2CAXA

Structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct dna heptad repeats
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
MAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Omega Repressors Bound to Direct and Inverted DNA Repeats Explain Modulation of Transcription.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcriptional repressor
molecule keywords ORF OMEGA
total genus 15
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2caxA00
2JXIA 2BJ3A 2BJ8A 2KELA 2WVCA 1U9PA 2HZAA 1BDTA 2K6LA 2JXHA 1EA4A 2BNWA 2JXGA 2WVBA 2GPEA 3OD2A 2WVFA 2CA9A 4ME7E 1ARQA 3GXQA 3VEBA 1QTGA 1B01A 2BJ1A 2K5JA 3LGHA 1P94A 2K1OA 2K29A 1PARA 2BJ7A 1MNTA 1IRQA 3QOQA 2H1OE 2BA3A 3VW4A 2BJ9A 1B28A 4HV0A 3FT7A 1ARRA 1NLAA 1Q5VA 2BNZA 2WVEA 1MYLA 1MYKA 2RBFA 2CADA 2AY0A 3H87C 2CPGA 2K9IA 2WVDA 2HZVA 4D8JA 1BDVA 2CAJA 1BAZA 1X93A 2BSQE 3VEAA 3FMTA 4FXEA 2CAXA
chains in the Genus database with same CATH superfamily
2BJ8A 2KELA 4ME7E 2WVFA 3GXQA 2BJ1A 4LQ3A 3IR7A 3QOQA 3SFGA 2BJ9A 3UQSA 1B28A 4HV0A 3FT7A 2BNZA 1MYLA 4NRUA 2AY0A 2CPGA 2CAJA 1BAZA 2HZVA 1BDVA 4FXEA 3LJPA 2JXIA 1OG7A 2HZAA 2BNWA 1EA4A 3UPFA 2UUWA 3NAIA 3NAHA 1P94A 2K29A 2Q2KA 2B43A 1IRQA 2H1OE 3VW4A 1Q5VA 4NRTA 2AN7A 2WVDA 4LRVA 2A2BA 1OHNA 1X93A 3VEAA 2BJ3A 2WVCA 3UR0A 1U9PA 2K6LA 2WK4A 2WVBA 3OD2A 3VEBA 1QTGA 1B01A 3LGHA 3BSOA 4QPXA 2BJ7A 4MJWA 1ARRA 1NLAA 2JBVA 2RBFA 1SH3A 2CADA 2UUTA 1Q16A 3SFUA 4AAIA 3H5XA 3NO7A 3FMTA 4O4RA 2CAXA 2CKWA 3QIDA 1BDTA 2JXHA 2JXGA 1ARQA 2GPEA 2CA9A 2H3AA 4LQ9A 2K5JA 2K1OA 1SH0A 3G5OA 1PARA 1SH2A 3BSNA 1MNTA 2ADLA 2BA3A 2KOEA 2WVEA 1MYKA 2KKEA 3H87C 3NNEA 2K9IA 4D8JA 2BSQE 3H5YA 1SIWA
chains in the Genus database with same CATH topology
2JXIA 2BJ3A 2BJ8A 2KELA 2WVCA 1U9PA 2HZAA 1BDTA 2K6LA 2JXHA 1EA4A 2BNWA 2JXGA 2WVBA 2GPEA 3OD2A 2WVFA 2CA9A 4ME7E 1ARQA 3GXQA 3VEBA 1QTGA 1B01A 2BJ1A 2K5JA 3LGHA 1P94A 2K1OA 2K29A 1PARA 2BJ7A 1MNTA 1IRQA 3QOQA 2H1OE 2BA3A 3VW4A 2BJ9A 1B28A 4HV0A 3FT7A 1ARRA 1NLAA 1Q5VA 2BNZA 2WVEA 1MYLA 1MYKA 2RBFA 2CADA 2AY0A 3H87C 2CPGA 2K9IA 2WVDA 2HZVA 4D8JA 1BDVA 2CAJA 1BAZA 1X93A 2BSQE 3VEAA 3FMTA 4FXEA 2CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXI A;  2BJ3 A;  2BJ8 A;  2KEL A;  2WVC A;  1U9P A;  2HZA A;  1BDT A;  2K6L A;  2JXH A;  1EA4 A;  2BNW A;  2JXG A;  2WVB A;  2GPE A;  3OD2 A;  2WVF A;  2CA9 A;  4ME7 E;  1ARQ A;  3GXQ A;  3VEB A;  1QTG A;  1B01 A;  2BJ1 A;  2K5J A;  3LGH A;  1P94 A;  2K1O A;  2K29 A;  1PAR A;  2BJ7 A;  1MNT A;  1IRQ A;  3QOQ A;  2H1O E;  2BA3 A;  3VW4 A;  2BJ9 A;  1B28 A;  4HV0 A;  3FT7 A;  1ARR A;  1NLA A;  1Q5V A;  2BNZ A;  2WVE A;  1MYL A;  1MYK A;  2RBF A;  2CAD A;  2AY0 A;  3H87 C;  2CPG A;  2K9I A;  2WVD A;  2HZV A;  4D8J A;  1BDV A;  2CAJ A;  1BAZ A;  1X93 A;  2BSQ E;  3VEA A;  3FMT A;  4FXE A;  2CAX A; 
#chains in the Genus database with same CATH topology
 2BJ8 A;  2KEL A;  4ME7 E;  2WVF A;  3GXQ A;  2BJ1 A;  4LQ3 A;  3IR7 A;  3QOQ A;  3SFG A;  2BJ9 A;  3UQS A;  1B28 A;  4HV0 A;  3FT7 A;  2BNZ A;  1MYL A;  4NRU A;  2AY0 A;  2CPG A;  2CAJ A;  1BAZ A;  2HZV A;  1BDV A;  4FXE A;  3LJP A;  2JXI A;  1OG7 A;  2HZA A;  2BNW A;  1EA4 A;  3UPF A;  2UUW A;  3NAI A;  3NAH A;  1P94 A;  2K29 A;  2Q2K A;  2B43 A;  1IRQ A;  2H1O E;  3VW4 A;  1Q5V A;  4NRT A;  2AN7 A;  2WVD A;  4LRV A;  2A2B A;  1OHN A;  1X93 A;  3VEA A;  2BJ3 A;  2WVC A;  3UR0 A;  1U9P A;  2K6L A;  2WK4 A;  2WVB A;  3OD2 A;  3VEB A;  1QTG A;  1B01 A;  3LGH A;  3BSO A;  4QPX A;  2BJ7 A;  4MJW A;  1ARR A;  1NLA A;  2JBV A;  2RBF A;  1SH3 A;  2CAD A;  2UUT A;  1Q16 A;  3SFU A;  4AAI A;  3H5X A;  3NO7 A;  3FMT A;  4O4R A;  2CAX A;  2CKW A;  3QID A;  1BDT A;  2JXH A;  2JXG A;  1ARQ A;  2GPE A;  2CA9 A;  2H3A A;  4LQ9 A;  2K5J A;  2K1O A;  1SH0 A;  3G5O A;  1PAR A;  1SH2 A;  3BSN A;  1MNT A;  2ADL A;  2BA3 A;  2KOE A;  2WVE A;  1MYK A;  2KKE A;  3H87 C;  3NNE A;  2K9I A;  4D8J A;  2BSQ E;  3H5Y A;  1SIW A; 
#chains in the Genus database with same CATH homology
 2JXI A;  2BJ3 A;  2BJ8 A;  2KEL A;  2WVC A;  1U9P A;  2HZA A;  1BDT A;  2K6L A;  2JXH A;  1EA4 A;  2BNW A;  2JXG A;  2WVB A;  2GPE A;  3OD2 A;  2WVF A;  2CA9 A;  4ME7 E;  1ARQ A;  3GXQ A;  3VEB A;  1QTG A;  1B01 A;  2BJ1 A;  2K5J A;  3LGH A;  1P94 A;  2K1O A;  2K29 A;  1PAR A;  2BJ7 A;  1MNT A;  1IRQ A;  3QOQ A;  2H1O E;  2BA3 A;  3VW4 A;  2BJ9 A;  1B28 A;  4HV0 A;  3FT7 A;  1ARR A;  1NLA A;  1Q5V A;  2BNZ A;  2WVE A;  1MYL A;  1MYK A;  2RBF A;  2CAD A;  2AY0 A;  3H87 C;  2CPG A;  2K9I A;  2WVD A;  2HZV A;  4D8J A;  1BDV A;  2CAJ A;  1BAZ A;  1X93 A;  2BSQ E;  3VEA A;  3FMT A;  4FXE A;  2CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...