A;  4GJS A;  2IZK A;  3RDQ A;  2MWH A;  1LDQ A;  3I0A A;  5FEN A;  2IZG B;  3C77 X;  3AKN A;  1LUQ A;  3IA8 A;  4Y0Q A;  5H9N A;  1PM1 X;  1TW4 A;  1GXA A;  2HMB A;  4LZV A;  4YDB A;  3SLO A;  3T6L A;  4ZHF A;  4M7M A;  1KL4 A;  3FA6 A;  1LF7 A;  4N7C A;  3P6C A;  1IFB A;  4LQZ A;  3NPO A;  1DV9 A;  2OF9 A;  2OY8 A;  3VE2 A;  2YMS A;  3FEN A;  4O9S A;  1MK5 A;  4QYP A;  5EZ2 A;  1I05 A;  2WPU A;  3VHM A;  2IZI A;  1ZNL A;  2RTK A;  3WZN A;  2RTO B;  2WEX A;  5EED A;  3T2W A;  3TZS A;  4FBO A;  4CDD A;  3B2H A;  3C78 X;  1GT4 A;  4O3Z A;  1SWU A;  1SY2 A;  1TXL A;  3FR4 A;  3FEP A;  1DF3 A;  2POA A;  4GGT A;  1AEL A;  2OFR X;  4JNJ A;  4QZU A;  5KID A;  1U0X A;  1PBO A;  1NQM A;  1ERB A;  1SWE A;  1NC9 A;  2VDF A;  2WQ9 A;  1AVG I;  2RA6 A;  4EFG A;  4YKO A;  4HFO A;  2X46 A;  5HCD C;  3FR5 A;  3RY1 A;  3MG5 A;  5BVQ A;  2G8C O;  4BX7 A;  3HOL A;  3P24 A;  3RE5 A;  3VU1 A;  3D96 A;  2OFM X;  3CKF A;  1KOI A;  2Y3E A;  4O4X A;  4BVM A;  4YMY A;  2FWV A;  2NNQ A;  3AEH A;  4NW4 A;  3WJG A;  1ADL A;  5EEE A;  1KQW A;  2ALL X;  2BT9 A;  4KCA A;  4COT A;  2L5P A;  5JR8 A;  3TGB A;  2R56 A;  4LZU A;  1BSO A;  4YFQ A;  5AEO A;  1BLR A;  2OVA A;  1SLD B;  4RUN A;  5HZ9 A;  2GTL N;  3WBG A;  3LV4 A;  2OY1 O;  1GKA A;  2NP1 A;  4AZP A;  4KC8 A;  4PJ2 A;  2G79 A;  3SAO A;  1QQS A;  1BWY A;  4MVE A;  5L8N A;  4C5P A;  4Z2P A;  4ZHH A;  4NYQ A;  1WUB A;  4YBU A;  4ZHG A;  2CZU A;  3QQ2 A;  1HXL A;  2X8T A;  4QRL A;  4QYN A;  5D4A A;  4Z28 A;  4CV7 A;  4ZH9 A;  4ZHC A;  5F58 A;  3D97 A;  4WHI A;  1X8Q A;  1O1V A;  4ID2 A;  4N7D A;  3RDU A;  2G7B A;  1NDJ A;  1OBQ A;  4OEM A;  1VYG A;  1IFC A;  3D9W A;  2ACO A;  2A2U A;  2O62 A;  1HXZ A;  4NV7 A;  2X56 A;  4YFP A;  5B11 O;  2FLJ A;  5IO6 A;  3AKM A;  1U18 A;  1U17 A;  3S5X A;  1KQX A;  1BBP A;  3DSZ A;  3S26 A;  5B5F A;  3WOV A;  4JHQ A;  3ZZV A;  1VWD B;  3EW2 A;  1JV4 A;  1DF8 A;  1S2P A;  3UEV A;  2X8S A;  3B2K A;  5LJD A;  2OVD A;  1SWL A;  2RQ0 A;  4BX7 B;  5HA0 A;  3NX2 A;  2W2B A;  2K23 A;  2F09 A;  1FJ1 E;  1Y52 X;  1B56 A;  2PY1 A;  4YGH A;  1SLF B;  1HY2 A;  3T1D A;  2BC3 A;  3WJF A;  1VWI B;  2L9C A;  1SWC A;  2Y32 A;  1I06 A;  3JS1 A;  4NLJ A;  2W2F A;  4I3B A;  2YG2 A;  5B2A O;  5HTE A;  3WZQ A;  1PBY A;  4QGW A;  1B0O A;  2MJI A;  2WR6 A;  1VWL B;  2GJ5 A;  3BU1 A;  4GDA A;  4HWM A;  4Y0S A;  3NBX X;  4I9S A;  5L3Y A;  2A8G A;  4TNN A;  4BX6 B;  1BSQ A;  1LIC A;  3VG7 A;  4CPI A;  1WBI A;  1PEE A;  1E2T A;  2M4L A;  2Q2M A;  1SRE A;  3CMP A;  4IAW A;  5D45 A;  5HBS A;  1GKA B;  3ZW1 A;  2FHL A;  2EU7 X;  2G78 A;  2IZB A;  5LKE A;  2QMI A;  2RTL A;  5AQ6 A;  2MM3 A;  2JN3 A;  2FTB A;  4Z2O A;  3BSZ E;  1VWA B;  3RDO A;  1KT3 A;  1EAL A;  1TOW A;  3OE3 A;  2OYB O;  1E02 A;  1N9M A;  1SA8 A;  2UZ2 A;  1MEP A;  1SWB A;  4MIR A;  1SY1 A;  4OKA A;  3NQK A;  4KT5 A;  1SWN A;  1CJ5 A;  4TQ2 A;  1EI5 A;  1NQN A;  4QGX A;  2AT0 X;  1TVQ A;  1IKE A;  4GNW A;  2RTF B;  1SWH A;  1T0V A;  4WBK A;  4XME A;  3WZO A;  5HWZ A;  2Z4I A;  4GGR A;  1OEK A;  2RTE B;  3HWD A;  4OS3 A;  2CM4 A;  3F9D A;  3ELX A;  4I9R A;  1R0U A;  3F8A A;  2MF6 A;  1SXU A;  4Z27 A;  1NP1 A;  4ORW A;  1YP7 A;  4EDE A;  4AZQ A;  1VWN B;  3GAQ A;  3PQS A;  4HPC A;  5JD2 A;  1EII A;  2K62 A;  1CBS A;  3WJE A;  2RTM A;  4CDC A;  1VWC B;  2DM5 A;  1O1U A;  1A18 A;  1SMP I;  5IXG A;  3WYP A;  5F6B A;  4OEL A;  3SOT A;  3LHN A;  1AVD A;  3CWK A;  4YCH A;  2G5L A;  2MHD A;  2FS7 A;  2WUT A;  2FHN X;  4O49 A;  1OEE A;  4ORX A;  2OZQ A;  1HQP A;  1NBX A;  2L68 A;  3IFB A;  3FDC A;  5FAZ A;  2F01 A;  2RTI B;  3SZJ A;  5K06 A;  1Y55 X;  1QFT A;  1VWO B;  2GTF X;  2HYS A;  2Q4N A;  3VPJ E;  2HKD A;  5C0N A;  3BX7 A;  2QOS C;  3EM0 A;  2IZA A;  1JZU A;  5L8I A;  4LKT A;  2LBV A;  3U0D A;  1EXS A;  2OVE A;  1ZRY A;  4QQ1 A;  3EYC A;  2A13 A; 
#chains in the Genus database with same CATH homology
 2C1Q A;  1VWF B;  3X00 A;  1SRI A;  4Z6J A;  4BJ8 A;  3T2X A;  1RAV A;  1SLE B;  1RST B;  1SLD B;  1SRG A;  3PK2 A;  4Z2V A;  3RDM A;  1SWG A;  3EW1 A;  4CPH B;  1VWB B;  1LDO A;  4Y59 A;  1HQQ A;  2GH7 A;  2OF8 A;  1SRF A;  4Z2P A;  3SZH A;  1SRJ A;  1RXK A;  4Z28 A;  1HXL A;  1RSU B;  3SZI A;  3VHI A;  4JO6 A;  4GJV A;  3RDU A;  3T6F A;  1NDJ A;  3RDX A;  2CAM A;  2IZD B;  4BX5 B;  3WYQ A;  1N7Y A;  1I9H A;  3RE6 A;  1HXZ A;  1SWO A;  3RDS A;  2AVI A;  5B5G A;  2IZH B;  1VWJ B;  5B5F A;  2RTN B;  4JHQ A;  1VWD B;  3EW2 A;  1Y53 X;  1DF8 A;  1MM9 A;  5IRU A;  4CPF A;  1SWQ A;  3VGW A;  1SWL A;  2C4I A;  4BX7 B;  4GGR A;  1KFF A;  1SWF A;  5F2B A;  2RTR B;  1Y52 X;  1SWR A;  3MM0 A;  1SLF B;  1HY2 A;  4IRW A;  1LEL A;  1VWP B;  2BC3 A;  1VWI B;  5IRW A;  1SWC A;  2Y32 A;  4I60 A;  3RY2 A;  1LCV A;  1N4J A;  3WZQ A;  1SWA A;  3VHH A;  1SRH A;  4GDA A;  1VWL B;  1STS B;  4U46 A;  4BCS A;  5K67 A;  5L3Y A;  2A8G A;  1VWM B;  4BX6 B;  1VYO A;  5CSE A;  4CPI A;  4CPE A;  1WBI A;  1SLG B;  1KL5 A;  1SRE A;  2RTA A;  3WZP A;  1SWJ A;  2FHL A;  5IRA A;  2IZB A;  1VWQ B;  1N43 A;  2RTL A;  1SWS A;  1VWH B;  2IZL B;  4EKV A;  4Z2O A;  1VWA B;  2OFB A;  3RDO A;  2C1S A;  3RDQ A;  4GJS A;  2IZK A;  1N9M A;  1N9Y A;  4CPH A;  1LDQ A;  2UZ2 A;  1MEP A;  1SWB A;  1KL3 A;  2IZG B;  1VWR B;  1LUQ A;  2JGS A;  4OKA A;  1SWN A;  3T6L A;  1MOY A;  1NQN A;  1VWG B;  1KL4 A;  3WZN A;  3WZO A;  2RTH B;  2RTF B;  1SWH A;  4BBO A;  2OF9 A;  2A5B A;  1LCW A;  1MK5 A;  1RXH A;  2IZE B;  2RTE B;  2WPU A;  2UYW A;  2IZI A;  2RTD B;  2RTK A;  3VHM A;  1SWT A;  2IZJ A;  2RTG B;  1STR B;  1AVE A;  2RTO B;  2IZC B;  3T2W A;  1VWE B;  5CHK A;  2MF6 A;  4Z27 A;  1SWP A;  2Y3F A;  1SWD A;  1SWU A;  2RTP B;  4BX6 A;  1VWN B;  4BX5 A;  2OFA A;  5JD2 A;  4YVB A;  2RTM A;  2QCB A;  1RXJ A;  1VWC B;  4GGT A;  4JNJ A;  1PTS A;  3WYP A;  1NQM A;  1STP A;  1SWE A;  1AVD A;  1NC9 A;  2G5L A;  5K68 A;  2ZSC A;  1VWK B;  2FHN X;  2RTC B;  1SWK A;  1NBX A;  2RTB B;  3MG5 A;  3RY1 A;  3FDC A;  4DNE A;  4BX7 A;  3RE5 A;  2F01 A;  2RTI B;  3SZJ A;  1Y55 X;  1VWO B;  4GD9 A;  2RTJ A;  2Y3E A;  2A5C A;  4Y5D A;  2IZA A;  1IJ8 A;  1LCZ A;  2IZF B;  4GGZ A;  2RTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...