2CBRA

Cellular retinoic acid binding protein i in complex with a retinobenzoic acid (am80)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
b'PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CRABP-I)
publication title Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 36
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2cbrA00
3WJGA 3APXA 5FENA 1X8QA 2JN3A 1FELA 2QO4A 3U9PC 5B29A 1I4UA 1LICA 3WJCA 2HZQA 2CBRA 3FR4A 1LKEA 3EBWA 1DZKA 4Y0QA 1FDQA 4ALBA 1LNMA 5DPQA 2L68A 5EDCA 4N7CA 3ELXA 4Y0SA 4GRJA 2OVEA 3P6FA 4A1YA 1NP1A 1KXOA 4BVMA 4IMOA 4XMDA 2EU7X 4LKPA 2HLVA 3BU9A 4AZNA 3FR5A 4GE1A 4A1HA 3RSWA 1LF7A 4AZRA 1GX8A 5EDBA 1IKJA 4ZH6A 1CRBA 1KQWA 5HZQA 2FLJA 3JSQA 4D6BA 5HCDC 1OPAA 1QY2A 4PSQA 3WBGA 4LKTA 2X46A 4NNTA 1MX8A 2HNXA 3EMMA 1YP7A 2AT3X 3MBTA 3TGCA 1YWDA 4A8ZA 3L4RA 1ZNKA 5F6ZA 4ZCBA 3P6GA 5H9AA 3BS2A 4TQ2A 4RUNA 1AVGI 4UU3A 1DC9A 4LZVA 3BDRA 1O8VA 4YFQA 2XSTA 5BVSA 3VG3A 5AQ6A 1FENA 4AYHA 1KQXA 2WWPA 1BSOA 3FENA 3EBKA 4YGZA 4NNSA 5L8NA 2L5PA 1DZMA 1ALBA 4XMHA 2ACOA 2AT6X 5LKEA 1G74A 3NQ9A 1HQPA 5HZ5A 5L8IA 4CK4A 4I9RA 1L6MA 1U0XA 5LKFA 1LIFA 1X8NA 1BM5A 1YWBA 1CBSA 3HWGA 2OVDA 3NX2A 4I3DA 1S7DA 1ZNLA 4ORRA 3OJYC 1EQDA 1I06A 5EZ2A 3VG4A 4GNYA 1X8UA 3NPOA 1S44A 1TOWA 1D2UA 1GKAA 1MDCA 4IB8A 2AT8X 3B2KA 2HZRA 2FTBA 5DG4A 1JZUA 2FT9A 4GETA 4ZFXA 1ZRYA 1IW2A 4ZHFA 4NYRA 2FS7A 2W2AA 1EUOA 2RD7C 3AKMA 1B8EA 1HMTA 4XMGA 3ZUOA 1I05A 1KGLA 4ZH9A 2OZQA 2NP1A 2ACPX 2GJ5A 4HPCA 5HCEC 1MUPA 2LBVA 1JJXA 1A18A 3VG2A 1BEBA 2LB6A 4ORWA 3WJFA 1SY0A 2Q4NA 1OBPA 1YUPA 3NR3A 1SXUA 1R0UA 1VPRA 1NGLA 3FA6A 1QABE 4YFPA 1ZNGA 1GT4A 2RCQA 4M6SA 3VG7A 3WJEA 2GC9A 3I17A 2WSJA 3NADA 5HWZA 1VYGA 1ADLA 3D97A 1OEKA 1IIUA 3FW4A 4AZPA 1O1UA 4I9SA 2MO5A 1SXXA 4YDAA 2LFOA 3KQ0A 4OMXA 4YFRA 1E00A 1N0SA 4YBUA 3KFFA 4I3BA 1ACDA 4GKCA 2RCTA 1PMPA 5F58A 1JYDA 2A2UA 3JS1A 1QFVA 1Z24A 3BX7A 4O9SA 1EALA 3KFIA 2OFRX 1EW3A 2W2BA 4YBPA 3K3LA 4AW8A 1OPBA 1ICMA 4QAEA 3NX1A 3F9DA 2WUTA 3BX8A 5H8TA 1GX9A 1TXLA 4IB7A 4A60A 1RBPA 5EPQA 4TKBA 4GNWA 3I0AA 3G7XA 4ZHCA 4IAWA 3CBSA 1KT6A 2PY1A 1XKIA 1QWDA 2Q9SA 1ICNA 5FAZA 2AH7X 5KIDA 3FIQA 4OMWA 4ARHA 3STKA 3C78X 3Q6LA 2JU7A 1IFCA 4BQUA 4UU2A 2LKKA 5D47A 2Q2MA 1MVGA 2WR6A 1PEEA 1U18A 1DF3A 3HK1A 4NLIA 1KZWA 1BLRA 1A3YA 1B56A 1IFBA 2RA6A 1EXSA 1QQSA 1EIIA 2E4JA 2AT5X 4HPAA 1UREA 4WBKA 1EIOA 4XMEA 4MVLA 1GM6A 3FEPA 5C0NA 2QM9A 1S2PA 5CE4A 4BOEA 2OFMX 1YWCA 5HZ9A 3APWA 4IMNA 3O22A 4IB6A 2P8GA 4QZUA 1OEJA 3FLLA 1GXAA 4TKJA 1FE3A 5BVTA 4IB9A 2FWVA 3PH6A 5LJDA 3TZSA 4ORXA 3EYCA 4K19A 5JR8A 1OBUA 5IO6A 2O62A 5D45A 4ALOA 3EM0A 1T68X 3APUA 3B2JA 4OS8A 3P6CA 3B2HA 3S26A 4GH7A 1BBPA 1CBRA 3ZQ3A 3PP6A 3IA8A 4YGHA 2FR2A 1QFTA 3CQNA 2YG2A 1X89A 4TLJA 3HWDA 3PECA 3DTQA 2G7BA 1CBIA 3MVFA 4NP1A 1E02A 4QGXA 1B0OA 5HBSA 5KHPA 1KT5A 1SY3A 2NNQA 1G5WA 3WXQA 5EEDA 2MM3A 2R74A 2L67A 1LIDA 3BRNA 4HPBA 1PBOA 1P6PA 2AKQA 4ZHGA 3KZAA 3P6EA 2WEWA 1KT4A 5F6BA 1I04A 5HTEA 2HMBA 4Y0RA 1O1VA 1DV9A 5B27A 3GAQA 3KFHA 4HPDA 1H91A 2K62A 5LJGA 2G79A 2KTDA 3C76X 4OS0A 3SAOA 1ZNDA 5LJEA 3NP1A 4QYPA 5BVQA 4ODDA 3STMX 1GT3A 3UEXA 2X45A 3U0DA 1BSQA 3ZUIA 1LPJA 1OBQA 4D6AA 3D96A 2NNDA 4IBAA 3UEUA 5KICA 4DQ3A 5H9NA 1BRQA 1TVQA 4ORUA 2JU3A 2AMMX 2FRSA 1JBHA 4ZR2A 5F1EA 2MJIA 2CZTA 4LZUA 2A13A 2NNEA 1YIVA 2IFBA 4WFUA 3FA7A 2BLGA 2W2FA 5HTDA 2CZUA 3BLGA 4M7MA 1CBQA 4AZOA 3FELA 3HWFA 2QOSC 1SY2A 2A2GA 1XCAA 1AQBA 4NYQA 3APVA 1EPBA 3F8AA 1YP6A 3FA8A 3BU1A 2ANSA 1A2DA 4EDEA 2F73A 1FTPA 5LJBA 4RUUA 3RZYA 1TW4A 4AZQA 1HBPA 2WQAE 3PEDA 3IFBA 3PPTA 5LJKA 3BY0A 3C77X 3P6HA 5HA0A 3VG5A 1A57A 1MX7A 4XMFA 4DQ4A 2Q39A 2DM5A 1BRPA 1DFVA 4ZHHA 1HBQA 5IO5A 2A0AA 1G85A 1X8PA 2CBSA 1E5PA 3CQRA 4YDBA 1SY1A 3WJBA 1SA8A 1IKEA 2K23A 1GGLA 2R56A 1AB0A 3FW5A 1UZ2X 3TGAA 2RQ0A 3UEVA 1SXWA 2FR3A 4ZHDA 1PM1X 3TF6A 1CJ5A 1HMSA 4OS3A 5L8OA 1YWAA 3O2YA 1JV4A 3B2IA 2ALLX 3HWEA 1B4MA 5D4AA 2QO6A 1BWYA 2JU8A 3FEKA 3FR2A 1VYFA 4YGGA 1RLBE 4TJZA 1NP4A 1ERBA 3FA9A 4XMCA 4EEJA 1SXYA 1KOIA 1G7NA 2AT0X 1LIEA 2WEXA 4ZGUA 3CR6A 1LIBA 5F7GA 5LJHA 1AELA 1JJJA 5HAEA 1T8VA 3BSZE 1KT3A 3UEWA 1X8OA 3U03A 1QY0A 1D3SA 4EFGA 4R0BA 4QGVA 5H9KA 4YCHA 3PH5A 4QZTA 3WVMA 5K06A 5HZ8A 1HMRA 1HN2A 2AL0X 2KT4B 4MVIA 4N7DA 2R73A 5H9LA 4YH0A 4QYNA 4EXZA 4YKMA 4KIIA 4AZMA 2POAA 5HCCC 1E06A 2XKLA 3STNA 4IAXA 3KFGA 3TGBA 3QKGA 2CM9A 5HZ6A 1FEMA 1ZNEA 4Y0PA 1BSYA 1OEEA 3D95A 3CWKA 3B2LA 4QGWA 3DSZA 2ASNX 1GT1A 2QO5A 4YCEA 2A3FX 4WFVA 1X71A 1GKAB 1QY1A 1DZPA 4TNNA 3WJDA 4ORYA 5HA1A 3VG6A 2FS6A 3T1DA 1T0VA 2GTFX 1KZXA 2G78A 2OVAA 1DZJA 2WQ9A 5EEEA 2N93A 4ORSA 2Q2PA 5D8JA 3AKNA 3CMPA 5FFHA 1LFOA 3CBCA 1JYJA 2LBAA 2L9CA 4YKOA 4ES7A 5LJCA 3O19A 1EPAA 1GT5A 1TOUA 1ML7A 3ELZA 1BJ7A 1ZNHA 3NQ3A 2CM4A 4MVKA 2HYSA 5D48A 1U17A 1ERXA 1QG5A 4HFOA 2JOZA 4NLJA 3P6DA 4ZJ0A 4TKHA 5IO7A 4YMYA 1KT7A 4I3CA 3FMZA
chains in the Genus database with same CATH superfamily
2F01A 1SLGB 3WJGA 1SWSA 1JIWI 1Y9LA 2OFBA 1X8QA 2JN3A 3APXA 4Z2OA 1FELA 2QO4A 5FENA 3U9PC 5B29A 1SRJA 3RDXA 1I4UA 1LICA 3FYFA 3WJCA 2HZQA 2CBRA 3FR4A 1LKEA 3EBWA 5CYBA 3WJBA 1IJ8A 1SWCA 1DZKA 2DJFA 4Y0QA 4WHIA 1FDQA 4ALBA 1LNMA 2I5VO 3VHHA 5DPQA 2GTLN 2L68A 4FBOA 5EDCA 4IABA 3ELXA 4N7CA 1VWRB 5B10O 2C4IA 1AVEA 4Y0SA 5B5GA 4GRJA 4CPEA 2QOMA 2OVEA 3P6FA 4A1YA 1NP1A 1KXOA 2CAMA 4BVMA 5L3YA 4IMOA 4XMDA 2EU7X 3VGWA 2C1SA 4LKPA 2HLVA 3EW2A 3BU9A 4AZNA 3FR5A 4CDFA 4GE1A 4A1HA 1N9MA 2Z4IA 3RSWA 1LF7A 4AZRA 4CSBA 1GX8A 1MM9A 2Y3EA 3RBYA 1SWQA 5EDBA 2RTIB 2X8TA 1IKJA 4ZH6A 3RDQA 2VDFA 1CRBA 1KQWA 5HZQA 2FLJA 2QCBA 3JSQA 4D6BA 5HCDC 1OPAA 1QY2A 3SLJA 2M4LA 4PSQA 3WBGA 4LKTA 2X46A 4I95A 4O4OA 2OL6O 1MX8A 2HNXA 3EMMA 4NNTA 4NW4A 1YP7A 2AT3X 3MBTA 3ZI8A 1YWDA 1Y0GA 3L4RA 3UAQA 4A8ZA 3TGCA 3SZHA 1SWEA 1ZNKA 3S60A 5F6ZA 3T2XA 2BHVA 4ZCBA 5K67A 3NBXX 5FQ6E 3P6GA 1SWRA 4MISA 5H9AA 2G8CO 3BS2A 4TQ2A 4RUNA 1AVGI 3N91A 4UU3A 1DC9A 4LZVA 3BDRA 4KCAA 1O8VA 4U8UN 3LHNA 4YFQA 1STSB 3SLOA 4CDCA 2X4MA 2XSTA 5BVSA 1AVDA 2X56A 1SRHA 5FQ8E 3VG3A 5AQ6A 1FENA 4AYHA 2X32A 1KQXA 2WWPA 1BSOA 1SMPI 3FENA 4ZGFA 2RTJA 3EBKA 1SWAA 4YGZA 4NNSA 5L8NA 1HY2A 2A8GA 2IZDB 1SWTA 2L5PA 1DZMA 1ALBA 2G5LA 4XMHA 2RTGB 5IRUA 2ACOA 2AT6X 4BX6A 1G74A 5LKEA 3NQ9A 1HQPA 3V8UA 5L8IA 2LA7A 5HZ5A 3MG5A 4CK4A 4I9RA 1L6MA 2RTRB 1U0XA 1SWOA 5LKFA 4GDAA 1LIFA 1X8NA 1BM5A 1YWBA 1CBSA 3T2WA 3HWGA 2OVDA 3NX2A 4I3DA 4Y59A 1S7DA 1SREA 1ZNLA 3OJYC 4ORRA 1EQDA 1I06A 4MIRA 2YMSA 5EZ2A 3VG4A 4GNYA 1X8UA 3NPOA 3KVNA 3VPJE 1S44A 1SWDA 1VWGB 1VWPB 1TOWA 1D2UA 1GKAA 1KL4A 1MDCA 4IB8A 2AT8X 3ZW1B 2IZHB 3B2KA 2HZRA 3SLTA 1FJ1E 3WZPA 2FTBA 5DG4A 1JZUA 2FT9A 1SWNA 3OBLA 4GETA 1ZRYA 4GU8A 3ZW0B 2IZJA 4ZFXA 2OL8O 1IW2A 4IRWA 2JMBA 4NYRA 4ZHFA 4CPHB 2ZAGA 1VWHB 2AVIA 2FS7A 2W2AA 3CKFA 1VWBB 4CDEA 1EUOA 2RD7C 3AKMA 1B8EA 1VWCB 1HMTA 1WBIA 4XMGA 3ZUOA 1I05A 1KGLA 4ZH9A 2OZQA 3VHIA 3H3IA 2NP1A 1SRFA 2ACPX 2GJ5A 1NQNA 4GGTA 4HPCA 5HCEC 1MUPA 3HPEA 2LBVA 1NDJA 1JJXA 1A18A 3VG2A 1SWUA 2X8SA 4L1NA 2RTFB 2GTLO 3PQUA 3NQKA 1VWIB 1BEBA 4JGLA 2LB6A 3CKGA 4ORWA 3WJFA 4O3XB 1SY0A 2Q4NA 1E2TA 1OBPA 4U46A 4DNEA 1YUPA 3NR3A 2RTEB 1SXUA 1SWPA 2RTPB 1R0UA 1VPRA 1NGLA 3FA6A 1QABE 4YFPA 4GJSA 1VWKB 1GT4A 1ZNGA 1KL3A 2FHNX 2RCQA 4KH8A 4M6SA 3RDMA 3VG7A 3WJEA 5FQ7E 5AEOA 2GC9A 2OY1O 3I17A 2WSJA 2UYWA 1PBYA 3NADA 4PJ2A 5HWZA 2FKJA 1VYGA 4CPFA 1VYOA 1ADLA 4MVEA 2KW1A 3D97A 2RTKA 1OEKA 4EKVA 1IIUA 3FW4A 4AZPA 1O1UA 4I9SA 4Z2PA 1VWJB 2MO5A 1SXXA 2RTNB 3MM0A 4EQAC 1JQPA 2LFOA 3KQ0A 1RSUB 4KC8A 4YDAA 4OMXA 4YFRA 1SLDB 1E00A 1N0SA 3P02A 3KFFA 2OF9A 1GX3A 4I3BA 4YBUA 3X00A 1ACDA 2Y32A 2RCTA 4GKCA 1JJUA 1PMPA 2RTHB 1JMZA 3Q34A 1JYDA 2A2UA 2GTLM 3JS1A 5F58A 1HXZA 1QFVA 1Z24A 3BX7A 4O9SA 1EALA 3KFIA 2OFRX 1EW3A 2W2BA 4YBPA 3K3LA 4AW8A 1OPBA 1W5RA 1ICMA 1LCVA 4FGIB 4MEEA 4QAEA 3NX1A 3F9DA 5B5FA 2WUTA 3AEHA 4O3YA 3BX8A 3WYPA 5H8TA 1GX9A 1RSTB 1TXLA 4B55A 4IB7A 4A60A 2RN4A 1RBPA 5EPQA 4TKBA 4GNWA 3I0AA 1I78A 3G7XA 4ZHCA 5IRWA 4IAWA 3CBSA 1UYNX 1KT6A 2PY1A 1HQQA 1XKIA 1QWDA 2Q9SA 3EW1A 1ICNA 4OKAA 5FAZA 2AH7X 3ZW2A 5KIDA 1K3BA 3FIQA 3QQ2A 4OMWA 2KD2A 4ARHA 3JQOA 3SZIA 4Z2VA 2GH7A 5K68A 3SOTA 3STKA 3ZZVA 4BCSA 4O3ZA 3C78X 4QNIA 2MWHA 3Q6LA 2JU7A 1IFCA 3FDCA 5CHKA 4BQUA 4UU2A 2LKKA 5D47A 1MVGA 2Q2MA 2WR6A 1PEEA 1U18A 1DF3A 3HK1A 4NLIA 2ZAIA 1KZWA 1BLRA 1A3YA 4NV7A 1B56A 1IFBA 2RA6A 1EXSA 1QQSA 1EIIA 2OVSA 2E4JA 2AT5X 4HPAA 1UREA 1VWEB 4WBKA 1EIOA 4XMEA 4MVLA 1GM6A 3FEPA 5C0NA 2QM9A 1S2PA 5CE4A 4BOEA 2OFMX 1YWCA 2RTLA 1Y53X 2IZAA 5HZ9A 3APWA 4IMNA 3O22A 4IB6A 2P8GA 4QZUA 1OEJA 3FLLA 4BX7B 1GXAA 4BJ8A 4TKJA 3GE2A 1FE3A 2RTOB 5BVTA 4IB9A 3RKGA 1VWQB 2FWVA 3PH6A 5LJDA 3SZJA 3TZSA 1KFFA 4ORXA 3EYCA 4K19A 5JR8A 1NBXA 1OBUA 5IO6A 2O62A 2RTQB 5D45A 4ALOA 4FBRA 3EM0A 1T68X 5F2BA 3APUA 4D6AA 1PTSA 3B2JA 4FQBB 4CV7A 4OS8A 4GK9A 3P6CA 3B2HA 3S26A 1WUBA 4GH7A 1BBPA 1CBRA 3ZQ3A 4GUZA 1Y52X 3PP6A 3HTYA 3IA8A 4YGHA 2FR2A 1SLFB 2IZBA 1QFTA 3HOLA 4O4XA 3CQNA 2YG2A 1X89A 1SWBA 1KL5A 4TLJA 4JHQA 3ZW0A 3HWDA 3PECA 3E3CA 3DTQA 1SWFA 2G7BA 1CBIA 3MVFA 4NP1A 1E02A 4QGXA 1B0OA 3PK2A 5HBSA 4BX5B 5KHPA 1KT5A 1SY3A 2NNQA 2OY5O 4C5PA 1G5WA 1Y9TA 4ON1A 3WXQA 5EEDA 2MM3A 2R74A 2L67A 1LIDA 3BRNA 4HPBA 1PBOA 4O3WA 3WZNA 4CDDA 1P6PA 2AKQA 1EI5A 4ZHGA 3KZAA 3P6EA 2VFBA 2WEWA 1KT4A 2Y3FA 5F6BA 1I04A 1LDQA 5HTEA 2HMBA 1I9HA 4Y0RA 1O1VA 1UYOX 3T6FA 1DV9A 2PI3O 3GAQA 5B27A 2DJGA 2OFAA 2OYBO 2C1QA 3KFHA 4HPDA 1RXHA 1H91A 2K62A 3D9WA 1VWOB 2G79A 2KTDA 3C76X 4OS0A 5LJGA 3SAOA 1ZNDA 4NV8A 4U9CA 4FBVA 3NP1A 4QYPA 5LJEA 5BVQA 1W6FA 4ODDA 3STMX 1GT3A 2F09A 3UEXA 1MOYA 2X45A 3U0DA 1BSQA 3ZUIA 1LPJA 1OBQA 1N4JA 2WPUA 3D96A 2NNDA 4I60A 4IBAA 3OD9A 4U3QA 3UEUA 4DQ3A 5KICA 2X55A 2VFCA 5H9NA 1BRQA 1TVQA 4ORUA 2JU3A 2RTMA 5JD2A 2AMMX 2FRSA 2JGSA 5B11O 1JBHA 4ZR2A 4KC7A 5F1EA 1N43A 2CZTA 2MJIA 1N9YA 2A13A 4LZUA 2FHLA 2NNEA 1YIVA 2IFBA 4LQZA 1MEPA 4WFUA 3WOVA 3FA7A 4HWMA 2BLGA 2W2FA 3EC5A 2IZKA 1LUQA 5HTDA 1VWFB 2CZUA 3BLGA 4ID2A 3VE2A 4M7MA 1CBQA 4AZOA 2RTAA 3FELA 3HWFA 2RTBB 1SY2A 2QOSC 2A2GA 1XCAA 2FKGA 1AQBA 4NYQA 3APVA 1EPBA 3F8AA 1YP6A 3FA8A 3BU1A 4OELA 3WYQA 2ANSA 3WZOA 1A2DA 4U8UO 2IZGB 1LELA 4EDEA 2F73A 1FTPA 5LJBA 4RUUA 3RZYA 1STPA 1TW4A 3VE1A 1HBPA 1VWDB 3LV4A 4AZQA 4COTA 2WQAE 3PEDA 4Z27A 3IFBA 3PPTA 5LJKA 3BY0A 3C77X 3P6HA 5HA0A 3VG5A 1A57A 1MX7A 4JO6A 4XMFA 2RTDB 2Q39A 2IZFB 2DM5A 4DQ4A 1BRPA 1DFVA 4O4SA 4QQ1A 4ZHHA 1HBQA 4GD9A 5IO5A 2A0AA 1G85A 1X8PA 1E5PA 2BS5A 2CBSA 3CQRA 1SY1A 2X8FA 1SA8A 1IKEA 2K23A 1GGLA 2R56A 1AB0A 3FW5A 1UZ2X 3LTWA 2RQ0A 3TGAA 2OL7A 1SXWA 3UEVA 2FR3A 4ZHDA 1PM1X 5CSEA 4O49A 1RXKA 3TF6A 1CJ5A 1HMSA 2A5BA 4OS3A 4QRLA 5L8OA 1YWAA 4JNJA 3O2YA 3D4RA 1JV4A 2KTSA 3B2IA 3HOEA 4GJVA 2ALLX 3HWEA 1B4MA 1SWLA 1JMXA 2QO6A 5D4AA 1BWYA 4BX7A 2JU8A 3RY2A 3FEKA 3FR2A 1NC9A 1VYFA 4YGGA 1RLBE 4TJZA 1HXLA 1NP4A 1SRGA 1ERBA 2OF8A 3FA9A 4XMCA 5IRAA 4EEJA 1SXYA 5IXGA 4U8UM 1KOIA 4O4UA 1LCWA 1G7NA 2AT0X 3MX7A 1LIEA 4I6SA 3F6ZB 2WEXA 4Z6JA 4ZGUA 3CR6A 1LIBA 5F7GA 2FGSA 5LJHA 3RE5A 1AELA 4BGFA 1K24A 1JJJA 5HAEA 2X34A 1T8VA 2BSZA 3BSZE 3S5VA 4CPIA 1KT3A 3UEWA 1X8OA 3U03A 4L3RA 1QY0A 1D3SA 4EFGA 2JW1A 2BS6A 2OY8A 4R0BA 4QGVA 2A5CA 5H9KA 1LCZA 4YCHA 3PH5A 4INNA 4QZTA 3WVMA 1Y55X 5K06A 2BC3A 3ZW1A 5B2AO 5AJBA 2IZIA 5HZ8A 4KT5A 5B3MO 1HMRA 1HN2A 2AL0X 2KT4B 2MF6A 4MVIA 4N7DA 2R73A 3PQSA 5H9LA 4YH0A 4QYNA 4GDZA 4EXZA 1SRIA 4YKMA 4KIIA 2I5ZO 4CPHA 4AZMA 2POAA 4BX6B 4BX5A 2OY7A 1NQMA 5HCCC 3VHMA 1E06A 2XKLA 3P24A 3STNA 4GGRA 4IAXA 4YVBA 3KFGA 4Y5DA 3T6LA 3TGBA 3QKGA 1VWMB 2CM9A 5HZ6A 1FEMA 1ZNEA 4Y0PA 4BBOA 1BSYA 4GZVA 1OEEA 1N7YA 3D95A 3CWKA 3B2LA 1SWJA 3DSZA 4QGWA 3RDSA 3WZQA 2ASNX 1GT1A 2QO5A 4YCEA 2A3FX 4WFVA 1X71A 1GKAB 1SWKA 1QY1A 1DZPA 4TNNA 5AJCA 3WJDA 4YDBA 4ORYA 5HA1A 3VG6A 2FS6A 3T1DA 1DF8A 4GGZA 1MK5A 1STRB 1T0VA 4ML7B 2MHDA 1VWLB 2GTFX 1KZXA 2G78A 2OVAA 1SWGA 3ZWEA 1DZJA 2WQ9A 5EEEA 4DCBA 2N93A 4ORSA 2Q2PA 5D8JA 3AKNA 2Z4HA 1LDOA 3RDOA 3CMPA 3FIDA 2RTCB 5FFHA 1LFOA 1SLEB 2IZLB 1JYJA 2LBAA 3CBCA 4OEMA 2L9CA 4YKOA 3RWXA 4ES7A 4Z28A 5LJCA 3O19A 1EPAA 1GT5A 5BYPA 2AF5A 2BT9A 3RE6A 2HKDA 3OE3A 1TOUA 2IZCB 1ML7A 3S5XA 2QMIA 3ELZA 1BJ7A 1RAVA 1ZNHA 3NQ3A 2CM4A 1OSPO 2ZSCA 4MVKA 2HYSA 5D48A 1VWNB 1W4TA 1U17A 3RDUA 1ERXA 1QG5A 1RXJA 2IZEB 2UZ2A 3PDFA 1VWAB 4HFOA 3RY1A 3AUMO 2JOZA 4NLJA 3P6DA 3VU1A 1SWHA 4ZJ0A 4TKHA 5IO7A 4YMYA 1KT7A 4I3CA 3FMZA
chains in the Genus database with same CATH topology
3WJGA 3APXA 1JIWI 1Y9LA 5FENA 1X8QA 2JN3A 1FELA 2QO4A 3U9PC 5B29A 1I4UA 1LICA 3FYFA 3WJCA 2HZQA 2CBRA 3FR4A 1LKEA 3EBWA 5CYBA 3WJBA 1DZKA 4Y0QA 4WHIA 1FDQA 4ALBA 1LNMA 5DPQA 2GTLN 2L68A 4FBOA 5EDCA 4IABA 3ELXA 4N7CA 4Y0SA 4GRJA 2OVEA 3P6FA 4A1YA 1NP1A 1KXOA 4BVMA 4IMOA 4XMDA 2EU7X 4LKPA 2HLVA 3BU9A 4AZNA 3FR5A 4GE1A 4A1HA 2Z4IA 3RSWA 1LF7A 4AZRA 4CSBA 1GX8A 3RBYA 5EDBA 2X8TA 1IKJA 4ZH6A 1CRBA 1KQWA 5HZQA 2FLJA 3JSQA 4D6BA 5HCDC 1OPAA 1QY2A 2M4LA 4PSQA 3WBGA 4LKTA 2X46A 4I95A 4O4OA 4NNTA 1MX8A 2HNXA 3EMMA 4NW4A 1YP7A 2AT3X 3MBTA 3ZI8A 1YWDA 4A8ZA 3L4RA 3UAQA 3TGCA 1ZNKA 3S60A 5F6ZA 2BHVA 4ZCBA 3NBXX 5FQ6E 3P6GA 4MISA 5H9AA 3BS2A 4TQ2A 4RUNA 1AVGI 3N91A 4UU3A 1DC9A 4LZVA 3BDRA 4KCAA 1O8VA 4U8UN 3LHNA 4YFQA 2XSTA 5BVSA 3VG3A 5FQ8E 5AQ6A 1FENA 4AYHA 1KQXA 2WWPA 1BSOA 1SMPI 3FENA 4ZGFA 3EBKA 4YGZA 4NNSA 5L8NA 2L5PA 1DZMA 1ALBA 4XMHA 2ACOA 2AT6X 5LKEA 1G74A 3NQ9A 1HQPA 3V8UA 5L8IA 2LA7A 5HZ5A 4CK4A 4I9RA 1L6MA 1U0XA 5LKFA 1LIFA 1X8NA 1BM5A 1YWBA 1CBSA 3HWGA 2OVDA 3NX2A 4I3DA 1S7DA 1ZNLA 4ORRA 3OJYC 1EQDA 1I06A 4MIRA 2YMSA 5EZ2A 3VG4A 4GNYA 1X8UA 3NPOA 3VPJE 1S44A 1TOWA 3ZW1B 1D2UA 1GKAA 1MDCA 4IB8A 2AT8X 3B2KA 2HZRA 2FTBA 5DG4A 1JZUA 2FT9A 3OBLA 4GETA 4GU8A 1ZRYA 3ZW0B 4ZFXA 1IW2A 2JMBA 4NYRA 4ZHFA 2ZAGA 2FS7A 2W2AA 1EUOA 2RD7C 3AKMA 1B8EA 1HMTA 4XMGA 3ZUOA 1I05A 1KGLA 4ZH9A 2OZQA 3H3IA 2NP1A 2ACPX 2GJ5A 4HPCA 5HCEC 1MUPA 2LBVA 1JJXA 1A18A 3VG2A 2X8SA 4L1NA 2GTLO 3PQUA 3NQKA 1BEBA 4JGLA 2LB6A 4ORWA 3WJFA 4O3XB 1SY0A 2Q4NA 1OBPA 1YUPA 3NR3A 1SXUA 1R0UA 1VPRA 1NGLA 3FA6A 1QABE 4YFPA 1ZNGA 1GT4A 2RCQA 4KH8A 4M6SA 3VG7A 5AEOA 3WJEA 5FQ7E 2GC9A 3I17A 2WSJA 3NADA 4PJ2A 5HWZA 1VYGA 1ADLA 4MVEA 2KW1A 3D97A 1OEKA 1IIUA 3FW4A 4AZPA 1O1UA 4I9SA 2MO5A 1SXXA 4EQAC 4YDAA 2LFOA 3KQ0A 4KC8A 4OMXA 4YFRA 3P02A 1E00A 1N0SA 4YBUA 3KFFA 4I3BA 1ACDA 4GKCA 2RCTA 1PMPA 5F58A 1JYDA 2A2UA 2GTLM 3JS1A 1QFVA 1Z24A 3BX7A 4O9SA 1EALA 3KFIA 2OFRX 1EW3A 2W2BA 4YBPA 3K3LA 4AW8A 1OPBA 1ICMA 4FGIB 4QAEA 3NX1A 3F9DA 2WUTA 4O3YA 3BX8A 5H8TA 1GX9A 1TXLA 4IB7A 4A60A 2RN4A 1RBPA 5EPQA 4TKBA 4GNWA 3I0AA 3G7XA 4ZHCA 4IAWA 3CBSA 1KT6A 2PY1A 1XKIA 1QWDA 2Q9SA 1ICNA 5FAZA 2AH7X 3ZW2A 5KIDA 3FIQA 4OMWA 4ARHA 2KD2A 3JQOA 3SOTA 3STKA 3ZZVA 4O3ZA 3C78X 4QNIA 2MWHA 3Q6LA 2JU7A 1IFCA 4BQUA 4UU2A 2LKKA 5D47A 1MVGA 2Q2MA 2WR6A 1PEEA 1U18A 1DF3A 3HK1A 4NLIA 2ZAIA 1KZWA 1BLRA 1A3YA 1B56A 1IFBA 2RA6A 1EXSA 1QQSA 1EIIA 2OVSA 2E4JA 2AT5X 4HPAA 1UREA 4WBKA 1EIOA 4XMEA 4MVLA 1GM6A 3FEPA 5C0NA 2QM9A 1S2PA 5CE4A 4BOEA 2OFMX 1YWCA 5HZ9A 3APWA 4IMNA 3O22A 4IB6A 2P8GA 4QZUA 1OEJA 3FLLA 1GXAA 4TKJA 3GE2A 1FE3A 5BVTA 4IB9A 3RKGA 2FWVA 3PH6A 5LJDA 3TZSA 4ORXA 3EYCA 4K19A 5JR8A 1OBUA 5IO6A 2O62A 5D45A 4ALOA 3EM0A 1T68X 3APUA 3B2JA 4FQBB 4CV7A 4OS8A 4GK9A 3P6CA 3B2HA 3S26A 4GH7A 1BBPA 1CBRA 3ZQ3A 3PP6A 3HTYA 3IA8A 4YGHA 2FR2A 1QFTA 3HOLA 4O4XA 3CQNA 2YG2A 1X89A 4TLJA 3ZW0A 3HWDA 3PECA 3E3CA 3DTQA 2G7BA 1CBIA 3MVFA 4NP1A 1E02A 4QGXA 1B0OA 5HBSA 5KHPA 1KT5A 1SY3A 2NNQA 1G5WA 1Y9TA 4ON1A 3WXQA 5EEDA 2MM3A 2R74A 2L67A 1LIDA 3BRNA 4HPBA 1PBOA 4O3WA 4FBRA 1P6PA 2AKQA 1EI5A 4ZHGA 3KZAA 3P6EA 2WEWA 1KT4A 5F6BA 1I04A 5HTEA 2HMBA 4Y0RA 1O1VA 1DV9A 5B27A 3GAQA 3KFHA 4HPDA 1H91A 2K62A 5LJGA 2G79A 2KTDA 3C76X 4OS0A 3SAOA 1ZNDA 4U9CA 4FBVA 3NP1A 4QYPA 5LJEA 5BVQA 4ODDA 3STMX 1GT3A 2F09A 3UEXA 2X45A 3U0DA 1BSQA 3ZUIA 1LPJA 1OBQA 4D6AA 3D96A 2NNDA 4IBAA 4U3QA 3OD9A 3UEUA 5KICA 4DQ3A 5H9NA 1BRQA 1TVQA 4ORUA 2JU3A 2AMMX 2FRSA 1JBHA 4ZR2A 4KC7A 5F1EA 2MJIA 2CZTA 4LZUA 2A13A 2NNEA 1YIVA 2IFBA 4LQZA 4WFUA 3WOVA 3FA7A 4HWMA 2BLGA 2W2FA 5HTDA 2CZUA 3BLGA 4ID2A 3VE2A 4M7MA 1CBQA 4AZOA 3FELA 3HWFA 1SY2A 2QOSC 2A2GA 1XCAA 1AQBA 4NYQA 3APVA 1EPBA 3F8AA 1YP6A 3FA8A 3BU1A 2ANSA 1A2DA 4U8UO 4EDEA 2F73A 1FTPA 5LJBA 4RUUA 3RZYA 1TW4A 3VE1A 1HBPA 4AZQA 3LV4A 4COTA 2WQAE 3PEDA 3IFBA 3PPTA 5LJKA 3BY0A 3C77X 3P6HA 5HA0A 3VG5A 1A57A 1MX7A 4XMFA 4DQ4A 2Q39A 2DM5A 1BRPA 1DFVA 4O4SA 4QQ1A 4ZHHA 1HBQA 5IO5A 2A0AA 2BS5A 1G85A 2CBSA 1X8PA 1E5PA 3CQRA 1SY1A 2X8FA 1SA8A 1IKEA 2K23A 1GGLA 2R56A 1AB0A 3FW5A 1UZ2X 3TGAA 2RQ0A 3UEVA 1SXWA 2FR3A 4ZHDA 1PM1X 4O49A 3TF6A 1CJ5A 1HMSA 4OS3A 4QRLA 5L8OA 1YWAA 3O2YA 3D4RA 1JV4A 2KTSA 3B2IA 3HOEA 2ALLX 3HWEA 1B4MA 5D4AA 2QO6A 1BWYA 2JU8A 3FEKA 3FR2A 1VYFA 4YGGA 1RLBE 4TJZA 1NP4A 1ERBA 3FA9A 4XMCA 4EEJA 1SXYA 4U8UM 1KOIA 4O4UA 3MX7A 1G7NA 2AT0X 1LIEA 4I6SA 3F6ZB 2WEXA 4ZGUA 3CR6A 1LIBA 5F7GA 5LJHA 1AELA 1JJJA 5HAEA 1T8VA 3BSZE 3S5VA 1KT3A 3UEWA 1X8OA 3U03A 4L3RA 1QY0A 1D3SA 4EFGA 2JW1A 2BS6A 4R0BA 4QGVA 5H9KA 4YCHA 3PH5A 4INNA 4QZTA 3WVMA 5K06A 3ZW1A 5AJBA 5HZ8A 4KT5A 1HMRA 1HN2A 2AL0X 2KT4B 4MVIA 4N7DA 2R73A 3PQSA 5H9LA 4YH0A 4QYNA 4GDZA 4EXZA 4YKMA 4KIIA 4AZMA 2POAA 5HCCC 1E06A 2XKLA 3P24A 3STNA 4IAXA 3KFGA 3TGBA 3QKGA 2CM9A 5HZ6A 1FEMA 1ZNEA 4Y0PA 1BSYA 4GZVA 1OEEA 3D95A 3CWKA 3B2LA 4QGWA 3DSZA 2ASNX 1GT1A 2QO5A 4YCEA 2A3FX 4WFVA 1X71A 1GKAB 1QY1A 1DZPA 4TNNA 5AJCA 3WJDA 4YDBA 4ORYA 5HA1A 3VG6A 2FS6A 3T1DA 4ML7B 1T0VA 2MHDA 2GTFX 1KZXA 2G78A 2OVAA 3ZWEA 1DZJA 2WQ9A 5EEEA 2N93A 4ORSA 2Q2PA 5D8JA 3AKNA 2Z4HA 3CMPA 5FFHA 1LFOA 3CBCA 1JYJA 2LBAA 2L9CA 4YKOA 3RWXA 4ES7A 5LJCA 3O19A 1EPAA 1GT5A 5BYPA 2BT9A 3OE3A 1TOUA 1ML7A 3S5XA 2QMIA 3ELZA 1BJ7A 1ZNHA 3NQ3A 2CM4A 4MVKA 2HYSA 5D48A 1U17A 1ERXA 1QG5A 4HFOA 2JOZA 4NLJA 3P6DA 3VU1A 4ZJ0A 4TKHA 5IO7A 4YMYA 1KT7A 4I3CA 3FMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJG A;  3APX A;  5FEN A;  1X8Q A;  2JN3 A;  1FEL A;  2QO4 A;  3U9P C;  5B29 A;  1I4U A;  1LIC A;  3WJC A;  2HZQ A;  2CBR A;  3FR4 A;  1LKE A;  3EBW A;  1DZK A;  4Y0Q A;  1FDQ A;  4ALB A;  1LNM A;  5DPQ A;  2L68 A;  5EDC A;  4N7C A;  3ELX A;  4Y0S A;  4GRJ A;  2OVE A;  3P6F A;  4A1Y A;  1NP1 A;  1KXO A;  4BVM A;  4IMO A;  4XMD A;  2EU7 X;  4LKP A;  2HLV A;  3BU9 A;  4AZN A;  3FR5 A;  4GE1 A;  4A1H A;  3RSW A;  1LF7 A;  4AZR A;  1GX8 A;  5EDB A;  1IKJ A;  4ZH6 A;  1CRB A;  1KQW A;  5HZQ A;  2FLJ A;  3JSQ A;  4D6B A;  5HCD C;  1OPA A;  1QY2 A;  4PSQ A;  3WBG A;  4LKT A;  2X46 A;  4NNT A;  1MX8 A;  2HNX A;  3EMM A;  1YP7 A;  2AT3 X;  3MBT A;  3TGC A;  1YWD A;  4A8Z A;  3L4R A;  1ZNK A;  5F6Z A;  4ZCB A;  3P6G A;  5H9A A;  3BS2 A;  4TQ2 A;  4RUN A;  1AVG I;  4UU3 A;  1DC9 A;  4LZV A;  3BDR A;  1O8V A;  4YFQ A;  2XST A;  5BVS A;  3VG3 A;  5AQ6 A;  1FEN A;  4AYH A;  1KQX A;  2WWP A;  1BSO A;  3FEN A;  3EBK A;  4YGZ A;  4NNS A;  5L8N A;  2L5P A;  1DZM A;  1ALB A;  4XMH A;  2ACO A;  2AT6 X;  5LKE A;  1G74 A;  3NQ9 A;  1HQP A;  5HZ5 A;  5L8I A;  4CK4 A;  4I9R A;  1L6M A;  1U0X A;  5LKF A;  1LIF A;  1X8N A;  1BM5 A;  1YWB A;  1CBS A;  3HWG A;  2OVD A;  3NX2 A;  4I3D A;  1S7D A;  1ZNL A;  4ORR A;  3OJY C;  1EQD A;  1I06 A;  5EZ2 A;  3VG4 A;  4GNY A;  1X8U A;  3NPO A;  1S44 A;  1TOW A;  1D2U A;  1GKA A;  1MDC A;  4IB8 A;  2AT8 X;  3B2K A;  2HZR A;  2FTB A;  5DG4 A;  1JZU A;  2FT9 A;  4GET A;  4ZFX A;  1ZRY A;  1IW2 A;  4ZHF A;  4NYR A;  2FS7 A;  2W2A A;  1EUO A;  2RD7 C;  3AKM A;  1B8E A;  1HMT A;  4XMG A;  3ZUO A;  1I05 A;  1KGL A;  4ZH9 A;  2OZQ A;  2NP1 A;  2ACP X;  2GJ5 A;  4HPC A;  5HCE C;  1MUP A;  2LBV A;  1JJX A;  1A18 A;  3VG2 A;  1BEB A;  2LB6 A;  4ORW A;  3WJF A;  1SY0 A;  2Q4N A;  1OBP A;  1YUP A;  3NR3 A;  1SXU A;  1R0U A;  1VPR A;  1NGL A;  3FA6 A;  1QAB E;  4YFP A;  1ZNG A;  1GT4 A;  2RCQ A;  4M6S A;  3VG7 A;  3WJE A;  2GC9 A;  3I17 A;  2WSJ A;  3NAD A;  5HWZ A;  1VYG A;  1ADL A;  3D97 A;  1OEK A;  1IIU A;  3FW4 A;  4AZP A;  1O1U A;  4I9S A;  2MO5 A;  1SXX A;  4YDA A;  2LFO A;  3KQ0 A;  4OMX A;  4YFR A;  1E00 A;  1N0S A;  4YBU A;  3KFF A;  4I3B A;  1ACD A;  4GKC A;  2RCT A;  1PMP A;  5F58 A;  1JYD A;  2A2U A;  3JS1 A;  1QFV A;  1Z24 A;  3BX7 A;  4O9S A;  1EAL A;  3KFI A;  2OFR X;  1EW3 A;  2W2B A;  4YBP A;  3K3L A;  4AW8 A;  1OPB A;  1ICM A;  4QAE A;  3NX1 A;  3F9D A;  2WUT A;  3BX8 A;  5H8T A;  1GX9 A;  1TXL A;  4IB7 A;  4A60 A;  1RBP A;  5EPQ A;  4TKB A;  4GNW A;  3I0A A;  3G7X A;  4ZHC A;  4IAW A;  3CBS A;  1KT6 A;  2PY1 A;  1XKI A;  1QWD A;  2Q9S A;  1ICN A;  5FAZ A;  2AH7 X;  5KID A;  3FIQ A;  4OMW A;  4ARH A;  3STK A;  3C78 X;  3Q6L A;  2JU7 A;  1IFC A;  4BQU A;  4UU2 A;  2LKK A;  5D47 A;  2Q2M A;  1MVG A;  2WR6 A;  1PEE A;  1U18 A;  1DF3 A;  3HK1 A;  4NLI A;  1KZW A;  1BLR A;  1A3Y A;  1B56 A;  1IFB A;  2RA6 A;  1EXS A;  1QQS A;  1EII A;  2E4J A;  2AT5 X;  4HPA A;  1URE A;  4WBK A;  1EIO A;  4XME A;  4MVL A;  1GM6 A;  3FEP A;  5C0N A;  2QM9 A;  1S2P A;  5CE4 A;  4BOE A;  2OFM X;  1YWC A;  5HZ9 A;  3APW A;  4IMN A;  3O22 A;  4IB6 A;  2P8G A;  4QZU A;  1OEJ A;  3FLL A;  1GXA A;  4TKJ A;  1FE3 A;  5BVT A;  4IB9 A;  2FWV A;  3PH6 A;  5LJD A;  3TZS A;  4ORX A;  3EYC A;  4K19 A;  5JR8 A;  1OBU A;  5IO6 A;  2O62 A;  5D45 A;  4ALO A;  3EM0 A;  1T68 X;  3APU A;  3B2J A;  4OS8 A;  3P6C A;  3B2H A;  3S26 A;  4GH7 A;  1BBP A;  1CBR A;  3ZQ3 A;  3PP6 A;  3IA8 A;  4YGH A;  2FR2 A;  1QFT A;  3CQN A;  2YG2 A;  1X89 A;  4TLJ A;  3HWD A;  3PEC A;  3DTQ A;  2G7B A;  1CBI A;  3MVF A;  4NP1 A;  1E02 A;  4QGX A;  1B0O A;  5HBS A;  5KHP A;  1KT5 A;  1SY3 A;  2NNQ A;  1G5W A;  3WXQ A;  5EED A;  2MM3 A;  2R74 A;  2L67 A;  1LID A;  3BRN A;  4HPB A;  1PBO A;  1P6P A;  2AKQ A;  4ZHG A;  3KZA A;  3P6E A;  2WEW A;  1KT4 A;  5F6B A;  1I04 A;  5HTE A;  2HMB A;  4Y0R A;  1O1V A;  1DV9 A;  5B27 A;  3GAQ A;  3KFH A;  4HPD A;  1H91 A;  2K62 A;  5LJG A;  2G79 A;  2KTD A;  3C76 X;  4OS0 A;  3SAO A;  1ZND A;  5LJE A;  3NP1 A;  4QYP A;  5BVQ A;  4ODD A;  3STM X;  1GT3 A;  3UEX A;  2X45 A;  3U0D A;  1BSQ A;  3ZUI A;  1LPJ A;  1OBQ A;  4D6A A;  3D96 A;  2NND A;  4IBA A;  3UEU A;  5KIC A;  4DQ3 A;  5H9N A;  1BRQ A;  1TVQ A;  4ORU A;  2JU3 A;  2AMM X;  2FRS A;  1JBH A;  4ZR2 A;  5F1E A;  2MJI A;  2CZT A;  4LZU A;  2A13 A;  2NNE A;  1YIV A;  2IFB A;  4WFU A;  3FA7 A;  2BLG A;  2W2F A;  5HTD A;  2CZU A;  3BLG A;  4M7M A;  1CBQ A;  4AZO A;  3FEL A;  3HWF A;  2QOS C;  1SY2 A;  2A2G A;  1XCA A;  1AQB A;  4NYQ A;  3APV A;  1EPB A;  3F8A A;  1YP6 A;  3FA8 A;  3BU1 A;  2ANS A;  1A2D A;  4EDE A;  2F73 A;  1FTP A;  5LJB A;  4RUU A;  3RZY A;  1TW4 A;  4AZQ A;  1HBP A;  2WQA E;  3PED A;  3IFB A;  3PPT A;  5LJK A;  3BY0 A;  3C77 X;  3P6H A;  5HA0 A;  3VG5 A;  1A57 A;  1MX7 A;  4XMF A;  4DQ4 A;  2Q39 A;  2DM5 A;  1BRP A;  1DFV A;  4ZHH A;  1HBQ A;  5IO5 A;  2A0A A;  1G85 A;  1X8P A;  2CBS A;  1E5P A;  3CQR A;  4YDB A;  1SY1 A;  3WJB A;  1SA8 A;  1IKE A;  2K23 A;  1GGL A;  2R56 A;  1AB0 A;  3FW5 A;  1UZ2 X;  3TGA A;  2RQ0 A;  3UEV A;  1SXW A;  2FR3 A;  4ZHD A;  1PM1 X;  3TF6 A;  1CJ5 A;  1HMS A;  4OS3 A;  5L8O A;  1YWA A;  3O2Y A;  1JV4 A;  3B2I A;  2ALL X;  3HWE A;  1B4M A;  5D4A A;  2QO6 A;  1BWY A;  2JU8 A;  3FEK A;  3FR2 A;  1VYF A;  4YGG A;  1RLB E;  4TJZ A;  1NP4 A;  1ERB A;  3FA9 A;  4XMC A;  4EEJ A;  1SXY A;  1KOI A;  1G7N A;  2AT0 X;  1LIE A;  2WEX A;  4ZGU A;  3CR6 A;  1LIB A;  5F7G A;  5LJH A;  1AEL A;  1JJJ A;  5HAE A;  1T8V A;  3BSZ E;  1KT3 A;  3UEW A;  1X8O A;  3U03 A;  1QY0 A;  1D3S A;  4EFG A;  4R0B A;  4QGV A;  5H9K A;  4YCH A;  3PH5 A;  4QZT A;  3WVM A;  5K06 A;  5HZ8 A;  1HMR A;  1HN2 A;  2AL0 X;  2KT4 B;  4MVI A;  4N7D A;  2R73 A;  5H9L A;  4YH0 A;  4QYN A;  4EXZ A;  4YKM A;  4KII A;  4AZM A;  2POA A;  5HCC C;  1E06 A;  2XKL A;  3STN A;  4IAX A;  3KFG A;  3TGB A;  3QKG A;  2CM9 A;  5HZ6 A;  1FEM A;  1ZNE A;  4Y0P A;  1BSY A;  1OEE A;  3D95 A;  3CWK A;  3B2L A;  4QGW A;  3DSZ A;  2ASN X;  1GT1 A;  2QO5 A;  4YCE A;  2A3F X;  4WFV A;  1X71 A;  1GKA B;  1QY1 A;  1DZP A;  4TNN A;  3WJD A;  4ORY A;  5HA1 A;  3VG6 A;  2FS6 A;  3T1D A;  1T0V A;  2GTF X;  1KZX A;  2G78 A;  2OVA A;  1DZJ A;  2WQ9 A;  5EEE A;  2N93 A;  4ORS A;  2Q2P A;  5D8J A;  3AKN A;  3CMP A;  5FFH A;  1LFO A;  3CBC A;  1JYJ A;  2LBA A;  2L9C A;  4YKO A;  4ES7 A;  5LJC A;  3O19 A;  1EPA A;  1GT5 A;  1TOU A;  1ML7 A;  3ELZ A;  1BJ7 A;  1ZNH A;  3NQ3 A;  2CM4 A;  4MVK A;  2HYS A;  5D48 A;  1U17 A;  1ERX A;  1QG5 A;  4HFO A;  2JOZ A;  4NLJ A;  3P6D A;  4ZJ0 A;  4TKH A;  5IO7 A;  4YMY A;  1KT7 A;  4I3C A;  3FMZ A; 
#chains in the Genus database with same CATH topology
 2F01 A;  1SLG B;  3WJG A;  1SWS A;  1JIW I;  1Y9L A;  2OFB A;  1X8Q A;  2JN3 A;  3APX A;  4Z2O A;  1FEL A;  2QO4 A;  5FEN A;  3U9P C;  5B29 A;  1SRJ A;  3RDX A;  1I4U A;  1LIC A;  3FYF A;  3WJC A;  2HZQ A;  2CBR A;  3FR4 A;  1LKE A;  3EBW A;  5CYB A;  3WJB A;  1IJ8 A;  1SWC A;  1DZK A;  2DJF A;  4Y0Q A;  4WHI A;  1FDQ A;  4ALB A;  1LNM A;  2I5V O;  3VHH A;  5DPQ A;  2GTL N;  2L68 A;  4FBO A;  5EDC A;  4IAB A;  3ELX A;  4N7C A;  1VWR B;  5B10 O;  2C4I A;  1AVE A;  4Y0S A;  5B5G A;  4GRJ A;  4CPE A;  2QOM A;  2OVE A;  3P6F A;  4A1Y A;  1NP1 A;  1KXO A;  2CAM A;  4BVM A;  5L3Y A;  4IMO A;  4XMD A;  2EU7 X;  3VGW A;  2C1S A;  4LKP A;  2HLV A;  3EW2 A;  3BU9 A;  4AZN A;  3FR5 A;  4CDF A;  4GE1 A;  4A1H A;  1N9M A;  2Z4I A;  3RSW A;  1LF7 A;  4AZR A;  4CSB A;  1GX8 A;  1MM9 A;  2Y3E A;  3RBY A;  1SWQ A;  5EDB A;  2RTI B;  2X8T A;  1IKJ A;  4ZH6 A;  3RDQ A;  2VDF A;  1CRB A;  1KQW A;  5HZQ A;  2FLJ A;  2QCB A;  3JSQ A;  4D6B A;  5HCD C;  1OPA A;  1QY2 A;  3SLJ A;  2M4L A;  4PSQ A;  3WBG A;  4LKT A;  2X46 A;  4I95 A;  4O4O A;  2OL6 O;  1MX8 A;  2HNX A;  3EMM A;  4NNT A;  4NW4 A;  1YP7 A;  2AT3 X;  3MBT A;  3ZI8 A;  1YWD A;  1Y0G A;  3L4R A;  3UAQ A;  4A8Z A;  3TGC A;  3SZH A;  1SWE A;  1ZNK A;  3S60 A;  5F6Z A;  3T2X A;  2BHV A;  4ZCB A;  5K67 A;  3NBX X;  5FQ6 E;  3P6G A;  1SWR A;  4MIS A;  5H9A A;  2G8C O;  3BS2 A;  4TQ2 A;  4RUN A;  1AVG I;  3N91 A;  4UU3 A;  1DC9 A;  4LZV A;  3BDR A;  4KCA A;  1O8V A;  4U8U N;  3LHN A;  4YFQ A;  1STS B;  3SLO A;  4CDC A;  2X4M A;  2XST A;  5BVS A;  1AVD A;  2X56 A;  1SRH A;  5FQ8 E;  3VG3 A;  5AQ6 A;  1FEN A;  4AYH A;  2X32 A;  1KQX A;  2WWP A;  1BSO A;  1SMP I;  3FEN A;  4ZGF A;  2RTJ A;  3EBK A;  1SWA A;  4YGZ A;  4NNS A;  5L8N A;  1HY2 A;  2A8G A;  2IZD B;  1SWT A;  2L5P A;  1DZM A;  1ALB A;  2G5L A;  4XMH A;  2RTG B;  5IRU A;  2ACO A;  2AT6 X;  4BX6 A;  1G74 A;  5LKE A;  3NQ9 A;  1HQP A;  3V8U A;  5L8I A;  2LA7 A;  5HZ5 A;  3MG5 A;  4CK4 A;  4I9R A;  1L6M A;  2RTR B;  1U0X A;  1SWO A;  5LKF A;  4GDA A;  1LIF A;  1X8N A;  1BM5 A;  1YWB A;  1CBS A;  3T2W A;  3HWG A;  2OVD A;  3NX2 A;  4I3D A;  4Y59 A;  1S7D A;  1SRE A;  1ZNL A;  3OJY C;  4ORR A;  1EQD A;  1I06 A;  4MIR A;  2YMS A;  5EZ2 A;  3VG4 A;  4GNY A;  1X8U A;  3NPO A;  3KVN A;  3VPJ E;  1S44 A;  1SWD A;  1VWG B;  1VWP B;  1TOW A;  1D2U A;  1GKA A;  1KL4 A;  1MDC A;  4IB8 A;  2AT8 X;  3ZW1 B;  2IZH B;  3B2K A;  2HZR A;  3SLT A;  1FJ1 E;  3WZP A;  2FTB A;  5DG4 A;  1JZU A;  2FT9 A;  1SWN A;  3OBL A;  4GET A;  1ZRY A;  4GU8 A;  3ZW0 B;  2IZJ A;  4ZFX A;  2OL8 O;  1IW2 A;  4IRW A;  2JMB A;  4NYR A;  4ZHF A;  4CPH B;  2ZAG A;  1VWH B;  2AVI A;  2FS7 A;  2W2A A;  3CKF A;  1VWB B;  4CDE A;  1EUO A;  2RD7 C;  3AKM A;  1B8E A;  1VWC B;  1HMT A;  1WBI A;  4XMG A;  3ZUO A;  1I05 A;  1KGL A;  4ZH9 A;  2OZQ A;  3VHI A;  3H3I A;  2NP1 A;  1SRF A;  2ACP X;  2GJ5 A;  1NQN A;  4GGT A;  4HPC A;  5HCE C;  1MUP A;  3HPE A;  2LBV A;  1NDJ A;  1JJX A;  1A18 A;  3VG2 A;  1SWU A;  2X8S A;  4L1N A;  2RTF B;  2GTL O;  3PQU A;  3NQK A;  1VWI B;  1BEB A;  4JGL A;  2LB6 A;  3CKG A;  4ORW A;  3WJF A;  4O3X B;  1SY0 A;  2Q4N A;  1E2T A;  1OBP A;  4U46 A;  4DNE A;  1YUP A;  3NR3 A;  2RTE B;  1SXU A;  1SWP A;  2RTP B;  1R0U A;  1VPR A;  1NGL A;  3FA6 A;  1QAB E;  4YFP A;  4GJS A;  1VWK B;  1GT4 A;  1ZNG A;  1KL3 A;  2FHN X;  2RCQ A;  4KH8 A;  4M6S A;  3RDM A;  3VG7 A;  3WJE A;  5FQ7 E;  5AEO A;  2GC9 A;  2OY1 O;  3I17 A;  2WSJ A;  2UYW A;  1PBY A;  3NAD A;  4PJ2 A;  5HWZ A;  2FKJ A;  1VYG A;  4CPF A;  1VYO A;  1ADL A;  4MVE A;  2KW1 A;  3D97 A;  2RTK A;  1OEK A;  4EKV A;  1IIU A;  3FW4 A;  4AZP A;  1O1U A;  4I9S A;  4Z2P A;  1VWJ B;  2MO5 A;  1SXX A;  2RTN B;  3MM0 A;  4EQA C;  1JQP A;  2LFO A;  3KQ0 A;  1RSU B;  4KC8 A;  4YDA A;  4OMX A;  4YFR A;  1SLD B;  1E00 A;  1N0S A;  3P02 A;  3KFF A;  2OF9 A;  1GX3 A;  4I3B A;  4YBU A;  3X00 A;  1ACD A;  2Y32 A;  2RCT A;  4GKC A;  1JJU A;  1PMP A;  2RTH B;  1JMZ A;  3Q34 A;  1JYD A;  2A2U A;  2GTL M;  3JS1 A;  5F58 A;  1HXZ A;  1QFV A;  1Z24 A;  3BX7 A;  4O9S A;  1EAL A;  3KFI A;  2OFR X;  1EW3 A;  2W2B A;  4YBP A;  3K3L A;  4AW8 A;  1OPB A;  1W5R A;  1ICM A;  1LCV A;  4FGI B;  4MEE A;  4QAE A;  3NX1 A;  3F9D A;  5B5F A;  2WUT A;  3AEH A;  4O3Y A;  3BX8 A;  3WYP A;  5H8T A;  1GX9 A;  1RST B;  1TXL A;  4B55 A;  4IB7 A;  4A60 A;  2RN4 A;  1RBP A;  5EPQ A;  4TKB A;  4GNW A;  3I0A A;  1I78 A;  3G7X A;  4ZHC A;  5IRW A;  4IAW A;  3CBS A;  1UYN X;  1KT6 A;  2PY1 A;  1HQQ A;  1XKI A;  1QWD A;  2Q9S A;  3EW1 A;  1ICN A;  4OKA A;  5FAZ A;  2AH7 X;  3ZW2 A;  5KID A;  1K3B A;  3FIQ A;  3QQ2 A;  4OMW A;  2KD2 A;  4ARH A;  3JQO A;  3SZI A;  4Z2V A;  2GH7 A;  5K68 A;  3SOT A;  3STK A;  3ZZV A;  4BCS A;  4O3Z A;  3C78 X;  4QNI A;  2MWH A;  3Q6L A;  2JU7 A;  1IFC A;  3FDC A;  5CHK A;  4BQU A;  4UU2 A;  2LKK A;  5D47 A;  1MVG A;  2Q2M A;  2WR6 A;  1PEE A;  1U18 A;  1DF3 A;  3HK1 A;  4NLI A;  2ZAI A;  1KZW A;  1BLR A;  1A3Y A;  4NV7 A;  1B56 A;  1IFB A;  2RA6 A;  1EXS A;  1QQS A;  1EII A;  2OVS A;  2E4J A;  2AT5 X;  4HPA A;  1URE A;  1VWE B;  4WBK A;  1EIO A;  4XME A;  4MVL A;  1GM6 A;  3FEP A;  5C0N A;  2QM9 A;  1S2P A;  5CE4 A;  4BOE A;  2OFM X;  1YWC A;  2RTL A;  1Y53 X;  2IZA A;  5HZ9 A;  3APW A;  4IMN A;  3O22 A;  4IB6 A;  2P8G A;  4QZU A;  1OEJ A;  3FLL A;  4BX7 B;  1GXA A;  4BJ8 A;  4TKJ A;  3GE2 A;  1FE3 A;  2RTO B;  5BVT A;  4IB9 A;  3RKG A;  1VWQ B;  2FWV A;  3PH6 A;  5LJD A;  3SZJ A;  3TZS A;  1KFF A;  4ORX A;  3EYC A;  4K19 A;  5JR8 A;  1NBX A;  1OBU A;  5IO6 A;  2O62 A;  2RTQ B;  5D45 A;  4ALO A;  4FBR A;  3EM0 A;  1T68 X;  5F2B A;  3APU A;  4D6A A;  1PTS A;  3B2J A;  4FQB B;  4CV7 A;  4OS8 A;  4GK9 A;  3P6C A;  3B2H A;  3S26 A;  1WUB A;  4GH7 A;  1BBP A;  1CBR A;  3ZQ3 A;  4GUZ A;  1Y52 X;  3PP6 A;  3HTY A;  3IA8 A;  4YGH A;  2FR2 A;  1SLF B;  2IZB A;  1QFT A;  3HOL A;  4O4X A;  3CQN A;  2YG2 A;  1X89 A;  1SWB A;  1KL5 A;  4TLJ A;  4JHQ A;  3ZW0 A;  3HWD A;  3PEC A;  3E3C A;  3DTQ A;  1SWF A;  2G7B A;  1CBI A;  3MVF A;  4NP1 A;  1E02 A;  4QGX A;  1B0O A;  3PK2 A;  5HBS A;  4BX5 B;  5KHP A;  1KT5 A;  1SY3 A;  2NNQ A;  2OY5 O;  4C5P A;  1G5W A;  1Y9T A;  4ON1 A;  3WXQ A;  5EED A;  2MM3 A;  2R74 A;  2L67 A;  1LID A;  3BRN A;  4HPB A;  1PBO A;  4O3W A;  3WZN A;  4CDD A;  1P6P A;  2AKQ A;  1EI5 A;  4ZHG A;  3KZA A;  3P6E A;  2VFB A;  2WEW A;  1KT4 A;  2Y3F A;  5F6B A;  1I04 A;  1LDQ A;  5HTE A;  2HMB A;  1I9H A;  4Y0R A;  1O1V A;  1UYO X;  3T6F A;  1DV9 A;  2PI3 O;  3GAQ A;  5B27 A;  2DJG A;  2OFA A;  2OYB O;  2C1Q A;  3KFH A;  4HPD A;  1RXH A;  1H91 A;  2K62 A;  3D9W A;  1VWO B;  2G79 A;  2KTD A;  3C76 X;  4OS0 A;  5LJG A;  3SAO A;  1ZND A;  4NV8 A;  4U9C A;  4FBV A;  3NP1 A;  4QYP A;  5LJE A;  5BVQ A;  1W6F A;  4ODD A;  3STM X;  1GT3 A;  2F09 A;  3UEX A;  1MOY A;  2X45 A;  3U0D A;  1BSQ A;  3ZUI A;  1LPJ A;  1OBQ A;  1N4J A;  2WPU A;  3D96 A;  2NND A;  4I60 A;  4IBA A;  3OD9 A;  4U3Q A;  3UEU A;  4DQ3 A;  5KIC A;  2X55 A;  2VFC A;  5H9N A;  1BRQ A;  1TVQ A;  4ORU A;  2JU3 A;  2RTM A;  5JD2 A;  2AMM X;  2FRS A;  2JGS A;  5B11 O;  1JBH A;  4ZR2 A;  4KC7 A;  5F1E A;  1N43 A;  2CZT A;  2MJI A;  1N9Y A;  2A13 A;  4LZU A;  2FHL A;  2NNE A;  1YIV A;  2IFB A;  4LQZ A;  1MEP A;  4WFU A;  3WOV A;  3FA7 A;  4HWM A;  2BLG A;  2W2F A;  3EC5 A;  2IZK A;  1LUQ A;  5HTD A;  1VWF B;  2CZU A;  3BLG A;  4ID2 A;  3VE2 A;  4M7M A;  1CBQ A;  4AZO A;  2RTA A;  3FEL A;  3HWF A;  2RTB B;  1SY2 A;  2QOS C;  2A2G A;  1XCA A;  2FKG A;  1AQB A;  4NYQ A;  3APV A;  1EPB A;  3F8A A;  1YP6 A;  3FA8 A;  3BU1 A;  4OEL A;  3WYQ A;  2ANS A;  3WZO A;  1A2D A;  4U8U O;  2IZG B;  1LEL A;  4EDE A;  2F73 A;  1FTP A;  5LJB A;  4RUU A;  3RZY A;  1STP A;  1TW4 A;  3VE1 A;  1HBP A;  1VWD B;  3LV4 A;  4AZQ A;  4COT A;  2WQA E;  3PED A;  4Z27 A;  3IFB A;  3PPT A;  5LJK A;  3BY0 A;  3C77 X;  3P6H A;  5HA0 A;  3VG5 A;  1A57 A;  1MX7 A;  4JO6 A;  4XMF A;  2RTD B;  2Q39 A;  2IZF B;  2DM5 A;  4DQ4 A;  1BRP A;  1DFV A;  4O4S A;  4QQ1 A;  4ZHH A;  1HBQ A;  4GD9 A;  5IO5 A;  2A0A A;  1G85 A;  1X8P A;  1E5P A;  2BS5 A;  2CBS A;  3CQR A;  1SY1 A;  2X8F A;  1SA8 A;  1IKE A;  2K23 A;  1GGL A;  2R56 A;  1AB0 A;  3FW5 A;  1UZ2 X;  3LTW A;  2RQ0 A;  3TGA A;  2OL7 A;  1SXW A;  3UEV A;  2FR3 A;  4ZHD A;  1PM1 X;  5CSE A;  4O49 A;  1RXK A;  3TF6 A;  1CJ5 A;  1HMS A;  2A5B A;  4OS3 A;  4QRL A;  5L8O A;  1YWA A;  4JNJ A;  3O2Y A;  3D4R A;  1JV4 A;  2KTS A;  3B2I A;  3HOE A;  4GJV A;  2ALL X;  3HWE A;  1B4M A;  1SWL A;  1JMX A;  2QO6 A;  5D4A A;  1BWY A;  4BX7 A;  2JU8 A;  3RY2 A;  3FEK A;  3FR2 A;  1NC9 A;  1VYF A;  4YGG A;  1RLB E;  4TJZ A;  1HXL A;  1NP4 A;  1SRG A;  1ERB A;  2OF8 A;  3FA9 A;  4XMC A;  5IRA A;  4EEJ A;  1SXY A;  5IXG A;  4U8U M;  1KOI A;  4O4U A;  1LCW A;  1G7N A;  2AT0 X;  3MX7 A;  1LIE A;  4I6S A;  3F6Z B;  2WEX A;  4Z6J A;  4ZGU A;  3CR6 A;  1LIB A;  5F7G A;  2FGS A;  5LJH A;  3RE5 A;  1AEL A;  4BGF A;  1K24 A;  1JJJ A;  5HAE A;  2X34 A;  1T8V A;  2BSZ A;  3BSZ E;  3S5V A;  4CPI A;  1KT3 A;  3UEW A;  1X8O A;  3U03 A;  4L3R A;  1QY0 A;  1D3S A;  4EFG A;  2JW1 A;  2BS6 A;  2OY8 A;  4R0B A;  4QGV A;  2A5C A;  5H9K A;  1LCZ A;  4YCH A;  3PH5 A;  4INN A;  4QZT A;  3WVM A;  1Y55 X;  5K06 A;  2BC3 A;  3ZW1 A;  5B2A O;  5AJB A;  2IZI A;  5HZ8 A;  4KT5 A;  5B3M O;  1HMR A;  1HN2 A;  2AL0 X;  2KT4 B;  2MF6 A;  4MVI A;  4N7D A;  2R73 A;  3PQS A;  5H9L A;  4YH0 A;  4QYN A;  4GDZ A;  4EXZ A;  1SRI A;  4YKM A;  4KII A;  2I5Z O;  4CPH A;  4AZM A;  2POA A;  4BX6 B;  4BX5 A;  2OY7 A;  1NQM A;  5HCC C;  3VHM A;  1E06 A;  2XKL A;  3P24 A;  3STN A;  4GGR A;  4IAX A;  4YVB A;  3KFG A;  4Y5D A;  3T6L A;  3TGB A;  3QKG A;  1VWM B;  2CM9 A;  5HZ6 A;  1FEM A;  1ZNE A;  4Y0P A;  4BBO A;  1BSY A;  4GZV A;  1OEE A;  1N7Y A;  3D95 A;  3CWK A;  3B2L A;  1SWJ A;  3DSZ A;  4QGW A;  3RDS A;  3WZQ A;  2ASN X;  1GT1 A;  2QO5 A;  4YCE A;  2A3F X;  4WFV A;  1X71 A;  1GKA B;  1SWK A;  1QY1 A;  1DZP A;  4TNN A;  5AJC A;  3WJD A;  4YDB A;  4ORY A;  5HA1 A;  3VG6 A;  2FS6 A;  3T1D A;  1DF8 A;  4GGZ A;  1MK5 A;  1STR B;  1T0V A;  4ML7 B;  2MHD A;  1VWL B;  2GTF X;  1KZX A;  2G78 A;  2OVA A;  1SWG A;  3ZWE A;  1DZJ A;  2WQ9 A;  5EEE A;  4DCB A;  2N93 A;  4ORS A;  2Q2P A;  5D8J A;  3AKN A;  2Z4H A;  1LDO A;  3RDO A;  3CMP A;  3FID A;  2RTC B;  5FFH A;  1LFO A;  1SLE B;  2IZL B;  1JYJ A;  2LBA A;  3CBC A;  4OEM A;  2L9C A;  4YKO A;  3RWX A;  4ES7 A;  4Z28 A;  5LJC A;  3O19 A;  1EPA A;  1GT5 A;  5BYP A;  2AF5 A;  2BT9 A;  3RE6 A;  2HKD A;  3OE3 A;  1TOU A;  2IZC B;  1ML7 A;  3S5X A;  2QMI A;  3ELZ A;  1BJ7 A;  1RAV A;  1ZNH A;  3NQ3 A;  2CM4 A;  1OSP O;  2ZSC A;  4MVK A;  2HYS A;  5D48 A;  1VWN B;  1W4T A;  1U17 A;  3RDU A;  1ERX A;  1QG5 A;  1RXJ A;  2IZE B;  2UZ2 A;  3PDF A;  1VWA B;  4HFO A;  3RY1 A;  3AUM O;  2JOZ A;  4NLJ A;  3P6D A;  3VU1 A;  1SWH A;  4ZJ0 A;  4TKH A;  5IO7 A;  4YMY A;  1KT7 A;  4I3C A;  3FMZ A; 
#chains in the Genus database with same CATH homology
 3WJG A;  3APX A;  1JIW I;  1Y9L A;  5FEN A;  1X8Q A;  2JN3 A;  1FEL A;  2QO4 A;  3U9P C;  5B29 A;  1I4U A;  1LIC A;  3FYF A;  3WJC A;  2HZQ A;  2CBR A;  3FR4 A;  1LKE A;  3EBW A;  5CYB A;  3WJB A;  1DZK A;  4Y0Q A;  4WHI A;  1FDQ A;  4ALB A;  1LNM A;  5DPQ A;  2GTL N;  2L68 A;  4FBO A;  5EDC A;  4IAB A;  3ELX A;  4N7C A;  4Y0S A;  4GRJ A;  2OVE A;  3P6F A;  4A1Y A;  1NP1 A;  1KXO A;  4BVM A;  4IMO A;  4XMD A;  2EU7 X;  4LKP A;  2HLV A;  3BU9 A;  4AZN A;  3FR5 A;  4GE1 A;  4A1H A;  2Z4I A;  3RSW A;  1LF7 A;  4AZR A;  4CSB A;  1GX8 A;  3RBY A;  5EDB A;  2X8T A;  1IKJ A;  4ZH6 A;  1CRB A;  1KQW A;  5HZQ A;  2FLJ A;  3JSQ A;  4D6B A;  5HCD C;  1OPA A;  1QY2 A;  2M4L A;  4PSQ A;  3WBG A;  4LKT A;  2X46 A;  4I95 A;  4O4O A;  4NNT A;  1MX8 A;  2HNX A;  3EMM A;  4NW4 A;  1YP7 A;  2AT3 X;  3MBT A;  3ZI8 A;  1YWD A;  4A8Z A;  3L4R A;  3UAQ A;  3TGC A;  1ZNK A;  3S60 A;  5F6Z A;  2BHV A;  4ZCB A;  3NBX X;  5FQ6 E;  3P6G A;  4MIS A;  5H9A A;  3BS2 A;  4TQ2 A;  4RUN A;  1AVG I;  3N91 A;  4UU3 A;  1DC9 A;  4LZV A;  3BDR A;  4KCA A;  1O8V A;  4U8U N;  3LHN A;  4YFQ A;  2XST A;  5BVS A;  3VG3 A;  5FQ8 E;  5AQ6 A;  1FEN A;  4AYH A;  1KQX A;  2WWP A;  1BSO A;  1SMP I;  3FEN A;  4ZGF A;  3EBK A;  4YGZ A;  4NNS A;  5L8N A;  2L5P A;  1DZM A;  1ALB A;  4XMH A;  2ACO A;  2AT6 X;  5LKE A;  1G74 A;  3NQ9 A;  1HQP A;  3V8U A;  5L8I A;  2LA7 A;  5HZ5 A;  4CK4 A;  4I9R A;  1L6M A;  1U0X A;  5LKF A;  1LIF A;  1X8N A;  1BM5 A;  1YWB A;  1CBS A;  3HWG A;  2OVD A;  3NX2 A;  4I3D A;  1S7D A;  1ZNL A;  4ORR A;  3OJY C;  1EQD A;  1I06 A;  4MIR A;  2YMS A;  5EZ2 A;  3VG4 A;  4GNY A;  1X8U A;  3NPO A;  3VPJ E;  1S44 A;  1TOW A;  3ZW1 B;  1D2U A;  1GKA A;  1MDC A;  4IB8 A;  2AT8 X;  3B2K A;  2HZR A;  2FTB A;  5DG4 A;  1JZU A;  2FT9 A;  3OBL A;  4GET A;  4GU8 A;  1ZRY A;  3ZW0 B;  4ZFX A;  1IW2 A;  2JMB A;  4NYR A;  4ZHF A;  2ZAG A;  2FS7 A;  2W2A A;  1EUO A;  2RD7 C;  3AKM A;  1B8E A;  1HMT A;  4XMG A;  3ZUO A;  1I05 A;  1KGL A;  4ZH9 A;  2OZQ A;  3H3I A;  2NP1 A;  2ACP X;  2GJ5 A;  4HPC A;  5HCE C;  1MUP A;  2LBV A;  1JJX A;  1A18 A;  3VG2 A;  2X8S A;  4L1N A;  2GTL O;  3PQU A;  3NQK A;  1BEB A;  4JGL A;  2LB6 A;  4ORW A;  3WJF A;  4O3X B;  1SY0 A;  2Q4N A;  1OBP A;  1YUP A;  3NR3 A;  1SXU A;  1R0U A;  1VPR A;  1NGL A;  3FA6 A;  1QAB E;  4YFP A;  1ZNG A;  1GT4 A;  2RCQ A;  4KH8 A;  4M6S A;  3VG7 A;  5AEO A;  3WJE A;  5FQ7 E;  2GC9 A;  3I17 A;  2WSJ A;  3NAD A;  4PJ2 A;  5HWZ A;  1VYG A;  1ADL A;  4MVE A;  2KW1 A;  3D97 A;  1OEK A;  1IIU A;  3FW4 A;  4AZP A;  1O1U A;  4I9S A;  2MO5 A;  1SXX A;  4EQA C;  4YDA A;  2LFO A;  3KQ0 A;  4KC8 A;  4OMX A;  4YFR A;  3P02 A;  1E00 A;  1N0S A;  4YBU A;  3KFF A;  4I3B A;  1ACD A;  4GKC A;  2RCT A;  1PMP A;  5F58 A;  1JYD A;  2A2U A;  2GTL M;  3JS1 A;  1QFV A;  1Z24 A;  3BX7 A;  4O9S A;  1EAL A;  3KFI A;  2OFR X;  1EW3 A;  2W2B A;  4YBP A;  3K3L A;  4AW8 A;  1OPB A;  1ICM A;  4FGI B;  4QAE A;  3NX1 A;  3F9D A;  2WUT A;  4O3Y A;  3BX8 A;  5H8T A;  1GX9 A;  1TXL A;  4IB7 A;  4A60 A;  2RN4 A;  1RBP A;  5EPQ A;  4TKB A;  4GNW A;  3I0A A;  3G7X A;  4ZHC A;  4IAW A;  3CBS A;  1KT6 A;  2PY1 A;  1XKI A;  1QWD A;  2Q9S A;  1ICN A;  5FAZ A;  2AH7 X;  3ZW2 A;  5KID A;  3FIQ A;  4OMW A;  4ARH A;  2KD2 A;  3JQO A;  3SOT A;  3STK A;  3ZZV A;  4O3Z A;  3C78 X;  4QNI A;  2MWH A;  3Q6L A;  2JU7 A;  1IFC A;  4BQU A;  4UU2 A;  2LKK A;  5D47 A;  1MVG A;  2Q2M A;  2WR6 A;  1PEE A;  1U18 A;  1DF3 A;  3HK1 A;  4NLI A;  2ZAI A;  1KZW A;  1BLR A;  1A3Y A;  1B56 A;  1IFB A;  2RA6 A;  1EXS A;  1QQS A;  1EII A;  2OVS A;  2E4J A;  2AT5 X;  4HPA A;  1URE A;  4WBK A;  1EIO A;  4XME A;  4MVL A;  1GM6 A;  3FEP A;  5C0N A;  2QM9 A;  1S2P A;  5CE4 A;  4BOE A;  2OFM X;  1YWC A;  5HZ9 A;  3APW A;  4IMN A;  3O22 A;  4IB6 A;  2P8G A;  4QZU A;  1OEJ A;  3FLL A;  1GXA A;  4TKJ A;  3GE2 A;  1FE3 A;  5BVT A;  4IB9 A;  3RKG A;  2FWV A;  3PH6 A;  5LJD A;  3TZS A;  4ORX A;  3EYC A;  4K19 A;  5JR8 A;  1OBU A;  5IO6 A;  2O62 A;  5D45 A;  4ALO A;  3EM0 A;  1T68 X;  3APU A;  3B2J A;  4FQB B;  4CV7 A;  4OS8 A;  4GK9 A;  3P6C A;  3B2H A;  3S26 A;  4GH7 A;  1BBP A;  1CBR A;  3ZQ3 A;  3PP6 A;  3HTY A;  3IA8 A;  4YGH A;  2FR2 A;  1QFT A;  3HOL A;  4O4X A;  3CQN A;  2YG2 A;  1X89 A;  4TLJ A;  3ZW0 A;  3HWD A;  3PEC A;  3E3C A;  3DTQ A;  2G7B A;  1CBI A;  3MVF A;  4NP1 A;  1E02 A;  4QGX A;  1B0O A;  5HBS A;  5KHP A;  1KT5 A;  1SY3 A;  2NNQ A;  1G5W A;  1Y9T A;  4ON1 A;  3WXQ A;  5EED A;  2MM3 A;  2R74 A;  2L67 A;  1LID A;  3BRN A;  4HPB A;  1PBO A;  4O3W A;  4FBR A;  1P6P A;  2AKQ A;  1EI5 A;  4ZHG A;  3KZA A;  3P6E A;  2WEW A;  1KT4 A;  5F6B A;  1I04 A;  5HTE A;  2HMB A;  4Y0R A;  1O1V A;  1DV9 A;  5B27 A;  3GAQ A;  3KFH A;  4HPD A;  1H91 A;  2K62 A;  5LJG A;  2G79 A;  2KTD A;  3C76 X;  4OS0 A;  3SAO A;  1ZND A;  4U9C A;  4FBV A;  3NP1 A;  4QYP A;  5LJE A;  5BVQ A;  4ODD A;  3STM X;  1GT3 A;  2F09 A;  3UEX A;  2X45 A;  3U0D A;  1BSQ A;  3ZUI A;  1LPJ A;  1OBQ A;  4D6A A;  3D96 A;  2NND A;  4IBA A;  4U3Q A;  3OD9 A;  3UEU A;  5KIC A;  4DQ3 A;  5H9N A;  1BRQ A;  1TVQ A;  4ORU A;  2JU3 A;  2AMM X;  2FRS A;  1JBH A;  4ZR2 A;  4KC7 A;  5F1E A;  2MJI A;  2CZT A;  4LZU A;  2A13 A;  2NNE A;  1YIV A;  2IFB A;  4LQZ A;  4WFU A;  3WOV A;  3FA7 A;  4HWM A;  2BLG A;  2W2F A;  5HTD A;  2CZU A;  3BLG A;  4ID2 A;  3VE2 A;  4M7M A;  1CBQ A;  4AZO A;  3FEL A;  3HWF A;  1SY2 A;  2QOS C;  2A2G A;  1XCA A;  1AQB A;  4NYQ A;  3APV A;  1EPB A;  3F8A A;  1YP6 A;  3FA8 A;  3BU1 A;  2ANS A;  1A2D A;  4U8U O;  4EDE A;  2F73 A;  1FTP A;  5LJB A;  4RUU A;  3RZY A;  1TW4 A;  3VE1 A;  1HBP A;  4AZQ A;  3LV4 A;  4COT A;  2WQA E;  3PED A;  3IFB A;  3PPT A;  5LJK A;  3BY0 A;  3C77 X;  3P6H A;  5HA0 A;  3VG5 A;  1A57 A;  1MX7 A;  4XMF A;  4DQ4 A;  2Q39 A;  2DM5 A;  1BRP A;  1DFV A;  4O4S A;  4QQ1 A;  4ZHH A;  1HBQ A;  5IO5 A;  2A0A A;  2BS5 A;  1G85 A;  2CBS A;  1X8P A;  1E5P A;  3CQR A;  1SY1 A;  2X8F A;  1SA8 A;  1IKE A;  2K23 A;  1GGL A;  2R56 A;  1AB0 A;  3FW5 A;  1UZ2 X;  3TGA A;  2RQ0 A;  3UEV A;  1SXW A;  2FR3 A;  4ZHD A;  1PM1 X;  4O49 A;  3TF6 A;  1CJ5 A;  1HMS A;  4OS3 A;  4QRL A;  5L8O A;  1YWA A;  3O2Y A;  3D4R A;  1JV4 A;  2KTS A;  3B2I A;  3HOE A;  2ALL X;  3HWE A;  1B4M A;  5D4A A;  2QO6 A;  1BWY A;  2JU8 A;  3FEK A;  3FR2 A;  1VYF A;  4YGG A;  1RLB E;  4TJZ A;  1NP4 A;  1ERB A;  3FA9 A;  4XMC A;  4EEJ A;  1SXY A;  4U8U M;  1KOI A;  4O4U A;  3MX7 A;  1G7N A;  2AT0 X;  1LIE A;  4I6S A;  3F6Z B;  2WEX A;  4ZGU A;  3CR6 A;  1LIB A;  5F7G A;  5LJH A;  1AEL A;  1JJJ A;  5HAE A;  1T8V A;  3BSZ E;  3S5V A;  1KT3 A;  3UEW A;  1X8O A;  3U03 A;  4L3R A;  1QY0 A;  1D3S A;  4EFG A;  2JW1 A;  2BS6 A;  4R0B A;  4QGV A;  5H9K A;  4YCH A;  3PH5 A;  4INN A;  4QZT A;  3WVM A;  5K06 A;  3ZW1 A;  5AJB A;  5HZ8 A;  4KT5 A;  1HMR A;  1HN2 A;  2AL0 X;  2KT4 B;  4MVI A;  4N7D A;  2R73 A;  3PQS A;  5H9L A;  4YH0 A;  4QYN A;  4GDZ A;  4EXZ A;  4YKM A;  4KII A;  4AZM A;  2POA A;  5HCC C;  1E06 A;  2XKL A;  3P24 A;  3STN A;  4IAX A;  3KFG A;  3TGB A;  3QKG A;  2CM9 A;  5HZ6 A;  1FEM A;  1ZNE A;  4Y0P A;  1BSY A;  4GZV A;  1OEE A;  3D95 A;  3CWK A;  3B2L A;  4QGW A;  3DSZ A;  2ASN X;  1GT1 A;  2QO5 A;  4YCE A;  2A3F X;  4WFV A;  1X71 A;  1GKA B;  1QY1 A;  1DZP A;  4TNN A;  5AJC A;  3WJD A;  4YDB A;  4ORY A;  5HA1 A;  3VG6 A;  2FS6 A;  3T1D A;  4ML7 B;  1T0V A;  2MHD A;  2GTF X;  1KZX A;  2G78 A;  2OVA A;  3ZWE A;  1DZJ A;  2WQ9 A;  5EEE A;  2N93 A;  4ORS A;  2Q2P A;  5D8J A;  3AKN A;  2Z4H A;  3CMP A;  5FFH A;  1LFO A;  3CBC A;  1JYJ A;  2LBA A;  2L9C A;  4YKO A;  3RWX A;  4ES7 A;  5LJC A;  3O19 A;  1EPA A;  1GT5 A;  5BYP A;  2BT9 A;  3OE3 A;  1TOU A;  1ML7 A;  3S5X A;  2QMI A;  3ELZ A;  1BJ7 A;  1ZNH A;  3NQ3 A;  2CM4 A;  4MVK A;  2HYS A;  5D48 A;  1U17 A;  1ERX A;  1QG5 A;  4HFO A;  2JOZ A;  4NLJ A;  3P6D A;  3VU1 A;  4ZJ0 A;  4TKH A;  5IO7 A;  4YMY A;  1KT7 A;  4I3C A;  3FMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...