2CBFA

The x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif, from bacillus megaterium, with the his-tag cleaved off
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
234
structure length
234
Chain Sequence
GSHMKLYIIGAGPGDPDLITVKGLKLLQQADVVLYADSLVSQDLIAKSKPGAEVLKTAGMHLEEMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAAEAELTIPDLTQTVILTRAEGRTPVPEFEKLTDLAKHKCTIALFLSSTLTKKVMKEFINAGWSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of a cobalamin biosynthetic enzyme, cobalt-precorrin-4 methyltransferase.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Methyltransferase
molecule keywords COBALT-PRECORRIN-4 TRANSMETHYLASE
total genus 62
structure length 234
sequence length 234
ec nomenclature ec 2.1.1.271: Cobalt-precorrin-4 methyltransferase.
pdb deposition date 1998-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2cbfA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2cbfA01
2EKAA 2ELEA 2EMRA 2EL2A 2EJZA 2PCAA 2E16A 2EN5A 4E16A 2PCKA 2ED3A 2DSIA 2E0NA 2DV7A 2DV3A 2HUXA 2DXXA 2ED5A 2HR8A 2E8SA 2E08A 3NDCA 2E4NA 2DSHA 2E8QA 3FFYA 2PCHA 1PJSA 2PCIA 2P6KA 2ZVCA 2E8HA 2P6IA 1VE2A 1WYZA 2BB3A 2PCMA 5HW4A 2DEKA 2OWFA 2E7RA 2OWGA 3I4TA 2EL3A 1VCEA 2EHLA 2P2XA 2OWUA 1V9AA 2EJKA 3NEIA 3KWPA 2EL0A 1S4DA 2DSGA 1PJTA 1VA0A 2E15A 2EH5A 2EGBA 2DXWA 2E4RA 2E17A 2DV5A 2EGSA 3FQ6A 1CBFA 2CBFA 2YBQA 2PB6A 2P5CA 2OWKA 2P6LA 2PCGA 2ZVBA 2OWVA 2E8RA 2ENIA 2ELDA 2EK7A 1WDEA 2PB5A 1WNGA 2QBUA 2P5FA 2HUVA 2E07A 1VHVA 2EH4A 2EK2A 2YBOA 2P9DA 3NUTA 2HUQA 3HH1A 2PB4A 2NPNA 2DV4A 2EK3A 1PJQA 2EL1A 2EH2A 3ND1A 2EGLA 2EHCA 2EMUA 2EJJA 2EK4A 2Z6RA 2EEQA 2HUTA 2P6DA 2E0KA 2DXVA
chains in the Genus database with same CATH superfamily
2EKAA 2ELEA 3DNFA 2EMRA 2EL2A 2EJZA 2PCAA 2E16A 3LMMA 2EN5A 3UWMA 4E16A 3URKA 2PCKA 4H4CA 2ED3A 3UV6A 3KE8A 2DSIA 4MUYA 4MUXA 4MV5A 3TIXB 2E0NA 2DV7A 3KEMA 2DV3A 2HUXA 2DXXA 2ED5A 2HR8A 4MV0A 2E8SA 2E08A 3NDCA 2E4NA 4EB3A 3KE9A 2DSHA 2E8QA 3FFYA 2PCHA 4H4DA 1PJSA 2PCIA 2P6KA 2ZVCA 2E8HA 2P6IA 4H4EA 3UV3A 1VE2A 3SZOA 1WYZA 2KYYA 2BB3A 3UTDA 2PCMA 5HW4A 2DEKA 2OWFA 2E7RA 2OWGA 3I4TA 3T0FA 2EL3A 1VCEA 2EHLA 2P2XA 2OWUA 1V9AA 2EJKA 3NEIA 3KWPA 3F7TA 2EL0A 1S4DA 2DSGA 1PJTA 1VA0A 2E15A 2EH5A 2EGBA 2DXWA 3SZUA 2E4RA 2E17A 2DV5A 2EGSA 3FQ6A 1CBFA 2CBFA 2YBQA 2PB6A 2P5CA 2OWKA 2P6LA 2PCGA 2ZVBA 4N7BA 2OWVA 2E8RA 2ENIA 2ELDA 3KELA 2EK7A 1WDEA 2PB5A 1WNGA 2QBUA 2P5FA 3ZGLA 2HUVA 2E07A 1VHVA 2EH4A 2EK2A 2YBOA 2P9DA 3NUTA 2HUQA 3HH1A 2PB4A 3UV7A 2NPNA 3UTCA 3KEFA 2DV4A 2EK3A 1PJQA 2EL1A 2EH2A 3ND1A 3SZLA 2EGLA 2EHCA 2EMUA 3ZGNA 2EJJA 2EK4A 2Z6RA 2EEQA 2HUTA 2P6DA 2E0KA 2DXVA 3T0GA
chains in the Genus database with same CATH topology
2EKAA 2ELEA 3DNFA 2EMRA 2EL2A 2EJZA 2PCAA 2E16A 3LMMA 2EN5A 3UWMA 4E16A 3URKA 2PCKA 4H4CA 2ED3A 3UV6A 3KE8A 2DSIA 4MUYA 4MUXA 4MV5A 3TIXB 2E0NA 2DV7A 3KEMA 2DV3A 2HUXA 2DXXA 2ED5A 2HR8A 4MV0A 2E8SA 2E08A 3NDCA 2E4NA 4EB3A 3KE9A 2DSHA 2E8QA 3FFYA 2PCHA 4H4DA 1PJSA 2PCIA 2P6KA 2ZVCA 2E8HA 2P6IA 4H4EA 3UV3A 1VE2A 3SZOA 1WYZA 2KYYA 2BB3A 3UTDA 2PCMA 5HW4A 2DEKA 2OWFA 2E7RA 2OWGA 3I4TA 3T0FA 2EL3A 1VCEA 2EHLA 2P2XA 2OWUA 1V9AA 2EJKA 3NEIA 3KWPA 3F7TA 2EL0A 1S4DA 2DSGA 1PJTA 1VA0A 2E15A 2EH5A 2EGBA 2DXWA 3SZUA 2E4RA 2E17A 2DV5A 2EGSA 3FQ6A 1CBFA 2CBFA 2YBQA 2PB6A 2P5CA 2OWKA 2P6LA 2PCGA 2ZVBA 4N7BA 2OWVA 2E8RA 2ENIA 2ELDA 3KELA 2EK7A 1WDEA 2PB5A 1WNGA 2QBUA 2P5FA 3ZGLA 2HUVA 2E07A 1VHVA 2EH4A 2EK2A 2YBOA 2P9DA 3NUTA 2HUQA 3HH1A 2PB4A 3UV7A 2NPNA 3UTCA 3KEFA 2DV4A 2EK3A 1PJQA 2EL1A 2EH2A 3ND1A 3SZLA 2EGLA 2EHCA 2EMUA 3ZGNA 2EJJA 2EK4A 2Z6RA 2EEQA 2HUTA 2P6DA 2E0KA 2DXVA 3T0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKA A;  2ELE A;  2EMR A;  2EL2 A;  2EJZ A;  2PCA A;  2E16 A;  2EN5 A;  4E16 A;  2PCK A;  2ED3 A;  2DSI A;  2E0N A;  2DV7 A;  2DV3 A;  2HUX A;  2DXX A;  2ED5 A;  2HR8 A;  2E8S A;  2E08 A;  3NDC A;  2E4N A;  2DSH A;  2E8Q A;  3FFY A;  2PCH A;  1PJS A;  2PCI A;  2P6K A;  2ZVC A;  2E8H A;  2P6I A;  1VE2 A;  1WYZ A;  2BB3 A;  2PCM A;  5HW4 A;  2DEK A;  2OWF A;  2E7R A;  2OWG A;  3I4T A;  2EL3 A;  1VCE A;  2EHL A;  2P2X A;  2OWU A;  1V9A A;  2EJK A;  3NEI A;  3KWP A;  2EL0 A;  1S4D A;  2DSG A;  1PJT A;  1VA0 A;  2E15 A;  2EH5 A;  2EGB A;  2DXW A;  2E4R A;  2E17 A;  2DV5 A;  2EGS A;  3FQ6 A;  1CBF A;  2CBF A;  2YBQ A;  2PB6 A;  2P5C A;  2OWK A;  2P6L A;  2PCG A;  2ZVB A;  2OWV A;  2E8R A;  2ENI A;  2ELD A;  2EK7 A;  1WDE A;  2PB5 A;  1WNG A;  2QBU A;  2P5F A;  2HUV A;  2E07 A;  1VHV A;  2EH4 A;  2EK2 A;  2YBO A;  2P9D A;  3NUT A;  2HUQ A;  3HH1 A;  2PB4 A;  2NPN A;  2DV4 A;  2EK3 A;  1PJQ A;  2EL1 A;  2EH2 A;  3ND1 A;  2EGL A;  2EHC A;  2EMU A;  2EJJ A;  2EK4 A;  2Z6R A;  2EEQ A;  2HUT A;  2P6D A;  2E0K A;  2DXV A; 
#chains in the Genus database with same CATH topology
 2EKA A;  2ELE A;  3DNF A;  2EMR A;  2EL2 A;  2EJZ A;  2PCA A;  2E16 A;  3LMM A;  2EN5 A;  3UWM A;  4E16 A;  3URK A;  2PCK A;  4H4C A;  2ED3 A;  3UV6 A;  3KE8 A;  2DSI A;  4MUY A;  4MUX A;  4MV5 A;  3TIX B;  2E0N A;  2DV7 A;  3KEM A;  2DV3 A;  2HUX A;  2DXX A;  2ED5 A;  2HR8 A;  4MV0 A;  2E8S A;  2E08 A;  3NDC A;  2E4N A;  4EB3 A;  3KE9 A;  2DSH A;  2E8Q A;  3FFY A;  2PCH A;  4H4D A;  1PJS A;  2PCI A;  2P6K A;  2ZVC A;  2E8H A;  2P6I A;  4H4E A;  3UV3 A;  1VE2 A;  3SZO A;  1WYZ A;  2KYY A;  2BB3 A;  3UTD A;  2PCM A;  5HW4 A;  2DEK A;  2OWF A;  2E7R A;  2OWG A;  3I4T A;  3T0F A;  2EL3 A;  1VCE A;  2EHL A;  2P2X A;  2OWU A;  1V9A A;  2EJK A;  3NEI A;  3KWP A;  3F7T A;  2EL0 A;  1S4D A;  2DSG A;  1PJT A;  1VA0 A;  2E15 A;  2EH5 A;  2EGB A;  2DXW A;  3SZU A;  2E4R A;  2E17 A;  2DV5 A;  2EGS A;  3FQ6 A;  1CBF A;  2CBF A;  2YBQ A;  2PB6 A;  2P5C A;  2OWK A;  2P6L A;  2PCG A;  2ZVB A;  4N7B A;  2OWV A;  2E8R A;  2ENI A;  2ELD A;  3KEL A;  2EK7 A;  1WDE A;  2PB5 A;  1WNG A;  2QBU A;  2P5F A;  3ZGL A;  2HUV A;  2E07 A;  1VHV A;  2EH4 A;  2EK2 A;  2YBO A;  2P9D A;  3NUT A;  2HUQ A;  3HH1 A;  2PB4 A;  3UV7 A;  2NPN A;  3UTC A;  3KEF A;  2DV4 A;  2EK3 A;  1PJQ A;  2EL1 A;  2EH2 A;  3ND1 A;  3SZL A;  2EGL A;  2EHC A;  2EMU A;  3ZGN A;  2EJJ A;  2EK4 A;  2Z6R A;  2EEQ A;  2HUT A;  2P6D A;  2E0K A;  2DXV A;  3T0G A; 
#chains in the Genus database with same CATH homology
 2EKA A;  2ELE A;  3DNF A;  2EMR A;  2EL2 A;  2EJZ A;  2PCA A;  2E16 A;  3LMM A;  2EN5 A;  3UWM A;  4E16 A;  3URK A;  2PCK A;  4H4C A;  2ED3 A;  3UV6 A;  3KE8 A;  2DSI A;  4MUY A;  4MUX A;  4MV5 A;  3TIX B;  2E0N A;  2DV7 A;  3KEM A;  2DV3 A;  2HUX A;  2DXX A;  2ED5 A;  2HR8 A;  4MV0 A;  2E8S A;  2E08 A;  3NDC A;  2E4N A;  4EB3 A;  3KE9 A;  2DSH A;  2E8Q A;  3FFY A;  2PCH A;  4H4D A;  1PJS A;  2PCI A;  2P6K A;  2ZVC A;  2E8H A;  2P6I A;  4H4E A;  3UV3 A;  1VE2 A;  3SZO A;  1WYZ A;  2KYY A;  2BB3 A;  3UTD A;  2PCM A;  5HW4 A;  2DEK A;  2OWF A;  2E7R A;  2OWG A;  3I4T A;  3T0F A;  2EL3 A;  1VCE A;  2EHL A;  2P2X A;  2OWU A;  1V9A A;  2EJK A;  3NEI A;  3KWP A;  3F7T A;  2EL0 A;  1S4D A;  2DSG A;  1PJT A;  1VA0 A;  2E15 A;  2EH5 A;  2EGB A;  2DXW A;  3SZU A;  2E4R A;  2E17 A;  2DV5 A;  2EGS A;  3FQ6 A;  1CBF A;  2CBF A;  2YBQ A;  2PB6 A;  2P5C A;  2OWK A;  2P6L A;  2PCG A;  2ZVB A;  4N7B A;  2OWV A;  2E8R A;  2ENI A;  2ELD A;  3KEL A;  2EK7 A;  1WDE A;  2PB5 A;  1WNG A;  2QBU A;  2P5F A;  3ZGL A;  2HUV A;  2E07 A;  1VHV A;  2EH4 A;  2EK2 A;  2YBO A;  2P9D A;  3NUT A;  2HUQ A;  3HH1 A;  2PB4 A;  3UV7 A;  2NPN A;  3UTC A;  3KEF A;  2DV4 A;  2EK3 A;  1PJQ A;  2EL1 A;  2EH2 A;  3ND1 A;  3SZL A;  2EGL A;  2EHC A;  2EMU A;  3ZGN A;  2EJJ A;  2EK4 A;  2Z6R A;  2EEQ A;  2HUT A;  2P6D A;  2E0K A;  2DXV A;  3T0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...