2CB9A

Crystal structure of the thioesterase domain of the fengycin biosynthesis cluster
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
212
Chain Sequence
SAAGEQHVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADAYLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNILDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Thioesterase Domain of the Fengycin Biosynthesis Cluster: A Structural Base for the Macrocyclization of a Non-Ribosomal Lipopeptide
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords FENGYCIN SYNTHETASE
total genus 72
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.40 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2cb9A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cb9A01
2GZRA 4O08A 1CUZA 1R88A 3VVMA 3DL4A 2H1IA 2O7VA 4DNPA 2J3DA 1PFQA 3TEJA 3FBWA 1A8QA 4H7FA 1ZIXA 4GLBA 1AX9A 2W22A 2OLEA 4Q05A 1XRPA 3G02A 5AP9A 5A7HA 3I6ZA 4H7DA 1BE0A 2IX9A 1IUOA 1VZ3A 4KAJA 4FHZA 1YA4A 2RAUA 2OCGA 5HF5A 1CPYA 1ZI6A 1DTEA 1H2XA 4AO7A 3FSGD 2RHTA 3H1AA 4F5ZA 5AOAA 1XFDA 1YS2X 3STWA 2V98A 4HVTA 4B0OA 5HF8A 2BGRA 1MO2A 5ALJA 3WMRA 5JD5A 1TKRA 1QIGA 5T4EA 3DQZA 1PV1A 4PSDA 3CXUA 2ACKA 1LPBB 1SOMA 4G5XA 3AZOA 1VKHA 1TCBA 2FX5A 1WHTA 1SCQA 2HA2A 2PBLA 2VAXA 2V96A 2RIPA 4KE8A 3F97A 5IH7A 5AK4A 5FKJA 4BYMA 4BC1A 4W9RA 1ZOIA 3AIOA 1DINA 2OGZA 1CUAA 3NOXA 2HDWA 3ILSA 3I2JA 3IDAA 5E4YA 1XLUA 5CTAA 2BUAA 1LGYA 4X6YA 3UMJA 1EDBA 5IKXA 3WKCA 2CKMA 1CEXA 3WIBA 3FAKA 3KOOA 4HS9A 3DL7A 4W1PA 5AM4A 1D07A 1QO9A 1WOMA 1G66A 2Z3ZA 3I2GA 5AKZA 4I4CA 3V1MA 5K3FB 3HC7A 5HF6A 1W75A 4ARBA 1BS9A 3FNBA 5HKBA 1WHSA 4HTAA 1GXSA 1XRLA 5ALVA 4CI9A 1CUFA 5E2IA 5KBYA 3C8HA 4WY5A 1E8MA 3BWXA 5KWIA 2XT0A 5AICA 1XZIA 2Q0XA 4UHHA 4LIPD 1ZI8A 1MN6A 2HADA 4BVJA 2C0QA 5HF9A 4FBLA 3V48A 1NU6A 4X94A 4GECA 4HZGA 3BF8A 4F0JA 3QMWA 3O4HA 3WK6A 2GBFA 2WHPB 4UFPA 1QOZA 5AK6A 5JD4A 5E4TA 1CUXA 3R40A 2VEOA 4B84A 1M33A 5ALZA 3W06A 5AM5A 1MTZA 3LCRA 3A70A 2OCLA 3HZOA 3I1YA 4UBOA 4B6GA 3H1BA 3ZV7A 2AXEA 3WWDA 2WJ4A 1SC9A 1H2WA 4BTLA 1LNSA 1N5RA 2I03A 1DT5A 4Y2SA 3BIWA 1F0NA 4KAAA 4WJLA 4J0DA 4BC0A 1XZMA 1LPSA 1CUGA 3BF7A 3WK9A 5LYYA 4RE6A 1VE6A 4ZV7A 3WWPA 2GZSA 5DLPA 1GPNA 1DQYA 4PQEA 5AKJA 5DTJA 3G0DA 3U1TA 5DYWA 3HLKA 2PL5A 1W6RA 4J0HA 1MNAA 5AI9A 5C8VA 4Z49A 1X70A 2WFLA 4P9NA 2OG1A 3RK4A 4FDMA 4H18A 2D0DA 4PO3X 5LKRA 3O9VA 1L7QA 2G63A 3H04A 2CBGA 3BJRA 5AOCA 1XZBA 3DNMA 3WWEA 4N5IX 2PU5A 1Q0ZA 1XQVA 2ZJFA 1UFOA 1C4XA 1BN7A 5YASA 3C8DA 4F60A 1CUIA 2HFJA 4B82A 1YA8A 5HQ3B 1MX5A 3W9UA 5A6VA 2B61A 3X3HA 1UK6A 1UOPA 5CT6A 3G9UA 3D2CA 3VJLA 3ZI7A 4AB1A 3GELA 5ALEA 1QE3A 4UPDA 1JJBA 4H77A 1DX6A 3IIIA 4OYLA 4FOLA 1QFSA 1W1IA 1UOOA 1Y7HA 5CH5A 2WFMA 1ZGBA 1XQWA 1VZ2A 2HM7A 3HXKA 3WL7A 5AHXA 4HAIA 2J3QA 3EQ7A 3UUEA 3DYVA 5JALA 1A7UA 1Q83A 1MX1A 5JASA 3CCCA 5CURA 3L1HA 4BDTA 3WZMA 5AK3A 4FBMA 1X2BA 1QIHA 1MPXA 5DWDA 4UHBA 4PNZA 2XUFA 4NS4A 4L0CA 1HDEA 4E15A 1CUUA 1HLGA 2WTMA 4DNOA 2C0PA 4PSCA 1K63A 4QDUA 5AM1A 3QPDA 3PF8A 4GDMA 4BBZA 1TAHA 3D5EA 4QDZA 3WKBA 3STTA 2H7XA 3D0KA 4P08A 2WHRA 3N2ZB 4DSAA 3BE8A 5C8XA 2ZJ6A 1VOTA 2Y6VA 3UUFA 5BWBA 3ZLVA 4U2FA 4KE7A 2OGSA 2WIFA 3C5VA 5AI4A 3WA7A 2WUDA 4UBLA 4A5SA 1T2NA 5FXMA 3R3VA 2YXPX 4JUIA 4GEGA 1YR2A 1DWOA 2OCKA 1WCYA 1WM1A 3ICVA 1JMYA 1R50A 2JGMA 2WUFA 4CCYA 2QKYA 1J2EA 2HRRA 5AO9A 1CIJA 1GKKA 3LS2A 2QT9A 2WIGA 4X00A 1AURA 1QIJA 4QDTA 3ICWA 1UK8A 4FMPA 5I9IA 3QMMA 4BAGA 4ZREA 2XQJA 4S0XA 1P0MA 2HA5A 3I1IA 4N8SA 3PFCA 2E3JA 3L1IA 4KE9A 4ARAA 3WL8A 2DHDA 3QMVA 3C43A 2QRUA 4C89A 4OPMA 5A62A 4LYDA 4DMKA 3WWOA 1CUBA 2WFLB 4CFSA 3O95A 1CUVA 3F8SA 1CV2A 4JEIA 4X90A 2XDWA 2XMCA 3A6ZA 3EF3A 1J07A 3WJ2A 3FCXA 3WI7A 2BAGA 2GYWA 4DLNA 3FCYA 3ED1A 5J3JA 5FPPA 2OXEA 2XQIA 1G4HA 3FLBA 5D7BA 3OPMA 4LKOA 1THTA 4FLMA 4MQLA 1GQRA 2RONA 5H3HA 1BCRA 5HCUA 2XMQA 1R9NA 2VT6A 2JF0A 3WA6A 2PVSA 5JAHA 2ZSHA 5LZ9A 1USWA 1JT2A 4X93A 3DEAA 2DCMA 3IB3A 4K6KA 4WY8A 5CT9A 4QE3A 5AKEA 5LZ8A 3OC0A 3G0GA 3P2MA 3QVMA 1J1IA 3ESCA 3WJ1A 1O6GA 1P0IA 1YCDA 1VLQA 5EFZA 4LXHA 1SCKA 5DNUA 2HHAA 3V1LA 1FJ2A 4MEAA 1DX4A 1QLWA 3W2TA 4CIBA 5AK5A 4AZ0A 3K6KA 3ZLTA 4AO6A 3AIKA 3HI4A 3STXA 1CUHA 1EI9A 4J03A 1W52X 4QA9A 2RI6A 4U2GA 1TCCA 1UK7A 3KSRA 5CT4A 4B7ZA 1DT3A 3Q0TA 5FP0A 1Q84A 1EX9A 2AJ8A 1CUEA 4G8CA 3PE6A 2JEYA 2V9ZA 4WDQA 4EY8A 3QBJA 2Y2UA 2XE4A 4RGYA 4X71A 2WQZA 1OCEA 4G1FA 2JEZA 1XZDA 4Y2VA 3W9BA 4QNNA 1LPPA 2OPHA 1ZJ5A 5FLKA 2ZVDA 1IMJA 5EHQA 1LPAB 4FNMA 5ESRA 4XJVA 1VA4A 2BCEA 3AZPA 1SFRA 3SX4A 2DR0A 2XMGA 4QDXA 1EK1A 2QR5A 3H18A 1CUCA 5EHXA 1W4LA 4Y2JA 2O2HA 5ALHA 4X91A 5AI0A 3IUNA 3WLAA 3I2KA 4I19A 4B9AA 2RGUA 3I28A 2HU8A 1KEZA 5ISMA 2JGLA 1AKNA 5A71A 3C70A 3KWFA 4PV7A 3RARA 4A16A 1IZ8A 5JAUA 1ZD5A 5C81A 5EHNA 3DS8A 4EHBA 4DNFA 1H2YA 1ZI9A 7YASA 1H22A 1GPKA 1EDEA 2QOEA 4CG3A 3HABA 5AM2A 2BKLA 4BCBA 4IH1A 2WU4A 3DCNA 2WHQA 2X5XA 3AUKA 4KRYA 1J06A 4AX4A 4BCCA 1MX9A 2WHPA 1ZJ4A 3HSSA 4Y2UA 1L7RA 5DTIA 4ZGBA 4Y2PA 3PUIA 5JYCA 5D3KA 4UHEA 1XZAA 1A8UA 3STYA 5JARA 4B80A 4B83A 5AI5A 1ORVA 2PM8A 3BIXA 1IUNA 4HRYA 1XROA 2PSHA 2Y1KA 2G5PA 4J0GA 3BJMA 3DD5A 2R8BA 3SC2A 1BROA 4UBIA 3V9AA 2PKYX 3FLAA 4J3JA 4WFJA 1BEZA 1THGA 4GBGA 4Q1VA 3ESAA 3PFBA 5JIBA 1ZD3A 5IVKA 4UBKA 1CUWA 2XUIA 3MGAA 4BVKA 4H7IA 4G9EA 1UT6A 3JYHA 2XUAA 4ZV9A 2JGFA 3AJAA 5EHZA 1Y37A 2VJAA 1PJAA 4HXGA 5BOVA 1BN6A 2W6CX 3IURA 2QJWA 5LIPA 4G9GA 4D9JA 4XX1A 2G4LA 3M3DA 3ANTA 1QJ4A 2CB9A 4G8BA 2WG1A 3E3AA 1L7AA 1DU4A 1CQWA 3K2IA 4DNQA 5EIAA 4XIIA 5I8PA 5KWJA 4WFIA 5DYTA 3A2MA 4JYMA 2Y2VA 5F4ZA 2WM2A 4U2BA 3A2NA 1CRLA 3I6MA 5HFAA 5FPQA 3IVMA 2OGTA 4FWBA 5ALPA 2XUOA 1BRTA 3O0DA 1CUYA 2PPLA 3RKSA 3C5WP 1XQYA 3FYUA 2OQVA 1WB6A 2ZYRA 1B41A 4UFOA 2QUAA 3OTQA 5ALKA 1XZHA 4I3FA 1XRNA 4DTCA 5ALSA 2RHWA 3VISA 3TGLA 1XZKA 5FDFA 4AMYA 3WYNA 1CR6A 4BE4A 3G8YA 4YASA 1UKAA 2XLBA 2PUJA 2ROQA 4J7AA 4KEAA 1YB7A 5ALOA 1Q0RA 4Y2RA 4GW3A 5C7YA 4BB0A 4X97A 2H7YA 5ALNA 4FLFA 1A88A 3V1NA 4XWGA 5JZBA 3FYUB 5ALUA 1G42A 3C6BA 4ITVA 4UHDA 5JZSA 1JU3A 3CCBA 1YSCA 2VTVA 3VDXA 3LIIA 2PSEA 2IIVA 5CMLA 3DOHA 2C5FA 3EBLA 2K2QB 2D5LA 1KU0A 4QLOA 5SYMA 4M0FA 3VKFA 5CH3A 4K6GA 4BP9A 2X76A 3JW8A 2XQFA 3QITA 2QJRA 1ZGCA 2Z8XA 4Q34A 2NW6A 3K9BA 4JH0A 5K3AA 5AI8A 3S8YA 3F96A 1FSSA 2QTBA 3H19A 4WDRA 5ALLA 5AM0A 2XUKA 2LIPA 5C8ZA 5CBKA 1XKTA 5AM3A 1MJ5A 4ETWA 1XZLA 5JANA 2VJCA 2I3ZA 4JYPA 4C4ZA 2C58A 2BJHA 3G9ZA 3O4GA 1DQZA 2QXTA 1UZAA 1QFMA 2IITA 3G0CA 4K6HA 3DYIA 2OCIA 4C87A 4C6HA 3QYJA 2XMZA 3H2KA 4KACA 5ALIA 2DSNA 2PX6A 2YASA 1AC5A 4G4IA 4DSZA 1X2EA 5T4FA 2XB6A 4YX9A 3QM1A 5ALRA 1C7JA 3STVA 2ONCA 5K3EA 2CMFA 1RYYA 4G4GA 4AXBA 2HA4A 3H0CA 4BZZA 3FLEA 1XZEA 1P0PA 4W1RA 2PSDA 1OILA 1UOQA 1CUDA 1CQZA 5D6OA 2WJ3A 2B20A 4UBJA 1E8DA 1QIMA 2QZPA 3WIOA 3IULA 2ZYIA 4TGLA 1U2EA 2J4FA 5BV7A 4EY5A 2JIDA 1C7IA 1YASA 4LXGA 3D59A 4H7KA 3Q8WA 4TPKA 2B9VA 3PI6A 4KR0A 4FFVA 5EGNA 3D7RA 3EIOA 3ESDA 4N8DA 2B4KA 1LBTA 4F21A 1WB4A 3VXKA 4QWMA 2C4HA 5JD6A 1TQHA 1QIKA 2AJLI 5HK8A 4CIAA 2QS9A 3HYSA 2EDAA 2HRQA 3EQ8A 3KWJA 3GZJA 3PDCA 3FVRA 3JWEA 5K5EA 2WILA 3WK8A 3H17A 4ROTA 4P93A 4PSUA 4K5QA 3SK0A 3SWWA 3WL6A 4L3WA 4EY6A 1JFRA 1LZKA 4HRXA 2AJDA 3R3ZA 1VXOA 3FYUC 4DYHA 4GXNA 3DKRA 4MWTA 4OU5A 5AKHA 3WL5A 1E3QA 3R3XA 4WFKA 1GGVA 3R3WA 3W04A 4PF1A 4IHAA 1QIEA 4OSEA 2PU7A 3N0TA 3B5EA 3WQHA 2WG2A 3QZUA 4J0IA 1LZLA 2V97A 5JAPA 2GBIA 4C01A 1RP1A 5CW2A 1ZIYA 4OB8A 2X8BA 3HJUA 4FKBA 2WIKA 3HEAA 4H7EA 2ZJ7A 1E8NA 1MAAA 4MWSA 4E14A 1XLVA 5DJ5A 4UHCA 5ALMA 5AI6A 5AJHA 2XMSA 5D3ZA 1HBJA 4Q3LA 4UBMA 4LYEA 5DNWA 3MUOA 1QZ3A 1H2ZA 5IVHA 2WKWA 1TIBA 3GUUA 3DLTA 4B0PA 2VJDA 3I2HA 4MJ3A 4EY4A 1EB9A 4X95A 1N8SA 3G9XA 1G5FA 3TJMA 1FFEA 3D2BA 3R0VA 3ANSA 1R4ZA 1EH5A 4U2DA 4DGQA 1VE7A 2FJ0A 5FRDA 5FV4A 4DMCA 2G5TA 5CXXA 2XUJA 3F98A 2AJBA 1OXMA 4OB7A 1N5MA 2XMRA 4OCZA 3DDUA 4CCWA 3I2FA 4AN1A 1JI3A 3DJYA 4J0JA 2Z3WA 1IZ7A 5IVDA 4ZXFA 1ZD2P 2ES4A 3GFFA 3D2AA 4OU4A 5K3BA 1A8SA 2WIDA 1O6FA 4C88A 1QO7A 1R3DA 3FSGA 1FFBA 1YB6A 2DHEA 2CUTA 3IBTA 2XI4A 4RPCA 3MVEA 3D4LA 2AJCA 3BDVA 1N1MA 4UBNA 1K4YA 3NGMA 3FYTA 3AIMA 2XUGA 4DIUA 3WYDA 3IA2A 3E1GA 3O4JA 3MUNA 1K5PA 5AKXA 2PSFA 5JADA 1ACLA 3C6YA 4FLEA 4A23A 6YASA 5DNVA 3IUJA 1LPNA 1ETHA 1FFAA 4X3CA 2JGIA 2HL6A 1AQLA 5A7GA 1UKCA 2YH2A 3CN7A 4BTVA 4AO8A 1S8OA 4FFWA 3FOBA 1CLEA 1AZWA 4M0EA 5I7UA 4M0MA 4X6XA 1XZFA 5AH0A 1DWPA 3NWOA 1AGYA 4QDOA 1P0QA 5HK9A 3GBSA 1JJFA 5FOQA 4ZRDA 1ODSA 1F6WA 3LLCA 4DM7A 3D3NA 5LZ4A 3R41A 4KAFA 3QH4A 2ZYSA 2C7BA 4GHWA 1K6EA 3M81A 4BAUA 5LZ2A 1EVQA 2DHCA 4N8EA 4OD0A 3RM3A 4PW0A 4GWLA 1MT3A 3ESBA 5AKYA 1NU8A 5ALDA 3KXPA 4NZZA 4L9AA 1IUPA 1U8EA 1HL7A 5AIBA 4OB6A 1MU0A 3IUQA 3PF9A 4KJXA 4LXIA 2QXUA 1Z68A 4BZWA 5KREA 4J0KA 5FUMA 1EVEA 5EIEA 3C6ZA 4GI1A 5CT8A 3DOIA 3B12A 2C5GA 1E89A 3I2IA 1XLWA 1B6GA 1JU4A 4EA6A 3WK5A 3ZWQA 2OAEA 4H35A 1I6WA 3T52A 4MEBA 2HU7A 4G8DA 3U0VA 2VA9A 2XQKA 1HPLA 4U2EA 5A7FA 2WUGA 3WZLA 1F0PA 1JMKC 1XZGA 3FWHA 4UUQA 3M82A 1KU6A 2BFNA 5A2GA 3WK4A 3G0BA 2GYUA 3WKEA 4BCDA 2DQZA 2P8SA 4BRSA 1EXWA 1XRQA 4UHFA 3S2ZA 2H7CA 2BGNA 2WSLA 2JGEA 3G9TA 4NVRA 4H7HA 4BATA 1ZICA 2XQGA 3WKDA 2JBWA 4Y2QA 2ECFA 4L72A 3HRHA 3B3QA 1QGED 4IH9A 5JAOA 4HXFB 1QIIA 2XUQA 2WIJA 4MQMA 1CVLA 2I3DA 4OUKX 2PUHA 4MYSA 5CXUA 2DFPA 1EB8A 1K8QA 4NMWA 5ALGA 3QPCA 4B85A 4E46A 1DWQA 3KDAA 1XKLA 1FFDA 5CT5A 2VJBA 1HQDA 1GT6A 3PICA 3GA7A 3R3UA 3H2IA 4V2IA 4OYYA 5CRIA 4Q82A 4BVLA 4KRXA 5AOBA 2WU3A 5ALXA 2EDCA 3F9CA 4DMHA 2I78A 3CN9A 1VA5A 1XRMA 4Q3KA 1XZJA 1BU8A 1YAHA 2VAVA 5LP1A 2VF2A 1EDDA 2CEKA 2FUKA 1IVYA 4QEKA 4P92A 5ALQA 4AMZA 1UKBA 3R3YA 3W05A 2ZSIA 3VJMA 2CZQA 3EQ9A 4EY7A 2Y6UA 2WJ6A 5AKGA 1RWQA 1T4MA 3C87A 3GROA 2HA0A 1XZCA 1BEEA 3E0XA 4IO0A 5ALYA 2XMDA 2XUDA 1MNQA 1ZD4A 4AN0A 2Z5GA 4G4JA 2CJPA 3OOSA 1GZ7A 1YS1X 2QUBA 3A2LA 4CG2A 4X85A 1E5TA 4X92A 4W63A 4MXDA 1ACJA 3V1KA 2DQYA 5ALFA 4QLAA 3HACA 3WK7A 4Y2TA 1EA5A 2OQIA 1NX9A 3I6YA 3VJKA 1FFCA 1LLFA 4AQDA 4MYDA 4TVKA 2ACEA 4H7JA 3PUHA 4KYVA 3DKKA 4EUSA 4YPVA 1JJIA 1EINA 2HIHA 4X7BA 5EI5A 2O2IA 3L1JA 5E4JA 1QTIA 2PSJA 2QMQA 2GBGA 3F67A 4BAZA 2XUHA 1EK2A 3LP5A 5HKAA 1AUOA 4EZIA 4Y2YA 4U2CA 1LPMA 1UXOA 1R1DA 3LIPA 3O4IA 1BCSA 5SYNA 2QVBA 3E4DA 4INZA 2XMBA 4B9EA 4B81A 3STUA 2GYVA 3T4UA 1E66A 3AINA 5AKLA 4QZVA 1EHYA 2XUPA 1W76A 3BDIA 4J0CA 3H2HA 5T4BA 2VQ6A 2VATA 1ORWA 2O7RA 3WKAA 1GQSA 3FVTA 4CG1A 4RE5A 1XRRA 1CUJA 5K3DA 5HZGA 2QM0A 1GKLA 4HXEB 3TRDA 4YK7A 4C4YA 5K3CA 2HFKA 1SCIA 4RNCA 2UZ0A 4EBBA 4Y9SA 2H9YA 3C6XA 1GPLA 4WCVA 5AIAA 1ISPA 3OM8A 3AILA 5T4HA 1TK3A 1UWCA 5JATA 2EEPA 2ORYA 4DMFA 2HU5A 1AMNA 2GBCA 2WG0A 4ZI5A 2FJPA 2HA7A 4BDSA 2J4CA 1F8UA 2BUBA 4CCYB 4XVCA 4BRZA 4X6UA 2Z8ZA 2VSQA 1QIDA 4N5HX 5DYYA 4BE9A 1TCAA 2JGKA 3G7NA 5K3FA 1LPOA 3RLIA 3ZPXA 1CFJA 4IH4A 4KE6A 1Y7IA 4EB0A 2HA3A 3C45A 4E11A 2JGJA 4FNGA 1MAHA 3YASA 1TRHA 3BXPA 3OG9A 5LZ7A 4H0CA 1U65A 1YAJA 1WB5A 3QPAA 1LBSA 2OAGA 1WPRA 2O2GA 4QWWA 5AKKA 4LHEA 4ZWNA 4C4XA 5LZ5A 1H23A 2WLSA 1ODTC 1XQXA 3NUZA 3VVLA 4Y7DA 4W1SA 3AFIA 5BWCA 2YYSA 4K2AA 5ALTA 2WTNA 4IQ4A 1QIFA 3KD2A 1VJ5A 5EIHA 2VT7A 5AKIA 1R9MA 3IUMA 4AZ3A 3OURA 1HKHA 3H2GA 1WPXA 4Q3OA 3ZLUA 5CH8A 3O9MA 4BP8A 1QTRA 2HA6A 3M83A 1JKMA 4JNCA 5LKAA 3AZQA 5IVIA 2WFZA 4FTWA 2XLCA 1CUSA 3WWCA 5ALWA 5LLSA 5HFNA 1ODCA 5JZ9A 1U4NA 1QONA 2BUCA 4Y2XA 1VXRA 2WUEA 3BL8A 3G0IA 2ZYHA 3H2JA 5HQ3A 2R11A 4UFNA 4W1QA 1UK9A
chains in the Genus database with same CATH superfamily
4IIVA 3W3AA 2O3QA 3L4SO 3K0SA 2C99A 2EZUA 4BYGA 2H1IA 2G9RA 3DHNA 4F8JA 3Q3VA 1NVUQ 2CHQA 2IXDA 1PKEA 4BNMA 1QQBA 1PZHA 1U7PA 2DBZA 3K8YA 1PFQA 4JEMA 5J23A 2QX6A 2B0CA 1J70A 2V7PA 3TEJA 5LUAA 1X77A 1A8QA 3IP3A 4X54A 3OZGA 2V6BA 4TQGA 2O2EA 3EA0A 4PHHA 2I4OA 4YCCA 5F76A 4KN8A 3E84A 4Y6SA 4RL4A 3F4KA 1ZR2A 2QROA 4YWJA 2C2MA 3UUWA 4FHGA 4G84A 1PDWA 4G0YA 5EC8A 5A7HA 1Q1AA 4PCLA 4H7DA 1SD1A 4GGPA 3GLQA 2IX9A 3MBKA 4YJ3A 1WHSB 1MOSA 3MGKA 4YJFA 4NP6A 2ZAYA 3F7TA 2Q1TA 4NCHA 3U9TA 1LXCA 3OZWA 4NJMA 1RPTA 5FTMA 1YZQA 4FEEA 1YQTA 2DKNA 1XYGA 2EG5A 5DSZA 4EX6A 4O8CA 4MRPA 3QWFA 2AN5A 1ULUA 5B1SA 4AO7A 3FSGD 3GRRA 4P34A 3KB8A 4OIFA 4TT3A 3U39A 3V8RA 5EJ2A 3TQOA 3L8MA 3ZYCA 2R0QC 4DLUA 4X0EA 2Q07A 1NMYA 5HF8A 3R8CA 4RAQA 1T4BA 5CHYA 4R0MA 5EUQB 4IJVA 1MO2A 3HVRA 1Z07A 1OZAA 2II6A 3MT0A 4N0EA 4V0SA 3P9RA 5DIZA 1JA1A 3ND6A 1WTCA 2IH5A 1ULBA 1YCFA 4L5BA 1Y82A 2EZTA 1PK8A 1Q7BA 3DQZA 4BQOA 4OLAA 1Q6YA 3CXUA 3B13B 3HB4X 3IO5A 4P32A 2AMYA 1SHJA 1LPBB 1OI2A 1A9XA 1SOMA 3UWPA 1J8DA 2Z3VA 4TV8A 4FEYA 3MA0A 4U6QA 2QPTA 2KM1A 3AZOA 3FDFA 1J42A 4LV5B 4ZO6A 3VR3D 2WDPA 5GZ6A 3V4RA 2FEKA 3GJYA 1EXDA 2JA2A 1TNDA 1SCQA 3TECE 1K8XB 3DYBA 2WD8A 1O6ZA 4ICIA 3MILA 3OTGA 1J33A 4RU1A 3WGGA 3FNFA 3LCVB 1T2FA 2ONJA 3FRIA 4EJSB 2O3RA 3LTEA 5KYWA 5FKJA 4BC1A 5EQFA 4F9KA 3PMIA 4O29A 1NVTA 1GP2A 1K66A 1K6XA 2L0XA 4KOAA 1SVMA 4RK6A 2GEJA 3KSZO 3DP7A 1U7OA 3NH9A 4XCQA 2AKEA 4I81A 4MITA 1GTZA 1G8SA 2HDWA 1KEVA 1HNNA 1WDKA 1V6AA 3R9WA 1U0LA 4HVAA 4QULA 5IG2A 5JXWA 1I7LA 3NTVA 3IDAA 2HJVA 1JHRA 1OKKD 3MTEA 5E4YA 2PUTA 3OIVA 1XLUA 1YOVA 2TS1A 5CTAA 2BUAA 1K4KA 2W4QA 3UOWA 2LIVA 4C04A 1EDBA 4QYIB 1A1VA 3ASZA 2ACVA 4K6CA 5CCXA 4R2IA 2OO3A 3I01M 1HC7A 3IQEA 4HS9A 3S81A 4E5DA 2VS1A 3L06A 1XCJA 4TVBA 5F23A 2WNIA 1QO9A 5GIPE 1OV4A 3DOEA 4FFBA 4S24A 3Q11A 5C53B 4UM9D 1NXOA 1TKAA 1XL1A 4OI4A 2ZBQA 5KYGA 5JU6A 3I2GA 4RH1A 1P4SA 3IXLA 3QKUA 3RUEA 3UOAB 3ZBTA 1W36C 4TT3D 2FG6C 2AE2A 1DV2A 2IHKA 3HH8A 1WXIA 1X1RA 5AKZA 5IC6A 5COQA 1M0SA 2J3MA 5E0OA 3V1MA 3VPXA 3K70C 3PDWA 2XF2A 3EW7A 4C07A 3MF4A 5LOVB 3RRNA 3ZD7A 2AYYA 1XT6A 1WVGA 3N0XA 4OHRA 4NDZA 1SVOA 4CIDA 1I1QB 1BS9A 1JB9A 4JXJA 2K7ZA 1NXWA 3CJQA 1WHSA 5DCLA 4TYQA 3RTGA 3V8EA 2PPVA 2XBMA 4HTAA 1KJWA 4LGCA 2YWXA 3T7EA 1BDJA 1POWA 1XRLA 1NSFA 4KWTA 1V26A 2XF8A 3CYFA 1NT4A 1V95A 1OX4B 4CTOA 1WPQA 1AG9A 1NN5A 4ZO7A 2WE7A 1T36B 5JROA 4RZUA 3N2IA 4RWEA 5KCMA 3UJBA 5DI3A 5LMNB 2V9PA 4GE3A 4Z51A 4IJMA 4WY5A 2HT6A 3WLOA 3TNFA 1ITZA 2H5IA 4F3CA 2FKNA 1AB6A 1T91A 2XT0A 3FW1A 5AICA 1XZIA 1V1RA 5CX4A 5U4QA 3T94A 3LPDA 2N1BA 1JZTA 2X0NA 2R5NA 1P8JA 2XJ9A 4E5UA 3WLIA 5KNDA 3NHMA 1ADGA 1L5OA 1CC1S 3NETA 5HF9A 3U49A 1EXVA 3O38A 4X94A 5SYAA 1EIWA 3QELA 2PX3A 2I2BA 5GGXA 3QDEA 1TGVA 1AXGA 1KSHA 3QMWA 4BWFB 2PIDA 1UPBA 5C8YF 1X9HA 2GLXA 2WHPB 1SCNE 1W46A 1QOZA 4PY2A 1I4TD 2XKBA 3H5VA 4J0QA 5AK6A 1GXSB 2AQKA 4FUQA 3TLEA 3UAWA 3HU1A 5TQ2B 3TB4A 1CUXA 4OI1A 1NC3A 3B1JA 1T3ZA 1RYMA 3NVAA 3ND9A 3AY7A 2QX4A 3MTQA 4C0QC 3AVYA 2JJQA 1KVTA 3KUUA 2VPWA 4DAEA 1RPJA 2ZAGA 3L4JA 1P6XA 2R84A 3KJIA 2ZTMA 3PB3A 4WZAA 4GKAA 1Z0SA 1CHNA 1CJSA 1IRXA 2RC5A 1DXYA 3LCRA 3A70A 1Z08A 4IF6A 3NDRA 5KAMA 2WTXA 4ZD6A 4CEIB 3QX9A 4WK2B 1MRSA 3ZV7A 4LYFA 5I7WA 2PDAA 4MUYA 4JQSA 1NKSA 2P9GA 3GUCA 2BW0A 5EWLB 1G17A 5F9HA 3PVSA 2H4XA 4IGEA 1A9PA 5CFNA 4OLJA 1RXSA 2D2EA 2GHQA 1EDOA 4NBUA 1XAJA 4V0ME 4NOLA 1DTWA 5GTDA 3H5RA 2VOEA 1LNSA 1RYDA 1ZWKA 3WGOA 1UBEA 3U4QA 2FFBA 3G68A 3Q5DA 4DBVO 4GZ6A 1NNEA 3T9EA 4F93B 5HWSA 1WZ2A 4NECA 2Q46A 2A1TS 1EHCA 2R5WA 1KI3A 3GJSA 1B76A 1TD9A 2R48A 1Y4UA 4Q01A 1CUGA 3EXIB 3K5PA 4PBRA 5CCBA 4EI7A 4CQNA 3TUIC 2EBHX 4JLSA 1DBQA 1FNMA 2FWMX 2NPOA 4RTAA 2HN9A 4A8JC 4L6IA 3IIKA 5J9FA 4OXNA 4EITA 1Q16A 1WDWB 5DTJA 3AV3A 4ZOAA 5DYWA 4NSNA 4UAUA 2ZQYA 3JXEA 4WUTA 4AG5A 1UJ2A 2COUA 3JAWB 4XYLA 4BNJA 4RAOA 4Y1RB 2Z08A 3NYQA 3Q0EA 1MNAA 1RQXA 3AVQA 1GOTA 2QX9A 3W8FA 1J7KA 2P9HA 1XHLA 3AP1A 3HCNA 3O8QA 3Q9SA 4G0XA 4OFXA 4R05A 5IBPA 4Z49A 4P9NA 3RK4A 2OG1A 1XCGB 4CM7A 3N2KA 1ETUA 2WPDD 2GPNA 5CVVA 5B6PA 3PNKA 4HYYA 1GT91 1Q17A 4CETA 1C0EA 2IHZA 4PO3X 4Q3AA 1E7RA 2CBXA 2YY6A 3OY2A 4DR3B 1VL8A 1N6PA 2G63A 4RIGA 4AZWA 4BJ3A 4MUNA 4RKEA 1IE3A 2VPIA 5AOCA 1SRRA 1SQSA 1ZCAA 4H2DA 1TJ5A 1GDTA 3I32A 2E4UA 1XZBA 1E9SA 5TRTA 2CK3A 1H85A 2PQ0A 5F64A 1VHTA 3ZKWB 4Z6KA 2ZPTX 4CMJA 4BUJA 3RRYA 3LDHA 5A1JA 4MHOA 2OD7A 4U02A 5KI6A 3EGEA 2FZKA 3KG2A 3IEVA 1XQ9A 5IHXA 2HLHA 3N8KA 1T24A 2I54A 1O9BA 3WXMA 4ER5A 1C4XA 4I8XA 4P82A 1Z17A 2D8AA 3RFXA 1CVIA 1PL8A 2QM3A 1R5JA 4IHJA 2N3ZA 4N9WA 1CDEA 2NUAA 5CB4A 4RHFA 4LJAA 4WSOA 4DIOA 3C8DA 4ZZ1A 4F60A 3LPMA 4R0NA 3VR6A 2VIIA 3SVLA 1J2JA 1P7CA 3G0OA 5DHFA 1KRXA 4MV0A 2HFJA 1DAIA 4B82A 4N76A 2GKOA 1Y1SA 2OOSA 2QD3A 4MWCA 2BRUC 5AR1A 3QYAA 4YRTA 4UOEA 4NU0A 2HW8A 3JSAA 1J1UA 4DILA 1ZY2A 4KITB 3GAZA 4MVJA 3UCXA 4GOKA 4JT2A 4O4HB 4DQLA 3UG6A 3JQAA 2JZCA 3IUYA 1MVLA 3ZLBA 1ZU4A 2TMKA 4AB1A 4RZIA 4F4DA 1OHHD 2HJRA 4YCMA 4ZJUA 1ICEA 2W8BA 1T0UA 2MMGA 3BXOA 3W8DA 1TQ6A 5JNTA 2E55A 2ECPA 4BRWA 1MEOA 4QT0A 3P52A 3A1FA 4JP1A 4UPDA 4H77A 1S3FA 4KR3A 4GR9A 4UEKA 4N3BA 3I5XA 2NZWA 1KZ4A 1QFSA 4MGEA 2HYIC 2W0MA 5E1OA 1E9AA 1W1IA 4RLFA 1OA1A 4ZP1A 5C1IA 4BFVA 3DE2X 3B9BA 4E31A 3IALA 3T4XA 1CLUA 1HEUA 4YJ3F 3LMKA 4BJ6A 3JQRA 3W4JA 4HJRA 4IM7A 4PTLA 2Z9DA 1NONA 3LRTA 1MXHA 3HXKA 3FMIA 3WL7A 3IDOA 4QPJC 3IVCA 4AJPA 5JE8A 2DPYA 3KFVA 2VNHA 1WSBA 2J3QA 3I6QA 4HAIA 2WYOA 4YT5A 2IV2X 2IHJA 2A78A 3HEBA 4Z5XA 1KO8A 1VMIA 3SICE 1WAMA 1A7UA 2OZPA 2P62A 3BB4A 3EIXA 1NW9B 3PHBE 4AJHA 1L7VC 3BG5A 4PYOA 3E7FA 2IE8A 1GPBA 2W6ZA 3L7KA 3MERA 1GAQA 4KQIA 4UC0A 3I76A 1OB5A 2DQKA 4CL0A 4M0CA 3INRA 4M1SA 4P86A 1JFVA 4Y1RA 2EKLA 4ENWA 4ESVA 1G2PA 2WAYA 3L1HA 1E61A 3KHKA 4RKYA 4YO7A 1KE1A 4IKOA 2BGMA 3EVEA 3F4BA 1Z5VA 1PV2A 3U37A 1TT5B 1QIHA 3LQ4A 3AVWA 1BHJA 4PICA 1PGJA 2QRVA 4P7JA 4TYPA 4D9IA 4Q4LA 5EZ5A 5DWDA 5CYFA 3V33A 4EHKA 5CVTA 3Q7RA 2A0XA 2Q2NA 4GSKA 5D3QA 1RWPA 5L45A 4A2QA 3VR2D 1DDIA 3UF0A 4F56A 2J32A 4RTMA 2PS3A 3ICOA 1SCUB 2DX7A 1WW8A 1ZJYA 4NS4A 4DR6B 3R6WA 3H1PA 3S0JA 5JSUA 3K1YA 2V6FA 3EEBA 3K4QA 2X4LA 1AO0A 3UAOA 3DBRB 2FWBA 2WTMA 2CDBA 4HQ0A 2CCKA 3M6WA 4I0WB 3QENA 5FI5A 5DHQA 5GJBA 4B2IA 1K63A 2EJWA 3EXHB 3FNRA 4QHSA 5CD1A 1KDZA 1ISGA 3A4IA 1OPXA 3WSTA 3QPDA 1G7RA 3CKLA 4N41A 4XYEA 2J9ZB 1GR0A 4GDMA 4XGRA 3C8UA 5HE8A 1XEWX 1GGJA 1KR5A 1TW2A 3I30X 5GONB 1D2RA 2VTBA 1JNYA 2C2XA 3D5EA 4TQUS 4X1KB 5EE9A 1XALA 2R00A 1DP4A 1M1YA 1XZQA 4K9PA 3LGSA 1KJQA 2BH2A 3EODA 2VO1A 5AW2A 4BO1A 4P33A 1CCWA 3JYPA 4EVRA 2RAPA 1B7GO 3LCCA 3UKOA 1PGQA 2WHRA 5B58C 2I99A 2KMLA 3N2ZB 1ISHA 2QMEA 3GEBA 4K86A 3T3OA 4DFDA 1DKNA 1AHPA 4YUAA 2FKAA 1J1ZA 1VOTA 2B8EA 2QSZA 2FQWA 4UDXX 2IU0A 5I7EA 5KHOC 3UUFA 3T1HB 5BWBA 1OH6A 3HWSA 9ATCA 2J48A 1UF9A 4QOSA 3N6RA 4U7WA 1TO1E 5G40A 2HC9A 5FUBA 1L5WA 3JVIA 1UKVY 3QY0A 3G8AA 1H8EA 4EB3A 3OLQA 1N8NA 4F86A 2YJZA 4A5SA 1X1CA 2D62A 2FPXA 4LI0A 3IQXA 1T2NA 1PKXA 4L78A 2W98A 1AKUA 4BNDB 2YV2A 1L3BA 3JD2A 1NVDA 1GKIA 2YXPX 1JAXA 3CR8A 5FBVB 4FGKA 1CRZA 1XDDA 5FPKA 2QNIA 3EXFA 4GI7A 3VC2A 4JB8A 1MIHA 1AGNA 4ND5A 4EF6A 5FWAA 1LFDB 1W2WB 1ZH0A 3GU3A 3OWHA 1E9RA 2CFOA 1SU6A 2I8LA 2XD9A 3BZWA 4JJ4A 1DWOA 3EC2A 5EJIA 1I0IA 3UMGA 4GMHA 2GCEA 4L1KA 2GO7A 1L7MA 1NKVA 3ICPA 1E3IA 5F51A 2WUFA 3ECAA 3OUUA 4CCYA 3QU9A 1J2EA 4B80A 4QJ5A 1ORHA 3KUCA 5AO9A 4MAFA 1GKKA 1R4NB 3LS2A 1U98A 1DIOB 2I65A 1QIJA 1WNFA 4QDTA 3SEFA 2GF2A 3ZZMA 2NYUA 5FBWB 1UK8A 2LKDA 4XH9B 4RQUA 4HZIA 3RAPR 3EDYA 4YT4A 5I9IA 1R0YA 5AW6A 4IMIB 4BAGA 5AW1A 1FDTA 3C1UA 4RTLA 2BLNA 2IYEA 2ZITA 4I4TB 2UYCA 4N8SA 4A0RA 5HZHA 1NT2A 1N0WA 2NQ8A 3DBRA 5M3BA 3X1MA 5KJCA 2P3LA 3NBMA 2GCNA 2XCIA 3L1IA 4PCVA 3VPCA 3ZNPA 1KEUA 2Q3EA 1XTUA 3LKBA 3VYTB 1BWPA 3SDZA 5SZKB 7MDHA 1HTTA 1RHJA 3FDIA 2OE2A 4GNRA 3F73A 4OQXA 4RORA 2O0LA 1VKJA 3JSXA 4KHPB 2C2HA 4GR4A 2VTBB 3QKSA 2G1PA 2GETA 4J16A 4NJEB 4MRMB 4HN4B 3OMLA 4DMLA 3PC4A 4O2AF 3SAJA 2ZJAA 3OZCA 1AGRA 3WWOA 1OC4A 4NYMR 2XDQA 4HGOA 4IDEA 4ZVKA 4J4BA 1GWNA 1CUBA 1RVDA 2WFLB 4G0MA 5BQ5A 4CFSA 3CX8A 1YU9A 2QIPA 3F8SA 4REOA 1RBYA 3HNRA 1NN1A 2XDWA 1T8RA 3K31A 4QEDA 2FPOA 2VNAA 3EA4A 1TGYA 3QBEA 4BE7B 2BD0A 4P3KA 2V7BA 4ZO9A 2BAGA 1BNCA 1T6XA 2NU6B 1PW7A 2AZDA 3NUQA 5JNWA 4R51A 3COSA 4ZICA 3OZIA 3PGVA 1Z28A 3RVSA 1Z0JA 4BJ5A 4W99A 5J3JA 2OMEA 3CV3A 3NB0A 2OXEA 1V16B 4E07A 4MI6A 1LF0A 2WHYA 2XQIA 3OBIA 3KSBC 5IS2A 1Z06A 3FLBA 2VDVE 4I2NA 1WXXA 5AW8A 4DHEA 2V7XA 5D7BA 1WZCA 5CX1A 4CMBA 2F3UA 1FS6A 4KLRA 2QTHA 3OPMA 4ENSA 1E96A 5BWNA 5AUQA 5K0NA 4MQLA 5EKXA 4JDUA 1CHDA 1MG0A 3OESA 2RCYA 2RONA 5HOQA 3DE0X 3NTXA 3RFFA 2DEUA 3MTIA 2DPXA 4P7FA 5C35A 1S02A 2GKSA 3UH1A 2CL6X 2ZCUA 1G21A 2JI9A 2PGDA 3G5UA 1ISIA 2A1UB 1SRQA 2J5BA 2PKXA 3M89A 4DL9A 3L84A 1JEJA 3A3OA 4TL9A 2GBPA 4BQQA 4C43A 1JKIA 4R8SA 4ZVVA 2DUMA 3THXA 4K0KB 2BJWA 4DN6A 1I7PA 2EL9A 2RAFA 1IBKB 4X93A 3DEAA 1CRQA 3GLKA 1F3LA 2CLOB 3E9DA 4K6KA 3PHGA 1W94A 4P36A 3JPWA 4RADA 2JJ8A 3G0GA 1Z2PX 3C15C 3LCJA 2D1FA 1AHHA 2P7HA 3MELA 4GX0A 4NXMB 4H16A 3BB3A 3KB2A 4L22A 3RTEA 1XU9A 4ZDJA 1YDWA 4PGMA 4AMVA 2J9FB 3CEHA 3EVZA 3GP5A 1J1IA 3ESCA 1RAGA 3WFIA 4MPRA 4MTLA 1A3CA 2GCGA 3OJCA 3RUAA 3G5AA 5FIUA 4KUEA 5EFZA 4CT4B 5DW0A 1MOZA 2AD1A 1ABBA 1G8AA 4HP8A 4MJLA 1AMUA 2WMDA 3ZQUA 1KKLA 4EPXA 2IPOA 3FTQA 1VLJA 2VF5X 1DX4A 3PQFA 2AC4A 4LOIA 3HVHA 4EGQA 1EYZA 3F1LA 1E3JA 2X7HA 4FFBB 1K7XB 2QB5A 4GOMD 4MYCA 4PRLA 5AK5A 5LPNA 3RVQA 3T3PB 4B8YA 5B6JA 2WZBA 1VCIA 3W5JA 3GV0A 1RYNA 4TXNA 4EFDA 2QMOA 3EWNA 1IBMB 1VJ0A 2HXYA 3P0EA 1CUHA 1LC0A 1T10A 2P2ZA 4JUCA 1XCLA 1UDWA 3UC5A 1FRNA 4DJAA 3RCBA 2WYVA 4U2GA 2CHFA 2CMDA 1NUQA 4JYBA 4UUOA 5IP5A 5FTNA 4BNLA 5EWMA 1HDOA 1EX9A 2D1SA 4MUFA 4R2JA 1C3EA 1XTVA 3CUEF 4V02A 1YIOA 1YS6A 2F17A 1K7YA 1FYDA 2FUEA 4EY8A 2QLNA 2HEGA 2Y2UA 3PR2B 5FTWA 4QPCA 5JJBA 3FPFA 4RF3A 4X71A 1J8YF 1L4YA 2EBUA 2WQZA 1JLMA 2X41A 4IRMA 4Q4AB 4CT0A 2ZBEA 4WFQA 3EHEA 1M5RA 4ZPXA 1GY8A 1RKQA 1F2UA 2GRAA 2JEZA 3EVGA 3H2SA 3OEED 2ORIA 3MMZA 4Y2VA 4DT1B 5BN1A 3FWPA 3W9BA 3AKCA 2QY6A 1RXVA 4FX2A 4Z4EA 1M8PA 2Q4OA 3I45A 5LQCA 1FBNA 3A3YA 3SJ7A 3CRNA 2HMTA 3SFTA 4KPYA 1ADJA 2QY9A 3RRMA 1NDQA 1ESDA 4MW6A 5FLKA 5FYDA 5KTNA 2OHOA 5EHQA 3CW9A 5SY6A 4AG6A 4RK4A 5IDQA 3NHBA 1FP4A 1P9RA 2QI9C 4Z1MD 2FX2A 3DMRA 4MNTA 5KKNB 4EG7A 1S2OA 4QNMA 1SFRA 4YRRA 3EZNA 2DR0A 1C9DB 1Z3CA 1S2DA 1ZKMA 3DZGA 4QDXA 2IH2A 2G5GX 5THXA 1S2LA 3G59A 3G8BA 4II7A 4RHCA 5HGXA 3KT0A 1EK1A 1NSYA 2KW5A 2CFRA 3LCUA 4IJQA 5EQDA 3DNFA 3IOBA 3DFIA 1ZOSA 1JVNA 1W4LA 3WMEA 2O2HA 5ALHA 2E48A 3PENA 1M8KA 4X91A 4Y6QA 1T6ZA 3P9ZA 5IAGA 3F1KA 2HHLA 3I2KA 3RQSA 1A9YA 3K09A 4B6JA 2HO5A 3D3WB 4B9AA 5B7NA 1TEZA 1JDTA 1M8GA 3RSSA 3N8DA 3GUYA 4CTJA 3ISJA 3OE1A 3F6YA 4GG1A 1AKNA 4IJ5A 5KJFA 4LNHA 3UTDA 3B2EA 3HU3A 3RARA 3T1OA 4A16A 1A0OA 1RNLA 2ZVQX 1TU0A 2GJKA 2YZ7A 6REQA 3K70D 1PR0A 2YUTA 3P2JA 4RPGA 4LBZA 1SVWA 1VMAA 1B23P 1F2DA 3IAS6 4TKLA 2AV6A 2I76A 1YNOA 3I9OA 1RVV1 3C74A 4AT1A 2JJ1A 2V54A 2H17A 4RDCA 4EFLA 2FPPB 4FOSA 3ZH9B 1N6LA 3LDUA 2ZIGA 1U0HC 3X1WA 3AO0B 4JVLA 4YRJA 3CSDA 1MA3A 3HRIA 3LJKA 2JFOA 2F3RA 2J5KA 1BOFA 4S1PA 1GGMA 4RV5A 1FMLA 3OTIA 4ZVMA 5JJLA 3RNOA 4BCBA 4A7PA 1CZLA 3MHPA 1I01A 2HK6A 4S1TA 3NBZC 2C77A 3VVCA 3R44A 5DT9A 5JNVA 1FTNA 3GL9A 1FJXA 3PTAA 5E2AA 4JV5B 3AUKA 3QEKA 2QVXX 3CT4A 1MX9A 2JHGA 4C3OB 4DC1A 1KXJA 8ABPA 2OV4A 2FMFA 1VB3A 2I7XA 1I1HA 4GS5A 3SG0A 2IEYA 3HSSA 3BD6A 4BGUA 3U7FB 1UC4B 2QRZA 2VJPA 1L7RA 2X9LA 1N9ZA 3AUYA 4Q7LA 2BV3A 2FETA 1JBEA 3O90A 2CXOA 4WMLA 5G0VA 1DZ3A 4EELA 2C9ZA 3OUTA 2WE8A 2PD4A 5JYCA 4P2GA 1NATA 1PZNA 2XBUA 2YXDA 5DV9A 4QUKA 2P5SA 1NYRA 1UMCB 3DZIA 1SKBA 2D54A 3QPWA 4G0QA 4R3WA 2XNKA 1ZOOA 3ADOA 3AB7A 3CC8A 4EZEA 3GRFA 1M1YE 1S8AA 3N1UA 4RM3A 3A4VA 4R7GA 3URMA 3V42A 4B83A 1NF8A 2D0PB 5CLJA 2YMQA 2PM8A 1SG9A 1IUNA 3IR7A 2IHVA 4H3SA 2WB4A 4MUIA 3OQJA 4OOEA 4IMJB 1OYVA 5BW6B 4PYJA 4H3VA 1XROA 3NFRA 2PSHA 3A6LA 5ECYA 2ZJ4A 1XJ0A 4R8RA 5ESXA 2X1MA 3PUYA 3IEMA 1GA1A 3DV9A 3VO2A 4N5DA 3UWDA 4CQMA 2WVJA 3PHLA 4EPTA 4UJ3A 2IHBA 3TKAA 3PJEA 4TMTA 2GUWA 4UBIA 1W4BA 3ZW9A 4DVGA 2YJGA 1M1NB 2X1HA 5TE9A 3OO0A 1AS0A 4KJZA 2PKYX 4NFHA 2VZ8A 3ZBQA 4KXMA 5AVRA 3LOUA 1W9MA 4HYQA 5T6BA 4DM4A 5FO0A 1II8B 2F1JA 4Z7OB 3ELWA 1TTPB 1IEVA 3FSRA 3I64A 3PGMA 5JFGA 2AFHE 4GBGA 4MR9A 2OXCA 6AT1A 1QRDA 1EM6A 2HNBA 1DEHA 2H2HA 2IIQA 2GK7A 2I8CA 3ESAA 3I37X 4KMMA 3D8HA 3KHUA 4LG1A 4CIYA 5F7ZA 2XUIA 1QBKC 3F5SA 4M0UA 5D2CA 3AXTA 2N42A 1PG0A 4BVKA 4H7IA 4RNDB 3HCCA 4G9EA 4HMPA 1T8UA 3ELDA 3I52A 3QBTA 1ZLYA 4QQRA 4PVCA 4D3DA 1J20A 2Q9CA 1JG2A 5FAXA 3GCGA 5I4CA 1WDTA 1DG3A 1LRLA 4FYYA 2WM9B 1BHSA 1FU4A 1J24A 4LF5B 1E77A 1K5DA 2R8OA 2OILA 4HXGA 4MUJA 1DNPA 1A1SA 3MTJA 3SOPA 2AG1A 3GZNA 1MO4A 1NQAO 2W6CX 3IURA 3BIFA 2EWVA 4MGZR 2RKOA 2QJWA 4XGQA 1PJRA 5LIPA 1JG6A 2FW1A 1N2CB 4I3GA 2ZZKA 3ZZNA 4A8TA 4G0VA 1LI4A 5KSZA 2RC6A 1FSFA 3JQFA 1TK9A 5THKA 3MWLA 2DECA 1I36A 1AZLA 1W5EA 3FGNA 2CB9A 3LKZA 5DCUA 5JO9A 5J4VA 2FSIA 1O5IA 1JIQA 4QU9A 4QREA 1A5BB 3D4IA 1E0JA 3L9WA 2GOYA 1NXXA 1NX6A 3RUIA 3X44A 3E3AA 2VOJA 4O33A 3NQ41 4PAMA 3DBOB 3DCJA 4PLFA 1HQCA 1YQ9A 4WJKB 1CQWA 4XASA 1T9BA 1CSEE 4QUAA 5L7WA 1OFGA 1X7HA 2PUWA 1PNOA 3UFXA 3U44A 4X7PA 1RQ2A 3DA8A 3VPSA 3NHLA 1CFZA 5EP1A 4C29A 1QDEA 2PMFA 3HL0A 4HAWA 4FYWA 3I58A 4RTSA 3E53A 3FUXA 2QU7A 1T6YA 5F4ZA 4DDHA 1LA2A 4RQAA 3E7PA 4URZR 3RHTA 1F7VA 2JJ2A 3RKUA 1NMEA 2C4MA 2PGIA 4D0GA 1S3SA 3CNLA 4B4DA 3NHYA 2GA8A 8GPBA 4W4TA 5LMCA 1KYIA 5HFAA 1Z0KA 3O1HB 2D4HA 4DA4A 1NJ8A 3F5MA 4EHHA 4EQZA 1C9KA 5CLIA 3NAZA 4YCSA 1YK1A 4NV1A 4E08A 5KOHA 1FSZA 4F71A 4MDHA 5WRFA 2AFIA 1IN4A 5DU2A 1BRTA 3D64A 3TOXA 2WBLC 3EF1A 4P84A 1QE0A 2Q3HA 1BGXT 1QXSA 3LDAA 3KK0A 2GEFA 2PPLA 1JR6A 2GARA 2C2ZA 3C5WP 4QFBA 2R8ZA 1XQYA 1VBFA 3KZOA 1G9SA 3I04A 4KQ6A 4PO1A 5TMBA 4B2PA 4BEBA 5JTUA 2OQVA 1MJFA 2QN2A 3OQ6A 3AR9A 3OM9A 2ZYRA 1E2KA 1B41A 4JBWA 4DIKA 2Y92A 1XZHA 2A58A 4YJ2B 5JO0A 4EG0A 5HUHA 2BE7A 1EUCA 1FMJA 3AGQA 3R74A 1UDRA 1SVNA 4B35A 1WF6A 3AEZA 4DTCA 5DHSA 4R1OA 2W4MA 1WD5A 4RQBA 3VISA 3VAYA 3VMFA 3RV4A 1MEJA 3W5IA 4M2LA 5EINA 4H6WA 4AMYA 1SBCA 2OP1A 2W2LD 1KBOA 1TKBA 1YC5A 3GJ3A 3N28A 3OAAA 4KRGA 2X3UA 2XNJA 3HN7A 1CR6A 2MSKA 3D6UA 1FTWA 2REQB 1FMCA 1KHTA 1N2IA 2A0WA 2IDMA 2W71A 3D6JA 1BCRB 3QOXA 4IF4A 4YASA 4KVAA 1ZVKA 5IT5A 2PUJA 2ROQA 1BXGB 1H8ED 3EMDA 4HLUC 3L93A 4KEAA 5ALOA 1I7SB 1G20B 1Q0RA 2BFBB 4Y2RA 5E38A 4HZUA 4GW3A 3BE5A 3D6TB 5ALNA 1XO1A 2A6PA 3KR1A 2O7SA 4CQJA 1IL0A 4COKA 3GFVA 4J2OA 1V25A 1KA9H 1KQPA 4BNZA 4TWRA 5G1NA 1IMOA 3WBBA 1J0EA 2RJNA 1Y80A 1L1EA 2JK1A 2YHUA 1QTQA 5EJMA 9LDBA 5LYJA 3NHZA 5B6IA 2G5CA 3BICA 1NR7A 3F9RA 4UNIA 4X66B 1D2CA 4PLHA 4FVTA 1AV7A 1OI7A 3ZDAA 2GD0A 3WBFA 2R4TA 3NG1A 3USES 3NIFB 2ZSKA 1MBZA 3OEHD 2C5FA 2I62A 4N7BA 1MB2A 1ZITA 1KYYA 5LNK6 1RQRA 5FPSA 1Y8QA 1AUQA 4DV1B 1GG2A 5SYMA 3QXSA 2EQBA 1AZTA 4JB3A 4R69A 2GUGA 5AHOA 4UW9A 2QLBA 3AXSA 3DC7A 3VPDA 4XQGA 1TYEB 1L6RA 4PU0A 4BPBA 2QW1A 2WTUA 2PZJA 1H69A 1NBAA 4LE1A 1EVKA 2FW7A 4C0SA 1EWYA 1NVGA 3P5BA 2X76A 2M98A 4K6GA 2OYSA 1N77A 4N40A 3IKLA 2QD1A 2ILTA 5KNDH 5KQLA 4OATA 4KHZA 4PAOA 4ALLA 3QITA 4DIBA 1ZGCA 1CR2A 3TKYA 5D01A 2Q6KA 2ERYA 2Q4BA 3K9BA 1C2YA 1WKVA 4ILKA 1OZFA 5CLFA 4ZAYA 3PEYA 2DPLA 3SI7A 3VR2A 4HMQA 2G8LA 5AI8A 3RK1A 1HNXB 4XUGB 3TX2A 1D3AA 1UL1X 2B94A 4K88A 3SHTA 1JG3A 5BVGB 3I09A 2HHHB 2F00A 1RLUA 3DDNA 1ZKDA 4GZ3A 3CZ9A 3KSUA 1J9EA 2QTBA 1M72A 2SCUB 2V7GA 1C14A 3B1WA 2GZAA 3A3PA 1Y8ZA 3ETDA 2HHCA 4QFCA 7AT1A 3HO6A 1HYBA 4I4TA 2Q5OA 3G2PA 3R9IA 4EARA 5C8ZA 4CV0A 1GL6A 2FMIA 3SC3A 4HSGA 4C2UA 3RHSA 4RJLA 4F3KA 1S4MA 1ZOLA 2NSJA 3JQ9C 4CM1A 4ETWA 2GN1A 2C42A 2MMCA 5ELLA 1BGWA 1ZUIA 3HGMA 2FN9A 5FEUA 4C7JA 3PDIB 1ZHOA 3ZV5A 2XZTA 4IDCA 1ZONA 2WF7A 2GZ3A 3EG9A 4IFTA 4RVGA 4Z7NB 1TL7C 5E9JA 1O77A 4TYWA 2C3MA 4Q7MB 3OA2A 3LY9A 1DUSA 3IAXA 4V1CB 2WFAA 1ONBA 4U8GA 1MHTA 3O8DA 1EFTA 1N4DA 3W8NA 4R16A 1UZAA 4TLBA 4CTNA 2D5AA 1PZGA 2Y1OA 3BJEA 4L50A 1LLQA 1PWZA 4UNQA 1EX6A 5FOVA 3SE0A 3TW8A 4IG4A 2IXTA 1EK5A 1IDN1 4CLEA 3CLSC 3DYIA 3EFBA 1U7ZA 3PG5A 6PFKA 3U7RA 4DUYB 4F2WA 1L1FA 5AJZA 4ID3A 1Y9AA 2XMZA 2CVPA 2E49A 2FPMA 3JD0A 1Z4JA 3UZUA 1KZHA 1JBKA 3AEKA 1OYWA 3CRW1 3IIEA 5KSPA 2QENA 1H3EA 3V4OA 1VRCA 1VSTA 3DW1X 2DBRA 5B2ZA 2CLDX 2BFMA 5E6SB 4ER3A 2P11A 5E6UB 5JDCC 2KX7A 1T2CA 1G98A 3RIGA 1EX7A 5HKOA 4YP7A 3KTAA 4LSWA 5B12A 5BV0A 1X2EA 3N8GA 2PX8A 1W85A 3MW8A 1AU9A 1XD9A 2Z57A 1PT7A 1X1QA 4MP3A 1UBLS 4UUAA 4R1LA 3SXUA 2A14A 2V8OA 4PSKA 2XVZA 3ONDA 4JU9A 3DEIA 5THQA 5C51B 3HFRA 2NUPB 2P6OA 2AG0A 2CMFA 3FI0A 4CLHA 1RYYA 3TNDA 1IWBB 2X4DA 3P9YA 3KRTA 1QU3A 4R2KA 3KYDB 2H2GA 1HM5A 2WSSA 3F46A 1HI9A 3AEYA 3PQ5A 1U0TA 1YZ3A 4HJXA 3CTPA 3RABA 3FLEA 2C4WA 2YHSA 5KQGA 1RZRD 4IWNA 4IUDS 2Q28A 3WQQA 1MO5A 4Q16A 1P0PA 2RHHA 3S70A 4BO2A 4W1RA 3HU5A 5TS2A 2FEWB 3HY4A 2CFCA 3CLTC 3OPNA 2Z4RA 4YQYA 5EEHA 1I5RA 4P3PA 1OY1A 2OHIA 2CT8A 3IHKA 1CQZA 4O4LA 2WJ3A 4NV3A 3HJNA 1P4HA 5D6OA 2O57A 4YMIA 5EJAA 3PGA1 3PX3A 4ZEXA 3QFRA 5EPUA 3WFJA 1C0LA 1N6OA 5JI3E 1CZOA 4JI3B 3RIHA 1CDOA 1ZGJA 1DKMA 4IAOA 2G0NA 1GCOA 3EQ2A 3GRPA 5EOVA 3SLRA 2NSDA 3CX6A 2BI8A 1SVSA 4GPEA 3A6PC 3HYNA 4TGLA 4Q48A 1U2ZA 2J4FA 1TVKB 4RACA 2C4UA 4DEYA 5BV7A 6LDHA 2F8MA 3WS7A 3OZVA 2J08A 1N3YA 2RGNC 5H80A 3TR6A 2LVBA 5A06A 3B38A 1SPBS 4E7OA 1XHFA 1QKIA 1R9GA 1ZK0A 2GJSA 3MCTA 4R2XA 3ZX4A 1IK4A 1UDBA 6CHYA 3Q8WA 4PYMA 2B9VA 3PI6A 2H9RA 3UNXA 5KTMA 4KR0A 1XKQA 4YCAA 1Q74A 1Z9BA 4BEWA 3PDIA 3GT4A 4PZZA 5C8DA 3QI2A 5LJLA 3DKVA 3IPLA 1YRYE 2DJIA 1P75A 4N8DA 4PNHA 4CW7A 1JU9A 3HJGA 4MWDA 1SBYA 4F21A 1P9OA 3C8ZA 4GVXA 1VBKA 3SOZA 1N57A 1TQHA 2HMWA 4PIMA 1E0DA 2JFXA 2VQ3A 1YULA 4CLXA 1DBRA 5EIOA 2RGAA 9LDTA 2JIMA 2EDAA 2PYDA 3KPJA 2H7VA 4HKTA 3B6KA 4KN6A 2J7PA 1J39A 3T6KA 3WDLA 2HRQA 3F71A 2BZ1A 5C1PA 3S7ZA 1OU0A 3M7IA 4WKGA 3PDCA 2Q9BA 3KNZA 3NGXA 5IH3A 1QAOA 3BQNB 2C7QA 2YQZA 3JWEA 4O3FA 2VWPA 1TI7A 2G1KA 1ECBA 1P2TA 1NUSA 1FU7A 3CZCA 2BN4A 2R6AA 4JLMA 4ITRC 1X7YA 3OX4A 1CP3A 1YGYA 2GBLA 1ZJ6A 3FOCA 1ODKA 3OQIA 3GWHA 4KDRA 1ZPDA 3PPYA 5AT1A 3SK0A 3EGWA 4R7TA 2CDAA 1GTMA 1JFRA 5EXEA 4R31A 4XARA 2M6RA 1GSOA 4HNAB 3HEMA 4JJ6A 4DYHA 1OX4A 4MGIR 3HYCA 1VGVA 3ITEA 3VU0A 4AZTA 4QYTA 1F8XA 1Y48E 5ITSA 3WBJA 5EQTA 1E6WA 1QMPA 3IT3A 5AKHA 1Z63A 2H1FA 4JJEA 4C9BA 3REOA 3EG5A 1NRIA 5IDWA 3WL5A 3ZD9A 1NNUA 2PQ2A 4JI0B 4V0MA 3N87A 4P4SB 5EMHA 1JQKA 3LHFA 2ALJA 4KV9A 3RVKA 2FZ5A 3DPIA 1T15A 1EFPA 1DJNA 1QK5A 1P33A 3ZU3A 1O94D 5KNBA 2C8VA 3P96A 4JUBA 3UAVA 1DAOA 2NIPA 4IHAA 4LDNA 4RESA 4OSEA 1FS5A 4MCHA 2AF3C 3T12A 5H81A 5H82A 4E4RA 1YXMA 2ERCA 4DVJA 1WSDA 4PPFA 2WG2A 2HF9A 1HOXA 2D4AA 2VYNA 4J0IA 1GRVA 2BGIA 3W9YA 4CL8A 5BR4A 4WESA 1TLFA 1LZLA 1Y7TA 2V97A 7ABPA 2GBIA 3H3JA 1SULA 3A1VA 3KQOA 2R47A 1C7EA 3IT0A 1AQ6A 1RP1A 3QLTA 1LBIA 1ZIYA 2CLLB 1J23A 1TJNA 5CW2A 3TSZA 3U26A 4LEIA 1MC1A 1CDZA 2A30A 1I10A 3T9BA 1ZXLA 2RGEA 3DTVA 4B09A 3BKWA 4Q15A 4HMOA 2B7LA 2Q2OA 2XE6A 1XTKA 1X7ZA 3LFUA 1NXQA 3TSYA 3W3AH 2IUEA 4JBYA 4WADA 2CVHA 4FK8A 1RWBA 3FYSA 3V4ZA 3GLIA 3GFSA 2IBSA 1E2GA 3W2FA 1EQ2A 3HADA 4E14A 1V5IA 3ZV4A 5CK4A 3HE3A 1A9ZA 1Y5IA 3SQWA 3F3KA 3AHIA 2BFDB 3CU5A 3FRHA 4XX0A 5AJHA 3QTTA 4IIEA 3TZKA 2I6TA 1PL0A 4RCZA 4N03A 4EATA 1ZM4A 1YU6A 2YWFA 3EOAI 4B5KA 2BLLA 4V0KA 3DUFA 1XEFA 3IAM1 3L92A 1QRUA 4ZYLA 3GFOA 5IMBA 3PFKA 3UB2A 1UPUA 2OZEA 2VPZA 3P97A 5DI9A 4EKNB 3EH2A 2Q0QA 1P17A 3HA2A 1KXZA 2WWRA 3DBVO 3NH6A 4MQEB 5FNVF 5JG7A 1H2ZA 5IVHA 5J63A 2O8BA 4N9QA 3EY4A 1C9EA 3ZDRA 4B40A 2FRDC 1DWUA 1CIVA 2BMWA 3HXPA 2CNWA 5KKAA 3W77A 3TG2A 1A9OA 4O5OA 1JSZA 4IS2A 3QLJA 2VJDA 1W4CA 1SZJG 2C4TA 5BQOA 1ID1A 1PEKE 4JMLA 3SZ3A 5KYWB 4J1SA 2ZBDA 1A71A 4BRUA 2OC9A 5JWRA 1RRKA 1OSNA 2PQMA 1FFEA 4HC4A 2KPOA 4OA8A 1L5GB 3K0CC 3R0VA 4E1AA 3ANSA 1I6KA 1RM5A 1GRQA 1JI0A 1N0IA 1R4ZA 2PYZA 1MABB 3ETJA 3NEPX 4OHWA 1EH5A 1XWWA 2NXNA 1BQ4A 2SNIE 2JD2A 4LRQA 1RHUA 4XLLA 1WO8A 3INGA 4NKRA 3RVBA 4OXXA 3TOZA 3OF2A 3TZ6A 1VE7A 4B2LA 4PN7A 3UK0A 3MLEA 2FJ0A 3ZY3A 2BZ0A 4YAEA 4NCAA 1YE3A 4NRDA 1QB8A 4ASUD 2WZDA 3RBVA 2O2CA 1RPAA 3AQIA 4HR7A 2XHEA 3O8QB 3K8ZA 3A14A 3MYYA 3VNSA 2WWIA 3C1AA 3SZUA 5CCEA 3AHCA 3AESB 3TTVA 1Y5NA 2JAXA 3X0DA 3Q2KA 2FN7A 1YVEI 4WLNA 1LV8A 3KLPX 4Y9RA 1FEZA 421PA 3HUTA 4AP5A 1E63A 2AJBA 2C2BA 5EPEA 5J4KA 1P4JA 2EKBA 1DMSA 4FZRA 1K7EB 4IGIA 3SKYA 2FAXA 3TN7A 5FL7A 4DA6A 3ESZA 1OXMA 1N5MA 2IEBA 2NO9A 2P75A 1ZISA 3EEQA 2XMRA 4OSOA 4DDTA 1PF7E 4QTYA 3LGXA 3DDUA 2YCLA 1IAVA 4RX1A 1N32B 1FTYA 3RJ5A 2AOTB 1RE0A 1Z4OA 3I2FA 3L7MA 3VO1A 3QFYA 4F5DA 3RBAA 2JL1A 2VP3A 2Z3WA 5KEIA 5IVDA 4PWZA 2VHZA 3HYRA 4GMFA 1H6CA 3BDAA 3KV3O 4U7HA 1U7TA 4BLUA 2QZJA 3KBOA 5K3BA 2A35A 2WIDA 3N8IA 2RGWA 1E79D 5CNKA 4ZU6X 4MICA 4UARA 4YR7A 4C88A 1QO7A 1W4ZA 3D3QA 3CUWA 3LPCA 4WASA 3VMMA 4C3UA 1TW3A 5BNWA 1YT5A 4FT4A 3PK0A 4Q02A 1QVRA 4FDUA 1TYCA 4BNHA 2J9YB 1V9LA 3IBTA 1YK0A 1Z18A 2H8GA 4R5MA 1VMEA 4TXLA 4QM7A 1FOEB 2R85A 5K0CA 2FQ1A 2XI4A 3E5MA 4RPCA 1DXQA 4I1OA 4Q9LA 2B34A 1MP0A 1TQ8A 5HDBB 3UG7A 2ZIXA 3D4LA 4F45A 1L7EA 1W0KA 3VUFA 1NUHA 2QORA 3JQAB 4UEJA 3HK2A 1V8OA 4NIMA 2XOKA 4ABYA 3WGHA 4X62B 3FYTA 2H2DA 2XUGA 3ZD6A 4GSYA 3TCKA 4RVCA 2IV7A 1VL5A 3LK7A 4AF8A 4HDOB 1V4VA 5H3CA 3KX2A 4J90A 3WYDA 3IA2A 1PV4A 1ACMA 3E1GA 5DP2A 5J2UB 3QELB 3O4JA 1A95A 3FCUB 1L1RA 3A9VA 2UKDA 1T3GA 2O14A 3AC0A 4HAOA 4HQKA 1QC5B 1UEXC 4IDDA 1L5YA 2ORVA 3B6MA 4PYQA 3CG0A 4NDNE 4TUYB 2LPMA 1NLMA 4DG5A 4PFSA 1QYRA 5TQ2A 2ECOA 1IN5A 1Y6RA 2JFPA 3C3KA 3OQVA 2QW8A 4X3CA 3QEOA 2QZSA 3W6UA 2GM5A 3EXAA 4QVGA 3JU3A 2MYUA 1SG6A 2FRDA 5KVQA 1KTIA 4GM1A 1FFWA 1VHJA 2Z9CA 4JU8A 1GU1A 4UMEA 4A6DA 2PMCA 4QJIA 1E1LA 3CN7A 2H1VA 2A4KA 1DC3A 1ESCA 3KFXA 3L7JA 3FOBA 3FR7A 4F06A 3FPBA 4GDFA 4M0EA 5I7UA 4QRHA 2FN3A 3LLMA 2JI7A 3HDHA 2Z9BA 2AFIB 3FUWA 5AH0A 2LCIA 1DWPA 4BX8A 3M5WA 3ME5A 1I94B 2PGNA 4MYUA 3E70C 2DUJA 4QDOA 1P0QA 4KODA 3GRYA 3S1LA 3TLKA 3CKKA 4FSXA 5ERXA 1E2EA 2ANCA 2Y1GA 5JS8A 1KWKA 3RT7A 1ND6A 4Q9NA 1ZH6A 5CTJA 1JGTA 2ZAOA 3BGDA 4FMDB 4BMYA 3U81A 1YQQA 5FOQA 1BKSB 4KR2A 1KF0A 3PSAA 4EVIA 2BZGA 5BSWA 1F6WA 1IU9A 2D3WA 2V59A 3DVRX 3H5NA 3ODGA 4WXYB 3IPXA 3MGGA 3VPFA 2LP4Y 2C94A 2RSLA 2I2CA 3FCAA 4P8RA 4FXOA 4NCNA 2OHXA 4TVOA 4ESHA 5KKCA 1I8TA 1OR8A 1CZUA 1PZEA 2AOTA 3E3LA 1NYQA 3QH4A 3DOJA 4UVGA 5ARBA 4UREA 2IYPA 4EW2A 1QGZA 1K6EA 2VDWA 4JLWA 2IT1A 3M81A 5KHAA 4A92A 3TGWA 3U7EB 3T1YB 1SHLA 1Y7LA 3E8MA 3LUBA 1I9CA 2VT2A 2CUNA 1LTKA 2GESA 3C7KA 1Q7GA 2X5KO 5KQSA 4N8EA 4OD0A 1NKTA 2JJ2D 3RM3A 3MSXA 4YJGA 4XYBA 3ROMA 2IZOA 2HR1A 3U3DA 4BMVA 2IY7A 4IJUA 3CX4A 4Z4FA 1QR6A 3NYWA 1OAOC 3ONEA 4KDCA 5AKYA 4TTIA 4KR6A 4C7BA 1C3LA 2IOFK 1RRPA 1HE2A 2LGJA 2WWWA 3CZAA 3G2NA 4DIEA 5J4LA 2HPVA 2PKRA 3B8EA 2O4CA 4HEJA 2YUIA 1AF7A 2GN8A 2B35A 3S44A 4D4MA 5LQRA 1CW2B 5KYYB 3W5CA 2FEOA 1YHNA 2J6CA 2AUMA 2ZOSA 4MVJH 2GEDA 3BHIA 4R9VA 1CR4A 2VL7A 2YHAA 1RP7A 3IUQA 4LXIA 3DEYX 2WWGA 1QDLB 3VM6A 2QTGA 3HS3A 4HBGA 1HYQA 1N2CA 1Z68A 3AL2A 3JYOA 4OY3A 4DQKA 3H4MA 3LQYA 4J0KA 4YUYA 3W5BA 1VDZA 3C6ZA 2PX2A 2HT1A 2ISSD 2VK8A 1L2TA 3GT7A 4PAWA 3B12A 3W7VA 5BYAA 1R8QA 1YONA 2BM9A 4CDNA 3TG8A 2ATXA 1E89A 5TJHA 1COWA 3D8RA 4G37A 4AY3A 2QUIA 4NATA 1UXIA 2VA8A 1GARA 2ZRDA 3MJEA 2ZRJA 1PJTA 3NM4A 1F6DA 1IWPB 1JQAA 3PNOA 3QA3E 4J9UE 5GJWC 1S3GA 4HYTA 1TJYA 5DTRA 5JSHA 1R0KA 1O94A 4JR1A 2ECQA 1I6WA 3Q72A 5FULA 1XE3A 3U0VA 3ETLA 2EP7A 4UEWA 3ZZUA 2VA9A 1HURA 1Z22A 2WJYA 2Y68A 1GUFA 1HPLA 4GL4A 1NTOA 3EZXA 3OIGA 2R7KA 3WZLA 1BH6A 3KV1A 3RFUA 1LJLA 3GEPA 3OLXA 2QBYA 3T5AA 4XCXA 1SVLA 2NXJA 4G0PA 3BTSA 4FSDA 4MR8B 7MHTA 2BFNA 3UANA 3T3MB 2VUTA 2HREA 2W6OA 4MLPA 1V48A 4Q3EA 3G0BA 2GYUA 4QAJA 5B4UA 1C8BA 1LWOA 2IY9A 3CZ4A 1H4SA 3D02A 3PEWA 3DV2A 5CA0A 4BRSA 1QHIA 2Q4EA 3LHSA 4JCOA 3ZGNA 1SXPA 3I05A 3MJDA 5D6NA 5KX5A 1A9TA 4TTAA 1RHKA 4PPYA 3RS4A 1X92A 1X38A 2UAGA 3R5JA 2VPQA 3OT4A 4H7HA 4NMXB 5IBQA 4J6FA 4ZARA 3S2IA 2RHDA 4A1OA 2DFLA 1NLYA 3EQ6A 4DV4B 4FR0A 1VPTA 1RHMA 2JZNA 4L72A 2I6QA 4JB2A 4DG8A 2XUQA 1GGEA 2H9AA 4FN5A 4IHJB 1G0OA 1CVLA 3BMCA 3SXPA 1NQXA 1V39A 2WF9A 3O73A 4NCKA 2CSXA 1YV9A 1CQJA 3IMCA 3TOSA 2P9QA 2XAAA 3GMIA 2CE2X 2PUHA 3BH0A 4GH5A 3TE7A 1QNFA 3OCXA 4CBVA 1EB8A 1BX3A 4UTZA 4BO8A 5JXJA 4B4OA 4DLZA 2D00A 1IJEA 1M2OB 3I53A 4FW8A 5BUZA 1N34B 1LX7A 4B85A 3O2QB 2Z2XA 2GJAA 2EIXA 4N18A 2PZBA 3EZ6A 4IV8A 4WL0A 1DWQA 1NF2A 3AR3A 3PGKA 4KREA 4D45A 1A27A 1XKLA 2HMYB 5CT5A 4KMSA 1T29A 4FMDF 3N39C 1BA2A 1KOLA 2HPHA 1ISRA 1W85B 2NM0A 1WRBA 3DMPA 3KZXA 3R3UA 1W59A 1BG6A 1P5JA 2ZYAA 1U8XX 3C4QA 4YA6A 4QTTB 3RIEA 3NMUF 4JLKA 4A0QA 5CRIA 3ZIAD 3G2JA 2W37A 4G07A 1U1CA 1HDZA 2OBXA 4KRXA 4QYMA 3WYGA 2WU3A 4NOJA 2AFHA 3CRMA 3I04M 4GI5A 5FADA 3CINA 4O4LF 4F7DA 3HZRA 4IOKA 4ME6A 2ZR7A 3C3AA 4ER0A 2JLYA 3VR0A 3BK2A 3EXEA 1JSXA 1BD4A 2QA5A 1SC3A 4ZV4A 5LDHA 3RVNA 2XB4A 1RYEA 1PS8A 2PWPA 2R6GA 1NHGA 2ZJ1A 2ZSAA 3W5UA 3AFJA 1E4YA 3BQ9A 1RRCA 5CFRA 1LSUA 2RHRA 3GLUA 4DJDC 5IZCA 2UVDA 3EFOB 1K7CA 1Q1BA 4QEKA 2TSYB 4AMZA 2I15A 4D9CA 3W34A 1Q0PA 3R3YA 4QASA 1CY1A 2ZBRA 3GBVA 3U4IA 2NPIA 2ZSIA 4TKVB 3VAZA 2V6IA 3VJMA 1EFCA 3EQ9A 2E7ZA 3D3JA 2WJ6A 2CLSA 2XYQA 3U31A 3QSGA 3CW8X 3SFVA 1T2UA 3MAAC 4YUVA 4DPKA 5TGTA 3ZDCA 1RWQA 3GDHA 3C87A 4FMCF 4JUAA 4K8RB 2VHQA 3VC7A 2PRIA 5CDFE 3DZHA 4YJHA 1DSSG 1GJRA 3KR2A 5F78A 4AKEA 4KU4A 1ZJJA 4FFNA 3I6IA 4LHWA 4ZVSA 2FXVA 2D6FA 4PFQA 1Q44A 3VJRA 5ALYA 3BE4A 3BREA 5AUNB 1IVSA 1ZD4A 2AI2A 4MCJA 4XM0A 5FNVB 3G2IA 2B1IA 5KTPA 2B2NA 2VPYA 3OOSA 2YFYA 1GZ7A 1W7AA 2C1XA 1LQ2A 2JNWA 2XGSA 3VKWA 4X85A 3D8SA 1NPDA 4P80A 5KDLA 1E1CA 3C7CB 2QTFA 3BH7A 3GF4A 3GQBB 4IUYA 4MV9A 4E4YA 5BQXA 3ECSA 4FZ5A 4HK4A 4MXDA 5TMDA 2ATCA 3FA2A 1T0IA 3V1KA 2F43A 2MR6A 4EPWA 3BMCB 1A9QA 1NV9A 1WQ4A 3KLBA 4U7JA 2C84A 4YNBA 4V1CA 5A6SA 2JS7A 4QRIA 3PX2A 3P9IA 1E2HA 1II0A 1YB4A 3CWCA 4D9GA 3QQPA 3QEBZ 2OT3B 5ALFA 4ZCMA 3SIXA 3KEMA 3OH8A 4BGEA 2NWQA 1ZO8A 2WKPA 3INYA 4ISBA 4U7TB 2PVCA 3UT6A 5K4HA 2UU9B 3UV3A 3G2HA 5DYGA 2PANA 1G38A 1EA5A 1E1KA 1TRKA 3KU1A 4X8MA 2OQIA 4YJ3B 4M3NA 3SQLA 4LF6B 1TADA 3FHJA 2I8AA 3M3PA 4KV7A 4PS0A 3E5NA 3SHWA 4D97A 4BNTA 3B85A 3NBUA 3LY7A 1JIKA 4L9WA 4M8SA 2WTBA 4ENTA 2EF1A 4DCGA 5A3RA 3I8OA 3S68A 1LLFA 4AQDA 2NNWB 4Y1GA 1E62A 2CYAA 1QMGA 4J1TC 4ND4A 3GZ4A 3H9GA 1Z6AA 2Y0EA 5DGTA 3OY7A 1F17A 3GMSA 3GZTB 3OZSA 4EUSA 4ZAVA 3VNRA 4OM7A 4YV1A 2EFDB 5E6UA 1Y5LA 2JRCA 2P1DA 3OOYA 4BFZA 1QNLA 3FUTA 4BLOA 3DQQA 1OLXA 1WCWA 2CXRA 2FE1A 3ZXSA 1NHWA 3AQ4A 1UMKA 4X7BA 4ZCQA 4BV3A 2Y76A 1UJNA 3G23A 4BWGA 1QTIA 1TPYA 4ZU1X 2YQ4A 2PSJA 5IAKA 5AJXA 3EC7A 2NUTA 1RRFA 4IHJF 4Z86A 5I6DA 1D1TA 4ZHQB 3UBMA 1E1NA 3F67A 2XVXA 4FW9A 1W87A 3FPCA 4AWXA 1W581 5JS6A 1QS0A 2ZIUB 1RXWA 3WB1A 5EHIA 3WBKA 4RVNA 5JSKA 1XVIA 3BOSA 4U1RA 1JAYA 5ECDA 3THSA 3KQUA 1GQ2A 1V6CA 3EXG2 3AHFA 4MQBA 3RKRA 4I55A 1HDRA 4IVPA 2HIAA 2Y27A 4XD7A 4WESB 5KYVA 3BAZA 3E22B 1JIXA 2I4RA 5ELXA 1NXSA 2EL7A 2FOIA 2BEKA 4XVHA 3OZBA 2XYPA 3AF3A 4OXQA 1E2IA 3ROEA 2HLDD 4INZA 4B9EA 5B2EA 4O4IB 4MA5A 4X8OA 5F12A 2X7XA 1UBRS 3IHLA 4D4JA 5A3VA 8AT1A 2UZ1B 1NBMD 5I9SA 3VZSA 5LA6A 3A06A 4NQZA 3BXEA 4EMSA 1U7WA 1W48A 2C5AA 2HDOA 2ZI6A 3ZHQA 3H5TA 1L5ZA 2C2GA 2CD9A 4NNPA 1L6IA 4Z1MA 2BFCB 3RRFA 1D6JA 1EHYA 4CKEA 1GTG1 3AT1A 4IX1A 3SYLA 2EJCA 2QL5A 4B5LA 1LNQA 3EVBA 4PBTA 4C2AA 3LAWA 1W30A 4JHXA 2WTEA 3QPVA 3TOCA 2XB8A 1J2YA 4IGAA 2CNKA 2JASA 4LZAA 1X9GA 3MT9A 2JIRA 4WN9B 3L0YA 1FSGA 1G64A 2O4UX 3P9KA 3CW2A 4BUCA 5M5BA 3ICQB 2R1TB 4B8ZA 3KKNA 5B4TA 2O7RA 1P80A 1QM5A 2P90A 1L5LA 3WYEA 4BX9A 3A9UA 1XSEA 4DCUA 5IC5A 2V55B 3DLAA 4H4DA 1R16A 4IIJF 1CR0A 3I9NA 5A9SB 5K3DA 1EIZA 1UAYA 1GKYA 3N2GA 3PRYA 4DQVA 5C7OO 1GKLA 4YRQA 3QFCA 2FSVC 3K9GA 2J7KA 3VSBA 4WECA 1G8KA 5CA0F 2FH5B 2BHNA 2ZPUA 3FHOA 1SU8A 3ANYB 4HDNA 1U81A 2H4ZA 1OPRA 4TWIA 1RIIA 2DERA 1ZEMA 2OCXA 1KI6B 2PD3A 2H4YA 4CIWA 4HNUA 4ZOBA 3UKJA 4C22A 4E32A 4YECA 3FDXA 3JQBA 1J0CA 2XTJA 3FD8A 4IHKA 4F96A 4F4CA 3GEHA 3BFVA 4DM3A 4P0QB 2XIQA 1JHPA 5IJ0B 3HDQA 3KC2A 5E1MA 3E1SA 1TIPA 2BR4A 3OM8A 2M2IA 5T4HA 1J49A 5GM2A 5EMLA 4NEHB 1Z0IA 4MLZA 4KPEC 5CNMA 3GRUA 4AKSA 1BQ3A 1DBSA 1QRRA 3GOQA 1A76A 3GP8A 2PXCA 1QZZA 1Z4NA 4AKIA 4PQYA 3VH2A 4Y98A 3W5VA 1CZHA 1ZNXA 5CM2Z 3QFHA 4Z7QB 1AMNA 4L27A 1Z15A 4W9NC 5DN9A 3G5MA 4NBVA 4ZI5A 1KI7A 3GDWA 3LZ6A 5FTLA 1FB5A 2XRYA 4JC4A 1U0FA 1JHAA 2JKVA 2Q41A 1W8DA 1GPWB 3NNDA 4BKUA 1FY2A 2PZGA 3I3OA 3KJEA 5HIIA 2EFGA 2AOVA 3IMFA 4CQMB 2Z8ZA 3ZDYB 2O19A 2DHRA 2BFEB 4HDCA 4TRNA 5K99A 4OFZA 3CSUA 2VJMA 1VIDA 2YIVX 4R3NA 4DJEC 3LUHA 1F2TA 4UM7A 2BKEA 3RTCA 1PFVA 1E5XA 1XK6A 4Y6RA 3MAJA 3THXB 2R2AA 4BQEA 1II8A 4HAUA 1WZEA 4AN4A 3B20A 2XYRA 5C5IA 5L4NA 4LNAA 2JGKA 1BWQA 4CQMD 4NHOA 3RLIA 5CFOA 1BHQ1 1K8RA 1KJZA 1M2FA 4N3GA 3TRFA 2XADA 1DRWA 1NPTO 1PAUA 1SQGA 2XNCA 4HLCA 3FNIA 4H08A 1AT1A 1NZDA 4PANA 5IT0A 1UKEA 3VGJA 3GXOA 2IHUA 3GB9A 2D2FA 2QWXA 1B1CA 5K0SA 3JRNA 3QEMA 2PYIA 2ODQA 5JECA 1XDWA 3N6VA 1KS9A 4XWWA 1RC8A 4C4SA 4FOOA 1QK4A 1OT3A 3FB4A 1J0BA 1R4MA 4KGZA 3WDMA 3OG9A 2DFKB 4RSRA 3CLRD 3R0XA 4HTFA 4WOKA 3QPAA 3UWMA 1LBSA 2XY4A 5EWLA 3ZU4A 4H1WA 3KETA 2YZ2A 4NAVA 4I5GA 1O87A 4GE0A 4HNHA 5AQ1A 3DLHA 2O2GA 5AKKA 4LHEA 4AY4A 4EFMA 3JQQA 3NOOA 3FHTA 1BFUA 2AB0A 4Y1FA 3PQ3A 1ONPA 1FUKA 5BSRA 3SJAA 3BULA 5UKDA 1XQXA 1AKMA 1PD0A 4IFBA 1OI3A 4UZEA 3GT3A 3QE3A 3E23A 3K53A 4OQYA 3S99A 3WTBA 3X1ZA 2ESRA 1QBGA 3AFIA 3ZTYA 3VTAA 5FOUA 1QX4A 4TWBA 3KAJA 4PRZA 5ALTA 4GMXA 4IQ4A 2P0AA 3L82B 4EJMA 4MDEA 2R3SA 3N3BC 3QTBA 3VPAA 1YMQA 1QIFA 3EEYA 5CD9A 2Z95A 2A5JA 1VJ5A 2ADFA 4YT8A 5CEJA 2OR3A 1VG0B 3GFPA 1BSVA 4UPVA 5KOJB 5EP3A 1HH4A 1R9MA 2O0JA 1JLSA 1O0BA 4LYAA 1KMHA 4MUXA 3T7AA 1TM3E 4M46A 3V3TA 4D42A 5K6TA 5JT1A 2Y1WA 3KE8A 1NP7A 3O7MA 4NK4A 2Y4OA 4GFDA 4B1FA 1WPXA 2G1AA 4B2YA 1V7QA 2AI3A 1BVUA 2B6HA 4HDMA 5CH8A 4M6WA