2CAQA

Structure of r21l mutant of sh28gst in complex with gsh
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
204
structure length
204
Chain Sequence
DHIKVIYFNGRGRAESILMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE 28 KDA
publication title Probing the Mechanism of Gsh Activation in Schistosoma Haematobium Glutathione-S-Transferase by Site-Directed Mutagenesis and X-Ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
molecule tags Transferase
total genus 71
structure length 204
sequence length 204
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2caqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2caqA01
3J7Yk 4KSMA 3GV1A 3UMAA 1EOHA 4TR4A 1N2AA 4XCSA 2X8CA 3RDWA 4GQFA 1MDKA 2FCHA 1MEKA 1EP7A 3TKQA 3TJKA 3L0HA 3VPQA 2HE3A 3UVHA 1XFLA 2FLSA 2MMZA 4LMWA 4ECIA 4MK3A 2JZRA 4MPGA 4ECJA 2FD3A 3ZRDA 4ZL9A 2DJ1A 2OA7A 4BPYA 4DEJA 4MJBA 3I43A 5HR1A 2JSYA 1KBNA 3HHVA 3TJGA 1AC1A 3HVSA 5IOXA 2CZ2A 4NHZA 1T4ZA 3FZ5A 4MA9A 3BD2A 1EGRA 3KCMA 1DE2A 4IJ3A 1V2AA 2IL3A 3VFIA 5KN0A 3M3MA 4JZQA 3O76A 3OR5A 4JR6A 3HDCA 3GKXA 3KZQA 4BWSA 3IV4A 1KEBA 4IHUA 5KN3A 2XPDA 4BVXA 2YV7A 3L9UA 3CBUA 2FGXA 4GQCA 2X64A 4OWYA 2DJ0A 5IMZA 1FHEA 3SWLA 3FZAA 3Q18A 1GUHA 4N10A 3MAKA 3IBHA 5D9TA 1FB6A 1NM3A 4QL9A 6GSTA 1B4PA 1SYXA 3O3TA 4MCUA 1YEXA 2FY6A 2H1BA 4RQRA 4DSRA 4IJIA 5A4WA 4ZB6A 4G2EA 4PNFA 4TOPA 3I69A 2WFCA 1XW5A 3M8NA 5ELAA 2L6CA 2H73A 2NTOA 1AQXA 2GSRA 1B9XC 1EWXA 4NWYA 3KP9A 1ILOA 2PBJA 5JCUA 1AXDA 3A2XA 5CREA 2LJRA 1GWCA 4L8EA 5B6MA 1XPVA 5IMAA 3ME8A 4K6XA 3QOUA 2HI7A 1XCCA 2QC7A 3HVXA 1M2AA 4XS4A 1Z3EA 3HJMA 1EGOA 3DWVA 3NZNA 1GTUA 1WPIA 2HT9A 1YKCA 1GNEA 1HNBA 3A3TA 5GSSA 5G1LA 1GTBA 4E8EA 4KGIA 3APSA 4MZWA 2R4VA 3F6DA 1CQHA 4NV2A 4OFNA 2FHEA 3UIWA 2LJAA 4ULXA 3ZL5A 5J3RA 4RQXA 1TRVA 4GCIA 1TTZA 2I4AA 4MP4A 5J9CA 1M9BA 3TKPA 4IN0A 2CAQA 5AIVA 4KF9A 4IS0A 3FY7A 5DQYA 11GSA 2FA8A 1TK8B 2MMNA 1H75A 4KNDA 3I6AA 3QMXA 3LEFA 3JCML 1W89A 2C3NA 2L59A 2MMAA 4BVXB 4OCEA 5DVBA 4KA0A 1X5DA 4PUAA 5HR0A 4JR4A 4PQHA 1GSEA 3GYKA 4NV5A 1THOA 1MD4A 1F37A 4CW9A 3ZLPA 2H19A 4HEA2 3APQA 1EEMA 2HRAA 2X99A 2IN3A 4EC0A 5H5SA 4F03A 1ZGNA 3ZFBA 5DCGA 4N0ZA 2C4JA 4TR3A 2GQMA 3HY2A 1PL1A 4POBA 1XZOA 2NPBA 1N8JA 3BOAA 2V2GA 2B7KA 1I9DA 4OFTA 2H30A 4ID0A 4V1Ag 1JZWA 2LJKA 5AIXA 1J0FA 2JZSA 4RI7A 2C1YA 4G19A 1GNWA 5IOWA 1GLPA 1JFUA 5EL8A 2VL2C 5DCHA 4IP1A 5IQYA 2YWMA 4X1UA 1A2LA 2HZEA 5HFGA 4HUAA 1FB0A 1MDJA 5CRHA 1BEDA 1GUKA 1Z7PA 2VM2A 4HJ2A 2WDUA 1TK0B 1SK2A 5FT3A 4XS4B 4G0IA 2TRXA 3D4TA 1K0OA 5ECIB 3K8NA 2F3MA 1PX7A 5JWQB 5GAPD 2RUEA 4IGJA 6GSYA 2P0GA 3VWUA 4CDOA 1V40A 4YQVA 5HFIA 3ZITA 2CVKA 2VCVA 2RIIA 5ECMB 4I5QA 1S3AA 1PRXA 3QFAC 1ML6A 4GLTA 5ECPB 1V9WA 5B6NA 5JCGA 2IFQA 4FH8A 3WT1A 4IQAA 2H6YA 4NXIA 4JBBA 2EIOA 3IC8A 5DJLA 1XXUA 3UEMA 1ZZYA 4EO3A 1I5GA 4WF5A 2GT5A 1CQGA 4YH2A 5D73A 4PUFC 1PN9A 2I3YA 3DMLA 5COHA 3MWHA 2WULA 2AHEA 1QK8A 1F6MC 3CSJA 3RPPA 4POKA 4P3YB 1PKZA 4MMMA 4TRXA 4N30A 4XIHA 3FR6A 3F3QA 4KDUA 3PINA 5DQSA 1O8XA 2HLSA 5CRWA 2L4QA 3LGCA 4MPFA 1M0UA 1JZDA 5ECHB 2A2SA 2H71A 1TDIA 4HDEA 5GSTA 3LQ7A 2IPAA 5ECLB 3HA9A 4KW6A 1OE8A 1R26A 3FKFA 4J2FA 1WJKA 1TU7A 2JSZA 1AQVA 1FOVA 2FWGA 2KP1A 1XW9A 3C1SA 1GSSA 1ZL9A 5EY6A 2K9FA 5D96A 2B5EA 1M2BA 3CSIA 2HZEB 4F0CA 2VOCA 1KNGA 1M7TA 4TXOA 3L4NA 3DYRA 2GGTA 2DJKA 2LQQA 5CRGA 3IE3A 1YEPA 2C3QA 1AIUA 2LNTA 4LA1A 3QAGA 1O6JA 2XHFA 3IK7A 1A8LA 4X0XA 2B7JA 2YCDA 2HSYA 3U5RE 3TUEA 3F3RA 1J9BA 3TJBA 1T8EB 1EEJA 2FWHA 2ON5A 2LQOA 1F3AA 2VO4A 3ZVJA 2ZCTA 2H66A 3PH9A 5CYYA 1ERVA 2R37A 3F4SA 1HNCA 3DVWA 1SJIA 3C71A 3ZVJD 2IFQB 4Z7XA 3WD6A 2VCQA 4GRFA 1SK1A 4YAPA 2QGVA 1ERWA 1LU4A 2GQKA 4OCFA 1ZCPA 2MZCA 2VUPA 5ECOB 3ED3A 2HQTA 2LNSA 1TU8A 4ISDA 5EVOA 4BWQA 1SKWB 4HS1A 1Q98A 4XRDA 5ECRB 2H6ZA 4X43A 4XRAA 1PSQA 3KD0A 3V1WA 2VM1A 4Q5RA 3GKNA 4ZB9A 9GSSA 3CMIA 6GSUA 3KMNA 4ZBDA 5IO2A 1YZXA 4EE0A 2XBIA 2YWIA 2PERA 4TXVA 2J9HA 3F4TA 1WRYA 2P31A 1TRUA 3ERFA 2OJLA 4PQ1A 4ZL8A 4L5OA 2O89A 1VF1A 5DAKB 3ERWA 4OMVA 1RW1A 1A24A 3VWVA 1TK5B 4EXJA 1X5CA 3UAPA 1XWGA 1GSQA 4DVCA 3CRUA 3D22A 4IW9A 3EINA 3ZMKA 1Z9HA 1M2DA 2LRCA 4XS6A 2F8AA 3VWWA 3O6TA 4O92A 2H76A 5INYA 4TXOB 1Y6EA 4V2NA 1WOUA 3IAM2 3UVTA 1FW1A 1S3CA 2REMA 4POMA 1J08A 1PQNA 12GSA 4G0LA 4F82A 4XS1A 2VCWA 3U6VA 3FEUA 5D93A 2LRNA 2L5OA 2H0GA 4YQUA 1A23A 2C8UA 1DE1A 1UVZA 2O8VB 1TW9A 4GSSA 4IQ1A 5H5RA 1WIKA 4MDCA 1URMA 2AV4A 3KEBA 4PTSA 1ZYQB 2HXKA 2K8SA 4OO4A 4F9ZA 1YKAA 2C80A 1GP1A 5HR2A 4K7OA 1G6YA 3M1GA 3CTGA 2BMXA 2DJ2A 2VLUA 3IHQA 5F05A 1GSUA 4HZ4A 4HQZA 4G9HA 1Z5YE 3A2WA 3Q19A 2V1MA 3VK9A 2CV4A 3DKSA 3WGDA 2E7PA 1U88A 1XOAA 5F8BA 1EOGA 1PX6A 4WEYA 2GTUA 2A4VA 5J5NA 1ABAA 3ZTLA 2GZYA 5C00A 4L0WA 3HZ8A 2CX3A 1LJRA 4JRRA 22GSA 3BCKA 4H86A 1ON4A 1YQ1A 2AAWA 2C0DA 1SJ6A 3RAZA 2R6KA 1YJ6A 1B48A 1ERUA 4HZ2A 3ZFLA 4EUYA 2PGTA 3GL3A 5IMFA 1AAZA 1GTIA 4ZILA 3ISOA 2H74A 1QMVA 4K7NA 3F9UA 2H1DA 3H4KA 20GSA 3EVIA 5EPFA 4KSOA 3L9SA 4IP6A 4IVFA 5E4WA 1NW2A 3IRAA 3RHBA 3M0FA 2VL3A 2RLIA 2VCZA 3GN3A 4LL1B 3QCPA 3TGZA 4MZBA 4LL4B 1OC8A 1SYRA 2M46A 2LKUA 5LCZA 2CZ3A 1T1VA 3EC3A 2AYTA 1U87A 3G7JA 4YQMA 2JL4A 1XWCA 3FHKA 1VGLA 1S3DA 2F51A 2H0HA 1RK4A 2CA8A 2YNXA 3RPNA 2DC5A 4O7HA 3DVXA 4PNGA 2LV3A 5IM9A 4WR4A 3KH9A 5D9VA 3VI5A 4G10A 4RUVA 3PPUA 2OE3A 5IMVA 5A4UA 4HU7A 2KUCA 4GTUA 4GSNA 1OC9A 1QGVA 3HXSA 3DXBA 3GL5A 3GX0A 2H70A 1EV4A 2VCTA 5KN2A 3AY8A 3CXGA 5F07A 2YWOA 2VIMA 2RUFA 1K0BA 2N5FA 5B7CA 2PU9C 3EMXA 2G2QA 5DJMA 2OKAA 3RHCA 1OKTA 2IMFA 2IMIA 4PXOA 2DMLA 5C04A 2GSSA 2FNOA 4KDYA 4NAXA 4EKZA 4MABA 4BL7A 2B1KA 2HSMA 1ZMAA 3GRXA 1GSFA 3A2VA 3UL3A 1FAAA 2VLVA 2PUKC 1OE7A 2CAIA 3IDVA 2AJQB 1B9YC 4BVYA 4I6XA 3LG6A 1BQ7A 1LBKA 2H1GA 2WZ9A 1GH2A 3KJYA 1KTEA 1Y25A 3E9JB 1F2EA 3I9V2 4ZB8A 2JADA 5DALA 3FYGA 3LORA 2B3SA 4K2DA 4WR5A 2CT6A 1XIYA 1GSYA 1OYJA 1A0FA 2P5RA 4ZBAA 2IWTA 2D2ZA 3W8SA 1YY7A 3BBYA 1QUWA 4WBRD 2C0EA 2YANA 2GSQA 1HYUA 3HJPA 1UA5A 2NDOA 4G0KA 1X9SB 1G0TA 1O7UA 2DJJA 2OBIA 2H6XA 3HKRA 5AISA 5BMUA 1BJXA 5G1KA 3M9JA 1TXXA 2WRTA 2YZHA 3DIEA 2YP6A 3TDGA 3EURA 1A8YA 3H93A 3ZZXA 1JLVA 3UBLA 4DSSA 3DD3A 2FUG2 1XVWA 3A5WA 4IELA 2GT6A 2MYGA 5G5EA 2FWEA 3BCIA 3TOTA 4J57E 5J9BA 3GIXA 3VI7A 2EIRA 1QXHA 5IIZA 3ZYWA 3NIVA 4HU9A 2GQLA 2F9SA 4D73A 3GMFA 5D8IA 3LYKA 4YAVA 3VPTA 4MF5A 2UZ8A 2VAFA 3TRPA 4K1FA 4I8BA 3QFBC 5ELGA 2PPTA 3QAWA 1OC9B 1G7OA 4FO5A 2GLRA 2OE1A 2K6VA 2WGRA 5G31A 2K8VA 2PWJA 2WCIA 4JU5A 2QKEA 1BYEA 1T7PB 4KCAA 1R5PA 1K3YA 4MJAA 1XVQA 3TKSE 1MTCA 2HSMB 2HSNB 2B6MA 4N11A 3D6IA 3FR3A 5GZZB 4K9ZA 2YZUA 4BVYB 3LJRA 2L5LA 2CX4A 1XW6A 4K8MA 1PL2A 4PX1A 5ABRA 1O85A 1VF3A 1U6TA 4FYCA 2KP2A 5DALB 3WT2A 2E2MA 2VL2A 2VLTA 3HCZA 3GFKA 2M80A 2HYXA 1TOFA 2HRKA 4ZL7A 2YJHA 2DIYA 2HRFA 2O87A 5CP1A 2IJYA 3VWXA 4TVEA 4Q5NA 3ZIJA 4V2LA 4O5RA 2PMTA 4IKHA 1IYHA 4GSTA 5J4UA 4WETA 1SENA 1ERTA 1R5AA 1WE0A 3US3A 4DSSB 1JZOA 1TRSA 3ZREA 2H01A 5G2ZA 5G5FA 1GL8A 1YF0A 1SL1B 3QD9A 16GSA 2ALBA 2R5GA 4O32A 1F3BA 1O73A 1GUMA 4KB3A 1T00A 4BA7A 4D73B 3EWLA 3KMOA 1MDIA 3GH9A 1GRXA 5D9XA 6GSSA 3L9VA 3Q74A 2YN1A 4KE3A 1TI1A 3F4RA 2NBSA 1ACVA 3MNGA 3HVVA 4ZIJA 5ECNB 2DBCA 1WP0A 1EV9A 3G7YA 3R2QA 4ILFA 2EIQA 3F63A 4EVMA 3P8WA 2H72A 4WXTA 2LS5A 1TI3A 3D4MA 5LD0A 3D5JA 3GUSA 1U3AA 2OADA 3G9BA 1T3BA 4QL7A 4AJ7A 1BX9A 3P7XA 1G7EA 1NHYA 3IR4A 1AUCA 1A2MA 4GWRA 4ML1A 1R7HA 3TCOA 3TKRA 1ZOFA 3GNJA 1K0CA 1PA3A 1T4YA 13GSA 1Z6NA 4HI7A 1OAZA 2HRKB 3N5OA 1HNAA 14GSA 2PN8A 2TIRA 3G7IA 1X0RA 3TKSA 4ZBBA 2V6OA 2LTKA 5FHIA 1IYIA 4KH7A 1X5EA 2JACA 5B8BA 3WGEA 4ECCA 5CRDA 4JE1A 4CHSA 4ML6A 1K0NA 1VF4A 3D21A 4Q5QA 4EL1A 2ES7A 5KEJA 4TKYA 3E0UA 2IMKA 4Q5FA 3WYWA 4JEDA 3KP8A 2O7KA 3F6FA 5GAND 2I1UA 5DBQA 2V32A 3CYNA 4TN8A 1E2YA 2QSIA 4FYUA 5JCWA 2GSTA 1OKDA 2E2GA 1PMTA 2DMMA 2DSAA 3PR8A 3LWAA 3PGTA 1XWAA 5L71A 2DLXA 1Z6MA 1B8XA 4HQSA 3N9JA 2R2JA 2YPMA 3QAVA 8GSSA 3Q6OA 5FWGA 1XWKA 5DDLA 1O81A 4RI6A 2X8GA 1K3OA 1EZKA 2EC4A 1VRSD 2HFDA 1G6WA 3IPZA 3DRNA 1TP9A 5JWRB 3VURA 1X9WB 4AJ8A 4V1Ap 4FIWA 5ID2A 2C0FA 5D9WA 2O85A 4PQIA 2JZTA 2I81A 4N0VA 1TKDB 3L78A 1V57A 2MBTA 3FZ9A 3QR6A 2YOIA 2YJ7A 1WWJA 1QQ2A 4LMVA 3ZIVA 5IMCA 1SU9A 1K0AA 3VLNA 5IO0A 4FYBA 3TRQA 3P2AA 2GZZA 1U3IA 1M99A 2CVDA 2WB9A 2HRNA 3RBTA 3ME7A 18GSA 3EU3A 1UC7A 4NHWA 2ZUPA 1JLWA 1GLQA 3GKMA 2GDRA 3R3EA 1RQMA 2I9HA 2Z9SA 19GSA 3TRXA 4FQUA 2B5YA 4E8HA 3IA1A 3KGKA 2H75A 1H4OA 1AW9A 2LSTA 3GSSA 1AQWA 4EF0A 3C73A 2KOKA 3FZ4A 1Q4JA 4K7IA 3QPMA 4AGSA 3LXZA 3TJJA 4NPBA 2XPEA 2HSHA 2NVLA 5IPHA 3IXRA 4ACSA 1C72A 3CRTA 3FR9A 3WGXA 4L0UA 4OO5A 2CQ9A 2GVPA 3H79A 3UARA 1BG5A 1M9AA 1JHBA 3DGQA 5H5QA 5J41A 2V6KA 3C1RA 1QFNA 3EMPA 4OD7A 5LNKe 1YDKA 3CTFA 1A0RP 1FVKA 5AN1A 5ECKB 3F8UA 2CVBA 4WF4A 1SL2B 5KN1A 4PGTA 2N5AA 5ID2B 4MF6A 1NSWA 4GXZA 2XC2A 1SL0B 5F06A 3P90A 2WJUA 4EDZA 4F2IA 3C7MA 3DEXA 5A4VA 2ZNMA 1X9MB 2GS3A 4WBJA 5IMDA 1THXA 2ON7A 6GSVA 5HR3A 1HQOA 2TRCP 2YWNA 3C8EA 2IIYA 5CNWA 3ERGA 4XHMA 1PGTA 4HOJA 4I2UA 5G30A 4LLRA 7GSSA 4USSA 6GSWA 3FRCA 3GX8A 4TR1A 4MH2A 3W8JA 2LEGA 2C3TA 1YF1A 4AF2A 4NMUA 4POLA 1FVJA 3FK8A 4L5LA 2VD0A 1EP8A 2VD1A 3KXOA 4MLYA 4ZXGA 2J23A 3KM6A 2L4CA 2F8FA 2H8LA 3GA4A 5ECSA 3GKKA 2PVOC 4QQ7A 1A2JA 3HD5A 2DJ3A 1XBSA 4J56E 1SD8A 2HZFA 3E3EA 1TRWA 2B5XA 2MMOA 4TW5A 3LYPA 2KHPA 3EE2A 3HJOA 2HNLA 3LXTA 1VF2A 2AUVA 2K18A 4TR0A 3LSZA 3GURA 2V41A 3GTUA 2M72A 3SBCA 4MH3A 4I97A 2KLXA 1Z7RA 1TJDA 2FWFA 4HJMA 3GH6A 5IPGA 5F0GA 4F0BA 1B4QA 4BL7B 3IK9A 1V98A 2DIZA 2H1AA 1O8WA 2WS2A 4EDYA 4PURA 3UBKA 1SKRB 6GSXA 2X8HA 5HFKA 2PVQA 3IOSA 1XOBA 4WKWA 2C0GA 2RM5A 3H8QA 3MDKA 2H0IA 3KH7A 2GZPA 1HD2A 2BTOT 5DAKA 5E59A 4IBPA 4XTSA 5HQPA 5JWOB 1GSDA 1XWBA 4KDXA 3UOMA 2AB6A 1SK0A 1V58A 1PKWA 1FG4A 1F9MA 3F0IA 3BJ5A 2XBQA 1PD21 1W4VA 3KIJA 2E0QA 5A5KA 1DBYA 2BJXA 3TKSC 1BAYA 3EYTA 5ENUA 1DSBA 3LFLA 4KAEA 3H1NA 1NHOA 2G0FA 1R4WA 2R3XA 1K3LA 3W6GA 4KX4A 4DSQA 3HYPA 4TR1B 3D0ZA 4V2MA 3TOUA 5ECQB 3EU4A 3NOFA 1FO5A 17GSA 1E6BA 2VL9A 1GULA 3KTLA 2L57A 5B8AA 2MBSA 1UN2A 1USBA 1DUGA 3FW2A 1K0MA 4KCEA 3UJ1A 2LRTA 3TB2A 2OACA 2A2RA 4K0NA 2RM6A 3MSZA 2YV9A 10GSA 2P5QA 5CO3A 3APOA 2N5BA 4K0GA 3QDNA 3J7Yb 4MF7A 3HZ4A 3IC4A 4AJ6A 2JU5A 2OE0A 5AGYA 1OC3A 1SJZA 4ECBA 5CAXA 2OBKA 2LUSA 4GF0A 2B1LA 1SD9A 1MD3A 1WMJA 2FA4A 2IMEA 2L6DA 1JZRA 1GTAA 1SKSB 3GSTA 3S9FA 1ZYEA 3CSHA 3GTUB 3KTBA 4MJCA 4KUNA 4MJEA 4OFMA 3M9KA 2IMDA 3GHAA 2VCXA 3ZMLA 1ST9A 4MZCA 4I2TA 1K0DA 3TJFA 3IAS2 1OVNA
chains in the Genus database with same CATH superfamily
4GDFA 3J7Yk 4KSMA 3GV1A 3UMAA 1EOHA 4AKXB 4TR4A 1N2AA 4XCSA 2WW2A 2X8CA 3RDWA 4GQFA 1MDKA 2FCHA 1BG1A 1MEKA 1EP7A 3TKQA 2EFEA 3TJKA 3L0HA 4CY8A 2UV8G 3VPQA 2HE3A 3UVHA 1XFLA 2FLSA 2MMZA 4LMWA 4ECIA 4MK3A 1ZYNA 2R0PA 2JZRA 4MPGA 4ECJA 2FD3A 3ZRDA 4ZL9A 2DJ1A 2OA7A 4BPYA 4DEJA 4MJBA 3I43A 2X4AA 5HR1A 2JSYA 1KBNA 3HHVA 3TJGA 1AC1A 3HVSA 5IOXA 2CZ2A 4NHZA 1T4ZA 3FZ5A 4MA9A 3BD2A 1EGRA 3KCMA 4K5SA 3CQFA 1DE2A 4IJ3A 1V2AA 4O5UA 2IL3A 3VFIA 5KN0A 3M3MA 4JZQA 3O76A 3OR5A 4JR6A 3HDCA 3GKXA 3KZQA 4BWSA 3IV4A 1KEBA 4IHUA 5KN3A 2XPDA 4BVXA 2YV7A 3L9UA 3CBUA 2FGXA 4GQCA 2X64A 4OWYA 2DJ0A 5IMZA 1FHEA 3SWLA 3FZAA 3Q18A 1GUHA 4N10A 3MAKA 3IBHA 2O3EA 5D9TA 1FB6A 1NM3A 4QL9A 6GSTA 1B4PA 1SYXA 3O3TA 4MCUA 1YEXA 2FY6A 2H1BA 4RQRA 4DSRA 4IJIA 5A4WA 4ZB6A 4AKIA 5A1NA 4G2EA 4PNFA 4TOPA 3I69A 2WFCA 1XW5A 3M8NA 5ELAA 1ZYPA 2L6CA 2H73A 2NTOA 1AQXA 2GSRA 1B9XC 3FMWA 1EWXA 4NWYA 3KP9A 1ILOA 2PBJA 5JCUA 1AXDA 3A2XA 5CREA 5KOWA 2LJRA 1GWCA 4L8EA 5B6MA 1XPVA 5IMAA 3ME8A 4K6XA 3QOUA 2HI7A 1XCCA 2QC7A 3HVXA 1M2AA 4XS4A 1Z3EA 3HJMA 1EGOA 3DWVA 3NZNA 1GTUA 1WPIA 2HT9A 1YKCA 1GNEA 1HNBA 3A3TA 4QMKA 5GSSA 5G1LA 1GTBA 4E8EA 4KGIA 3APSA 4MZWA 2R4VA 3F6DA 1CQHA 4NV2A 4OFNA 2FHEA 2EFDA 3UIWA 2LJAA 4ULXA 3ZL5A 5J3RA 4RQXA 1TRVA 4GCIA 1TTZA 2I4AA 4MP4A 5J9CA 1M9BA 3TKPA 2CAQA 5AIVA 4IN0A 4KF9A 4IS0A 3FY7A 5DQYA 11GSA 2FA8A 1TK8B 2MMNA 1M3JA 1H75A 4KNDA 3MYDA 3I6AA 1SVLA 3QMXA 3LEFA 3JCML 1W89A 2C3NA 2L59A 2MMAA 4BVXB 4OCEA 5DVBA 4KA0A 1X5DA 4PUAA 5HR0A 4JR4A 4PQHA 1GSEA 3GYKA 4NV5A 1THOA 1MD4A 1F37A 4CW9A 3ZLPA 2H19A 4HEA2 3APQA 1EEMA 2HRAA 2X99A 2IN3A 4EC0A 5H5SA 4F03A 1ZGNA 3ZFBA 5DCGA 4N0ZA 2C4JA 4TR3A 2GQMA 3HY2A 5A1NB 1PL1A 4POBA 1XZOA 2NPBA 1N8JA 3BOAA 2V2GA 2B7KA 3HMJG 1I9DA 4OFTA 2H30A 4ID0A 4V1Ag 1JZWA 3CWGA 5J47A 2LJKA 5AIXA 5J4YA 1J0FA 2OT3A 2JZSA 4RI7A 2C1YA 4G19A 1GNWA 5IOWA 1GLPA 1JFUA 5EL8A 2VL2C 5DCHA 4IP1A 5IQYA 2YWMA 4X1UA 1A2LA 2HZEA 5HFGA 4HUAA 5A34B 1FB0A 1MDJA 5CRHA 1BEDA 1GUKA 1SVMA 1Z7PA 2VM2A 4HJ2A 2WDUA 1TK0B 1SK2A 5FT3A 4XS4B 4G0IA 2TRXA 3D4TA 1K0OA 5ECIB 3K8NA 2F3MA 1PX7A 5JWQB 5GAPD 2RUEA 4IGJA 6GSYA 2P0GA 3VWUA 4CDOA 1V40A 4YQVA 5HFIA 3ZITA 2CVKA 2VCVA 2RIIA 5ECMB 4I5QA 1S3AA 1PRXA 3QFAC 1ML6A 1V9WA 4GLTA 4PHZC 5ECPB 5B6NA 5JCGA 2IFQA 4FH8A 3WT1A 2QA1A 4IQAA 2H6YA 4NXIA 4JBBA 2EIOA 3IC8A 5DJLA 1XXUA 3UEMA 1ZZYA 4EO3A 1I5GA 4WF5A 2GT5A 1CQGA 4YH2A 5D73A 4PUFC 1PN9A 2I3YA 3DMLA 5COHA 3MWHA 2WULA 2AHEA 1QK8A 1F6MC 3CSJA 3RPPA 4POKA 4P3YB 1PKZA 4MMMA 4TRXA 4N30A 4XIHA 3FR6A 3F3QA 4KDUA 3PINA 5DQSA 1O8XA 2HLSA 5CRWA 2L4QA 3LGCA 4MPFA 1M0UA 1JZDA 5ECHB 2A2SA 2H71A 1TDIA 4HDEA 5GSTA 3LQ7A 2IPAA 5ECLB 3HA9A 4KW6A 1OE8A 1R26A 3FKFA 4J2FA 1WJKA 1TU7A 2JSZA 1AQVA 1FOVA 2FWGA 2KP1A 1XW9A 3C1SA 1GSSA 1ZL9A 5EY6A 2K9FA 5D96A 2B5EA 1M2BA 3CSIA 2HZEB 4F0CA 2VOCA 1KNGA 1M7TA 4TXOA 3L4NA 3DYRA 2GGTA 2DJKA 2LQQA 5CRGA 3IE3A 1YEPA 2C3QA 1AIUA 2LNTA 4LA1A 3QAGA 1O6JA 2XHFA 3IK7A 1A8LA 4X0XA 2B7JA 2YCDA 2HSYA 3U5RE 3TUEA 2A4HA 3F3RA 1J9BA 3TJBA 1T8EB 3TU3B 1EEJA 2FWHA 2ON5A 2LQOA 1F3AA 2VO4A 3ZVJA 2ZCTA 2H66A 3PH9A 5CYYA 1ERVA 2R37A 3F4SA 1HNCA 3DVWA 1SJIA 3C71A 3ZVJD 2IFQB 4Z7XA 3WD6A 2VCQA 4GRFA 1SK1A 4YAPA 2QGVA 1ERWA 1LU4A 2GQKA 4OCFA 1ZCPA 2MZCA 2VUPA 5ECOB 3ED3A 2HQTA 4N3ZA 1TU8A 2LNSA 4ISDA 5EVOA 4BWQA 1YVLA 1SKWB 4HS1A 1Q98A 4XRDA 5ECRB 2H6ZA 4X43A 4XRAA 1PSQA 3KD0A 3V1WA 2VM1A 4Q5RA 3GKNA 4ZB9A 9GSSA 3CMIA 6GSUA 3KMNA 4ZBDA 5IO2A 1YZXA 4EE0A 2XBIA 2YWIA 2PERA 4TXVA 2J9HA 3F4TA 1WRYA 2P31A 1TRUA 3ERFA 2OJLA 4PQ1A 4ZL8A 4L5OA 2O89A 1VF1A 1S4BP 5J40A 5DAKB 3ERWA 4OMVA 1RW1A 1A24A 3VWVA 1TK5B 4EXJA 1X5CA 3UAPA 1XWGA 1GSQA 4DVCA 3CRUA 3D22A 4IW9A 3EINA 3ZMKA 1Z9HA 1M2DA 2LRCA 4XS6A 2F8AA 3VWWA 3RFRC 3O6TA 4O92A 2H76A 5INYA 4TXOB 1Y6EA 4V2NA 1WOUA 3IAM2 3UVTA 1FW1A 1S3CA 2REMA 4POMA 1J08A 1PQNA 12GSA 2WW3A 4G0LA 4F82A 4XS1A 2VCWA 3U6VA 3FEUA 5D93A 2LRNA 2L5OA 2H0GA 4YQUA 1A23A 2C8UA 1DE1A 1UVZA 2O8VB 1TW9A 4GSSA 4IQ1A 5H5RA 1WIKA 4MDCA 1URMA 2AV4A 4Z2RA 3KEBA 2R0CA 4PTSA 1ZYQB 2HXKA 2K8SA 4OO4A 4F9ZA 1YKAA 1XG8A 2C80A 1GP1A 5HR2A 4K7OA 1G6YA 3M1GA 3CTGA 2BMXA 2DJ2A 2VLUA 3IHQA 5F05A 1GSUA 4HZ4A 4AI6A 4HQZA 4G9HA 1Z5YE 3A2WA 3Q19A 2V1MA 3VK9A 2CV4A 3DKSA 3WGDA 2E7PA 1U88A 1XOAA 5F8BA 1EOGA 1PX6A 4WEYA 2GTUA 2A4VA 5J5NA 1ABAA 3ZTLA 2GZYA 2O5VA 5C00A 4L0WA 3HZ8A 5J4VA 2CX3A 5KOXA 1LJRA 4JRRA 2QA2A 22GSA 3BCKA 4H86A 1ON4A 1YQ1A 2AAWA 2C0DA 4HSCX 1SJ6A 3RAZA 2WW1A 2R6KA 1YJ6A 1B48A 1ERUA 4HZ2A 3ZFLA 4EUYA 2PGTA 3GL3A 5IMFA 1AAZA 1GTIA 4ZILA 4YKFA 3ISOA 2H74A 1QMVA 4K7NA 3F9UA 3A5IA 2H1DA 3H4KA 20GSA 3EVIA 5EPFA 4KSOA 3L9SA 4IP6A 4IVFA 2X49A 5E4WA 1NW2A 3LW9A 3IRAA 3RHBA 3M0FA 2VL3A 2RLIA 2VCZA 3GN3A 4LL1B 3QCPA 3TGZA 4MZBA 4LL4B 1OC8A 1SYRA 2M46A 2LKUA 5LCZA 2CZ3A 1T1VA 3EC3A 2AYTA 1U87A 3G7JA 4YQMA 2JL4A 1XWCA 3FHKA 1VGLA 1S3DA 2F51A 2H0HA 1RK4A 1SVOA 2CA8A 2YNXA 3RPNA 2DC5A 4O7HA 3DVXA 4PNGA 2LV3A 5IM9A 4WR4A 3KH9A 5D9VA 3VI5A 4G10A 4RUVA 3PPUA 2OE3A 5IMVA 5A4UA 4HU7A 2KUCA 4GTUA 4GSNA 1OC9A 1QGVA 3HXSA 3DXBA 3GL5A 3GX0A 2H70A 1EV4A 2VCTA 5KN2A 3AY8A 3CXGA 5F07A 2YWOA 2WVZA 2VIMA 2RUFA 1K0BA 2N5FA 5B7CA 2PU9C 3EMXA 2G2QA 5DJMA 2OKAA 4PI0C 3RHCA 1OKTA 2IMFA 1YEWC 2IMIA 4PXOA 2DMLA 5C04A 2GSSA 2FNOA 4KDYA 4NAXA 4EKZA 4MABA 4BL7A 2B1KA 2HSMA 2HSNA 1ZMAA 3GRXA 1GSFA 3A2VA 3UL3A 1FAAA 2VLVA 2PUKC 1OE7A 2CAIA 3IDVA 4W66A 2AJQB 4G01A 1B9YC 4BVYA 4I6XA 3LG6A 1BQ7A 1LBKA 2H1GA 2WZ9A 1GH2A 3KJYA 4CY6A 1KTEA 1Y25A 3E9JB 1F2EA 3I9V2 4ZB8A 2JADA 5DALA 3FYGA 3LORA 2B3SA 4K2DA 4WR5A 2CT6A 1XIYA 1GSYA 1OYJA 1A0FA 2P5RA 4ZBAA 4K5RA 2IWTA 2D2ZA 3W8SA 1YY7A 3BBYA 1QUWA 4WBRD 2C0EA 4MNNA 2YANA 2GSQA 4O5QA 2DKHA 1HYUA 3HJPA 1UA5A 2NDOA 4G0KA 1X9SB 1G0TA 1FOHA 1O7UA 2DJJA 2OBIA 2H6XA 3HKRA 5AISA 5BMUA 1BJXA 5G1KA 3M9JA 1TXXA 2WRTA 2YZHA 3DIEA 4K2XA 2YP6A 3TDGA 3EURA 1A8YA 3H93A 3ZZXA 1JLVA 3UBLA 4DSSA 3DD3A 2FUG2 1XVWA 3A5WA 4IELA 2GT6A 2MYGA 5G5EA 2FWEA 3BCIA 3TOTA 4J57E 5J9BA 3GIXA 3VI7A 2EIRA 1QXHA 5IIZA 3ZYWA 3NIVA 4HU9A 2GQLA 2F9SA 4D73A 3GMFA 5D8IA 3LYKA 4YAVA 3VPTA 4MF5A 2UZ8A 4Z2TA 2VAFA 3TRPA 4K1FA 4I8BA 3QFBC 5ELGA 2PPTA 3QAWA 1OC9B 1G7OA 4FO5A 2GLRA 2OE1A 3MIXA 2K6VA 2WGRA 5G31A 2K8VA 2PWJA 2WCIA 4JU5A 2QKEA 1PN0A 1BYEA 1T7PB 4KCAA 1R5PA 1K3YA 4MJAA 1XVQA 3TKSE 1MTCA 2HSMB 2HSNB 2B6MA 4N11A 3D6IA 3FR3A 5GZZB 4K9ZA 2YZUA 4BVYB 3LJRA 1N25A 2L5LA 2CX4A 1XW6A 4K8MA 1PL2A 4PX1A 5ABRA 1O85A 1VF3A 1U6TA 4FYCA 2KP2A 5DALB 3WT2A 2E2MA 2VL2A 2VLTA 3HCZA 3GFKA 2M80A 2HYXA 1TOFA 2HRKA 4ZL7A 2YJHA 2DIYA 2HRFA 2O87A 5CP1A 2IJYA 3VWXA 2WVYA 4TVEA 4Q5NA 3ZIJA 4V2LA 4O5RA 5BMUB 2PMTA 4IKHA 1IYHA 4GSTA 5J4UA 4WETA 1SENA 1ERTA 1R5AA 1WE0A 3US3A 4DSSB 1JZOA 1TRSA 3ZREA 2H01A 5G2ZA 5G5FA 1GL8A 3CHXC 1YF0A 1SL1B 3QD9A 16GSA 2ALBA 2R5GA 4O32A 1F3BA 1O73A 1GUMA 4KB3A 1T00A 4BA7A 4D73B 3EWLA 3KMOA 1MDIA 3GH9A 1GRXA 5D9XA 6GSSA 3L9VA 3Q74A 2YN1A 4KE3A 1TI1A 3F4RA 2DKIA 2NBSA 1ACVA 3RGBC 3MNGA 3HVVA 4ZIJA 5ECNB 2EFHA 2DBCA 1WP0A 1EV9A 3G7YA 3R2QA 4ILFA 2EIQA 3F63A 4EVMA 3P8WA 2H72A 4WXTA 2LS5A 1TI3A 3D4MA 5LD0A 3D5JA 3GUSA 1U3AA 2OADA 3G9BA 1T3BA 4QL7A 4AJ7A 1BX9A 3P7XA 1G7EA 1NHYA 3IR4A 1AUCA 1A2MA 4GWRA 4ML1A 1R7HA 3TCOA 3TKRA 1ZOFA 3GNJA 1K0CA 1PA3A 1T4YA 13GSA 1Z6NA 4HI7A 1OAZA 2HRKB 3N5OA 1HNAA 14GSA 2PN8A 2TIRA 3G7IA 1X0RA 3TKSA 4ZBBA 2V6OA 2LTKA 5FHIA 1IYIA 4KH7A 1X5EA 2JACA 5B8BA 3WGEA 4ECCA 5CRDA 4JE1A 4CHSA 1I1IP 4ML6A 1K0NA 1VF4A 3D21A 4Q5QA 4EL1A 2ES7A 5KEJA 1Y1UA 4TKYA 3E0UA 2IMKA 4Q5FA 3WYWA 4JEDA 3KP8A 4EIPA 4E68A 2O7KA 3F6FA 5GAND 2I1UA 5DBQA 2V32A 3CYNA 4TN8A 1E2YA 2QSIA 4FYUA 5JCWA 2GSTA 1OKDA 2E2GA 1PMTA 2DMMA 2DSAA 3PR8A 1PFOA 3LWAA 3PGTA 1XWAA 5L71A 2DLXA 1Z6MA 1B8XA 4PI2C 3N9JA 2R2JA 4HQSA 4FXYP 3QAVA 2YPMA 8GSSA 3Q6OA 5FWGA 1XWKA 5DDLA 4EIQA 1O81A 4RI6A 2X8GA 1K3OA 4Z2UA 1EZKA 2EC4A 1VRSD 2HFDA 1G6WA 3IPZA 3DRNA 1TP9A 5JWRB 3VURA 1X9WB 4AJ8A 4V1Ap 4FIWA 5ID2A 2C0FA 5D9WA 2O85A 4PQIA 1S3RA 2JZTA 2I81A 4N0VA 1TKDB 3L78A 1V57A 2MBTA 3FZ9A 3QR6A 2YOIA 2YJ7A 5A34A 1WWJA 1QQ2A 4LMVA 3ZIVA 5IMCA 1SU9A 1K0AA 3VLNA 4X4JA 5IO0A 4FYBA 3TRQA 3P2AA 2GZZA 1U3IA 1TXUA 1M99A 2CVDA 2WB9A 2HRNA 3RBTA 3ME7A 18GSA 3EU3A 1UC7A 4NHWA 2ZUPA 1JLWA 1GLQA 3GKMA 2GDRA 3R3EA 1RQMA 2I9HA 2Z9SA 19GSA 4ZB7A 3TRXA 4FQUA 3EPTA 2B5YA 4E8HA 3IA1A 3KGKA 2H75A 2A2PA 1H4OA 1AW9A 2LSTA 3GSSA 1AQWA 4EF0A 3C73A 2KOKA 3FZ4A 1Q4JA 4BIKA 4K7IA 3QPMA 4AGSA 3LXZA 3TJJA 2O36A 4NPBA 2XPEA 2HSHA 2NVLA 5IPHA 3IXRA 4ACSA 1C72A 3CRTA 3FR9A 3WGXA 4L0UA 4OO5A 2CQ9A 2GVPA 3H79A 3UARA 1BG5A 1M9AA 1JHBA 3DGQA 5H5QA 5J41A 2V6KA 3C1RA 1QFNA 3EMPA 4OD7A 5LNKe 1YDKA 3CTFA 1A0RP 1FVKA 5AN1A 5ECKB 3F8UA 2CVBA 4WF4A 1SL2B 5KN1A 5A5HA 4AKHA 4PGTA 2N5AA 5ID2B 4MF6A 1NSWA 4GXZA 2XC2A 1SL0B 5F06A 3P90A 2WJUA 4EDZA 4F2IA 2H1LA 3C7MA 3DEXA 5A4VA 2ZNMA 1X9MB 2GS3A 4WBJA 2WW0A 5IMDA 1THXA 2ON7A 6GSVA 5HR3A 1HQOA 2TRCP 2YWNA 3C8EA 2IIYA 2WVXA 5CNWA 3ERGA 4XHMA 1PGTA 4HOJA 4I2UA 5G30A 4LLRA 7GSSA 4USSA 6GSWA 3FRCA 3GX8A 4TR1A 4MH2A 3W8JA 2LEGA 2C3TA 1YF1A 4AF2A 4NMUA 4POLA 1FVJA 3FK8A 4L5LA 2VD0A 1EP8A 2VD1A 3KXOA 4MLYA 4ZXGA 2J23A 3KM6A 2L4CA 2F8FA 2H8LA 3GA4A 5ECSA 3GKKA 2PVOC 4QQ7A 1A2JA 3HD5A 2DJ3A 1XBSA 4J56E 1SD8A 4YKGA 2HZFA 3E3EA 1TRWA 2B5XA 2MMOA 4TW5A 3LYPA 2KHPA 3EE2A 3HJOA 2HNLA 3LXTA 1VF2A 2AUVA 2K18A 4TR0A 3LSZA 3GURA 2V41A 3GTUA 2M72A 3SBCA 4MH3A 4I97A 2KLXA 1Z7RA 1TJDA 2FWFA 4HJMA 3GH6A 5IPGA 5F0GA 1BF5A 4F0BA 1B4QA 4BL7B 3IK9A 1V98A 2DIZA 2H1AA 1O8WA 2WZSA 2WS2A 4EDYA 4PURA 3UBKA 1SKRB 6GSXA 2X8HA 4A5PA 5HFKA 2PVQA 3IOSA 1XOBA 3IHGA 4WKWA 5A5HB 5BRTA 2C0GA 2RM5A 3H8QA 3MDKA 2H0IA 3KH7A 2GZPA 1HD2A 2BTOT 5DAKA 5E59A 4IBPA 4XTSA 5HQPA 5JWOB 1GSDA 1XWBA 4KDXA 3UOMA 2AB6A 1SK0A 1V58A 1PKWA 1FG4A 2R0GA 1F9MA 3F0IA 3BJ5A 2XBQA 1PD21 1W4VA 3KIJA 2E0QA 5A5KA 1DBYA 2BJXA 3TKSC 1BAYA 2EFCA 3EYTA 5ENUA 2WVXB 1DSBA 3LFLA 4KAEA 3H1NA 1NHOA 2G0FA 1R4WA 2R3XA 1K3LA 3W6GA 4KX4A 4DSQA 3HYPA 4TR1B 3D0ZA 4V2MA 3TOUA 5ECQB 3EU4A 3NOFA 1FO5A 17GSA 1E6BA 2VL9A 1GULA 3KTLA 2L57A 5B8AA 2MBSA 1UN2A 2VKZG 1USBA 1DUGA 3FW2A 1K0MA 3HVNA 4KCEA 3UJ1A 2LRTA 3TB2A 2OACA 2A2RA 4K0NA 2RM6A 3MSZA 2YV9A 10GSA 2P5QA 5CO3A 3APOA 2N5BA 4AKGA 4K0GA 3QDNA 1M3IA 3J7Yb 4MF7A 3HZ4A 3IC4A 4AJ6A 2JU5A 2OE0A 1OC3A 1SJZA 5AGYA 4ECBA 5CAXA 2OBKA 2LUSA 4GF0A 4ICYA 2B1LA 1SD9A 1MD3A 1WMJA 2FA4A 2IMEA 2L6DA 1JZRA 1GTAA 1SKSB 3GSTA 3S9FA 1ZYEA 3CSHA 3GTUB 3KTBA 4MJCA 4KUNA 4MJEA 4OFMA 3M9KA 2IMDA 3GHAA 2VCXA 3ZMLA 1ST9A 4MZCA 4I2TA 1K0DA 3TJFA 3IAS2 1OVNA
chains in the Genus database with same CATH topology
4GDFA 3J7Yk 4KSMA 3GV1A 3UMAA 1EOHA 4AKXB 4TR4A 1N2AA 4XCSA 2X8CA 3RDWA 4GQFA 1MDKA 2FCHA 1BG1A 1MEKA 1EP7A 3TKQA 2EFEA 3TJKA 3L0HA 4CY8A 2UV8G 3VPQA 2HE3A 3UVHA 1XFLA 2FLSA 2MMZA 4LMWA 4ECIA 4MK3A 1ZYNA 2R0PA 2JZRA 4MPGA 4ECJA 2FD3A 3ZRDA 4ZL9A 2DJ1A 2OA7A 4BPYA 4DEJA 4MJBA 3I43A 2X4AA 5HR1A 2JSYA 1KBNA 3HHVA 3TJGA 1AC1A 3HVSA 5IOXA 2CZ2A 4NHZA 1T4ZA 3FZ5A 4MA9A 3BD2A 1EGRA 3KCMA 4K5SA 1DE2A 4IJ3A 1V2AA 4O5UA 2IL3A 3VFIA 5KN0A 3M3MA 4JZQA 3O76A 3OR5A 4JR6A 3HDCA 3GKXA 3KZQA 4BWSA 3IV4A 1KEBA 4IHUA 5KN3A 2XPDA 4BVXA 2YV7A 3L9UA 3CBUA 2FGXA 4GQCA 2X64A 4OWYA 2DJ0A 5IMZA 1FHEA 3SWLA 3FZAA 3Q18A 1GUHA 4N10A 3MAKA 3IBHA 5D9TA 1FB6A 1NM3A 4QL9A 6GSTA 1B4PA 1SYXA 3O3TA 4MCUA 1YEXA 2FY6A 2H1BA 4RQRA 4DSRA 4IJIA 5A4WA 4ZB6A 4AKIA 5A1NA 4G2EA 4PNFA 4TOPA 3I69A 2WFCA 1XW5A 3M8NA 5ELAA 1ZYPA 2L6CA 2H73A 2NTOA 1AQXA 2GSRA 1B9XC 3FMWA 1EWXA 4NWYA 3KP9A 1ILOA 2PBJA 5JCUA 1AXDA 3A2XA 5CREA 5KOWA 2LJRA 1GWCA 4L8EA 5B6MA 1XPVA 5IMAA 3ME8A 4K6XA 3QOUA 2HI7A 1XCCA 2QC7A 3HVXA 1M2AA 4XS4A 1Z3EA 3HJMA 1EGOA 3DWVA 3NZNA 1GTUA 1WPIA 2HT9A 1YKCA 1GNEA 1HNBA 3A3TA 4QMKA 5GSSA 5G1LA 1GTBA 4E8EA 4KGIA 3APSA 4MZWA 2R4VA 3F6DA 1CQHA 4NV2A 4OFNA 2FHEA 2EFDA 3UIWA 2LJAA 4ULXA 3ZL5A 5J3RA 4RQXA 1TRVA 4GCIA 1TTZA 2I4AA 4MP4A 5J9CA 1M9BA 3TKPA 2CAQA 5AIVA 4IN0A 4KF9A 4IS0A 3FY7A 5DQYA 11GSA 2FA8A 1TK8B 2MMNA 1H75A 4KNDA 3MYDA 3I6AA 1SVLA 3QMXA 3LEFA 3JCML 1W89A 2C3NA 2L59A 2MMAA 4BVXB 4OCEA 5DVBA 4KA0A 1X5DA 4PUAA 5HR0A 4JR4A 4PQHA 1GSEA 3GYKA 4NV5A 1THOA 1MD4A 1F37A 4CW9A 3ZLPA 2H19A 4HEA2 3APQA 1EEMA 2HRAA 2X99A 2IN3A 4EC0A 5H5SA 4F03A 1ZGNA 3ZFBA 5DCGA 4N0ZA 2C4JA 4TR3A 2GQMA 3HY2A 5A1NB 1PL1A 4POBA 1XZOA 2NPBA 1N8JA 3BOAA 2V2GA 2B7KA 3HMJG 1I9DA 4OFTA 2H30A 4ID0A 4V1Ag 1JZWA 3CWGA 5J47A 2LJKA 5AIXA 5J4YA 1J0FA 2OT3A 2JZSA 4RI7A 2C1YA 4G19A 1GNWA 5IOWA 1GLPA 1JFUA 5EL8A 2VL2C 5DCHA 4IP1A 5IQYA 2YWMA 4X1UA 1A2LA 2HZEA 5HFGA 4HUAA 5A34B 1FB0A 1MDJA 5CRHA 1BEDA 1GUKA 1SVMA 1Z7PA 2VM2A 4HJ2A 2WDUA 1TK0B 1SK2A 5FT3A 4XS4B 4G0IA 2TRXA 3D4TA 1K0OA 5ECIB 3K8NA 2F3MA 1PX7A 5JWQB 5GAPD 2RUEA 4IGJA 6GSYA 2P0GA 3VWUA 4CDOA 1V40A 4YQVA 5HFIA 3ZITA 2CVKA 2VCVA 2RIIA 5ECMB 4I5QA 1S3AA 1PRXA 3QFAC 1ML6A 4GLTA 5ECPB 1V9WA 5B6NA 5JCGA 2IFQA 4FH8A 3WT1A 2QA1A 4IQAA 2H6YA 4NXIA 4JBBA 2EIOA 3IC8A 5DJLA 1XXUA 3UEMA 1ZZYA 4EO3A 1I5GA 4WF5A 2GT5A 1CQGA 4YH2A 5D73A 4PUFC 1PN9A 2I3YA 3DMLA 5COHA 3MWHA 2WULA 2AHEA 1QK8A 1F6MC 3CSJA 3RPPA 4POKA 4P3YB 1PKZA 4MMMA 4TRXA 4N30A 4XIHA 3FR6A 3F3QA 4KDUA 3PINA 5DQSA 1O8XA 2HLSA 5CRWA 2L4QA 3LGCA 4MPFA 1M0UA 1JZDA 5ECHB 2A2SA 2H71A 1TDIA 4HDEA 5GSTA 3LQ7A 2IPAA 5ECLB 3HA9A 4KW6A 1OE8A 1R26A 3FKFA 4J2FA 1WJKA 1TU7A 2JSZA 1AQVA 1FOVA 2FWGA 2KP1A 1XW9A 3C1SA 1GSSA 1ZL9A 5EY6A 2K9FA 5D96A 2B5EA 1M2BA 3CSIA 2HZEB 4F0CA 2VOCA 1KNGA 1M7TA 4TXOA 3L4NA 3DYRA 2GGTA 2DJKA 2LQQA 5CRGA 3IE3A 1YEPA 2C3QA 1AIUA 2LNTA 4LA1A 3QAGA 1O6JA 2XHFA 3IK7A 1A8LA 4X0XA 2B7JA 2YCDA 2HSYA 3U5RE 3TUEA 2A4HA 3F3RA 1J9BA 3TJBA 1T8EB 3TU3B 1EEJA 2FWHA 2ON5A 2LQOA 1F3AA 2VO4A 3ZVJA 2ZCTA 2H66A 3PH9A 5CYYA 1ERVA 2R37A 3F4SA 1HNCA 3DVWA 1SJIA 3C71A 3ZVJD 2IFQB 4Z7XA 3WD6A 2VCQA 4GRFA 1SK1A 4YAPA 2QGVA 1ERWA 1LU4A 2GQKA 4OCFA 1ZCPA 2MZCA 2VUPA 5ECOB 3ED3A 2HQTA 4N3ZA 1TU8A 2LNSA 4ISDA 5EVOA 4BWQA 1YVLA 1SKWB 4HS1A 1Q98A 4XRDA 5ECRB 2H6ZA 4X43A 4XRAA 1PSQA 3KD0A 3V1WA 2VM1A 4Q5RA 3GKNA 4ZB9A 9GSSA 3CMIA 6GSUA 3KMNA 4ZBDA 5IO2A 1YZXA 4EE0A 2XBIA 2YWIA 2PERA 4TXVA 2J9HA 3F4TA 1WRYA 2P31A 1TRUA 3ERFA 2OJLA 4PQ1A 4ZL8A 4L5OA 2O89A 1VF1A 5J40A 5DAKB 3ERWA 4OMVA 1RW1A 1A24A 3VWVA 1TK5B 4EXJA 1X5CA 3UAPA 1XWGA 1GSQA 4DVCA 3CRUA 3D22A 4IW9A 3EINA 3ZMKA 1Z9HA 1M2DA 2LRCA 4XS6A 2F8AA 3VWWA 3O6TA 4O92A 2H76A 5INYA 4TXOB 1Y6EA 4V2NA 1WOUA 3IAM2 3UVTA 1FW1A 1S3CA 2REMA 4POMA 1J08A 1PQNA 12GSA 4G0LA 4F82A 4XS1A 2VCWA 3U6VA 3FEUA 5D93A 2LRNA 2L5OA 2H0GA 4YQUA 1A23A 2C8UA 1DE1A 1UVZA 2O8VB 1TW9A 4GSSA 4IQ1A 5H5RA 1WIKA 4MDCA 1URMA 2AV4A 4Z2RA 3KEBA 2R0CA 4PTSA 1ZYQB 2HXKA 2K8SA 4OO4A 4F9ZA 1YKAA 2C80A 1GP1A 5HR2A 4K7OA 1G6YA 3M1GA 3CTGA 2BMXA 2DJ2A 2VLUA 3IHQA 5F05A 1GSUA 4HZ4A 4AI6A 4HQZA 4G9HA 1Z5YE 3A2WA 3Q19A 2V1MA 3VK9A 2CV4A 3DKSA 3WGDA 2E7PA 1U88A 1XOAA 5F8BA 1EOGA 1PX6A 4WEYA 2GTUA 2A4VA 5J5NA 1ABAA 3ZTLA 2GZYA 2O5VA 5C00A 4L0WA 3HZ8A 5J4VA 2CX3A 5KOXA 1LJRA 4JRRA 2QA2A 22GSA 3BCKA 4H86A 1ON4A 1YQ1A 2AAWA 2C0DA 1SJ6A 3RAZA 2R6KA 1YJ6A 1B48A 1ERUA 4HZ2A 3ZFLA 4EUYA 2PGTA 3GL3A 5IMFA 1AAZA 1GTIA 4ZILA 4YKFA 3ISOA 2H74A 1QMVA 4K7NA 3F9UA 3A5IA 2H1DA 3H4KA 20GSA 3EVIA 5EPFA 4KSOA 3L9SA 4IP6A 4IVFA 2X49A 5E4WA 1NW2A 3LW9A 3IRAA 3RHBA 3M0FA 2VL3A 2RLIA 2VCZA 3GN3A 4LL1B 3QCPA 3TGZA 4MZBA 4LL4B 1OC8A 1SYRA 2M46A 2LKUA 5LCZA 2CZ3A 1T1VA 3EC3A 2AYTA 1U87A 3G7JA 4YQMA 2JL4A 1XWCA 3FHKA 1VGLA 1S3DA 2F51A 2H0HA 1RK4A 1SVOA 2CA8A 2YNXA 3RPNA 2DC5A 4O7HA 3DVXA 4PNGA 2LV3A 5IM9A 4WR4A 3KH9A 5D9VA 3VI5A 4G10A 4RUVA 3PPUA 2OE3A 5IMVA 5A4UA 4HU7A 2KUCA 4GTUA 4GSNA 1OC9A 1QGVA 3HXSA 3DXBA 3GL5A 3GX0A 2H70A 1EV4A 2VCTA 5KN2A 3AY8A 3CXGA 5F07A 2YWOA 2VIMA 2RUFA 1K0BA 2N5FA 5B7CA 2PU9C 3EMXA 2G2QA 5DJMA 2OKAA 3RHCA 1OKTA 2IMFA 2IMIA 4PXOA 2DMLA 5C04A 2GSSA 2FNOA 4KDYA 4NAXA 4EKZA 4MABA 4BL7A 2B1KA 2HSMA 2HSNA 1ZMAA 3GRXA 1GSFA 3A2VA 3UL3A 1FAAA 2VLVA 2PUKC 1OE7A 2CAIA 3IDVA 4W66A 2AJQB 4G01A 1B9YC 4BVYA 4I6XA 3LG6A 1BQ7A 1LBKA 2H1GA 2WZ9A 1GH2A 3KJYA 4CY6A 1KTEA 1Y25A 3E9JB 1F2EA 3I9V2 4ZB8A 2JADA 5DALA 3FYGA 3LORA 2B3SA 4K2DA 4WR5A 2CT6A 1XIYA 1GSYA 1OYJA 1A0FA 2P5RA 4ZBAA 4K5RA 2IWTA 2D2ZA 3W8SA 1YY7A 3BBYA 1QUWA 4WBRD 2C0EA 4MNNA 2YANA 2GSQA 4O5QA 2DKHA 1HYUA 3HJPA 1UA5A 2NDOA 4G0KA 1X9SB 1G0TA 1FOHA 1O7UA 2DJJA 2OBIA 2H6XA 3HKRA 5AISA 5BMUA 1BJXA 5G1KA 3M9JA 1TXXA 2WRTA 2YZHA 3DIEA 4K2XA 2YP6A 3TDGA 3EURA 1A8YA 3H93A 3ZZXA 1JLVA 3UBLA 4DSSA 3DD3A 2FUG2 1XVWA 3A5WA 4IELA 2GT6A 2MYGA 5G5EA 2FWEA 3BCIA 3TOTA 4J57E 5J9BA 3GIXA 3VI7A 2EIRA 1QXHA 5IIZA 3ZYWA 3NIVA 4HU9A 2GQLA 2F9SA 4D73A 3GMFA 5D8IA 3LYKA 4YAVA 3VPTA 4MF5A 2UZ8A 4Z2TA 2VAFA 3TRPA 4K1FA 4I8BA 3QFBC 5ELGA 2PPTA 3QAWA 1OC9B 1G7OA 4FO5A 2GLRA 2OE1A 3MIXA 2K6VA 2WGRA 5G31A 2K8VA 2PWJA 2WCIA 4JU5A 2QKEA 1PN0A 1BYEA 1T7PB 4KCAA 1R5PA 1K3YA 4MJAA 1XVQA 3TKSE 1MTCA 2HSMB 2HSNB 2B6MA 4N11A 3D6IA 3FR3A 5GZZB 4K9ZA 2YZUA 4BVYB 3LJRA 1N25A 2L5LA 2CX4A 1XW6A 4K8MA 1PL2A 4PX1A 5ABRA 1O85A 1VF3A 1U6TA 4FYCA 2KP2A 5DALB 3WT2A 2E2MA 2VL2A 2VLTA 3HCZA 3GFKA 2M80A 2HYXA 1TOFA 2HRKA 4ZL7A 2YJHA 2DIYA 2HRFA 2O87A 5CP1A 2IJYA 3VWXA 4TVEA 4Q5NA 3ZIJA 4V2LA 4O5RA 5BMUB 2PMTA 4IKHA 1IYHA 4GSTA 5J4UA 4WETA 1SENA 1ERTA 1R5AA 1WE0A 3US3A 4DSSB 1JZOA 1TRSA 3ZREA 2H01A 5G2ZA 5G5FA 1GL8A 1YF0A 1SL1B 3QD9A 16GSA 2ALBA 2R5GA 4O32A 1F3BA 1O73A 1GUMA 4KB3A 1T00A 4BA7A 4D73B 3EWLA 3KMOA 1MDIA 3GH9A 1GRXA 5D9XA 6GSSA 3L9VA 3Q74A 2YN1A 4KE3A 1TI1A 3F4RA 2DKIA 2NBSA 1ACVA 3MNGA 3HVVA 4ZIJA 5ECNB 2EFHA 2DBCA 1WP0A 1EV9A 3G7YA 3R2QA 4ILFA 2EIQA 3F63A 4EVMA 3P8WA 2H72A 4WXTA 2LS5A 1TI3A 3D4MA 5LD0A 3D5JA 3GUSA 1U3AA 2OADA 3G9BA 1T3BA 4QL7A 4AJ7A 1BX9A 3P7XA 1G7EA 1NHYA 3IR4A 1AUCA 1A2MA 4GWRA 4ML1A 1R7HA 3TCOA 3TKRA 1ZOFA 3GNJA 1K0CA 1PA3A 1T4YA 13GSA 1Z6NA 4HI7A 1OAZA 2HRKB 3N5OA 1HNAA 14GSA 2PN8A 2TIRA 3G7IA 1X0RA 3TKSA 4ZBBA 2V6OA 2LTKA 5FHIA 1IYIA 4KH7A 1X5EA 2JACA 5B8BA 3WGEA 4ECCA 5CRDA 4JE1A 4CHSA 4ML6A 1K0NA 1VF4A 3D21A 4Q5QA 4EL1A 2ES7A 5KEJA 1Y1UA 4TKYA 3E0UA 2IMKA 4Q5FA 3WYWA 4JEDA 3KP8A 4EIPA 4E68A 2O7KA 3F6FA 5GAND 2I1UA 5DBQA 2V32A 3CYNA 4TN8A 1E2YA 2QSIA 4FYUA 5JCWA 2GSTA 1OKDA 2E2GA 1PMTA 2DMMA 2DSAA 3PR8A 3LWAA 3PGTA 1XWAA 5L71A 2DLXA 1Z6MA 1B8XA 3N9JA 2R2JA 4HQSA 2YPMA 3QAVA 8GSSA 3Q6OA 5FWGA 1XWKA 5DDLA 4EIQA 1O81A 4RI6A 2X8GA 1K3OA 4Z2UA 1EZKA 2EC4A 1VRSD 2HFDA 1G6WA 3IPZA 3DRNA 1TP9A 5JWRB 3VURA 1X9WB 4AJ8A 4V1Ap 4FIWA 5ID2A 2C0FA 5D9WA 2O85A 4PQIA 2JZTA 2I81A 4N0VA 1TKDB 3L78A 1V57A 2MBTA 3FZ9A 3QR6A 2YOIA 2YJ7A 5A34A 1WWJA 1QQ2A 4LMVA 3ZIVA 5IMCA 1SU9A 1K0AA 3VLNA 4X4JA 5IO0A 4FYBA 3TRQA 3P2AA 2GZZA 1U3IA 1TXUA 1M99A 2CVDA 2WB9A 2HRNA 3RBTA 3ME7A 18GSA 3EU3A 1UC7A 4NHWA 2ZUPA 1JLWA 1GLQA 3GKMA 2GDRA 3R3EA 1RQMA 2I9HA 2Z9SA 19GSA 4ZB7A 3TRXA 4FQUA 3EPTA 2B5YA 4E8HA 3IA1A 3KGKA 2H75A 2A2PA 1H4OA 1AW9A 2LSTA 3GSSA 1AQWA 4EF0A 3C73A 2KOKA 3FZ4A 1Q4JA 4K7IA 3QPMA 4AGSA 3LXZA 3TJJA 4NPBA 2XPEA 2HSHA 2NVLA 5IPHA 3IXRA 4ACSA 1C72A 3CRTA 3FR9A 3WGXA 4L0UA 4OO5A 2CQ9A 2GVPA 3H79A 3UARA 1BG5A 1M9AA 1JHBA 3DGQA 5H5QA 5J41A 2V6KA 3C1RA 1QFNA 3EMPA 4OD7A 5LNKe 1YDKA 3CTFA 1A0RP 1FVKA 5AN1A 5ECKB 3F8UA 2CVBA 4WF4A 1SL2B 5KN1A 5A5HA 4AKHA 4PGTA 2N5AA 5ID2B 4MF6A 1NSWA 4GXZA 2XC2A 1SL0B 5F06A 3P90A 2WJUA 4EDZA 4F2IA 2H1LA 3C7MA 3DEXA 5A4VA 2ZNMA 1X9MB 2GS3A 4WBJA 5IMDA 1THXA 2ON7A 6GSVA 5HR3A 1HQOA 2TRCP 2YWNA 3C8EA 2IIYA 5CNWA 3ERGA 4XHMA 1PGTA 4HOJA 4I2UA 5G30A 4LLRA 7GSSA 4USSA 6GSWA 3FRCA 3GX8A 4TR1A 4MH2A 3W8JA 2LEGA 2C3TA 1YF1A 4AF2A 4NMUA 4POLA 1FVJA 3FK8A 4L5LA 2VD0A 1EP8A 2VD1A 3KXOA 4MLYA 4ZXGA 2J23A 3KM6A 2L4CA 2F8FA 2H8LA 3GA4A 5ECSA 3GKKA 2PVOC 4QQ7A 1A2JA 3HD5A 2DJ3A 1XBSA 4J56E 1SD8A 4YKGA 2HZFA 3E3EA 1TRWA 2B5XA 2MMOA 4TW5A 3LYPA 2KHPA 3EE2A 3HJOA 2HNLA 3LXTA 1VF2A 2AUVA 2K18A 4TR0A 3LSZA 3GURA 2V41A 3GTUA 2M72A 3SBCA 4MH3A 4I97A 2KLXA 1Z7RA 1TJDA 2FWFA 4HJMA 3GH6A 5IPGA 5F0GA 1BF5A 4F0BA 1B4QA 4BL7B 3IK9A 1V98A 2DIZA 2H1AA 1O8WA 2WS2A 4EDYA 4PURA 3UBKA 1SKRB 6GSXA 2X8HA 4A5PA 5HFKA 2PVQA 3IOSA 1XOBA 3IHGA 4WKWA 5A5HB 5BRTA 2C0GA 2RM5A 3H8QA 3MDKA 2H0IA 3KH7A 2GZPA 1HD2A 2BTOT 5DAKA 5E59A 4IBPA 4XTSA 5HQPA 5JWOB 1GSDA 1XWBA 4KDXA 3UOMA 2AB6A 1SK0A 1V58A 1PKWA 1FG4A 2R0GA 1F9MA 3F0IA 3BJ5A 2XBQA 1PD21 1W4VA 3KIJA 2E0QA 5A5KA 1DBYA 2BJXA 3TKSC 1BAYA 2EFCA 3EYTA 5ENUA 1DSBA 3LFLA 4KAEA 3H1NA 1NHOA 2G0FA 1R4WA 2R3XA 1K3LA 3W6GA 4KX4A 4DSQA 3HYPA 4TR1B 3D0ZA 4V2MA 3TOUA 5ECQB 3EU4A 3NOFA 1FO5A 17GSA 1E6BA 2VL9A 1GULA 3KTLA 2L57A 5B8AA 2MBSA 1UN2A 2VKZG 1USBA 1DUGA 3FW2A 1K0MA 4KCEA 3UJ1A 2LRTA 3TB2A 2OACA 2A2RA 4K0NA 2RM6A 3MSZA 2YV9A 10GSA 2P5QA 5CO3A 3APOA 2N5BA 4AKGA 4K0GA 3QDNA 3J7Yb 4MF7A 3HZ4A 3IC4A 4AJ6A 2JU5A 2OE0A 5AGYA 1OC3A 1SJZA 4ECBA 5CAXA 2OBKA 2LUSA 4GF0A 4ICYA 2B1LA 1SD9A 1MD3A 1WMJA 2FA4A 2IMEA 2L6DA 1JZRA 1GTAA 1SKSB 3GSTA 3S9FA 1ZYEA 3CSHA 3GTUB 3KTBA 4MJCA 4KUNA 4MJEA 4OFMA 3M9KA 2IMDA 3GHAA 2VCXA 3ZMLA 1ST9A 4MZCA 4I2TA 1K0DA 3TJFA 3IAS2 1OVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y k;  4KSM A;  3GV1 A;  3UMA A;  1EOH A;  4TR4 A;  1N2A A;  4XCS A;  2X8C A;  3RDW A;  4GQF A;  1MDK A;  2FCH A;  1MEK A;  1EP7 A;  3TKQ A;  3TJK A;  3L0H A;  3VPQ A;  2HE3 A;  3UVH A;  1XFL A;  2FLS A;  2MMZ A;  4LMW A;  4ECI A;  4MK3 A;  2JZR A;  4MPG A;  4ECJ A;  2FD3 A;  3ZRD A;  4ZL9 A;  2DJ1 A;  2OA7 A;  4BPY A;  4DEJ A;  4MJB A;  3I43 A;  5HR1 A;  2JSY A;  1KBN A;  3HHV A;  3TJG A;  1AC1 A;  3HVS A;  5IOX A;  2CZ2 A;  4NHZ A;  1T4Z A;  3FZ5 A;  4MA9 A;  3BD2 A;  1EGR A;  3KCM A;  1DE2 A;  4IJ3 A;  1V2A A;  2IL3 A;  3VFI A;  5KN0 A;  3M3M A;  4JZQ A;  3O76 A;  3OR5 A;  4JR6 A;  3HDC A;  3GKX A;  3KZQ A;  4BWS A;  3IV4 A;  1KEB A;  4IHU A;  5KN3 A;  2XPD A;  4BVX A;  2YV7 A;  3L9U A;  3CBU A;  2FGX A;  4GQC A;  2X64 A;  4OWY A;  2DJ0 A;  5IMZ A;  1FHE A;  3SWL A;  3FZA A;  3Q18 A;  1GUH A;  4N10 A;  3MAK A;  3IBH A;  5D9T A;  1FB6 A;  1NM3 A;  4QL9 A;  6GST A;  1B4P A;  1SYX A;  3O3T A;  4MCU A;  1YEX A;  2FY6 A;  2H1B A;  4RQR A;  4DSR A;  4IJI A;  5A4W A;  4ZB6 A;  4G2E A;  4PNF A;  4TOP A;  3I69 A;  2WFC A;  1XW5 A;  3M8N A;  5ELA A;  2L6C A;  2H73 A;  2NTO A;  1AQX A;  2GSR A;  1B9X C;  1EWX A;  4NWY A;  3KP9 A;  1ILO A;  2PBJ A;  5JCU A;  1AXD A;  3A2X A;  5CRE A;  2LJR A;  1GWC A;  4L8E A;  5B6M A;  1XPV A;  5IMA A;  3ME8 A;  4K6X A;  3QOU A;  2HI7 A;  1XCC A;  2QC7 A;  3HVX A;  1M2A A;  4XS4 A;  1Z3E A;  3HJM A;  1EGO A;  3DWV A;  3NZN A;  1GTU A;  1WPI A;  2HT9 A;  1YKC A;  1GNE A;  1HNB A;  3A3T A;  5GSS A;  5G1L A;  1GTB A;  4E8E A;  4KGI A;  3APS A;  4MZW A;  2R4V A;  3F6D A;  1CQH A;  4NV2 A;  4OFN A;  2FHE A;  3UIW A;  2LJA A;  4ULX A;  3ZL5 A;  5J3R A;  4RQX A;  1TRV A;  4GCI A;  1TTZ A;  2I4A A;  4MP4 A;  5J9C A;  1M9B A;  3TKP A;  4IN0 A;  2CAQ A;  5AIV A;  4KF9 A;  4IS0 A;  3FY7 A;  5DQY A;  11GS A;  2FA8 A;  1TK8 B;  2MMN A;  1H75 A;  4KND A;  3I6A A;  3QMX A;  3LEF A;  3JCM L;  1W89 A;  2C3N A;  2L59 A;  2MMA A;  4BVX B;  4OCE A;  5DVB A;  4KA0 A;  1X5D A;  4PUA A;  5HR0 A;  4JR4 A;  4PQH A;  1GSE A;  3GYK A;  4NV5 A;  1THO A;  1MD4 A;  1F37 A;  4CW9 A;  3ZLP A;  2H19 A;  4HEA 2;  3APQ A;  1EEM A;  2HRA A;  2X99 A;  2IN3 A;  4EC0 A;  5H5S A;  4F03 A;  1ZGN A;  3ZFB A;  5DCG A;  4N0Z A;  2C4J A;  4TR3 A;  2GQM A;  3HY2 A;  1PL1 A;  4POB A;  1XZO A;  2NPB A;  1N8J A;  3BOA A;  2V2G A;  2B7K A;  1I9D A;  4OFT A;  2H30 A;  4ID0 A;  4V1A g;  1JZW A;  2LJK A;  5AIX A;  1J0F A;  2JZS A;  4RI7 A;  2C1Y A;  4G19 A;  1GNW A;  5IOW A;  1GLP A;  1JFU A;  5EL8 A;  2VL2 C;  5DCH A;  4IP1 A;  5IQY A;  2YWM A;  4X1U A;  1A2L A;  2HZE A;  5HFG A;  4HUA A;  1FB0 A;  1MDJ A;  5CRH A;  1BED A;  1GUK A;  1Z7P A;  2VM2 A;  4HJ2 A;  2WDU A;  1TK0 B;  1SK2 A;  5FT3 A;  4XS4 B;  4G0I A;  2TRX A;  3D4T A;  1K0O A;  5ECI B;  3K8N A;  2F3M A;  1PX7 A;  5JWQ B;  5GAP D;  2RUE A;  4IGJ A;  6GSY A;  2P0G A;  3VWU A;  4CDO A;  1V40 A;  4YQV A;  5HFI A;  3ZIT A;  2CVK A;  2VCV A;  2RII A;  5ECM B;  4I5Q A;  1S3A A;  1PRX A;  3QFA C;  1ML6 A;  4GLT A;  5ECP B;  1V9W A;  5B6N A;  5JCG A;  2IFQ A;  4FH8 A;  3WT1 A;  4IQA A;  2H6Y A;  4NXI A;  4JBB A;  2EIO A;  3IC8 A;  5DJL A;  1XXU A;  3UEM A;  1ZZY A;  4EO3 A;  1I5G A;  4WF5 A;  2GT5 A;  1CQG A;  4YH2 A;  5D73 A;  4PUF C;  1PN9 A;  2I3Y A;  3DML A;  5COH A;  3MWH A;  2WUL A;  2AHE A;  1QK8 A;  1F6M C;  3CSJ A;  3RPP A;  4POK A;  4P3Y B;  1PKZ A;  4MMM A;  4TRX A;  4N30 A;  4XIH A;  3FR6 A;  3F3Q A;  4KDU A;  3PIN A;  5DQS A;  1O8X A;  2HLS A;  5CRW A;  2L4Q A;  3LGC A;  4MPF A;  1M0U A;  1JZD A;  5ECH B;  2A2S A;  2H71 A;  1TDI A;  4HDE A;  5GST A;  3LQ7 A;  2IPA A;  5ECL B;  3HA9 A;  4KW6 A;  1OE8 A;  1R26 A;  3FKF A;  4J2F A;  1WJK A;  1TU7 A;  2JSZ A;  1AQV A;  1FOV A;  2FWG A;  2KP1 A;  1XW9 A;  3C1S A;  1GSS A;  1ZL9 A;  5EY6 A;  2K9F A;  5D96 A;  2B5E A;  1M2B A;  3CSI A;  2HZE B;  4F0C A;  2VOC A;  1KNG A;  1M7T A;  4TXO A;  3L4N A;  3DYR A;  2GGT A;  2DJK A;  2LQQ A;  5CRG A;  3IE3 A;  1YEP A;  2C3Q A;  1AIU A;  2LNT A;  4LA1 A;  3QAG A;  1O6J A;  2XHF A;  3IK7 A;  1A8L A;  4X0X A;  2B7J A;  2YCD A;  2HSY A;  3U5R E;  3TUE A;  3F3R A;  1J9B A;  3TJB A;  1T8E B;  1EEJ A;  2FWH A;  2ON5 A;  2LQO A;  1F3A A;  2VO4 A;  3ZVJ A;  2ZCT A;  2H66 A;  3PH9 A;  5CYY A;  1ERV A;  2R37 A;  3F4S A;  1HNC A;  3DVW A;  1SJI A;  3C71 A;  3ZVJ D;  2IFQ B;  4Z7X A;  3WD6 A;  2VCQ A;  4GRF A;  1SK1 A;  4YAP A;  2QGV A;  1ERW A;  1LU4 A;  2GQK A;  4OCF A;  1ZCP A;  2MZC A;  2VUP A;  5ECO B;  3ED3 A;  2HQT A;  2LNS A;  1TU8 A;  4ISD A;  5EVO A;  4BWQ A;  1SKW B;  4HS1 A;  1Q98 A;  4XRD A;  5ECR B;  2H6Z A;  4X43 A;  4XRA A;  1PSQ A;  3KD0 A;  3V1W A;  2VM1 A;  4Q5R A;  3GKN A;  4ZB9 A;  9GSS A;  3CMI A;  6GSU A;  3KMN A;  4ZBD A;  5IO2 A;  1YZX A;  4EE0 A;  2XBI A;  2YWI A;  2PER A;  4TXV A;  2J9H A;  3F4T A;  1WRY A;  2P31 A;  1TRU A;  3ERF A;  2OJL A;  4PQ1 A;  4ZL8 A;  4L5O A;  2O89 A;  1VF1 A;  5DAK B;  3ERW A;  4OMV A;  1RW1 A;  1A24 A;  3VWV A;  1TK5 B;  4EXJ A;  1X5C A;  3UAP A;  1XWG A;  1GSQ A;  4DVC A;  3CRU A;  3D22 A;  4IW9 A;  3EIN A;  3ZMK A;  1Z9H A;  1M2D A;  2LRC A;  4XS6 A;  2F8A A;  3VWW A;  3O6T A;  4O92 A;  2H76 A;  5INY A;  4TXO B;  1Y6E A;  4V2N A;  1WOU A;  3IAM 2;  3UVT A;  1FW1 A;  1S3C A;  2REM A;  4POM A;  1J08 A;  1PQN A;  12GS A;  4G0L A;  4F82 A;  4XS1 A;  2VCW A;  3U6V A;  3FEU A;  5D93 A;  2LRN A;  2L5O A;  2H0G A;  4YQU A;  1A23 A;  2C8U A;  1DE1 A;  1UVZ A;  2O8V B;  1TW9 A;  4GSS A;  4IQ1 A;  5H5R A;  1WIK A;  4MDC A;  1URM A;  2AV4 A;  3KEB A;  4PTS A;  1ZYQ B;  2HXK A;  2K8S A;  4OO4 A;  4F9Z A;  1YKA A;  2C80 A;  1GP1 A;  5HR2 A;  4K7O A;  1G6Y A;  3M1G A;  3CTG A;  2BMX A;  2DJ2 A;  2VLU A;  3IHQ A;  5F05 A;  1GSU A;  4HZ4 A;  4HQZ A;  4G9H A;  1Z5Y E;  3A2W A;  3Q19 A;  2V1M A;  3VK9 A;  2CV4 A;  3DKS A;  3WGD A;  2E7P A;  1U88 A;  1XOA A;  5F8B A;  1EOG A;  1PX6 A;  4WEY A;  2GTU A;  2A4V A;  5J5N A;  1ABA A;  3ZTL A;  2GZY A;  5C00 A;  4L0W A;  3HZ8 A;  2CX3 A;  1LJR A;  4JRR A;  22GS A;  3BCK A;  4H86 A;  1ON4 A;  1YQ1 A;  2AAW A;  2C0D A;  1SJ6 A;  3RAZ A;  2R6K A;  1YJ6 A;  1B48 A;  1ERU A;  4HZ2 A;  3ZFL A;  4EUY A;  2PGT A;  3GL3 A;  5IMF A;  1AAZ A;  1GTI A;  4ZIL A;  3ISO A;  2H74 A;  1QMV A;  4K7N A;  3F9U A;  2H1D A;  3H4K A;  20GS A;  3EVI A;  5EPF A;  4KSO A;  3L9S A;  4IP6 A;  4IVF A;  5E4W A;  1NW2 A;  3IRA A;  3RHB A;  3M0F A;  2VL3 A;  2RLI A;  2VCZ A;  3GN3 A;  4LL1 B;  3QCP A;  3TGZ A;  4MZB A;  4LL4 B;  1OC8 A;  1SYR A;  2M46 A;  2LKU A;  5LCZ A;  2CZ3 A;  1T1V A;  3EC3 A;  2AYT A;  1U87 A;  3G7J A;  4YQM A;  2JL4 A;  1XWC A;  3FHK A;  1VGL A;  1S3D A;  2F51 A;  2H0H A;  1RK4 A;  2CA8 A;  2YNX A;  3RPN A;  2DC5 A;  4O7H A;  3DVX A;  4PNG A;  2LV3 A;  5IM9 A;  4WR4 A;  3KH9 A;  5D9V A;  3VI5 A;  4G10 A;  4RUV A;  3PPU A;  2OE3 A;  5IMV A;  5A4U A;  4HU7 A;  2KUC A;  4GTU A;  4GSN A;  1OC9 A;  1QGV A;  3HXS A;  3DXB A;  3GL5 A;  3GX0 A;  2H70 A;  1EV4 A;  2VCT A;  5KN2 A;  3AY8 A;  3CXG A;  5F07 A;  2YWO A;  2VIM A;  2RUF A;  1K0B A;  2N5F A;  5B7C A;  2PU9 C;  3EMX A;  2G2Q A;  5DJM A;  2OKA A;  3RHC A;  1OKT A;  2IMF A;  2IMI A;  4PXO A;  2DML A;  5C04 A;  2GSS A;  2FNO A;  4KDY A;  4NAX A;  4EKZ A;  4MAB A;  4BL7 A;  2B1K A;  2HSM A;  1ZMA A;  3GRX A;  1GSF A;  3A2V A;  3UL3 A;  1FAA A;  2VLV A;  2PUK C;  1OE7 A;  2CAI A;  3IDV A;  2AJQ B;  1B9Y C;  4BVY A;  4I6X A;  3LG6 A;  1BQ7 A;  1LBK A;  2H1G A;  2WZ9 A;  1GH2 A;  3KJY A;  1KTE A;  1Y25 A;  3E9J B;  1F2E A;  3I9V 2;  4ZB8 A;  2JAD A;  5DAL A;  3FYG A;  3LOR A;  2B3S A;  4K2D A;  4WR5 A;  2CT6 A;  1XIY A;  1GSY A;  1OYJ A;  1A0F A;  2P5R A;  4ZBA A;  2IWT A;  2D2Z A;  3W8S A;  1YY7 A;  3BBY A;  1QUW A;  4WBR D;  2C0E A;  2YAN A;  2GSQ A;  1HYU A;  3HJP A;  1UA5 A;  2NDO A;  4G0K A;  1X9S B;  1G0T A;  1O7U A;  2DJJ A;  2OBI A;  2H6X A;  3HKR A;  5AIS A;  5BMU A;  1BJX A;  5G1K A;  3M9J A;  1TXX A;  2WRT A;  2YZH A;  3DIE A;  2YP6 A;  3TDG A;  3EUR A;  1A8Y A;  3H93 A;  3ZZX A;  1JLV A;  3UBL A;  4DSS A;  3DD3 A;  2FUG 2;  1XVW A;  3A5W A;  4IEL A;  2GT6 A;  2MYG A;  5G5E A;  2FWE A;  3BCI A;  3TOT A;  4J57 E;  5J9B A;  3GIX A;  3VI7 A;  2EIR A;  1QXH A;  5IIZ A;  3ZYW A;  3NIV A;  4HU9 A;  2GQL A;  2F9S A;  4D73 A;  3GMF A;  5D8I A;  3LYK A;  4YAV A;  3VPT A;  4MF5 A;  2UZ8 A;  2VAF A;  3TRP A;  4K1F A;  4I8B A;  3QFB C;  5ELG A;  2PPT A;  3QAW A;  1OC9 B;  1G7O A;  4FO5 A;  2GLR A;  2OE1 A;  2K6V A;  2WGR A;  5G31 A;  2K8V A;  2PWJ A;  2WCI A;  4JU5 A;  2QKE A;  1BYE A;  1T7P B;  4KCA A;  1R5P A;  1K3Y A;  4MJA A;  1XVQ A;  3TKS E;  1MTC A;  2HSM B;  2HSN B;  2B6M A;  4N11 A;  3D6I A;  3FR3 A;  5GZZ B;  4K9Z A;  2YZU A;  4BVY B;  3LJR A;  2L5L A;  2CX4 A;  1XW6 A;  4K8M A;  1PL2 A;  4PX1 A;  5ABR A;  1O85 A;  1VF3 A;  1U6T A;  4FYC A;  2KP2 A;  5DAL B;  3WT2 A;  2E2M A;  2VL2 A;  2VLT A;  3HCZ A;  3GFK A;  2M80 A;  2HYX A;  1TOF A;  2HRK A;  4ZL7 A;  2YJH A;  2DIY A;  2HRF A;  2O87 A;  5CP1 A;  2IJY A;  3VWX A;  4TVE A;  4Q5N A;  3ZIJ A;  4V2L A;  4O5R A;  2PMT A;  4IKH A;  1IYH A;  4GST A;  5J4U A;  4WET A;  1SEN A;  1ERT A;  1R5A A;  1WE0 A;  3US3 A;  4DSS B;  1JZO A;  1TRS A;  3ZRE A;  2H01 A;  5G2Z A;  5G5F A;  1GL8 A;  1YF0 A;  1SL1 B;  3QD9 A;  16GS A;  2ALB A;  2R5G A;  4O32 A;  1F3B A;  1O73 A;  1GUM A;  4KB3 A;  1T00 A;  4BA7 A;  4D73 B;  3EWL A;  3KMO A;  1MDI A;  3GH9 A;  1GRX A;  5D9X A;  6GSS A;  3L9V A;  3Q74 A;  2YN1 A;  4KE3 A;  1TI1 A;  3F4R A;  2NBS A;  1ACV A;  3MNG A;  3HVV A;  4ZIJ A;  5ECN B;  2DBC A;  1WP0 A;  1EV9 A;  3G7Y A;  3R2Q A;  4ILF A;  2EIQ A;  3F63 A;  4EVM A;  3P8W A;  2H72 A;  4WXT A;  2LS5 A;  1TI3 A;  3D4M A;  5LD0 A;  3D5J A;  3GUS A;  1U3A A;  2OAD A;  3G9B A;  1T3B A;  4QL7 A;  4AJ7 A;  1BX9 A;  3P7X A;  1G7E A;  1NHY A;  3IR4 A;  1AUC A;  1A2M A;  4GWR A;  4ML1 A;  1R7H A;  3TCO A;  3TKR A;  1ZOF A;  3GNJ A;  1K0C A;  1PA3 A;  1T4Y A;  13GS A;  1Z6N A;  4HI7 A;  1OAZ A;  2HRK B;  3N5O A;  1HNA A;  14GS A;  2PN8 A;  2TIR A;  3G7I A;  1X0R A;  3TKS A;  4ZBB A;  2V6O A;  2LTK A;  5FHI A;  1IYI A;  4KH7 A;  1X5E A;  2JAC A;  5B8B A;  3WGE A;  4ECC A;  5CRD A;  4JE1 A;  4CHS A;  4ML6 A;  1K0N A;  1VF4 A;  3D21 A;  4Q5Q A;  4EL1 A;  2ES7 A;  5KEJ A;  4TKY A;  3E0U A;  2IMK A;  4Q5F A;  3WYW A;  4JED A;  3KP8 A;  2O7K A;  3F6F A;  5GAN D;  2I1U A;  5DBQ A;  2V32 A;  3CYN A;  4TN8 A;  1E2Y A;  2QSI A;  4FYU A;  5JCW A;  2GST A;  1OKD A;  2E2G A;  1PMT A;  2DMM A;  2DSA A;  3PR8 A;  3LWA A;  3PGT A;  1XWA A;  5L71 A;  2DLX A;  1Z6M A;  1B8X A;  4HQS A;  3N9J A;  2R2J A;  2YPM A;  3QAV A;  8GSS A;  3Q6O A;  5FWG A;  1XWK A;  5DDL A;  1O81 A;  4RI6 A;  2X8G A;  1K3O A;  1EZK A;  2EC4 A;  1VRS D;  2HFD A;  1G6W A;  3IPZ A;  3DRN A;  1TP9 A;  5JWR B;  3VUR A;  1X9W B;  4AJ8 A;  4V1A p;  4FIW A;  5ID2 A;  2C0F A;  5D9W A;  2O85 A;  4PQI A;  2JZT A;  2I81 A;  4N0V A;  1TKD B;  3L78 A;  1V57 A;  2MBT A;  3FZ9 A;  3QR6 A;  2YOI A;  2YJ7 A;  1WWJ A;  1QQ2 A;  4LMV A;  3ZIV A;  5IMC A;  1SU9 A;  1K0A A;  3VLN A;  5IO0 A;  4FYB A;  3TRQ A;  3P2A A;  2GZZ A;  1U3I A;  1M99 A;  2CVD A;  2WB9 A;  2HRN A;  3RBT A;  3ME7 A;  18GS A;  3EU3 A;  1UC7 A;  4NHW A;  2ZUP A;  1JLW A;  1GLQ A;  3GKM A;  2GDR A;  3R3E A;  1RQM A;  2I9H A;  2Z9S A;  19GS A;  3TRX A;  4FQU A;  2B5Y A;  4E8H A;  3IA1 A;  3KGK A;  2H75 A;  1H4O A;  1AW9 A;  2LST A;  3GSS A;  1AQW A;  4EF0 A;  3C73 A;  2KOK A;  3FZ4 A;  1Q4J A;  4K7I A;  3QPM A;  4AGS A;  3LXZ A;  3TJJ A;  4NPB A;  2XPE A;  2HSH A;  2NVL A;  5IPH A;  3IXR A;  4ACS A;  1C72 A;  3CRT A;  3FR9 A;  3WGX A;  4L0U A;  4OO5 A;  2CQ9 A;  2GVP A;  3H79 A;  3UAR A;  1BG5 A;  1M9A A;  1JHB A;  3DGQ A;  5H5Q A;  5J41 A;  2V6K A;  3C1R A;  1QFN A;  3EMP A;  4OD7 A;  5LNK e;  1YDK A;  3CTF A;  1A0R P;  1FVK A;  5AN1 A;  5ECK B;  3F8U A;  2CVB A;  4WF4 A;  1SL2 B;  5KN1 A;  4PGT A;  2N5A A;  5ID2 B;  4MF6 A;  1NSW A;  4GXZ A;  2XC2 A;  1SL0 B;  5F06 A;  3P90 A;  2WJU A;  4EDZ A;  4F2I A;  3C7M A;  3DEX A;  5A4V A;  2ZNM A;  1X9M B;  2GS3 A;  4WBJ A;  5IMD A;  1THX A;  2ON7 A;  6GSV A;  5HR3 A;  1HQO A;  2TRC P;  2YWN A;  3C8E A;  2IIY A;  5CNW A;  3ERG A;  4XHM A;  1PGT A;  4HOJ A;  4I2U A;  5G30 A;  4LLR A;  7GSS A;  4USS A;  6GSW A;  3FRC A;  3GX8 A;  4TR1 A;  4MH2 A;  3W8J A;  2LEG A;  2C3T A;  1YF1 A;  4AF2 A;  4NMU A;  4POL A;  1FVJ A;  3FK8 A;  4L5L A;  2VD0 A;  1EP8 A;  2VD1 A;  3KXO A;  4MLY A;  4ZXG A;  2J23 A;  3KM6 A;  2L4C A;  2F8F A;  2H8L A;  3GA4 A;  5ECS A;  3GKK A;  2PVO C;  4QQ7 A;  1A2J A;  3HD5 A;  2DJ3 A;  1XBS A;  4J56 E;  1SD8 A;  2HZF A;  3E3E A;  1TRW A;  2B5X A;  2MMO A;  4TW5 A;  3LYP A;  2KHP A;  3EE2 A;  3HJO A;  2HNL A;  3LXT A;  1VF2 A;  2AUV A;  2K18 A;  4TR0 A;  3LSZ A;  3GUR A;  2V41 A;  3GTU A;  2M72 A;  3SBC A;  4MH3 A;  4I97 A;  2KLX A;  1Z7R A;  1TJD A;  2FWF A;  4HJM A;  3GH6 A;  5IPG A;  5F0G A;  4F0B A;  1B4Q A;  4BL7 B;  3IK9 A;  1V98 A;  2DIZ A;  2H1A A;  1O8W A;  2WS2 A;  4EDY A;  4PUR A;  3UBK A;  1SKR B;  6GSX A;  2X8H A;  5HFK A;  2PVQ A;  3IOS A;  1XOB A;  4WKW A;  2C0G A;  2RM5 A;  3H8Q A;  3MDK A;  2H0I A;  3KH7 A;  2GZP A;  1HD2 A;  2BTO T;  5DAK A;  5E59 A;  4IBP A;  4XTS A;  5HQP A;  5JWO B;  1GSD A;  1XWB A;  4KDX A;  3UOM A;  2AB6 A;  1SK0 A;  1V58 A;  1PKW A;  1FG4 A;  1F9M A;  3F0I A;  3BJ5 A;  2XBQ A;  1PD2 1;  1W4V A;  3KIJ A;  2E0Q A;  5A5K A;  1DBY A;  2BJX A;  3TKS C;  1BAY A;  3EYT A;  5ENU A;  1DSB A;  3LFL A;  4KAE A;  3H1N A;  1NHO A;  2G0F A;  1R4W A;  2R3X A;  1K3L A;  3W6G A;  4KX4 A;  4DSQ A;  3HYP A;  4TR1 B;  3D0Z A;  4V2M A;  3TOU A;  5ECQ B;  3EU4 A;  3NOF A;  1FO5 A;  17GS A;  1E6B A;  2VL9 A;  1GUL A;  3KTL A;  2L57 A;  5B8A A;  2MBS A;  1UN2 A;  1USB A;  1DUG A;  3FW2 A;  1K0M A;  4KCE A;  3UJ1 A;  2LRT A;  3TB2 A;  2OAC A;  2A2R A;  4K0N A;  2RM6 A;  3MSZ A;  2YV9 A;  10GS A;  2P5Q A;  5CO3 A;  3APO A;  2N5B A;  4K0G A;  3QDN A;  3J7Y b;  4MF7 A;  3HZ4 A;  3IC4 A;  4AJ6 A;  2JU5 A;  2OE0 A;  5AGY A;  1OC3 A;  1SJZ A;  4ECB A;  5CAX A;  2OBK A;  2LUS A;  4GF0 A;  2B1L A;  1SD9 A;  1MD3 A;  1WMJ A;  2FA4 A;  2IME A;  2L6D A;  1JZR A;  1GTA A;  1SKS B;  3GST A;  3S9F A;  1ZYE A;  3CSH A;  3GTU B;  3KTB A;  4MJC A;  4KUN A;  4MJE A;  4OFM A;  3M9K A;  2IMD A;  3GHA A;  2VCX A;  3ZML A;  1ST9 A;  4MZC A;  4I2T A;  1K0D A;  3TJF A;  3IAS 2;  1OVN A; 
#chains in the Genus database with same CATH topology
 4GDF A;  3J7Y k;  4KSM A;  3GV1 A;  3UMA A;  1EOH A;  4AKX B;  4TR4 A;  1N2A A;  4XCS A;  2WW2 A;  2X8C A;  3RDW A;  4GQF A;  1MDK A;  2FCH A;  1BG1 A;  1MEK A;  1EP7 A;  3TKQ A;  2EFE A;  3TJK A;  3L0H A;  4CY8 A;  2UV8 G;  3VPQ A;  2HE3 A;  3UVH A;  1XFL A;  2FLS A;  2MMZ A;  4LMW A;  4ECI A;  4MK3 A;  1ZYN A;  2R0P A;  2JZR A;  4MPG A;  4ECJ A;  2FD3 A;  3ZRD A;  4ZL9 A;  2DJ1 A;  2OA7 A;  4BPY A;  4DEJ A;  4MJB A;  3I43 A;  2X4A A;  5HR1 A;  2JSY A;  1KBN A;  3HHV A;  3TJG A;  1AC1 A;  3HVS A;  5IOX A;  2CZ2 A;  4NHZ A;  1T4Z A;  3FZ5 A;  4MA9 A;  3BD2 A;  1EGR A;  3KCM A;  4K5S A;  3CQF A;  1DE2 A;  4IJ3 A;  1V2A A;  4O5U A;  2IL3 A;  3VFI A;  5KN0 A;  3M3M A;  4JZQ A;  3O76 A;  3OR5 A;  4JR6 A;  3HDC A;  3GKX A;  3KZQ A;  4BWS A;  3IV4 A;  1KEB A;  4IHU A;  5KN3 A;  2XPD A;  4BVX A;  2YV7 A;  3L9U A;  3CBU A;  2FGX A;  4GQC A;  2X64 A;  4OWY A;  2DJ0 A;  5IMZ A;  1FHE A;  3SWL A;  3FZA A;  3Q18 A;  1GUH A;  4N10 A;  3MAK A;  3IBH A;  2O3E A;  5D9T A;  1FB6 A;  1NM3 A;  4QL9 A;  6GST A;  1B4P A;  1SYX A;  3O3T A;  4MCU A;  1YEX A;  2FY6 A;  2H1B A;  4RQR A;  4DSR A;  4IJI A;  5A4W A;  4ZB6 A;  4AKI A;  5A1N A;  4G2E A;  4PNF A;  4TOP A;  3I69 A;  2WFC A;  1XW5 A;  3M8N A;  5ELA A;  1ZYP A;  2L6C A;  2H73 A;  2NTO A;  1AQX A;  2GSR A;  1B9X C;  3FMW A;  1EWX A;  4NWY A;  3KP9 A;  1ILO A;  2PBJ A;  5JCU A;  1AXD A;  3A2X A;  5CRE A;  5KOW A;  2LJR A;  1GWC A;  4L8E A;  5B6M A;  1XPV A;  5IMA A;  3ME8 A;  4K6X A;  3QOU A;  2HI7 A;  1XCC A;  2QC7 A;  3HVX A;  1M2A A;  4XS4 A;  1Z3E A;  3HJM A;  1EGO A;  3DWV A;  3NZN A;  1GTU A;  1WPI A;  2HT9 A;  1YKC A;  1GNE A;  1HNB A;  3A3T A;  4QMK A;  5GSS A;  5G1L A;  1GTB A;  4E8E A;  4KGI A;  3APS A;  4MZW A;  2R4V A;  3F6D A;  1CQH A;  4NV2 A;  4OFN A;  2FHE A;  2EFD A;  3UIW A;  2LJA A;  4ULX A;  3ZL5 A;  5J3R A;  4RQX A;  1TRV A;  4GCI A;  1TTZ A;  2I4A A;  4MP4 A;  5J9C A;  1M9B A;  3TKP A;  2CAQ A;  5AIV A;  4IN0 A;  4KF9 A;  4IS0 A;  3FY7 A;  5DQY A;  11GS A;  2FA8 A;  1TK8 B;  2MMN A;  1M3J A;  1H75 A;  4KND A;  3MYD A;  3I6A A;  1SVL A;  3QMX A;  3LEF A;  3JCM L;  1W89 A;  2C3N A;  2L59 A;  2MMA A;  4BVX B;  4OCE A;  5DVB A;  4KA0 A;  1X5D A;  4PUA A;  5HR0 A;  4JR4 A;  4PQH A;  1GSE A;  3GYK A;  4NV5 A;  1THO A;  1MD4 A;  1F37 A;  4CW9 A;  3ZLP A;  2H19 A;  4HEA 2;  3APQ A;  1EEM A;  2HRA A;  2X99 A;  2IN3 A;  4EC0 A;  5H5S A;  4F03 A;  1ZGN A;  3ZFB A;  5DCG A;  4N0Z A;  2C4J A;  4TR3 A;  2GQM A;  3HY2 A;  5A1N B;  1PL1 A;  4POB A;  1XZO A;  2NPB A;  1N8J A;  3BOA A;  2V2G A;  2B7K A;  3HMJ G;  1I9D A;  4OFT A;  2H30 A;  4ID0 A;  4V1A g;  1JZW A;  3CWG A;  5J47 A;  2LJK A;  5AIX A;  5J4Y A;  1J0F A;  2OT3 A;  2JZS A;  4RI7 A;  2C1Y A;  4G19 A;  1GNW A;  5IOW A;  1GLP A;  1JFU A;  5EL8 A;  2VL2 C;  5DCH A;  4IP1 A;  5IQY A;  2YWM A;  4X1U A;  1A2L A;  2HZE A;  5HFG A;  4HUA A;  5A34 B;  1FB0 A;  1MDJ A;  5CRH A;  1BED A;  1GUK A;  1SVM A;  1Z7P A;  2VM2 A;  4HJ2 A;  2WDU A;  1TK0 B;  1SK2 A;  5FT3 A;  4XS4 B;  4G0I A;  2TRX A;  3D4T A;  1K0O A;  5ECI B;  3K8N A;  2F3M A;  1PX7 A;  5JWQ B;  5GAP D;  2RUE A;  4IGJ A;  6GSY A;  2P0G A;  3VWU A;  4CDO A;  1V40 A;  4YQV A;  5HFI A;  3ZIT A;  2CVK A;  2VCV A;  2RII A;  5ECM B;  4I5Q A;  1S3A A;  1PRX A;  3QFA C;  1ML6 A;  1V9W A;  4GLT A;  4PHZ C;  5ECP B;  5B6N A;  5JCG A;  2IFQ A;  4FH8 A;  3WT1 A;  2QA1 A;  4IQA A;  2H6Y A;  4NXI A;  4JBB A;  2EIO A;  3IC8 A;  5DJL A;  1XXU A;  3UEM A;  1ZZY A;  4EO3 A;  1I5G A;  4WF5 A;  2GT5 A;  1CQG A;  4YH2 A;  5D73 A;  4PUF C;  1PN9 A;  2I3Y A;  3DML A;  5COH A;  3MWH A;  2WUL A;  2AHE A;  1QK8 A;  1F6M C;  3CSJ A;  3RPP A;  4POK A;  4P3Y B;  1PKZ A;  4MMM A;  4TRX A;  4N30 A;  4XIH A;  3FR6 A;  3F3Q A;  4KDU A;  3PIN A;  5DQS A;  1O8X A;  2HLS A;  5CRW A;  2L4Q A;  3LGC A;  4MPF A;  1M0U A;  1JZD A;  5ECH B;  2A2S A;  2H71 A;  1TDI A;  4HDE A;  5GST A;  3LQ7 A;  2IPA A;  5ECL B;  3HA9 A;  4KW6 A;  1OE8 A;  1R26 A;  3FKF A;  4J2F A;  1WJK A;  1TU7 A;  2JSZ A;  1AQV A;  1FOV A;  2FWG A;  2KP1 A;  1XW9 A;  3C1S A;  1GSS A;  1ZL9 A;  5EY6 A;  2K9F A;  5D96 A;  2B5E A;  1M2B A;  3CSI A;  2HZE B;  4F0C A;  2VOC A;  1KNG A;  1M7T A;  4TXO A;  3L4N A;  3DYR A;  2GGT A;  2DJK A;  2LQQ A;  5CRG A;  3IE3 A;  1YEP A;  2C3Q A;  1AIU A;  2LNT A;  4LA1 A;  3QAG A;  1O6J A;  2XHF A;  3IK7 A;  1A8L A;  4X0X A;  2B7J A;  2YCD A;  2HSY A;  3U5R E;  3TUE A;  2A4H A;  3F3R A;  1J9B A;  3TJB A;  1T8E B;  3TU3 B;  1EEJ A;  2FWH A;  2ON5 A;  2LQO A;  1F3A A;  2VO4 A;  3ZVJ A;  2ZCT A;  2H66 A;  3PH9 A;  5CYY A;  1ERV A;  2R37 A;  3F4S A;  1HNC A;  3DVW A;  1SJI A;  3C71 A;  3ZVJ D;  2IFQ B;  4Z7X A;  3WD6 A;  2VCQ A;  4GRF A;  1SK1 A;  4YAP A;  2QGV A;  1ERW A;  1LU4 A;  2GQK A;  4OCF A;  1ZCP A;  2MZC A;  2VUP A;  5ECO B;  3ED3 A;  2HQT A;  4N3Z A;  1TU8 A;  2LNS A;  4ISD A;  5EVO A;  4BWQ A;  1YVL A;  1SKW B;  4HS1 A;  1Q98 A;  4XRD A;  5ECR B;  2H6Z A;  4X43 A;  4XRA A;  1PSQ A;  3KD0 A;  3V1W A;  2VM1 A;  4Q5R A;  3GKN A;  4ZB9 A;  9GSS A;  3CMI A;  6GSU A;  3KMN A;  4ZBD A;  5IO2 A;  1YZX A;  4EE0 A;  2XBI A;  2YWI A;  2PER A;  4TXV A;  2J9H A;  3F4T A;  1WRY A;  2P31 A;  1TRU A;  3ERF A;  2OJL A;  4PQ1 A;  4ZL8 A;  4L5O A;  2O89 A;  1VF1 A;  1S4B P;  5J40 A;  5DAK B;  3ERW A;  4OMV A;  1RW1 A;  1A24 A;  3VWV A;  1TK5 B;  4EXJ A;  1X5C A;  3UAP A;  1XWG A;  1GSQ A;  4DVC A;  3CRU A;  3D22 A;  4IW9 A;  3EIN A;  3ZMK A;  1Z9H A;  1M2D A;  2LRC A;  4XS6 A;  2F8A A;  3VWW A;  3RFR C;  3O6T A;  4O92 A;  2H76 A;  5INY A;  4TXO B;  1Y6E A;  4V2N A;  1WOU A;  3IAM 2;  3UVT A;  1FW1 A;  1S3C A;  2REM A;  4POM A;  1J08 A;  1PQN A;  12GS A;  2WW3 A;  4G0L A;  4F82 A;  4XS1 A;  2VCW A;  3U6V A;  3FEU A;  5D93 A;  2LRN A;  2L5O A;  2H0G A;  4YQU A;  1A23 A;  2C8U A;  1DE1 A;  1UVZ A;  2O8V B;  1TW9 A;  4GSS A;  4IQ1 A;  5H5R A;  1WIK A;  4MDC A;  1URM A;  2AV4 A;  4Z2R A;  3KEB A;  2R0C A;  4PTS A;  1ZYQ B;  2HXK A;  2K8S A;  4OO4 A;  4F9Z A;  1YKA A;  1XG8 A;  2C80 A;  1GP1 A;  5HR2 A;  4K7O A;  1G6Y A;  3M1G A;  3CTG A;  2BMX A;  2DJ2 A;  2VLU A;  3IHQ A;  5F05 A;  1GSU A;  4HZ4 A;  4AI6 A;  4HQZ A;  4G9H A;  1Z5Y E;  3A2W A;  3Q19 A;  2V1M A;  3VK9 A;  2CV4 A;  3DKS A;  3WGD A;  2E7P A;  1U88 A;  1XOA A;  5F8B A;  1EOG A;  1PX6 A;  4WEY A;  2GTU A;  2A4V A;  5J5N A;  1ABA A;  3ZTL A;  2GZY A;  2O5V A;  5C00 A;  4L0W A;  3HZ8 A;  5J4V A;  2CX3 A;  5KOX A;  1LJR A;  4JRR A;  2QA2 A;  22GS A;  3BCK A;  4H86 A;  1ON4 A;  1YQ1 A;  2AAW A;  2C0D A;  4HSC X;  1SJ6 A;  3RAZ A;  2WW1 A;  2R6K A;  1YJ6 A;  1B48 A;  1ERU A;  4HZ2 A;  3ZFL A;  4EUY A;  2PGT A;  3GL3 A;  5IMF A;  1AAZ A;  1GTI A;  4ZIL A;  4YKF A;  3ISO A;  2H74 A;  1QMV A;  4K7N A;  3F9U A;  3A5I A;  2H1D A;  3H4K A;  20GS A;  3EVI A;  5EPF A;  4KSO A;  3L9S A;  4IP6 A;  4IVF A;  2X49 A;  5E4W A;  1NW2 A;  3LW9 A;  3IRA A;  3RHB A;  3M0F A;  2VL3 A;  2RLI A;  2VCZ A;  3GN3 A;  4LL1 B;  3QCP A;  3TGZ A;  4MZB A;  4LL4 B;  1OC8 A;  1SYR A;  2M46 A;  2LKU A;  5LCZ A;  2CZ3 A;  1T1V A;  3EC3 A;  2AYT A;  1U87 A;  3G7J A;  4YQM A;  2JL4 A;  1XWC A;  3FHK A;  1VGL A;  1S3D A;  2F51 A;  2H0H A;  1RK4 A;  1SVO A;  2CA8 A;  2YNX A;  3RPN A;  2DC5 A;  4O7H A;  3DVX A;  4PNG A;  2LV3 A;  5IM9 A;  4WR4 A;  3KH9 A;  5D9V A;  3VI5 A;  4G10 A;  4RUV A;  3PPU A;  2OE3 A;  5IMV A;  5A4U A;  4HU7 A;  2KUC A;  4GTU A;  4GSN A;  1OC9 A;  1QGV A;  3HXS A;  3DXB A;  3GL5 A;  3GX0 A;  2H70 A;  1EV4 A;  2VCT A;  5KN2 A;  3AY8 A;  3CXG A;  5F07 A;  2YWO A;  2WVZ A;  2VIM A;  2RUF A;  1K0B A;  2N5F A;  5B7C A;  2PU9 C;  3EMX A;  2G2Q A;  5DJM A;  2OKA A;  4PI0 C;  3RHC A;  1OKT A;  2IMF A;  1YEW C;  2IMI A;  4PXO A;  2DML A;  5C04 A;  2GSS A;  2FNO A;  4KDY A;  4NAX A;  4EKZ A;  4MAB A;  4BL7 A;  2B1K A;  2HSM A;  2HSN A;  1ZMA A;  3GRX A;  1GSF A;  3A2V A;  3UL3 A;  1FAA A;  2VLV A;  2PUK C;  1OE7 A;  2CAI A;  3IDV A;  4W66 A;  2AJQ B;  4G01 A;  1B9Y C;  4BVY A;  4I6X A;  3LG6 A;  1BQ7 A;  1LBK A;  2H1G A;  2WZ9 A;  1GH2 A;  3KJY A;  4CY6 A;  1KTE A;  1Y25 A;  3E9J B;  1F2E A;  3I9V 2;  4ZB8 A;  2JAD A;  5DAL A;  3FYG A;  3LOR A;  2B3S A;  4K2D A;  4WR5 A;  2CT6 A;  1XIY A;  1GSY A;  1OYJ A;  1A0F A;  2P5R A;  4ZBA A;  4K5R A;  2IWT A;  2D2Z A;  3W8S A;  1YY7 A;  3BBY A;  1QUW A;  4WBR D;  2C0E A;  4MNN A;  2YAN A;  2GSQ A;  4O5Q A;  2DKH A;  1HYU A;  3HJP A;  1UA5 A;  2NDO A;  4G0K A;  1X9S B;  1G0T A;  1FOH A;  1O7U A;  2DJJ A;  2OBI A;  2H6X A;  3HKR A;  5AIS A;  5BMU A;  1BJX A;  5G1K A;  3M9J A;  1TXX A;  2WRT A;  2YZH A;  3DIE A;  4K2X A;  2YP6 A;  3TDG A;  3EUR A;  1A8Y A;  3H93 A;  3ZZX A;  1JLV A;  3UBL A;  4DSS A;  3DD3 A;  2FUG 2;  1XVW A;  3A5W A;  4IEL A;  2GT6 A;  2MYG A;  5G5E A;  2FWE A;  3BCI A;  3TOT A;  4J57 E;  5J9B A;  3GIX A;  3VI7 A;  2EIR A;  1QXH A;  5IIZ A;  3ZYW A;  3NIV A;  4HU9 A;  2GQL A;  2F9S A;  4D73 A;  3GMF A;  5D8I A;  3LYK A;  4YAV A;  3VPT A;  4MF5 A;  2UZ8 A;  4Z2T A;  2VAF A;  3TRP A;  4K1F A;  4I8B A;  3QFB C;  5ELG A;  2PPT A;  3QAW A;  1OC9 B;  1G7O A;  4FO5 A;  2GLR A;  2OE1 A;  3MIX A;  2K6V A;  2WGR A;  5G31 A;  2K8V A;  2PWJ A;  2WCI A;  4JU5 A;  2QKE A;  1PN0 A;  1BYE A;  1T7P B;  4KCA A;  1R5P A;  1K3Y A;  4MJA A;  1XVQ A;  3TKS E;  1MTC A;  2HSM B;  2HSN B;  2B6M A;  4N11 A;  3D6I A;  3FR3 A;  5GZZ B;  4K9Z A;  2YZU A;  4BVY B;  3LJR A;  1N25 A;  2L5L A;  2CX4 A;  1XW6 A;  4K8M A;  1PL2 A;  4PX1 A;  5ABR A;  1O85 A;  1VF3 A;  1U6T A;  4FYC A;  2KP2 A;  5DAL B;  3WT2 A;  2E2M A;  2VL2 A;  2VLT A;  3HCZ A;  3GFK A;  2M80 A;  2HYX A;  1TOF A;  2HRK A;  4ZL7 A;  2YJH A;  2DIY A;  2HRF A;  2O87 A;  5CP1 A;  2IJY A;  3VWX A;  2WVY A;  4TVE A;  4Q5N A;  3ZIJ A;  4V2L A;  4O5R A;  5BMU B;  2PMT A;  4IKH A;  1IYH A;  4GST A;  5J4U A;  4WET A;  1SEN A;  1ERT A;  1R5A A;  1WE0 A;  3US3 A;  4DSS B;  1JZO A;  1TRS A;  3ZRE A;  2H01 A;  5G2Z A;  5G5F A;  1GL8 A;  3CHX C;  1YF0 A;  1SL1 B;  3QD9 A;  16GS A;  2ALB A;  2R5G A;  4O32 A;  1F3B A;  1O73 A;  1GUM A;  4KB3 A;  1T00 A;  4BA7 A;  4D73 B;  3EWL A;  3KMO A;  1MDI A;  3GH9 A;  1GRX A;  5D9X A;  6GSS A;  3L9V A;  3Q74 A;  2YN1 A;  4KE3 A;  1TI1 A;  3F4R A;  2DKI A;  2NBS A;  1ACV A;  3RGB C;  3MNG A;  3HVV A;  4ZIJ A;  5ECN B;  2EFH A;  2DBC A;  1WP0 A;  1EV9 A;  3G7Y A;  3R2Q A;  4ILF A;  2EIQ A;  3F63 A;  4EVM A;  3P8W A;  2H72 A;  4WXT A;  2LS5 A;  1TI3 A;  3D4M A;  5LD0 A;  3D5J A;  3GUS A;  1U3A A;  2OAD A;  3G9B A;  1T3B A;  4QL7 A;  4AJ7 A;  1BX9 A;  3P7X A;  1G7E A;  1NHY A;  3IR4 A;  1AUC A;  1A2M A;  4GWR A;  4ML1 A;  1R7H A;  3TCO A;  3TKR A;  1ZOF A;  3GNJ A;  1K0C A;  1PA3 A;  1T4Y A;  13GS A;  1Z6N A;  4HI7 A;  1OAZ A;  2HRK B;  3N5O A;  1HNA A;  14GS A;  2PN8 A;  2TIR A;  3G7I A;  1X0R A;  3TKS A;  4ZBB A;  2V6O A;  2LTK A;  5FHI A;  1IYI A;  4KH7 A;  1X5E A;  2JAC A;  5B8B A;  3WGE A;  4ECC A;  5CRD A;  4JE1 A;  4CHS A;  1I1I P;  4ML6 A;  1K0N A;  1VF4 A;  3D21 A;  4Q5Q A;  4EL1 A;  2ES7 A;  5KEJ A;  1Y1U A;  4TKY A;  3E0U A;  2IMK A;  4Q5F A;  3WYW A;  4JED A;  3KP8 A;  4EIP A;  4E68 A;  2O7K A;  3F6F A;  5GAN D;  2I1U A;  5DBQ A;  2V32 A;  3CYN A;  4TN8 A;  1E2Y A;  2QSI A;  4FYU A;  5JCW A;  2GST A;  1OKD A;  2E2G A;  1PMT A;  2DMM A;  2DSA A;  3PR8 A;  1PFO A;  3LWA A;  3PGT A;  1XWA A;  5L71 A;  2DLX A;  1Z6M A;  1B8X A;  4PI2 C;  3N9J A;  2R2J A;  4HQS A;  4FXY P;  3QAV A;  2YPM A;  8GSS A;  3Q6O A;  5FWG A;  1XWK A;  5DDL A;  4EIQ A;  1O81 A;  4RI6 A;  2X8G A;  1K3O A;  4Z2U A;  1EZK A;  2EC4 A;  1VRS D;  2HFD A;  1G6W A;  3IPZ A;  3DRN A;  1TP9 A;  5JWR B;  3VUR A;  1X9W B;  4AJ8 A;  4V1A p;  4FIW A;  5ID2 A;  2C0F A;  5D9W A;  2O85 A;  4PQI A;  1S3R A;  2JZT A;  2I81 A;  4N0V A;  1TKD B;  3L78 A;  1V57 A;  2MBT A;  3FZ9 A;  3QR6 A;  2YOI A;  2YJ7 A;  5A34 A;  1WWJ A;  1QQ2 A;  4LMV A;  3ZIV A;  5IMC A;  1SU9 A;  1K0A A;  3VLN A;  4X4J A;  5IO0 A;  4FYB A;  3TRQ A;  3P2A A;  2GZZ A;  1U3I A;  1TXU A;  1M99 A;  2CVD A;  2WB9 A;  2HRN A;  3RBT A;  3ME7 A;  18GS A;  3EU3 A;  1UC7 A;  4NHW A;  2ZUP A;  1JLW A;  1GLQ A;  3GKM A;  2GDR A;  3R3E A;  1RQM A;  2I9H A;  2Z9S A;  19GS A;  4ZB7 A;  3TRX A;  4FQU A;  3EPT A;  2B5Y A;  4E8H A;  3IA1 A;  3KGK A;  2H75 A;  2A2P A;  1H4O A;  1AW9 A;  2LST A;  3GSS A;  1AQW A;  4EF0 A;  3C73 A;  2KOK A;  3FZ4 A;  1Q4J A;  4BIK A;  4K7I A;  3QPM A;  4AGS A;  3LXZ A;  3TJJ A;  2O36 A;  4NPB A;  2XPE A;  2HSH A;  2NVL A;  5IPH A;  3IXR A;  4ACS A;  1C72 A;  3CRT A;  3FR9 A;  3WGX A;  4L0U A;  4OO5 A;  2CQ9 A;  2GVP A;  3H79 A;  3UAR A;  1BG5 A;  1M9A A;  1JHB A;  3DGQ A;  5H5Q A;  5J41 A;  2V6K A;  3C1R A;  1QFN A;  3EMP A;  4OD7 A;  5LNK e;  1YDK A;  3CTF A;  1A0R P;  1FVK A;  5AN1 A;  5ECK B;  3F8U A;  2CVB A;  4WF4 A;  1SL2 B;  5KN1 A;  5A5H A;  4AKH A;  4PGT A;  2N5A A;  5ID2 B;  4MF6 A;  1NSW A;  4GXZ A;  2XC2 A;  1SL0 B;  5F06 A;  3P90 A;  2WJU A;  4EDZ A;  4F2I A;  2H1L A;  3C7M A;  3DEX A;  5A4V A;  2ZNM A;  1X9M B;  2GS3 A;  4WBJ A;  2WW0 A;  5IMD A;  1THX A;  2ON7 A;  6GSV A;  5HR3 A;  1HQO A;  2TRC P;  2YWN A;  3C8E A;  2IIY A;  2WVX A;  5CNW A;  3ERG A;  4XHM A;  1PGT A;  4HOJ A;  4I2U A;  5G30 A;  4LLR A;  7GSS A;  4USS A;  6GSW A;  3FRC A;  3GX8 A;  4TR1 A;  4MH2 A;  3W8J A;  2LEG A;  2C3T A;  1YF1 A;  4AF2 A;  4NMU A;  4POL A;  1FVJ A;  3FK8 A;  4L5L A;  2VD0 A;  1EP8 A;  2VD1 A;  3KXO A;  4MLY A;  4ZXG A;  2J23 A;  3KM6 A;  2L4C A;  2F8F A;  2H8L A;  3GA4 A;  5ECS A;  3GKK A;  2PVO C;  4QQ7 A;  1A2J A;  3HD5 A;  2DJ3 A;  1XBS A;  4J56 E;  1SD8 A;  4YKG A;  2HZF A;  3E3E A;  1TRW A;  2B5X A;  2MMO A;  4TW5 A;  3LYP A;  2KHP A;  3EE2 A;  3HJO A;  2HNL A;  3LXT A;  1VF2 A;  2AUV A;  2K18 A;  4TR0 A;  3LSZ A;  3GUR A;  2V41 A;  3GTU A;  2M72 A;  3SBC A;  4MH3 A;  4I97 A;  2KLX A;  1Z7R A;  1TJD A;  2FWF A;  4HJM A;  3GH6 A;  5IPG A;  5F0G A;  1BF5 A;  4F0B A;  1B4Q A;  4BL7 B;  3IK9 A;  1V98 A;  2DIZ A;  2H1A A;  1O8W A;  2WZS A;  2WS2 A;  4EDY A;  4PUR A;  3UBK A;  1SKR B;  6GSX A;  2X8H A;  4A5P A;  5HFK A;  2PVQ A;  3IOS A;  1XOB A;  3IHG A;  4WKW A;  5A5H B;  5BRT A;  2C0G A;  2RM5 A;  3H8Q A;  3MDK A;  2H0I A;  3KH7 A;  2GZP A;  1HD2 A;  2BTO T;  5DAK A;  5E59 A;  4IBP A;  4XTS A;  5HQP A;  5JWO B;  1GSD A;  1XWB A;  4KDX A;  3UOM A;  2AB6 A;  1SK0 A;  1V58 A;  1PKW A;  1FG4 A;  2R0G A;  1F9M A;  3F0I A;  3BJ5 A;  2XBQ A;  1PD2 1;  1W4V A;  3KIJ A;  2E0Q A;  5A5K A;  1DBY A;  2BJX A;  3TKS C;  1BAY A;  2EFC A;  3EYT A;  5ENU A;  2WVX B;  1DSB A;  3LFL A;  4KAE A;  3H1N A;  1NHO A;  2G0F A;  1R4W A;  2R3X A;  1K3L A;  3W6G A;  4KX4 A;  4DSQ A;  3HYP A;  4TR1 B;  3D0Z A;  4V2M A;  3TOU A;  5ECQ B;  3EU4 A;  3NOF A;  1FO5 A;  17GS A;  1E6B A;  2VL9 A;  1GUL A;  3KTL A;  2L57 A;  5B8A A;  2MBS A;  1UN2 A;  2VKZ G;  1USB A;  1DUG A;  3FW2 A;  1K0M A;  3HVN A;  4KCE A;  3UJ1 A;  2LRT A;  3TB2 A;  2OAC A;  2A2R A;  4K0N A;  2RM6 A;  3MSZ A;  2YV9 A;  10GS A;  2P5Q A;  5CO3 A;  3APO A;  2N5B A;  4AKG A;  4K0G A;  3QDN A;  1M3I A;  3J7Y b;  4MF7 A;  3HZ4 A;  3IC4 A;  4AJ6 A;  2JU5 A;  2OE0 A;  1OC3 A;  1SJZ A;  5AGY A;  4ECB A;  5CAX A;  2OBK A;  2LUS A;  4GF0 A;  4ICY A;  2B1L A;  1SD9 A;  1MD3 A;  1WMJ A;  2FA4 A;  2IME A;  2L6D A;  1JZR A;  1GTA A;  1SKS B;  3GST A;  3S9F A;  1ZYE A;  3CSH A;  3GTU B;  3KTB A;  4MJC A;  4KUN A;  4MJE A;  4OFM A;  3M9K A;  2IMD A;  3GHA A;  2VCX A;  3ZML A;  1ST9 A;  4MZC A;  4I2T A;  1K0D A;  3TJF A;  3IAS 2;  1OVN A; 
#chains in the Genus database with same CATH homology
 4GDF A;  3J7Y k;  4KSM A;  3GV1 A;  3UMA A;  1EOH A;  4AKX B;  4TR4 A;  1N2A A;  4XCS A;  2X8C A;  3RDW A;  4GQF A;  1MDK A;  2FCH A;  1BG1 A;  1MEK A;  1EP7 A;  3TKQ A;  2EFE A;  3TJK A;  3L0H A;  4CY8 A;  2UV8 G;  3VPQ A;  2HE3 A;  3UVH A;  1XFL A;  2FLS A;  2MMZ A;  4LMW A;  4ECI A;  4MK3 A;  1ZYN A;  2R0P A;  2JZR A;  4MPG A;  4ECJ A;  2FD3 A;  3ZRD A;  4ZL9 A;  2DJ1 A;  2OA7 A;  4BPY A;  4DEJ A;  4MJB A;  3I43 A;  2X4A A;  5HR1 A;  2JSY A;  1KBN A;  3HHV A;  3TJG A;  1AC1 A;  3HVS A;  5IOX A;  2CZ2 A;  4NHZ A;  1T4Z A;  3FZ5 A;  4MA9 A;  3BD2 A;  1EGR A;  3KCM A;  4K5S A;  1DE2 A;  4IJ3 A;  1V2A A;  4O5U A;  2IL3 A;  3VFI A;  5KN0 A;  3M3M A;  4JZQ A;  3O76 A;  3OR5 A;  4JR6 A;  3HDC A;  3GKX A;  3KZQ A;  4BWS A;  3IV4 A;  1KEB A;  4IHU A;  5KN3 A;  2XPD A;  4BVX A;  2YV7 A;  3L9U A;  3CBU A;  2FGX A;  4GQC A;  2X64 A;  4OWY A;  2DJ0 A;  5IMZ A;  1FHE A;  3SWL A;  3FZA A;  3Q18 A;  1GUH A;  4N10 A;  3MAK A;  3IBH A;  5D9T A;  1FB6 A;  1NM3 A;  4QL9 A;  6GST A;  1B4P A;  1SYX A;  3O3T A;  4MCU A;  1YEX A;  2FY6 A;  2H1B A;  4RQR A;  4DSR A;  4IJI A;  5A4W A;  4ZB6 A;  4AKI A;  5A1N A;  4G2E A;  4PNF A;  4TOP A;  3I69 A;  2WFC A;  1XW5 A;  3M8N A;  5ELA A;  1ZYP A;  2L6C A;  2H73 A;  2NTO A;  1AQX A;  2GSR A;  1B9X C;  3FMW A;  1EWX A;  4NWY A;  3KP9 A;  1ILO A;  2PBJ A;  5JCU A;  1AXD A;  3A2X A;  5CRE A;  5KOW A;  2LJR A;  1GWC A;  4L8E A;  5B6M A;  1XPV A;  5IMA A;  3ME8 A;  4K6X A;  3QOU A;  2HI7 A;  1XCC A;  2QC7 A;  3HVX A;  1M2A A;  4XS4 A;  1Z3E A;  3HJM A;  1EGO A;  3DWV A;  3NZN A;  1GTU A;  1WPI A;  2HT9 A;  1YKC A;  1GNE A;  1HNB A;  3A3T A;  4QMK A;  5GSS A;  5G1L A;  1GTB A;  4E8E A;  4KGI A;  3APS A;  4MZW A;  2R4V A;  3F6D A;  1CQH A;  4NV2 A;  4OFN A;  2FHE A;  2EFD A;  3UIW A;  2LJA A;  4ULX A;  3ZL5 A;  5J3R A;  4RQX A;  1TRV A;  4GCI A;  1TTZ A;  2I4A A;  4MP4 A;  5J9C A;  1M9B A;  3TKP A;  2CAQ A;  5AIV A;  4IN0 A;  4KF9 A;  4IS0 A;  3FY7 A;  5DQY A;  11GS A;  2FA8 A;  1TK8 B;  2MMN A;  1H75 A;  4KND A;  3MYD A;  3I6A A;  1SVL A;  3QMX A;  3LEF A;  3JCM L;  1W89 A;  2C3N A;  2L59 A;  2MMA A;  4BVX B;  4OCE A;  5DVB A;  4KA0 A;  1X5D A;  4PUA A;  5HR0 A;  4JR4 A;  4PQH A;  1GSE A;  3GYK A;  4NV5 A;  1THO A;  1MD4 A;  1F37 A;  4CW9 A;  3ZLP A;  2H19 A;  4HEA 2;  3APQ A;  1EEM A;  2HRA A;  2X99 A;  2IN3 A;  4EC0 A;  5H5S A;  4F03 A;  1ZGN A;  3ZFB A;  5DCG A;  4N0Z A;  2C4J A;  4TR3 A;  2GQM A;  3HY2 A;  5A1N B;  1PL1 A;  4POB A;  1XZO A;  2NPB A;  1N8J A;  3BOA A;  2V2G A;  2B7K A;  3HMJ G;  1I9D A;  4OFT A;  2H30 A;  4ID0 A;  4V1A g;  1JZW A;  3CWG A;  5J47 A;  2LJK A;  5AIX A;  5J4Y A;  1J0F A;  2OT3 A;  2JZS A;  4RI7 A;  2C1Y A;  4G19 A;  1GNW A;  5IOW A;  1GLP A;  1JFU A;  5EL8 A;  2VL2 C;  5DCH A;  4IP1 A;  5IQY A;  2YWM A;  4X1U A;  1A2L A;  2HZE A;  5HFG A;  4HUA A;  5A34 B;  1FB0 A;  1MDJ A;  5CRH A;  1BED A;  1GUK A;  1SVM A;  1Z7P A;  2VM2 A;  4HJ2 A;  2WDU A;  1TK0 B;  1SK2 A;  5FT3 A;  4XS4 B;  4G0I A;  2TRX A;  3D4T A;  1K0O A;  5ECI B;  3K8N A;  2F3M A;  1PX7 A;  5JWQ B;  5GAP D;  2RUE A;  4IGJ A;  6GSY A;  2P0G A;  3VWU A;  4CDO A;  1V40 A;  4YQV A;  5HFI A;  3ZIT A;  2CVK A;  2VCV A;  2RII A;  5ECM B;  4I5Q A;  1S3A A;  1PRX A;  3QFA C;  1ML6 A;  4GLT A;  5ECP B;  1V9W A;  5B6N A;  5JCG A;  2IFQ A;  4FH8 A;  3WT1 A;  2QA1 A;  4IQA A;  2H6Y A;  4NXI A;  4JBB A;  2EIO A;  3IC8 A;  5DJL A;  1XXU A;  3UEM A;  1ZZY A;  4EO3 A;  1I5G A;  4WF5 A;  2GT5 A;  1CQG A;  4YH2 A;  5D73 A;  4PUF C;  1PN9 A;  2I3Y A;  3DML A;  5COH A;  3MWH A;  2WUL A;  2AHE A;  1QK8 A;  1F6M C;  3CSJ A;  3RPP A;  4POK A;  4P3Y B;  1PKZ A;  4MMM A;  4TRX A;  4N30 A;  4XIH A;  3FR6 A;  3F3Q A;  4KDU A;  3PIN A;  5DQS A;  1O8X A;  2HLS A;  5CRW A;  2L4Q A;  3LGC A;  4MPF A;  1M0U A;  1JZD A;  5ECH B;  2A2S A;  2H71 A;  1TDI A;  4HDE A;  5GST A;  3LQ7 A;  2IPA A;  5ECL B;  3HA9 A;  4KW6 A;  1OE8 A;  1R26 A;  3FKF A;  4J2F A;  1WJK A;  1TU7 A;  2JSZ A;  1AQV A;  1FOV A;  2FWG A;  2KP1 A;  1XW9 A;  3C1S A;  1GSS A;  1ZL9 A;  5EY6 A;  2K9F A;  5D96 A;  2B5E A;  1M2B A;  3CSI A;  2HZE B;  4F0C A;  2VOC A;  1KNG A;  1M7T A;  4TXO A;  3L4N A;  3DYR A;  2GGT A;  2DJK A;  2LQQ A;  5CRG A;  3IE3 A;  1YEP A;  2C3Q A;  1AIU A;  2LNT A;  4LA1 A;  3QAG A;  1O6J A;  2XHF A;  3IK7 A;  1A8L A;  4X0X A;  2B7J A;  2YCD A;  2HSY A;  3U5R E;  3TUE A;  2A4H A;  3F3R A;  1J9B A;  3TJB A;  1T8E B;  3TU3 B;  1EEJ A;  2FWH A;  2ON5 A;  2LQO A;  1F3A A;  2VO4 A;  3ZVJ A;  2ZCT A;  2H66 A;  3PH9 A;  5CYY A;  1ERV A;  2R37 A;  3F4S A;  1HNC A;  3DVW A;  1SJI A;  3C71 A;  3ZVJ D;  2IFQ B;  4Z7X A;  3WD6 A;  2VCQ A;  4GRF A;  1SK1 A;  4YAP A;  2QGV A;  1ERW A;  1LU4 A;  2GQK A;  4OCF A;  1ZCP A;  2MZC A;  2VUP A;  5ECO B;  3ED3 A;  2HQT A;  4N3Z A;  1TU8 A;  2LNS A;  4ISD A;  5EVO A;  4BWQ A;  1YVL A;  1SKW B;  4HS1 A;  1Q98 A;  4XRD A;  5ECR B;  2H6Z A;  4X43 A;  4XRA A;  1PSQ A;  3KD0 A;  3V1W A;  2VM1 A;  4Q5R A;  3GKN A;  4ZB9 A;  9GSS A;  3CMI A;  6GSU A;  3KMN A;  4ZBD A;  5IO2 A;  1YZX A;  4EE0 A;  2XBI A;  2YWI A;  2PER A;  4TXV A;  2J9H A;  3F4T A;  1WRY A;  2P31 A;  1TRU A;  3ERF A;  2OJL A;  4PQ1 A;  4ZL8 A;  4L5O A;  2O89 A;  1VF1 A;  5J40 A;  5DAK B;  3ERW A;  4OMV A;  1RW1 A;  1A24 A;  3VWV A;  1TK5 B;  4EXJ A;  1X5C A;  3UAP A;  1XWG A;  1GSQ A;  4DVC A;  3CRU A;  3D22 A;  4IW9 A;  3EIN A;  3ZMK A;  1Z9H A;  1M2D A;  2LRC A;  4XS6 A;  2F8A A;  3VWW A;  3O6T A;  4O92 A;  2H76 A;  5INY A;  4TXO B;  1Y6E A;  4V2N A;  1WOU A;  3IAM 2;  3UVT A;  1FW1 A;  1S3C A;  2REM A;  4POM A;  1J08 A;  1PQN A;  12GS A;  4G0L A;  4F82 A;  4XS1 A;  2VCW A;  3U6V A;  3FEU A;  5D93 A;  2LRN A;  2L5O A;  2H0G A;  4YQU A;  1A23 A;  2C8U A;  1DE1 A;  1UVZ A;  2O8V B;  1TW9 A;  4GSS A;  4IQ1 A;  5H5R A;  1WIK A;  4MDC A;  1URM A;  2AV4 A;  4Z2R A;  3KEB A;  2R0C A;  4PTS A;  1ZYQ B;  2HXK A;  2K8S A;  4OO4 A;  4F9Z A;  1YKA A;  2C80 A;  1GP1 A;  5HR2 A;  4K7O A;  1G6Y A;  3M1G A;  3CTG A;  2BMX A;  2DJ2 A;  2VLU A;  3IHQ A;  5F05 A;  1GSU A;  4HZ4 A;  4AI6 A;  4HQZ A;  4G9H A;  1Z5Y E;  3A2W A;  3Q19 A;  2V1M A;  3VK9 A;  2CV4 A;  3DKS A;  3WGD A;  2E7P A;  1U88 A;  1XOA A;  5F8B A;  1EOG A;  1PX6 A;  4WEY A;  2GTU A;  2A4V A;  5J5N A;  1ABA A;  3ZTL A;  2GZY A;  2O5V A;  5C00 A;  4L0W A;  3HZ8 A;  5J4V A;  2CX3 A;  5KOX A;  1LJR A;  4JRR A;  2QA2 A;  22GS A;  3BCK A;  4H86 A;  1ON4 A;  1YQ1 A;  2AAW A;  2C0D A;  1SJ6 A;  3RAZ A;  2R6K A;  1YJ6 A;  1B48 A;  1ERU A;  4HZ2 A;  3ZFL A;  4EUY A;  2PGT A;  3GL3 A;  5IMF A;  1AAZ A;  1GTI A;  4ZIL A;  4YKF A;  3ISO A;  2H74 A;  1QMV A;  4K7N A;  3F9U A;  3A5I A;  2H1D A;  3H4K A;  20GS A;  3EVI A;  5EPF A;  4KSO A;  3L9S A;  4IP6 A;  4IVF A;  2X49 A;  5E4W A;  1NW2 A;  3LW9 A;  3IRA A;  3RHB A;  3M0F A;  2VL3 A;  2RLI A;  2VCZ A;  3GN3 A;  4LL1 B;  3QCP A;  3TGZ A;  4MZB A;  4LL4 B;  1OC8 A;  1SYR A;  2M46 A;  2LKU A;  5LCZ A;  2CZ3 A;  1T1V A;  3EC3 A;  2AYT A;  1U87 A;  3G7J A;  4YQM A;  2JL4 A;  1XWC A;  3FHK A;  1VGL A;  1S3D A;  2F51 A;  2H0H A;  1RK4 A;  1SVO A;  2CA8 A;  2YNX A;  3RPN A;  2DC5 A;  4O7H A;  3DVX A;  4PNG A;  2LV3 A;  5IM9 A;  4WR4 A;  3KH9 A;  5D9V A;  3VI5 A;  4G10 A;  4RUV A;  3PPU A;  2OE3 A;  5IMV A;  5A4U A;  4HU7 A;  2KUC A;  4GTU A;  4GSN A;  1OC9 A;  1QGV A;  3HXS A;  3DXB A;  3GL5 A;  3GX0 A;  2H70 A;  1EV4 A;  2VCT A;  5KN2 A;  3AY8 A;  3CXG A;  5F07 A;  2YWO A;  2VIM A;  2RUF A;  1K0B A;  2N5F A;  5B7C A;  2PU9 C;  3EMX A;  2G2Q A;  5DJM A;  2OKA A;  3RHC A;  1OKT A;  2IMF A;  2IMI A;  4PXO A;  2DML A;  5C04 A;  2GSS A;  2FNO A;  4KDY A;  4NAX A;  4EKZ A;  4MAB A;  4BL7 A;  2B1K A;  2HSM A;  2HSN A;  1ZMA A;  3GRX A;  1GSF A;  3A2V A;  3UL3 A;  1FAA A;  2VLV A;  2PUK C;  1OE7 A;  2CAI A;  3IDV A;  4W66 A;  2AJQ B;  4G01 A;  1B9Y C;  4BVY A;  4I6X A;  3LG6 A;  1BQ7 A;  1LBK A;  2H1G A;  2WZ9 A;  1GH2 A;  3KJY A;  4CY6 A;  1KTE A;  1Y25 A;  3E9J B;  1F2E A;  3I9V 2;  4ZB8 A;  2JAD A;  5DAL A;  3FYG A;  3LOR A;  2B3S A;  4K2D A;  4WR5 A;  2CT6 A;  1XIY A;  1GSY A;  1OYJ A;  1A0F A;  2P5R A;  4ZBA A;  4K5R A;  2IWT A;  2D2Z A;  3W8S A;  1YY7 A;  3BBY A;  1QUW A;  4WBR D;  2C0E A;  4MNN A;  2YAN A;  2GSQ A;  4O5Q A;  2DKH A;  1HYU A;  3HJP A;  1UA5 A;  2NDO A;  4G0K A;  1X9S B;  1G0T A;  1FOH A;  1O7U A;  2DJJ A;  2OBI A;  2H6X A;  3HKR A;  5AIS A;  5BMU A;  1BJX A;  5G1K A;  3M9J A;  1TXX A;  2WRT A;  2YZH A;  3DIE A;  4K2X A;  2YP6 A;  3TDG A;  3EUR A;  1A8Y A;  3H93 A;  3ZZX A;  1JLV A;  3UBL A;  4DSS A;  3DD3 A;  2FUG 2;  1XVW A;  3A5W A;  4IEL A;  2GT6 A;  2MYG A;  5G5E A;  2FWE A;  3BCI A;  3TOT A;  4J57 E;  5J9B A;  3GIX A;  3VI7 A;  2EIR A;  1QXH A;  5IIZ A;  3ZYW A;  3NIV A;  4HU9 A;  2GQL A;  2F9S A;  4D73 A;  3GMF A;  5D8I A;  3LYK A;  4YAV A;  3VPT A;  4MF5 A;  2UZ8 A;  4Z2T A;  2VAF A;  3TRP A;  4K1F A;  4I8B A;  3QFB C;  5ELG A;  2PPT A;  3QAW A;  1OC9 B;  1G7O A;  4FO5 A;  2GLR A;  2OE1 A;  3MIX A;  2K6V A;  2WGR A;  5G31 A;  2K8V A;  2PWJ A;  2WCI A;  4JU5 A;  2QKE A;  1PN0 A;  1BYE A;  1T7P B;  4KCA A;  1R5P A;  1K3Y A;  4MJA A;  1XVQ A;  3TKS E;  1MTC A;  2HSM B;  2HSN B;  2B6M A;  4N11 A;  3D6I A;  3FR3 A;  5GZZ B;  4K9Z A;  2YZU A;  4BVY B;  3LJR A;  1N25 A;  2L5L A;  2CX4 A;  1XW6 A;  4K8M A;  1PL2 A;  4PX1 A;  5ABR A;  1O85 A;  1VF3 A;  1U6T A;  4FYC A;  2KP2 A;  5DAL B;  3WT2 A;  2E2M A;  2VL2 A;  2VLT A;  3HCZ A;  3GFK A;  2M80 A;  2HYX A;  1TOF A;  2HRK A;  4ZL7 A;  2YJH A;  2DIY A;  2HRF A;  2O87 A;  5CP1 A;  2IJY A;  3VWX A;  4TVE A;  4Q5N A;  3ZIJ A;  4V2L A;  4O5R A;  5BMU B;  2PMT A;  4IKH A;  1IYH A;  4GST A;  5J4U A;  4WET A;  1SEN A;  1ERT A;  1R5A A;  1WE0 A;  3US3 A;  4DSS B;  1JZO A;  1TRS A;  3ZRE A;  2H01 A;  5G2Z A;  5G5F A;  1GL8 A;  1YF0 A;  1SL1 B;  3QD9 A;  16GS A;  2ALB A;  2R5G A;  4O32 A;  1F3B A;  1O73 A;  1GUM A;  4KB3 A;  1T00 A;  4BA7 A;  4D73 B;  3EWL A;  3KMO A;  1MDI A;  3GH9 A;  1GRX A;  5D9X A;  6GSS A;  3L9V A;  3Q74 A;  2YN1 A;  4KE3 A;  1TI1 A;  3F4R A;  2DKI A;  2NBS A;  1ACV A;  3MNG A;  3HVV A;  4ZIJ A;  5ECN B;  2EFH A;  2DBC A;  1WP0 A;  1EV9 A;  3G7Y A;  3R2Q A;  4ILF A;  2EIQ A;  3F63 A;  4EVM A;  3P8W A;  2H72 A;  4WXT A;  2LS5 A;  1TI3 A;  3D4M A;  5LD0 A;  3D5J A;  3GUS A;  1U3A A;  2OAD A;  3G9B A;  1T3B A;  4QL7 A;  4AJ7 A;  1BX9 A;  3P7X A;  1G7E A;  1NHY A;  3IR4 A;  1AUC A;  1A2M A;  4GWR A;  4ML1 A;  1R7H A;  3TCO A;  3TKR A;  1ZOF A;  3GNJ A;  1K0C A;  1PA3 A;  1T4Y A;  13GS A;  1Z6N A;  4HI7 A;  1OAZ A;  2HRK B;  3N5O A;  1HNA A;  14GS A;  2PN8 A;  2TIR A;  3G7I A;  1X0R A;  3TKS A;  4ZBB A;  2V6O A;  2LTK A;  5FHI A;  1IYI A;  4KH7 A;  1X5E A;  2JAC A;  5B8B A;  3WGE A;  4ECC A;  5CRD A;  4JE1 A;  4CHS A;  4ML6 A;  1K0N A;  1VF4 A;  3D21 A;  4Q5Q A;  4EL1 A;  2ES7 A;  5KEJ A;  1Y1U A;  4TKY A;  3E0U A;  2IMK A;  4Q5F A;  3WYW A;  4JED A;  3KP8 A;  4EIP A;  4E68 A;  2O7K A;  3F6F A;  5GAN D;  2I1U A;  5DBQ A;  2V32 A;  3CYN A;  4TN8 A;  1E2Y A;  2QSI A;  4FYU A;  5JCW A;  2GST A;  1OKD A;  2E2G A;  1PMT A;  2DMM A;  2DSA A;  3PR8 A;  3LWA A;  3PGT A;  1XWA A;  5L71 A;  2DLX A;  1Z6M A;  1B8X A;  3N9J A;  2R2J A;  4HQS A;  2YPM A;  3QAV A;  8GSS A;  3Q6O A;  5FWG A;  1XWK A;  5DDL A;  4EIQ A;  1O81 A;  4RI6 A;  2X8G A;  1K3O A;  4Z2U A;  1EZK A;  2EC4 A;  1VRS D;  2HFD A;  1G6W A;  3IPZ A;  3DRN A;  1TP9 A;  5JWR B;  3VUR A;  1X9W B;  4AJ8 A;  4V1A p;  4FIW A;  5ID2 A;  2C0F A;  5D9W A;  2O85 A;  4PQI A;  2JZT A;  2I81 A;  4N0V A;  1TKD B;  3L78 A;  1V57 A;  2MBT A;  3FZ9 A;  3QR6 A;  2YOI A;  2YJ7 A;  5A34 A;  1WWJ A;  1QQ2 A;  4LMV A;  3ZIV A;  5IMC A;  1SU9 A;  1K0A A;  3VLN A;  4X4J A;  5IO0 A;  4FYB A;  3TRQ A;  3P2A A;  2GZZ A;  1U3I A;  1TXU A;  1M99 A;  2CVD A;  2WB9 A;  2HRN A;  3RBT A;  3ME7 A;  18GS A;  3EU3 A;  1UC7 A;  4NHW A;  2ZUP A;  1JLW A;  1GLQ A;  3GKM A;  2GDR A;  3R3E A;  1RQM A;  2I9H A;  2Z9S A;  19GS A;  4ZB7 A;  3TRX A;  4FQU A;  3EPT A;  2B5Y A;  4E8H A;  3IA1 A;  3KGK A;  2H75 A;  2A2P A;  1H4O A;  1AW9 A;  2LST A;  3GSS A;  1AQW A;  4EF0 A;  3C73 A;  2KOK A;  3FZ4 A;  1Q4J A;  4K7I A;  3QPM A;  4AGS A;  3LXZ A;  3TJJ A;  4NPB A;  2XPE A;  2HSH A;  2NVL A;  5IPH A;  3IXR A;  4ACS A;  1C72 A;  3CRT A;  3FR9 A;  3WGX A;  4L0U A;  4OO5 A;  2CQ9 A;  2GVP A;  3H79 A;  3UAR A;  1BG5 A;  1M9A A;  1JHB A;  3DGQ A;  5H5Q A;  5J41 A;  2V6K A;  3C1R A;  1QFN A;  3EMP A;  4OD7 A;  5LNK e;  1YDK A;  3CTF A;  1A0R P;  1FVK A;  5AN1 A;  5ECK B;  3F8U A;  2CVB A;  4WF4 A;  1SL2 B;  5KN1 A;  5A5H A;  4AKH A;  4PGT A;  2N5A A;  5ID2 B;  4MF6 A;  1NSW A;  4GXZ A;  2XC2 A;  1SL0 B;  5F06 A;  3P90 A;  2WJU A;  4EDZ A;  4F2I A;  2H1L A;  3C7M A;  3DEX A;  5A4V A;  2ZNM A;  1X9M B;  2GS3 A;  4WBJ A;  5IMD A;  1THX A;  2ON7 A;  6GSV A;  5HR3 A;  1HQO A;  2TRC P;  2YWN A;  3C8E A;  2IIY A;  5CNW A;  3ERG A;  4XHM A;  1PGT A;  4HOJ A;  4I2U A;  5G30 A;  4LLR A;  7GSS A;  4USS A;  6GSW A;  3FRC A;  3GX8 A;  4TR1 A;  4MH2 A;  3W8J A;  2LEG A;  2C3T A;  1YF1 A;  4AF2 A;  4NMU A;  4POL A;  1FVJ A;  3FK8 A;  4L5L A;  2VD0 A;  1EP8 A;  2VD1 A;  3KXO A;  4MLY A;  4ZXG A;  2J23 A;  3KM6 A;  2L4C A;  2F8F A;  2H8L A;  3GA4 A;  5ECS A;  3GKK A;  2PVO C;  4QQ7 A;  1A2J A;  3HD5 A;  2DJ3 A;  1XBS A;  4J56 E;  1SD8 A;  4YKG A;  2HZF A;  3E3E A;  1TRW A;  2B5X A;  2MMO A;  4TW5 A;  3LYP A;  2KHP A;  3EE2 A;  3HJO A;  2HNL A;  3LXT A;  1VF2 A;  2AUV A;  2K18 A;  4TR0 A;  3LSZ A;  3GUR A;  2V41 A;  3GTU A;  2M72 A;  3SBC A;  4MH3 A;  4I97 A;  2KLX A;  1Z7R A;  1TJD A;  2FWF A;  4HJM A;  3GH6 A;  5IPG A;  5F0G A;  1BF5 A;  4F0B A;  1B4Q A;  4BL7 B;  3IK9 A;  1V98 A;  2DIZ A;  2H1A A;  1O8W A;  2WS2 A;  4EDY A;  4PUR A;  3UBK A;  1SKR B;  6GSX A;  2X8H A;  4A5P A;  5HFK A;  2PVQ A;  3IOS A;  1XOB A;  3IHG A;  4WKW A;  5A5H B;  5BRT A;  2C0G A;  2RM5 A;  3H8Q A;  3MDK A;  2H0I A;  3KH7 A;  2GZP A;  1HD2 A;  2BTO T;  5DAK A;  5E59 A;  4IBP A;  4XTS A;  5HQP A;  5JWO B;  1GSD A;  1XWB A;  4KDX A;  3UOM A;  2AB6 A;  1SK0 A;  1V58 A;  1PKW A;  1FG4 A;  2R0G A;  1F9M A;  3F0I A;  3BJ5 A;  2XBQ A;  1PD2 1;  1W4V A;  3KIJ A;  2E0Q A;  5A5K A;  1DBY A;  2BJX A;  3TKS C;  1BAY A;  2EFC A;  3EYT A;  5ENU A;  1DSB A;  3LFL A;  4KAE A;  3H1N A;  1NHO A;  2G0F A;  1R4W A;  2R3X A;  1K3L A;  3W6G A;  4KX4 A;  4DSQ A;  3HYP A;  4TR1 B;  3D0Z A;  4V2M A;  3TOU A;  5ECQ B;  3EU4 A;  3NOF A;  1FO5 A;  17GS A;  1E6B A;  2VL9 A;  1GUL A;  3KTL A;  2L57 A;  5B8A A;  2MBS A;  1UN2 A;  2VKZ G;  1USB A;  1DUG A;  3FW2 A;  1K0M A;  4KCE A;  3UJ1 A;  2LRT A;  3TB2 A;  2OAC A;  2A2R A;  4K0N A;  2RM6 A;  3MSZ A;  2YV9 A;  10GS A;  2P5Q A;  5CO3 A;  3APO A;  2N5B A;  4AKG A;  4K0G A;  3QDN A;  3J7Y b;  4MF7 A;  3HZ4 A;  3IC4 A;  4AJ6 A;  2JU5 A;  2OE0 A;  5AGY A;  1OC3 A;  1SJZ A;  4ECB A;  5CAX A;  2OBK A;  2LUS A;  4GF0 A;  4ICY A;  2B1L A;  1SD9 A;  1MD3 A;  1WMJ A;  2FA4 A;  2IME A;  2L6D A;  1JZR A;  1GTA A;  1SKS B;  3GST A;  3S9F A;  1ZYE A;  3CSH A;  3GTU B;  3KTB A;  4MJC A;  4KUN A;  4MJE A;  4OFM A;  3M9K A;  2IMD A;  3GHA A;  2VCX A;  3ZML A;  1ST9 A;  4MZC A;  4I2T A;  1K0D A;  3TJF A;  3IAS 2;  1OVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...