2CBSA

Cellular retinoic acid binding protein ii in complex with a synthetic retinoic acid (ro-13 6307)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CRABP-II)
publication title Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 38
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2cbsA00
4OMXA 2XSTA 3BU9A 1AQBA 1H91A 1KT5A 2CBSA 4ORSA 1GGLA 2G79A 5D47A 2AT6X 3BX7A 3I0AA 5LJKA 3PEDA 1KOIA 3EBKA 3ZQ3A 5FAZA 3VG3A 5IO5A 4EXZA 2HLVA 4Y0SA 5DPQA 3EMMA 2Q39A 3D97A 3F8AA 3KFHA 1OEEA 1ZNHA 4HPBA 1GX8A 4RUNA 1JJXA 2FR3A 2QO5A 5HA0A 1MX7A 1JV4A 4ALOA 1S44A 3BDRA 3NQ3A 1BWYA 3BS2A 2MO5A 2WWPA 2YG2A 3C78X 3QKGA 1FEMA 2Q2PA 5LJDA 1X8OA 2X46A 5LJHA 4AZMA 3NADA 3FENA 2OVDA 3UEXA 4OMWA 1KT3A 3WJEA 2RCTA 4TKHA 4LZVA 3UEWA 2RA6A 4GH7A 1BSOA 4WBKA 4TNNA 1DV9A 4BVMA 1QFVA 1MX8A 2HMBA 4GRJA 2F73A 3C76X 1JBHA 4GETA 1SY0A 3NX1A 3DTQA 4AZRA 3PP6A 1VYGA 1BLRA 1X71A 4NNTA 1ZNDA 3D95A 3P6EA 5F1EA 3STMX 4ZHDA 3U9PC 1A2DA 2CBRA 4TJZA 1KZWA 4ZHGA 3BY0A 4Y0QA 1ZNGA 1FENA 3EM0A 4YBUA 4NLIA 4DQ3A 3P6HA 4IMNA 1KXOA 3FLLA 3WJCA 2LKKA 3WJBA 1I05A 3JS1A 2HZQA 3FR2A 4IB7A 1EPBA 5HTEA 1JYJA 1NP4A 1PBOA 4NNSA 1FELA 1ACDA 1SY1A 2E4JA 3CBCA 4ZHHA 1BM5A 1HQPA 3TGBA 2AT8X 3CMPA 5HWZA 3NR3A 2HNXA 4ZJ0A 4QGVA 4YGHA 1G74A 3WJGA 5HZ6A 5KICA 1SY3A 4D6AA 5FFHA 1OPAA 3KFGA 2WSJA 1ERBA 1DF3A 1L6MA 1LIBA 4N7DA 5B29A 1X8PA 4ZH9A 1LFOA 4YCEA 1QQSA 4TKBA 2LBAA 1NGLA 4WFVA 4ZH6A 3TGCA 4IB6A 4YFPA 4BQUA 5DG4A 4NYRA 3U03A 1JZUA 3HWGA 2JU3A 4ZCBA 2AKQA 4XMFA 3NX2A 4QGXA 5LJBA 1QY1A 2GTFX 1GKAA 1P6PA 3TGAA 2OZQA 2HYSA 3CWKA 1CJ5A 3PECA 1GT1A 5H9NA 2CZUA 2AH7X 3HWFA 3PPTA 4GNWA 2HZRA 4K19A 2FLJA 1DC9A 1JJJA 3KZAA 1PEEA 1D2UA 5HZ9A 1VPRA 4ZR2A 1R0UA 2Q9SA 4AZOA 4NLJA 5KHPA 3PH6A 3D96A 1G5WA 1BEBA 1QABE 1A57A 3HWEA 4D6BA 1UREA 2KT4B 5IO6A 1EW3A 2MM3A 3IA8A 3HK1A 4QZTA 5D8JA 1EUOA 4ARHA 3VG5A 1B8EA 1BSYA 2X45A 3B2IA 4IMOA 1DZJA 4YKMA 3FELA 5L8IA 1LIDA 2ALLX 4YKOA 3B2JA 3FEPA 1LF7A 1GT5A 1IKEA 1GT3A 2AMMX 4YMYA 4QGWA 3S26A 5HBSA 3WBGA 3KQ0A 1A3YA 3BLGA 5H8TA 1DZKA 2BLGA 5HTDA 5HZ8A 1HBPA 2JN3A 4AZPA 4EEJA 2CM9A 2QOSC 3GAQA 3FA9A 1U17A 3KFFA 4AZNA 4GNYA 4I3BA 4XMEA 1DFVA 2A2UA 1FE3A 4TKJA 1EIOA 1HN2A 4R0BA 1B4MA 1YUPA 3Q6LA 4YFQA 2NP1A 2FT9A 5AQ6A 1YWAA 4GE1A 1GKAB 3P6CA 4HPDA 1KQWA 1KZXA 4N7CA 1ML7A 1E02A 2R56A 4XMGA 1EIIA 1YIVA 5EDCA 4QAEA 1ADLA 4A1YA 5EZ2A 2FTBA 5F7GA 2XKLA 2FRSA 5H9KA 3RZYA 2NNDA 1GM6A 3B2KA 3APUA 4UU2A 1QY2A 2WQAE 4ORRA 5H9LA 1MDCA 4Y0RA 5HA1A 1KT7A 4YDBA 4WFUA 3FIQA 1E00A 1GXAA 3STNA 2PY1A 1BJ7A 3NP1A 5D4AA 1SXYA 4HPCA 4YGGA 3ZUIA 1ZNEA 4MVKA 1LICA 1EQDA 2L68A 1IFCA 2K23A 1AVGI 1VYFA 2EU7X 4YGZA 4IAXA 4ZHFA 2WUTA 4AW8A 2N93A 1AB0A 5B27A 3WXQA 3FA8A 4ZGUA 1YP6A 1O8VA 3KFIA 2L67A 3P6GA 2POAA 1GT4A 2QO6A 3VG6A 3U0DA 2FWVA 3APVA 1DZMA 2RQ0A 1T0VA 3B2LA 4LKTA 2WEWA 1OEJA 1X8QA 2Q4NA 2L5PA 4GKCA 1DZPA 1BSQA 3FA6A 5EDBA 4ZHCA 1G85A 1YWDA 4KIIA 1SXUA 3C77X 1QWDA 1YP7A 4LKPA 2AL0X 3ZUOA 5IO7A 1YWBA 4IB8A 4ORYA 1GX9A 1KGLA 4EFGA 1CBQA 1G7NA 3MBTA 4TLJA 4XMHA 4UU3A 5BVSA 1CBRA 3STKA 3PH5A 4RUUA 3AKNA 1BRQA 1OEKA 5BVQA 2JU8A 2A13A 1UZ2X 2OFMX 2WEXA 3BX8A 1XKIA 4LZUA 1BBPA 1Z24A 3UEUA 1AELA 4MVLA 3FA7A 2K62A 4I3DA 4OS0A 3L4RA 4OS8A 5CE4A 2WQ9A 5L8OA 1TOUA 1E06A 2NNQA 3BU1A 1TOWA 3BSZE 4IBAA 1SXXA 2OVAA 4ORWA 4Y0PA 3NPOA 1FDQA 3FR5A 3NQ9A 1S7DA 5C0NA 3I17A 1U0XA 2O62A 1O1UA 1EXSA 4AZQA 5L8NA 2JOZA 5F6ZA 2GJ5A 1SXWA 4M7MA 4PSQA 1LNMA 2FS7A 2LB6A 2A2GA 3OJYC 3HWDA 5F6BA 3O2YA 2W2AA 5LKFA 4ES7A 5HAEA 4AYHA 2OVEA 2RD7C 3DSZA 2JU7A 3WVMA 1FTPA 2QM9A 3T1DA 2AT3X 1XCAA 2IFBA 4A1HA 1RBPA 1X8UA 1SY2A 4HFOA 1X89A 3P6FA 1IFBA 1EALA 1OPBA 4M6SA 5LJGA 3EYCA 3O22A 5KIDA 1HBQA 1ICNA 1I4UA 1IIUA 3JSQA 5LKEA 4A8ZA 1U18A 5F58A 2W2FA 2FR2A 3VG7A 2LFOA 2R74A 1HMTA 1SA8A 2QO4A 2RCQA 5BVTA 2L9CA 4QYPA 1ICMA 3CQRA 5K06A 4YDAA 5HZQA 2ACPX 2FS6A 3VG2A 1S2PA 2AT5X 4ODDA 4ORXA 3BRNA 4BOEA 4YCHA 1ERXA 1ZNKA 2A0AA 1PM1X 1E5PA 4YH0A 5EEEA 3ELZA 3K3LA 3F9DA 1CBIA 1CBSA 2CZTA 2KTDA 4CK4A 4ZFXA 1KQXA 4O9SA 1MUPA 3FEKA 1JYDA 4I9RA 1QFTA 2G7BA 1YWCA 1I06A 5HCDC 3CQNA 3AKMA 2OFRX 4EDEA 2ANSA 1B0OA 1KT4A 3UEVA 1EPAA 1QY0A 1ZRYA 1QG5A 4I3CA 1IKJA 1KT6A 3VG4A 2GC9A 1BRPA 5FENA 4YFRA 5D45A 4IB9A 2Q2MA 1OBQA 4NP1A 4XMDA 2DM5A 4HPAA 5D48A 5EEDA 2MJIA 2ACOA 2WR6A 4ORUA 5LJCA 2AT0X 3IFBA 1LIFA 1MVGA 5HCCC 1IW2A 4YBPA 3B2HA 1D3SA 1RLBE 3APXA 3CBSA 5HCEC 1OBPA 4ALBA 4NYQA 4QYNA 2G78A 1X8NA 1NP1A 1N0SA 3WJFA 3FW4A 4I9SA 5EPQA 4QZUA 3SAOA 1I04A 3P6DA 3G7XA 3ELXA 2CM4A 3FW5A 2P8GA 1TVQA 4TQ2A 3EBWA 3TZSA 3TF6A 1A18A 3RSWA 1HMSA 1B56A 5H9AA 1TXLA 1LPJA 3WJDA 5HZ5A 1OBUA 4IAWA 2W2BA 4A60A 1T8VA 3CR6A 3MVFA 4MVIA 3APWA 2ASNX 1CRBA 1LIEA 1HMRA 2A3FX 3FR4A 5JR8A 5LJEA 4OS3A 1ALBA 3O19A 1PMPA 4XMCA 4DQ4A 2NNEA 3FMZA 1O1VA 1ZNLA 1TW4A 2LBVA 2R73A 1LKEA 1T68X
chains in the Genus database with same CATH superfamily
2OF8A 4OMXA 2XSTA 3BU9A 1AQBA 1H91A 1KT5A 2CBSA 4ORSA 1GGLA 1W5RA 2G79A 5D47A 4MISA 2AT6X 3BX7A 2JMBA 3I0AA 4CPHB 5IXGA 4GGTA 5LJKA 1NDJA 1KOIA 3PEDA 1NBXA 3EBKA 3ZQ3A 3PQUA 5FAZA 3VG3A 5IO5A 4BX5B 4EXZA 4U9CA 2HLVA 2G8CO 4Y0SA 4BJ8A 5DPQA 1JMXA 1SWLA 3EMMA 2Q39A 1SRJA 4KH8A 3WZQA 1Y9LA 2IZHB 1MK5A 3D97A 3F8AA 1KL3A 3KFHA 4O49A 1OEEA 1ZNHA 1SWNA 1GX8A 3MG5A 4HPBA 1HXLA 4RUNA 1JJXA 2FR3A 3SLJA 2QO5A 4ID2A 1MX7A 5HA0A 1JV4A 1I9HA 3RDXA 2IZCB 4KC7A 1K24A 1S44A 4HWMA 4ALOA 3BDRA 3NQ3A 1BWYA 3BS2A 2MO5A 2WWPA 4COTA 2YG2A 3C78X 3QKGA 4FGIB 1FEMA 2Q2PA 5LJDA 1X8OA 1RAVA 2X46A 4Z2PA 5LJHA 2X4MA 4AZMA 3NADA 2GTLM 3FENA 2OVDA 3P24A 3UEXA 2OFBA 5B10O 4OMWA 1KT3A 3WJEA 2RCTA 4TKHA 4LZVA 3UEWA 2RA6A 1SWGA 4GH7A 1BSOA 1UYNX 2BHVA 4TNNA 4WBKA 1DV9A 4BVMA 1HY2A 1QFVA 4U8UO 1MX8A 2HMBA 2OL7A 3HOEA 4GRJA 4IRWA 2F73A 3C76X 1JBHA 2AVIA 2BSZA 4GETA 1SY0A 3NX1A 3DTQA 4AZRA 3PP6A 1KL5A 1VYGA 3S5VA 1BLRA 1X71A 4NNTA 5AEOA 1ZNDA 3D95A 1LCVA 3P6EA 5F1EA 3STMX 4ZHDA 3U9PC 1MOYA 1A2DA 2RTQB 1NQNA 2CBRA 2OF9A 3CKFA 3S60A 4TJZA 1KZWA 1SWJA 4INNA 4ZHGA 1LELA 3BY0A 4GJVA 4Y0QA 1ZNGA 2RN4A 1FENA 1RXHA 5IRUA 3EM0A 4YBUA 4NLIA 3WYPA 4DQ3A 1SWHA 3P6HA 1SLEB 1KXOA 3FLLA 4IMNA 3OBLA 2LKKA 3WJBA 1I05A 3WJCA 2BT9A 3JS1A 4EKVA 4Z28A 2HZQA 3FR2A 4IB7A 1EPBA 5HTEA 2FKJA 1JYJA 1NP4A 1PBOA 4NNSA 2KTSA 1FELA 1ACDA 1SY1A 2E4JA 2RTLA 3CBCA 5CSEA 3HTYA 5F2BA 4ZHHA 1BM5A 1HQPA 3TGBA 2AT8X 3CMPA 1SLGB 4FBVA 3NR3A 2HNXA 4IABA 4CDCA 4ZJ0A 5HWZA 4QGVA 4YGHA 1G74A 3WJGA 5HZ6A 5KICA 1SY3A 4D6AA 3SOTA 1KL4A 5FFHA 1OPAA 3KFGA 2WSJA 1ERBA 1DF3A 1L6MA 1LIBA 1VWQB 3P02A 1X8PA 4N7DA 4ZH9A 5B29A 1LFOA 4YCEA 1QQSA 1SWFA 1I78A 4TKBA 2LBAA 1NGLA 4WFVA 4ZH6A 3X00A 3TGCA 2OY7A 4IB6A 4YFPA 1E2TA 2C1SA 5DG4A 4NYRA 3SZJA 3D4RA 3T2WA 4BQUA 3U03A 3HWGA 2JU3A 4ZCBA 2AKQA 4XMFA 3NX2A 4QGXA 5LJBA 1QY1A 1RSUB 2GTFX 1GKAA 1P6PA 3S5XA 4OKAA 3TGAA 2OZQA 1DF8A 2HYSA 3CWKA 1HQQA 3PECA 4CPIA 1CJ5A 1GT1A 3QQ2A 2CZUA 5H9NA 2AH7X 4GGRA 4MIRA 3HWFA 2JGSA 3PPTA 4GNWA 2HZRA 4K19A 5AJCA 3RDMA 4B55A 2FLJA 1DC9A 3WOVA 3KZAA 1VWIB 1SRFA 1PEEA 3RDOA 3NQKA 2OL8O 1JJJA 1D2UA 5HZ9A 2I5VO 1VPRA 4ZR2A 1R0UA 2Q9SA 4AZOA 4NLJA 5KHPA 3PH6A 3D96A 1G5WA 1BEBA 1GX3A 1QABE 1A57A 3HWEA 1VWJB 4D6BA 1UREA 2KT4B 5IO6A 1EW3A 1SWAA 3WZOA 1Y53X 2MM3A 2X8FA 3MX7A 4KCAA 3IA8A 2LA7A 1SWBA 3HK1A 4QRLA 4QZTA 3VHHA 5D8JA 1EUOA 4O4OA 3VG5A 4ARHA 1B8EA 2BS6A 1SWKA 2G5LA 4L3RA 4O3WA 1BSYA 2X45A 3B2IA 4IMOA 1DZJA 4U46A 4YKMA 3FELA 4Y5DA 5L8IA 4ZGFA 1LIDA 2ALLX 3PK2A 4YKOA 1SRIA 3B2JA 3FEPA 1LF7A 1GT5A 1IKEA 1GT3A 2AMMX 4YMYA 4QGWA 3S26A 2RTPB 5HBSA 3KQ0A 3WBGA 3ZWEA 1A3YA 3BLGA 3EC5A 5H8TA 1DZKA 2BLGA 1IJ8A 1AVDA 2IZKA 3FDCA 3PQSA 5HTDA 5HZ8A 1HBPA 2C1QA 2JN3A 2QCBA 4AZPA 4CDEA 2CM9A 4EEJA 1JZUA 2QOSC 3GAQA 2WPUA 3FA9A 1WUBA 1U17A 1SWCA 1VYOA 2FHNX 3H3IA 3KFFA 2VFCA 1NC9A 3GE2A 4QQ1A 5FQ6E 4AZNA 1JQPA 4GNYA 4I3BA 2PI3O 4QNIA 3ZZVA 4GZVA 4XMEA 3RE5A 3VE1A 1DFVA 4LQZA 1VWMB 1FE3A 2A2UA 2GTLO 4TKJA 4EQAC 1KFFA 2RTNB 4CPEA 1EIOA 1HN2A 2QOMA 3LHNA 4R0BA 1B4MA 1YUPA 2RTBB 3Q6LA 4JO6A 4YFQA 2NP1A 1UYOX 3RDQA 2FT9A 5AQ6A 1YWAA 4GE1A 5K68A 1GKAB 3P6CA 4HPDA 4CDDA 5L3YA 4I60A 1KQWA 4ON1A 3ZW0A 5BYPA 1KZXA 4N7CA 1SWSA 1ML7A 1E02A 1RSTB 2R56A 5B11O 4ML7B 3UAQA 1RXKA 4XMGA 1EIIA 1YIVA 5EDCA 4BGFA 4QAEA 3LV4A 1ADLA 2RTAA 4U8UN 1SWDA 4A1YA 4FBOA 5EZ2A 2FTBA 5F7GA 3T2XA 2XKLA 1LCWA 3CKGA 2FRSA 2A5BA 2Y3EA 2RTDB 5H9KA 3RZYA 2NNDA 1GM6A 3B2KA 3APUA 4UU2A 5B3MO 1QY2A 2WQAE 4ORRA 5H9LA 1MDCA 1VWPB 4Y0RA 5HA1A 1KT7A 3WZPA 1EI5A 1Y52X 3PDFA 4YDBA 4WFUA 2GH7A 4O4UA 2X8TA 3FIQA 1E00A 2IZIA 1GXAA 1JJUA 2IZAA 3FYFA 3STNA 2M4LA 1JIWI 2PY1A 4GDZA 1BJ7A 1RXJA 3NP1A 5D4AA 4OEMA 1SXYA 2RTEB 1SWUA 4L1NA 4HPCA 1SRHA 4GUZA 4YGGA 3V8UA 3ZUIA 3RKGA 1ZNEA 2FHLA 4MVKA 1LICA 4BX6A 1EQDA 2RTMA 2L68A 1MM9A 1IFCA 1N9MA 1AVGI 2K23A 2VFBA 1VYFA 2EU7X 3HPEA 4MVEA 4IAXA 2KD2A 1VWHB 4YGZA 1VWCB 4ZHFA 2WUTA 4AW8A 2N93A 1AB0A 5B27A 4O4SA 3T6FA 3VE2A 3RY1A 3WXQA 2Y32A 3FA8A 4WHIA 4ZGUA 1YP6A 1O8VA 3KFIA 2L67A 3P6GA 2POAA 1GT4A 2QO6A 4O4XA 3VG6A 3U0DA 4FQBB 2FWVA 3APVA 1DZMA 2RQ0A 1T0VA 3B2LA 3HOLA 4LKTA 2WEWA 3JQOA 1OEJA 1X8QA 2Q4NA 2L5PA 2MF6A 4GKCA 1DZPA 4C5PA 1BSQA 2ZSCA 3FA6A 4JHQA 4CDFA 5EDBA 4ZHCA 1G85A 1YWDA 4KIIA 2I5ZO 1SXUA 3C77X 1QWDA 1VWEB 1YP7A 2AL0X 4LKPA 3ZUOA 1YWBA 2F01A 4IB8A 5IO7A 4ORYA 2OL6O 3F6ZB 1GX9A 1KGLA 4GU8A 4EFGA 1CBQA 1G7NA 2RTGB 2OVSA 3MBTA 4OELA 4TLJA 1STPA 4XMHA 2X34A 4CV7A 4UU3A 5BVSA 2IZJA 5IRWA 1CBRA 2YMSA 4MEEA 2OY8A 3STKA 2ZAIA 3PH5A 4RUUA 3AKNA 1BRQA 3RDUA 1OEKA 5BVQA 2OYBO 2JU8A 2A13A 1UZ2X 4GJSA 2OFMX 1STRB 2WEXA 2MWHA 4BCSA 3BX8A 1XKIA 4LZUA 3RE6A 1BBPA 1Z24A 3UEUA 2IZDB 3AUMO 4MVLA 3FA7A 4BBOA 1AELA 2K62A 1SWRA 4I3DA 4OS0A 3L4RA 4OS8A 5CE4A 1VWFB 2WQ9A 5L8OA 1TOUA 1E06A 2NNQA 3BU1A 3VHIA 2AF5A 1TOWA 1WBIA 3BSZE 4IBAA 4DNEA 2FKGA 2IZBA 1SXXA 2OVAA 4ORWA 4Y0PA 5K67A 3RY2A 1PBYA 3NPOA 1FDQA 3FR5A 3NBXX 3NQ9A 1S7DA 5C0NA 3RWXA 3I17A 2A5CA 1U0XA 2O62A 1O1UA 5B2AO 3WZNA 1EXSA 4BX6B 4AZQA 5L8NA 2JOZA 2MHDA 5F6ZA 4CPFA 2RTRB 2GJ5A 1LUQA 1SXWA 1VWKB 1LNMA 2FS7A 4GD9A 4M7MA 4PSQA 2LB6A 2RTJA 2A2GA 4GK9A 3OJYC 3HWDA 5F6BA 1VWRB 2OFAA 5CHKA 3O2YA 2W2AA 5JD2A 5LKFA 4ES7A 5HAEA 4AYHA 2OVEA 2RD7C 4NV8A 3DSZA 2JU7A 1VWAB 4GDAA 1N9YA 1FTPA 2GTLN 2QM9A 4KT5A 3WVMA 4Z27A 4JNJA 3T1DA 2AT3X 2IZEB 1XCAA 2IFBA 4CSBA 1W6FA 2DJFA 1RBPA 2Y3FA 1X8UA 4A1HA 1SY2A 4HFOA 3E3CA 1X89A 1VWDB 3P6FA 1IFBA 3ZW1A 1OPBA 1EALA 1SLFB 4PJ2A 4O3ZA 4M6SA 3SLTA 2RTIB 3EYCA 3O22A 5LJGA 5KIDA 1HBQA 1ICNA 1NQMA 1I4UA 1IIUA 3JSQA 4Y59A 5AJBA 5LKEA 4A8ZA 1U18A 4O3YA 2X56A 5F58A 2W2FA 4Z2OA 1OSPO 2IZGB 2FR2A 5FQ8E 3WYQA 1SMPI 3VG7A 2LFOA 3KVNA 2R74A 1HMTA 1LCZA 1SA8A 2QO4A 2RCQA 2L9CA 5BVTA 2RTFB 1PTSA 4QYPA 1ICMA 1VWNB 3CQRA 1W4TA 5K06A 4YDAA 2OY1O 2ZAGA 2ACPX 5HZQA 2FS6A 3FIDA 3VG2A 1S2PA 2AT5X 2X8SA 2UYWA 1SWOA 4ODDA 4ORXA 3BRNA 3VGWA 3RDSA 4BOEA 1K3BA 3OE3A 4YCHA 2F09A 3EW2A 1ERXA 3LTWA 1SWEA 1ZNKA 4I95A 1VWOB 2A0AA 4O3XB 5CYBA 4U3QA 1PM1X 1E5PA 4YH0A 1VWGB 3SZHA 5B5FA 5EEEA 3ELZA 3K3LA 3F9DA 2VDFA 1CBIA 1CBSA 2CZTA 2KTDA 1SREA 2Z4HA 4CK4A 4ZFXA 4NW4A 3D9WA 2X32A 1KQXA 4O9SA 1MUPA 3FEKA 3RBYA 1JYDA 2Z4IA 4I9RA 1QFTA 2G7BA 2IZLB 1YWCA 1I06A 3ZW0B 4U8UM 5HCDC 3CQNA 3AKMA 2OFRX 4BX7A 4EDEA 2ANSA 1B0OA 4Z2VA 4JGLA 2IZFB 5FQ7E 1KT4A 3UEVA 1EPAA 1QY0A 1ZRYA 1VWBB 3ZI8A 1QG5A 4I3CA 1IKJA 1KT6A 3VG4A 2GC9A 1BRPA 3N91A 5FENA 4YFRA 5D45A 4IB9A 2HKDA 2Q2MA 1OBQA 4NP1A 4XMDA 2DM5A 4CPHA 4HPAA 5D48A 5EEDA 2MJIA 1SWTA 2ACOA 1N43A 2QMIA 2WR6A 4ORUA 1VWLB 5LJCA 2AT0X 4BX5A 3IFBA 2KW1A 1LIFA 4NV7A 4I6SA 1MVGA 5HCCC 2C4IA 3ZW1B 1Y55X 1IW2A 3SLOA 4YBPA 1HXZA 3B2HA 1D3SA 3Q34A 1RLBE 3APXA 3CBSA 5HCEC 1OBPA 4ALBA 4NYQA 4QYNA 3VPJE 2G78A 4YVBA 3OD9A 1X8NA 1NP1A 1N7YA 2X55A 2A8GA 1N0SA 3WJFA 3FW4A 4I9SA 5EPQA 1SRGA 4QZUA 2RTKA 1N4JA 2OY5O 3SAOA 3T6LA 1STSB 1LDOA 3ZW2A 1Y9TA 2FGSA 3MM0A 1AVEA 2DJGA 1I04A 3P6DA 4GGZA 3G7XA 5B5GA 3ELXA 2CM4A 2RTOB 3FW5A 1LDQA 2P8GA 4DCBA 1TVQA 2RTHB 1MEPA 1JMZA 4TQ2A 1SWQA 3EBWA 3VU1A 3TZSA 3TF6A 1A18A 3RSWA 1HMSA 2BS5A 2UZ2A 2RTCB 1B56A 5H9AA 1TXLA 1LPJA 3WJDA 5HZ5A 1OBUA 4IAWA 2W2BA 4A60A 1Y0GA 5IRAA 1T8VA 2BC3A 3CR6A 3EW1A 3MVFA 4MVIA 4FBRA 3APWA 1FJ1E 2ASNX 1CRBA 1LIEA 2CAMA 1HMRA 4Z6JA 1SLDB 2A3FX 3FR4A 5JR8A 5LJEA 4KC8A 3AEHA 4OS3A 1ALBA 3O19A 1SWPA 1PMPA 3VHMA 4XMCA 4BX7B 4DQ4A 2NNEA 3FMZA 1O1VA 1ZNLA 1TW4A 2LBVA 2R73A 1LKEA 1T68X 3SZIA 2JW1A
chains in the Genus database with same CATH topology
4OMXA 2XSTA 3BU9A 1AQBA 1H91A 1KT5A 2CBSA 4ORSA 1GGLA 2G79A 5D47A 4MISA 2AT6X 3BX7A 2JMBA 3I0AA 5LJKA 3PEDA 1KOIA 3EBKA 3ZQ3A 3PQUA 5FAZA 3VG3A 5IO5A 4EXZA 4U9CA 2HLVA 4Y0SA 5DPQA 3EMMA 2Q39A 4KH8A 1Y9LA 3D97A 3F8AA 3KFHA 1OEEA 1ZNHA 4HPBA 1GX8A 4RUNA 1JJXA 2FR3A 2QO5A 4ID2A 1MX7A 5HA0A 1JV4A 4KC7A 1S44A 4HWMA 4ALOA 3BDRA 3NQ3A 1BWYA 3BS2A 2MO5A 2WWPA 4COTA 2YG2A 3C78X 3QKGA 4FGIB 1FEMA 2Q2PA 5LJDA 1X8OA 2X46A 5LJHA 4AZMA 3NADA 2GTLM 3FENA 2OVDA 3P24A 3UEXA 4OMWA 1KT3A 3WJEA 2RCTA 4TKHA 4LZVA 3UEWA 2RA6A 4GH7A 1BSOA 2BHVA 4TNNA 4WBKA 1DV9A 4BVMA 1QFVA 4U8UO 1MX8A 2HMBA 3HOEA 4GRJA 2F73A 3C76X 1JBHA 4GETA 1SY0A 3NX1A 3DTQA 4AZRA 3PP6A 1VYGA 3S5VA 1BLRA 1X71A 4NNTA 5AEOA 1ZNDA 3D95A 3P6EA 5F1EA 3STMX 4ZHDA 3U9PC 3S60A 1A2DA 2CBRA 4TJZA 1KZWA 4INNA 4ZHGA 3BY0A 4Y0QA 1ZNGA 2RN4A 1FENA 3EM0A 4YBUA 4NLIA 4DQ3A 3P6HA 4IMNA 1KXOA 3FLLA 3WJCA 3OBLA 2LKKA 3WJBA 1I05A 2BT9A 3JS1A 2HZQA 3FR2A 4IB7A 1EPBA 5HTEA 1JYJA 1NP4A 1PBOA 4NNSA 2KTSA 1FELA 1ACDA 1SY1A 2E4JA 3CBCA 3HTYA 4ZHHA 1BM5A 1HQPA 3TGBA 2AT8X 3CMPA 4FBVA 4IABA 3NR3A 2HNXA 4ZJ0A 5HWZA 4QGVA 4YGHA 1G74A 3WJGA 5HZ6A 5KICA 1SY3A 4D6AA 3SOTA 5FFHA 1OPAA 3KFGA 2WSJA 1ERBA 1DF3A 1L6MA 1LIBA 3P02A 4N7DA 1X8PA 4ZH9A 5B29A 1LFOA 4YCEA 1QQSA 4TKBA 2LBAA 1NGLA 4WFVA 4ZH6A 3TGCA 4IB6A 4YFPA 4BQUA 5DG4A 4NYRA 3U03A 3D4RA 1JZUA 3HWGA 2JU3A 4ZCBA 2AKQA 4XMFA 3NX2A 4QGXA 5LJBA 1QY1A 2GTFX 1GKAA 1P6PA 3S5XA 3TGAA 2OZQA 2HYSA 3CWKA 1CJ5A 3PECA 1GT1A 5H9NA 2CZUA 2AH7X 4MIRA 3HWFA 3PPTA 4GNWA 2HZRA 4K19A 5AJCA 2FLJA 1DC9A 3WOVA 3KZAA 1JJJA 1PEEA 3NQKA 1D2UA 5HZ9A 1VPRA 4ZR2A 1R0UA 2Q9SA 4AZOA 4NLJA 5KHPA 3PH6A 3D96A 1G5WA 1BEBA 1QABE 1A57A 3HWEA 4D6BA 1UREA 2KT4B 5IO6A 1EW3A 2X8FA 2MM3A 3MX7A 4KCAA 3IA8A 2LA7A 4QRLA 3HK1A 4QZTA 5D8JA 1EUOA 4O4OA 3VG5A 4ARHA 1B8EA 2BS6A 4L3RA 4O3WA 1BSYA 2X45A 3B2IA 4IMOA 1DZJA 4YKMA 3FELA 5L8IA 4ZGFA 1LIDA 2ALLX 4YKOA 3B2JA 3FEPA 1LF7A 1GT5A 1IKEA 1GT3A 2AMMX 4YMYA 4QGWA 3S26A 5HBSA 3WBGA 3KQ0A 3ZWEA 1A3YA 3BLGA 5H8TA 1DZKA 2BLGA 5HTDA 3PQSA 5HZ8A 1HBPA 2JN3A 4AZPA 4EEJA 2CM9A 2QOSC 3GAQA 3FA9A 1U17A 3H3IA 3KFFA 4AZNA 4QQ1A 3GE2A 5FQ6E 4GNYA 4I3BA 4QNIA 3ZZVA 4GZVA 4XMEA 3VE1A 1DFVA 4LQZA 2A2UA 1FE3A 2GTLO 4TKJA 4EQAC 1EIOA 1HN2A 3LHNA 4R0BA 1B4MA 1YUPA 3Q6LA 4YFQA 2NP1A 2FT9A 5AQ6A 1YWAA 4GE1A 1GKAB 3P6CA 4HPDA 4ON1A 1KQWA 3ZW0A 5BYPA 1KZXA 4N7CA 1ML7A 1E02A 2R56A 3UAQA 4ML7B 4XMGA 1EIIA 1YIVA 5EDCA 4QAEA 3LV4A 1ADLA 4U8UN 4A1YA 4FBOA 5EZ2A 2FTBA 5F7GA 2XKLA 2FRSA 5H9KA 3RZYA 2NNDA 1GM6A 3B2KA 3APUA 4UU2A 1QY2A 2WQAE 4ORRA 5H9LA 1MDCA 4Y0RA 5HA1A 1KT7A 1EI5A 4YDBA 4WFUA 4O4UA 2X8TA 3FIQA 1E00A 1GXAA 3FYFA 3STNA 2M4LA 1JIWI 2PY1A 4GDZA 1BJ7A 3NP1A 5D4AA 1SXYA 4L1NA 4HPCA 4YGGA 3ZUIA 3V8UA 3RKGA 1ZNEA 4MVKA 1LICA 1EQDA 2L68A 1IFCA 2K23A 1AVGI 4O49A 1VYFA 2EU7X 4MVEA 4IAXA 2KD2A 4YGZA 4ZHFA 2WUTA 4AW8A 2N93A 1AB0A 5B27A 4O4SA 3VE2A 3WXQA 3FA8A 4WHIA 4ZGUA 1YP6A 1O8VA 3KFIA 2L67A 3P6GA 2POAA 1GT4A 2QO6A 4O4XA 3VG6A 3U0DA 4FQBB 2FWVA 3APVA 1DZMA 2RQ0A 1T0VA 3B2LA 3HOLA 4LKTA 2WEWA 3JQOA 1OEJA 1X8QA 2Q4NA 2L5PA 4GKCA 1DZPA 1BSQA 3FA6A 5EDBA 4ZHCA 1G85A 1YWDA 4KIIA 1SXUA 3C77X 1QWDA 1YP7A 4LKPA 2AL0X 3ZUOA 3ZW0B 1YWBA 5IO7A 4IB8A 4ORYA 3F6ZB 1GX9A 1KGLA 4GU8A 4EFGA 1CBQA 1G7NA 2OVSA 3MBTA 4TLJA 4XMHA 4CV7A 4UU3A 5BVSA 1CBRA 2YMSA 3STKA 2ZAIA 3PH5A 4RUUA 3AKNA 1BRQA 1OEKA 5BVQA 2JU8A 2A13A 1UZ2X 2OFMX 2WEXA 2MWHA 3BX8A 1XKIA 4LZUA 1BBPA 1Z24A 3UEUA 1AELA 4MVLA 3FA7A 2K62A 4I3DA 4OS0A 3L4RA 4OS8A 5CE4A 2WQ9A 5L8OA 1TOUA 1E06A 2NNQA 3BU1A 1TOWA 3BSZE 4IBAA 1SXXA 2OVAA 4ORWA 4Y0PA 3NPOA 1FDQA 3FR5A 3NBXX 3NQ9A 1S7DA 5C0NA 3RWXA 3I17A 1U0XA 2O62A 1O1UA 1EXSA 4AZQA 5L8NA 2JOZA 2MHDA 5F6ZA 2GJ5A 1SXWA 4M7MA 4PSQA 1LNMA 2FS7A 2LB6A 2A2GA 4GK9A 3OJYC 3HWDA 5F6BA 3O2YA 2W2AA 5LKFA 4ES7A 5HAEA 4AYHA 2OVEA 2RD7C 3DSZA 2JU7A 3WVMA 1FTPA 2GTLN 2QM9A 4KT5A 3T1DA 2AT3X 1XCAA 2IFBA 4CSBA 4A1HA 1RBPA 1X8UA 1SY2A 4HFOA 3E3CA 1X89A 3P6FA 1IFBA 3ZW1A 1OPBA 1EALA 4PJ2A 4O3ZA 4M6SA 5LJGA 3EYCA 3O22A 5KIDA 1HBQA 1ICNA 1I4UA 1IIUA 3JSQA 5AJBA 5LKEA 4A8ZA 1U18A 4O3YA 5F58A 2W2FA 2FR2A 5FQ8E 1SMPI 3VG7A 2LFOA 2R74A 1HMTA 1SA8A 2QO4A 2RCQA 5BVTA 2L9CA 4QYPA 1ICMA 3CQRA 5K06A 4YDAA 5HZQA 2ZAGA 2ACPX 2FS6A 3VG2A 1S2PA 2AT5X 2X8SA 4ODDA 4ORXA 3BRNA 4BOEA 3OE3A 4YCHA 2F09A 1ERXA 1ZNKA 4I95A 2A0AA 4O3XB 5CYBA 4U3QA 1PM1X 1E5PA 4YH0A 5EEEA 3ELZA 3K3LA 3F9DA 1CBIA 1CBSA 2CZTA 2KTDA 2Z4HA 4CK4A 4ZFXA 4NW4A 1KQXA 4O9SA 1MUPA 3FEKA 3RBYA 1JYDA 2Z4IA 4I9RA 1QFTA 2G7BA 1YWCA 1I06A 5HCDC 4U8UM 3CQNA 3AKMA 2OFRX 4EDEA 2ANSA 1B0OA 4JGLA 5FQ7E 1KT4A 3UEVA 1EPAA 1QY0A 1ZRYA 3ZI8A 1QG5A 4I3CA 1IKJA 1KT6A 3VG4A 2GC9A 1BRPA 3N91A 5FENA 4YFRA 5D45A 4IB9A 2Q2MA 1OBQA 4NP1A 4XMDA 2DM5A 4HPAA 5D48A 5EEDA 2MJIA 2ACOA 2QMIA 2WR6A 4ORUA 5LJCA 2AT0X 3IFBA 2KW1A 1LIFA 4I6SA 1MVGA 5HCCC 3ZW1B 1IW2A 4YBPA 3B2HA 1D3SA 1RLBE 3APXA 3CBSA 5HCEC 1OBPA 4ALBA 4NYQA 4QYNA 3VPJE 2G78A 3OD9A 1X8NA 1NP1A 1N0SA 3WJFA 3FW4A 4I9SA 5EPQA 4QZUA 3SAOA 3ZW2A 1Y9TA 1I04A 3P6DA 3G7XA 3ELXA 2CM4A 3FW5A 2P8GA 1TVQA 4TQ2A 3EBWA 3VU1A 3TZSA 3TF6A 1A18A 3RSWA 1HMSA 2BS5A 1B56A 5H9AA 1TXLA 1LPJA 3WJDA 5HZ5A 1OBUA 4IAWA 2W2BA 4A60A 1T8VA 3CR6A 3MVFA 4MVIA 4FBRA 3APWA 2ASNX 1CRBA 1LIEA 1HMRA 2A3FX 3FR4A 5JR8A 5LJEA 4KC8A 4OS3A 1ALBA 3O19A 1PMPA 4XMCA 4DQ4A 2NNEA 3FMZA 1O1VA 1ZNLA 1TW4A 2LBVA 2R73A 1LKEA 1T68X 2JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMX A;  2XST A;  3BU9 A;  1AQB A;  1H91 A;  1KT5 A;  2CBS A;  4ORS A;  1GGL A;  2G79 A;  5D47 A;  2AT6 X;  3BX7 A;  3I0A A;  5LJK A;  3PED A;  1KOI A;  3EBK A;  3ZQ3 A;  5FAZ A;  3VG3 A;  5IO5 A;  4EXZ A;  2HLV A;  4Y0S A;  5DPQ A;  3EMM A;  2Q39 A;  3D97 A;  3F8A A;  3KFH A;  1OEE A;  1ZNH A;  4HPB A;  1GX8 A;  4RUN A;  1JJX A;  2FR3 A;  2QO5 A;  5HA0 A;  1MX7 A;  1JV4 A;  4ALO A;  1S44 A;  3BDR A;  3NQ3 A;  1BWY A;  3BS2 A;  2MO5 A;  2WWP A;  2YG2 A;  3C78 X;  3QKG A;  1FEM A;  2Q2P A;  5LJD A;  1X8O A;  2X46 A;  5LJH A;  4AZM A;  3NAD A;  3FEN A;  2OVD A;  3UEX A;  4OMW A;  1KT3 A;  3WJE A;  2RCT A;  4TKH A;  4LZV A;  3UEW A;  2RA6 A;  4GH7 A;  1BSO A;  4WBK A;  4TNN A;  1DV9 A;  4BVM A;  1QFV A;  1MX8 A;  2HMB A;  4GRJ A;  2F73 A;  3C76 X;  1JBH A;  4GET A;  1SY0 A;  3NX1 A;  3DTQ A;  4AZR A;  3PP6 A;  1VYG A;  1BLR A;  1X71 A;  4NNT A;  1ZND A;  3D95 A;  3P6E A;  5F1E A;  3STM X;  4ZHD A;  3U9P C;  1A2D A;  2CBR A;  4TJZ A;  1KZW A;  4ZHG A;  3BY0 A;  4Y0Q A;  1ZNG A;  1FEN A;  3EM0 A;  4YBU A;  4NLI A;  4DQ3 A;  3P6H A;  4IMN A;  1KXO A;  3FLL A;  3WJC A;  2LKK A;  3WJB A;  1I05 A;  3JS1 A;  2HZQ A;  3FR2 A;  4IB7 A;  1EPB A;  5HTE A;  1JYJ A;  1NP4 A;  1PBO A;  4NNS A;  1FEL A;  1ACD A;  1SY1 A;  2E4J A;  3CBC A;  4ZHH A;  1BM5 A;  1HQP A;  3TGB A;  2AT8 X;  3CMP A;  5HWZ A;  3NR3 A;  2HNX A;  4ZJ0 A;  4QGV A;  4YGH A;  1G74 A;  3WJG A;  5HZ6 A;  5KIC A;  1SY3 A;  4D6A A;  5FFH A;  1OPA A;  3KFG A;  2WSJ A;  1ERB A;  1DF3 A;  1L6M A;  1LIB A;  4N7D A;  5B29 A;  1X8P A;  4ZH9 A;  1LFO A;  4YCE A;  1QQS A;  4TKB A;  2LBA A;  1NGL A;  4WFV A;  4ZH6 A;  3TGC A;  4IB6 A;  4YFP A;  4BQU A;  5DG4 A;  4NYR A;  3U03 A;  1JZU A;  3HWG A;  2JU3 A;  4ZCB A;  2AKQ A;  4XMF A;  3NX2 A;  4QGX A;  5LJB A;  1QY1 A;  2GTF X;  1GKA A;  1P6P A;  3TGA A;  2OZQ A;  2HYS A;  3CWK A;  1CJ5 A;  3PEC A;  1GT1 A;  5H9N A;  2CZU A;  2AH7 X;  3HWF A;  3PPT A;  4GNW A;  2HZR A;  4K19 A;  2FLJ A;  1DC9 A;  1JJJ A;  3KZA A;  1PEE A;  1D2U A;  5HZ9 A;  1VPR A;  4ZR2 A;  1R0U A;  2Q9S A;  4AZO A;  4NLJ A;  5KHP A;  3PH6 A;  3D96 A;  1G5W A;  1BEB A;  1QAB E;  1A57 A;  3HWE A;  4D6B A;  1URE A;  2KT4 B;  5IO6 A;  1EW3 A;  2MM3 A;  3IA8 A;  3HK1 A;  4QZT A;  5D8J A;  1EUO A;  4ARH A;  3VG5 A;  1B8E A;  1BSY A;  2X45 A;  3B2I A;  4IMO A;  1DZJ A;  4YKM A;  3FEL A;  5L8I A;  1LID A;  2ALL X;  4YKO A;  3B2J A;  3FEP A;  1LF7 A;  1GT5 A;  1IKE A;  1GT3 A;  2AMM X;  4YMY A;  4QGW A;  3S26 A;  5HBS A;  3WBG A;  3KQ0 A;  1A3Y A;  3BLG A;  5H8T A;  1DZK A;  2BLG A;  5HTD A;  5HZ8 A;  1HBP A;  2JN3 A;  4AZP A;  4EEJ A;  2CM9 A;  2QOS C;  3GAQ A;  3FA9 A;  1U17 A;  3KFF A;  4AZN A;  4GNY A;  4I3B A;  4XME A;  1DFV A;  2A2U A;  1FE3 A;  4TKJ A;  1EIO A;  1HN2 A;  4R0B A;  1B4M A;  1YUP A;  3Q6L A;  4YFQ A;  2NP1 A;  2FT9 A;  5AQ6 A;  1YWA A;  4GE1 A;  1GKA B;  3P6C A;  4HPD A;  1KQW A;  1KZX A;  4N7C A;  1ML7 A;  1E02 A;  2R56 A;  4XMG A;  1EII A;  1YIV A;  5EDC A;  4QAE A;  1ADL A;  4A1Y A;  5EZ2 A;  2FTB A;  5F7G A;  2XKL A;  2FRS A;  5H9K A;  3RZY A;  2NND A;  1GM6 A;  3B2K A;  3APU A;  4UU2 A;  1QY2 A;  2WQA E;  4ORR A;  5H9L A;  1MDC A;  4Y0R A;  5HA1 A;  1KT7 A;  4YDB A;  4WFU A;  3FIQ A;  1E00 A;  1GXA A;  3STN A;  2PY1 A;  1BJ7 A;  3NP1 A;  5D4A A;  1SXY A;  4HPC A;  4YGG A;  3ZUI A;  1ZNE A;  4MVK A;  1LIC A;  1EQD A;  2L68 A;  1IFC A;  2K23 A;  1AVG I;  1VYF A;  2EU7 X;  4YGZ A;  4IAX A;  4ZHF A;  2WUT A;  4AW8 A;  2N93 A;  1AB0 A;  5B27 A;  3WXQ A;  3FA8 A;  4ZGU A;  1YP6 A;  1O8V A;  3KFI A;  2L67 A;  3P6G A;  2POA A;  1GT4 A;  2QO6 A;  3VG6 A;  3U0D A;  2FWV A;  3APV A;  1DZM A;  2RQ0 A;  1T0V A;  3B2L A;  4LKT A;  2WEW A;  1OEJ A;  1X8Q A;  2Q4N A;  2L5P A;  4GKC A;  1DZP A;  1BSQ A;  3FA6 A;  5EDB A;  4ZHC A;  1G85 A;  1YWD A;  4KII A;  1SXU A;  3C77 X;  1QWD A;  1YP7 A;  4LKP A;  2AL0 X;  3ZUO A;  5IO7 A;  1YWB A;  4IB8 A;  4ORY A;  1GX9 A;  1KGL A;  4EFG A;  1CBQ A;  1G7N A;  3MBT A;  4TLJ A;  4XMH A;  4UU3 A;  5BVS A;  1CBR A;  3STK A;  3PH5 A;  4RUU A;  3AKN A;  1BRQ A;  1OEK A;  5BVQ A;  2JU8 A;  2A13 A;  1UZ2 X;  2OFM X;  2WEX A;  3BX8 A;  1XKI A;  4LZU A;  1BBP A;  1Z24 A;  3UEU A;  1AEL A;  4MVL A;  3FA7 A;  2K62 A;  4I3D A;  4OS0 A;  3L4R A;  4OS8 A;  5CE4 A;  2WQ9 A;  5L8O A;  1TOU A;  1E06 A;  2NNQ A;  3BU1 A;  1TOW A;  3BSZ E;  4IBA A;  1SXX A;  2OVA A;  4ORW A;  4Y0P A;  3NPO A;  1FDQ A;  3FR5 A;  3NQ9 A;  1S7D A;  5C0N A;  3I17 A;  1U0X A;  2O62 A;  1O1U A;  1EXS A;  4AZQ A;  5L8N A;  2JOZ A;  5F6Z A;  2GJ5 A;  1SXW A;  4M7M A;  4PSQ A;  1LNM A;  2FS7 A;  2LB6 A;  2A2G A;  3OJY C;  3HWD A;  5F6B A;  3O2Y A;  2W2A A;  5LKF A;  4ES7 A;  5HAE A;  4AYH A;  2OVE A;  2RD7 C;  3DSZ A;  2JU7 A;  3WVM A;  1FTP A;  2QM9 A;  3T1D A;  2AT3 X;  1XCA A;  2IFB A;  4A1H A;  1RBP A;  1X8U A;  1SY2 A;  4HFO A;  1X89 A;  3P6F A;  1IFB A;  1EAL A;  1OPB A;  4M6S A;  5LJG A;  3EYC A;  3O22 A;  5KID A;  1HBQ A;  1ICN A;  1I4U A;  1IIU A;  3JSQ A;  5LKE A;  4A8Z A;  1U18 A;  5F58 A;  2W2F A;  2FR2 A;  3VG7 A;  2LFO A;  2R74 A;  1HMT A;  1SA8 A;  2QO4 A;  2RCQ A;  5BVT A;  2L9C A;  4QYP A;  1ICM A;  3CQR A;  5K06 A;  4YDA A;  5HZQ A;  2ACP X;  2FS6 A;  3VG2 A;  1S2P A;  2AT5 X;  4ODD A;  4ORX A;  3BRN A;  4BOE A;  4YCH A;  1ERX A;  1ZNK A;  2A0A A;  1PM1 X;  1E5P A;  4YH0 A;  5EEE A;  3ELZ A;  3K3L A;  3F9D A;  1CBI A;  1CBS A;  2CZT A;  2KTD A;  4CK4 A;  4ZFX A;  1KQX A;  4O9S A;  1MUP A;  3FEK A;  1JYD A;  4I9R A;  1QFT A;  2G7B A;  1YWC A;  1I06 A;  5HCD C;  3CQN A;  3AKM A;  2OFR X;  4EDE A;  2ANS A;  1B0O A;  1KT4 A;  3UEV A;  1EPA A;  1QY0 A;  1ZRY A;  1QG5 A;  4I3C A;  1IKJ A;  1KT6 A;  3VG4 A;  2GC9 A;  1BRP A;  5FEN A;  4YFR A;  5D45 A;  4IB9 A;  2Q2M A;  1OBQ A;  4NP1 A;  4XMD A;  2DM5 A;  4HPA A;  5D48 A;  5EED A;  2MJI A;  2ACO A;  2WR6 A;  4ORU A;  5LJC A;  2AT0 X;  3IFB A;  1LIF A;  1MVG A;  5HCC C;  1IW2 A;  4YBP A;  3B2H A;  1D3S A;  1RLB E;  3APX A;  3CBS A;  5HCE C;  1OBP A;  4ALB A;  4NYQ A;  4QYN A;  2G78 A;  1X8N A;  1NP1 A;  1N0S A;  3WJF A;  3FW4 A;  4I9S A;  5EPQ A;  4QZU A;  3SAO A;  1I04 A;  3P6D A;  3G7X A;  3ELX A;  2CM4 A;  3FW5 A;  2P8G A;  1TVQ A;  4TQ2 A;  3EBW A;  3TZS A;  3TF6 A;  1A18 A;  3RSW A;  1HMS A;  1B56 A;  5H9A A;  1TXL A;  1LPJ A;  3WJD A;  5HZ5 A;  1OBU A;  4IAW A;  2W2B A;  4A60 A;  1T8V A;  3CR6 A;  3MVF A;  4MVI A;  3APW A;  2ASN X;  1CRB A;  1LIE A;  1HMR A;  2A3F X;  3FR4 A;  5JR8 A;  5LJE A;  4OS3 A;  1ALB A;  3O19 A;  1PMP A;  4XMC A;  4DQ4 A;  2NNE A;  3FMZ A;  1O1V A;  1ZNL A;  1TW4 A;  2LBV A;  2R73 A;  1LKE A;  1T68 X; 
#chains in the Genus database with same CATH topology
 2OF8 A;  4OMX A;  2XST A;  3BU9 A;  1AQB A;  1H91 A;  1KT5 A;  2CBS A;  4ORS A;  1GGL A;  1W5R A;  2G79 A;  5D47 A;  4MIS A;  2AT6 X;  3BX7 A;  2JMB A;  3I0A A;  4CPH B;  5IXG A;  4GGT A;  5LJK A;  1NDJ A;  1KOI A;  3PED A;  1NBX A;  3EBK A;  3ZQ3 A;  3PQU A;  5FAZ A;  3VG3 A;  5IO5 A;  4BX5 B;  4EXZ A;  4U9C A;  2HLV A;  2G8C O;  4Y0S A;  4BJ8 A;  5DPQ A;  1JMX A;  1SWL A;  3EMM A;  2Q39 A;  1SRJ A;  4KH8 A;  3WZQ A;  1Y9L A;  2IZH B;  1MK5 A;  3D97 A;  3F8A A;  1KL3 A;  3KFH A;  4O49 A;  1OEE A;  1ZNH A;  1SWN A;  1GX8 A;  3MG5 A;  4HPB A;  1HXL A;  4RUN A;  1JJX A;  2FR3 A;  3SLJ A;  2QO5 A;  4ID2 A;  1MX7 A;  5HA0 A;  1JV4 A;  1I9H A;  3RDX A;  2IZC B;  4KC7 A;  1K24 A;  1S44 A;  4HWM A;  4ALO A;  3BDR A;  3NQ3 A;  1BWY A;  3BS2 A;  2MO5 A;  2WWP A;  4COT A;  2YG2 A;  3C78 X;  3QKG A;  4FGI B;  1FEM A;  2Q2P A;  5LJD A;  1X8O A;  1RAV A;  2X46 A;  4Z2P A;  5LJH A;  2X4M A;  4AZM A;  3NAD A;  2GTL M;  3FEN A;  2OVD A;  3P24 A;  3UEX A;  2OFB A;  5B10 O;  4OMW A;  1KT3 A;  3WJE A;  2RCT A;  4TKH A;  4LZV A;  3UEW A;  2RA6 A;  1SWG A;  4GH7 A;  1BSO A;  1UYN X;  2BHV A;  4TNN A;  4WBK A;  1DV9 A;  4BVM A;  1HY2 A;  1QFV A;  4U8U O;  1MX8 A;  2HMB A;  2OL7 A;  3HOE A;  4GRJ A;  4IRW A;  2F73 A;  3C76 X;  1JBH A;  2AVI A;  2BSZ A;  4GET A;  1SY0 A;  3NX1 A;  3DTQ A;  4AZR A;  3PP6 A;  1KL5 A;  1VYG A;  3S5V A;  1BLR A;  1X71 A;  4NNT A;  5AEO A;  1ZND A;  3D95 A;  1LCV A;  3P6E A;  5F1E A;  3STM X;  4ZHD A;  3U9P C;  1MOY A;  1A2D A;  2RTQ B;  1NQN A;  2CBR A;  2OF9 A;  3CKF A;  3S60 A;  4TJZ A;  1KZW A;  1SWJ A;  4INN A;  4ZHG A;  1LEL A;  3BY0 A;  4GJV A;  4Y0Q A;  1ZNG A;  2RN4 A;  1FEN A;  1RXH A;  5IRU A;  3EM0 A;  4YBU A;  4NLI A;  3WYP A;  4DQ3 A;  1SWH A;  3P6H A;  1SLE B;  1KXO A;  3FLL A;  4IMN A;  3OBL A;  2LKK A;  3WJB A;  1I05 A;  3WJC A;  2BT9 A;  3JS1 A;  4EKV A;  4Z28 A;  2HZQ A;  3FR2 A;  4IB7 A;  1EPB A;  5HTE A;  2FKJ A;  1JYJ A;  1NP4 A;  1PBO A;  4NNS A;  2KTS A;  1FEL A;  1ACD A;  1SY1 A;  2E4J A;  2RTL A;  3CBC A;  5CSE A;  3HTY A;  5F2B A;  4ZHH A;  1BM5 A;  1HQP A;  3TGB A;  2AT8 X;  3CMP A;  1SLG B;  4FBV A;  3NR3 A;  2HNX A;  4IAB A;  4CDC A;  4ZJ0 A;  5HWZ A;  4QGV A;  4YGH A;  1G74 A;  3WJG A;  5HZ6 A;  5KIC A;  1SY3 A;  4D6A A;  3SOT A;  1KL4 A;  5FFH A;  1OPA A;  3KFG A;  2WSJ A;  1ERB A;  1DF3 A;  1L6M A;  1LIB A;  1VWQ B;  3P02 A;  1X8P A;  4N7D A;  4ZH9 A;  5B29 A;  1LFO A;  4YCE A;  1QQS A;  1SWF A;  1I78 A;  4TKB A;  2LBA A;  1NGL A;  4WFV A;  4ZH6 A;  3X00 A;  3TGC A;  2OY7 A;  4IB6 A;  4YFP A;  1E2T A;  2C1S A;  5DG4 A;  4NYR A;  3SZJ A;  3D4R A;  3T2W A;  4BQU A;  3U03 A;  3HWG A;  2JU3 A;  4ZCB A;  2AKQ A;  4XMF A;  3NX2 A;  4QGX A;  5LJB A;  1QY1 A;  1RSU B;  2GTF X;  1GKA A;  1P6P A;  3S5X A;  4OKA A;  3TGA A;  2OZQ A;  1DF8 A;  2HYS A;  3CWK A;  1HQQ A;  3PEC A;  4CPI A;  1CJ5 A;  1GT1 A;  3QQ2 A;  2CZU A;  5H9N A;  2AH7 X;  4GGR A;  4MIR A;  3HWF A;  2JGS A;  3PPT A;  4GNW A;  2HZR A;  4K19 A;  5AJC A;  3RDM A;  4B55 A;  2FLJ A;  1DC9 A;  3WOV A;  3KZA A;  1VWI B;  1SRF A;  1PEE A;  3RDO A;  3NQK A;  2OL8 O;  1JJJ A;  1D2U A;  5HZ9 A;  2I5V O;  1VPR A;  4ZR2 A;  1R0U A;  2Q9S A;  4AZO A;  4NLJ A;  5KHP A;  3PH6 A;  3D96 A;  1G5W A;  1BEB A;  1GX3 A;  1QAB E;  1A57 A;  3HWE A;  1VWJ B;  4D6B A;  1URE A;  2KT4 B;  5IO6 A;  1EW3 A;  1SWA A;  3WZO A;  1Y53 X;  2MM3 A;  2X8F A;  3MX7 A;  4KCA A;  3IA8 A;  2LA7 A;  1SWB A;  3HK1 A;  4QRL A;  4QZT A;  3VHH A;  5D8J A;  1EUO A;  4O4O A;  3VG5 A;  4ARH A;  1B8E A;  2BS6 A;  1SWK A;  2G5L A;  4L3R A;  4O3W A;  1BSY A;  2X45 A;  3B2I A;  4IMO A;  1DZJ A;  4U46 A;  4YKM A;  3FEL A;  4Y5D A;  5L8I A;  4ZGF A;  1LID A;  2ALL X;  3PK2 A;  4YKO A;  1SRI A;  3B2J A;  3FEP A;  1LF7 A;  1GT5 A;  1IKE A;  1GT3 A;  2AMM X;  4YMY A;  4QGW A;  3S26 A;  2RTP B;  5HBS A;  3KQ0 A;  3WBG A;  3ZWE A;  1A3Y A;  3BLG A;  3EC5 A;  5H8T A;  1DZK A;  2BLG A;  1IJ8 A;  1AVD A;  2IZK A;  3FDC A;  3PQS A;  5HTD A;  5HZ8 A;  1HBP A;  2C1Q A;  2JN3 A;  2QCB A;  4AZP A;  4CDE A;  2CM9 A;  4EEJ A;  1JZU A;  2QOS C;  3GAQ A;  2WPU A;  3FA9 A;  1WUB A;  1U17 A;  1SWC A;  1VYO A;  2FHN X;  3H3I A;  3KFF A;  2VFC A;  1NC9 A;  3GE2 A;  4QQ1 A;  5FQ6 E;  4AZN A;  1JQP A;  4GNY A;  4I3B A;  2PI3 O;  4QNI A;  3ZZV A;  4GZV A;  4XME A;  3RE5 A;  3VE1 A;  1DFV A;  4LQZ A;  1VWM B;  1FE3 A;  2A2U A;  2GTL O;  4TKJ A;  4EQA C;  1KFF A;  2RTN B;  4CPE A;  1EIO A;  1HN2 A;  2QOM A;  3LHN A;  4R0B A;  1B4M A;  1YUP A;  2RTB B;  3Q6L A;  4JO6 A;  4YFQ A;  2NP1 A;  1UYO X;  3RDQ A;  2FT9 A;  5AQ6 A;  1YWA A;  4GE1 A;  5K68 A;  1GKA B;  3P6C A;  4HPD A;  4CDD A;  5L3Y A;  4I60 A;  1KQW A;  4ON1 A;  3ZW0 A;  5BYP A;  1KZX A;  4N7C A;  1SWS A;  1ML7 A;  1E02 A;  1RST B;  2R56 A;  5B11 O;  4ML7 B;  3UAQ A;  1RXK A;  4XMG A;  1EII A;  1YIV A;  5EDC A;  4BGF A;  4QAE A;  3LV4 A;  1ADL A;  2RTA A;  4U8U N;  1SWD A;  4A1Y A;  4FBO A;  5EZ2 A;  2FTB A;  5F7G A;  3T2X A;  2XKL A;  1LCW A;  3CKG A;  2FRS A;  2A5B A;  2Y3E A;  2RTD B;  5H9K A;  3RZY A;  2NND A;  1GM6 A;  3B2K A;  3APU A;  4UU2 A;  5B3M O;  1QY2 A;  2WQA E;  4ORR A;  5H9L A;  1MDC A;  1VWP B;  4Y0R A;  5HA1 A;  1KT7 A;  3WZP A;  1EI5 A;  1Y52 X;  3PDF A;  4YDB A;  4WFU A;  2GH7 A;  4O4U A;  2X8T A;  3FIQ A;  1E00 A;  2IZI A;  1GXA A;  1JJU A;  2IZA A;  3FYF A;  3STN A;  2M4L A;  1JIW I;  2PY1 A;  4GDZ A;  1BJ7 A;  1RXJ A;  3NP1 A;  5D4A A;  4OEM A;  1SXY A;  2RTE B;  1SWU A;  4L1N A;  4HPC A;  1SRH A;  4GUZ A;  4YGG A;  3V8U A;  3ZUI A;  3RKG A;  1ZNE A;  2FHL A;  4MVK A;  1LIC A;  4BX6 A;  1EQD A;  2RTM A;  2L68 A;  1MM9 A;  1IFC A;  1N9M A;  1AVG I;  2K23 A;  2VFB A;  1VYF A;  2EU7 X;  3HPE A;  4MVE A;  4IAX A;  2KD2 A;  1VWH B;  4YGZ A;  1VWC B;  4ZHF A;  2WUT A;  4AW8 A;  2N93 A;  1AB0 A;  5B27 A;  4O4S A;  3T6F A;  3VE2 A;  3RY1 A;  3WXQ A;  2Y32 A;  3FA8 A;  4WHI A;  4ZGU A;  1YP6 A;  1O8V A;  3KFI A;  2L67 A;  3P6G A;  2POA A;  1GT4 A;  2QO6 A;  4O4X A;  3VG6 A;  3U0D A;  4FQB B;  2FWV A;  3APV A;  1DZM A;  2RQ0 A;  1T0V A;  3B2L A;  3HOL A;  4LKT A;  2WEW A;  3JQO A;  1OEJ A;  1X8Q A;  2Q4N A;  2L5P A;  2MF6 A;  4GKC A;  1DZP A;  4C5P A;  1BSQ A;  2ZSC A;  3FA6 A;  4JHQ A;  4CDF A;  5EDB A;  4ZHC A;  1G85 A;  1YWD A;  4KII A;  2I5Z O;  1SXU A;  3C77 X;  1QWD A;  1VWE B;  1YP7 A;  2AL0 X;  4LKP A;  3ZUO A;  1YWB A;  2F01 A;  4IB8 A;  5IO7 A;  4ORY A;  2OL6 O;  3F6Z B;  1GX9 A;  1KGL A;  4GU8 A;  4EFG A;  1CBQ A;  1G7N A;  2RTG B;  2OVS A;  3MBT A;  4OEL A;  4TLJ A;  1STP A;  4XMH A;  2X34 A;  4CV7 A;  4UU3 A;  5BVS A;  2IZJ A;  5IRW A;  1CBR A;  2YMS A;  4MEE A;  2OY8 A;  3STK A;  2ZAI A;  3PH5 A;  4RUU A;  3AKN A;  1BRQ A;  3RDU A;  1OEK A;  5BVQ A;  2OYB O;  2JU8 A;  2A13 A;  1UZ2 X;  4GJS A;  2OFM X;  1STR B;  2WEX A;  2MWH A;  4BCS A;  3BX8 A;  1XKI A;  4LZU A;  3RE6 A;  1BBP A;  1Z24 A;  3UEU A;  2IZD B;  3AUM O;  4MVL A;  3FA7 A;  4BBO A;  1AEL A;  2K62 A;  1SWR A;  4I3D A;  4OS0 A;  3L4R A;  4OS8 A;  5CE4 A;  1VWF B;  2WQ9 A;  5L8O A;  1TOU A;  1E06 A;  2NNQ A;  3BU1 A;  3VHI A;  2AF5 A;  1TOW A;  1WBI A;  3BSZ E;  4IBA A;  4DNE A;  2FKG A;  2IZB A;  1SXX A;  2OVA A;  4ORW A;  4Y0P A;  5K67 A;  3RY2 A;  1PBY A;  3NPO A;  1FDQ A;  3FR5 A;  3NBX X;  3NQ9 A;  1S7D A;  5C0N A;  3RWX A;  3I17 A;  2A5C A;  1U0X A;  2O62 A;  1O1U A;  5B2A O;  3WZN A;  1EXS A;  4BX6 B;  4AZQ A;  5L8N A;  2JOZ A;  2MHD A;  5F6Z A;  4CPF A;  2RTR B;  2GJ5 A;  1LUQ A;  1SXW A;  1VWK B;  1LNM A;  2FS7 A;  4GD9 A;  4M7M A;  4PSQ A;  2LB6 A;  2RTJ A;  2A2G A;  4GK9 A;  3OJY C;  3HWD A;  5F6B A;  1VWR B;  2OFA A;  5CHK A;  3O2Y A;  2W2A A;  5JD2 A;  5LKF A;  4ES7 A;  5HAE A;  4AYH A;  2OVE A;  2RD7 C;  4NV8 A;  3DSZ A;  2JU7 A;  1VWA B;  4GDA A;  1N9Y A;  1FTP A;  2GTL N;  2QM9 A;  4KT5 A;  3WVM A;  4Z27 A;  4JNJ A;  3T1D A;  2AT3 X;  2IZE B;  1XCA A;  2IFB A;  4CSB A;  1W6F A;  2DJF A;  1RBP A;  2Y3F A;  1X8U A;  4A1H A;  1SY2 A;  4HFO A;  3E3C A;  1X89 A;  1VWD B;  3P6F A;  1IFB A;  3ZW1 A;  1OPB A;  1EAL A;  1SLF B;  4PJ2 A;  4O3Z A;  4M6S A;  3SLT A;  2RTI B;  3EYC A;  3O22 A;  5LJG A;  5KID A;  1HBQ A;  1ICN A;  1NQM A;  1I4U A;  1IIU A;  3JSQ A;  4Y59 A;  5AJB A;  5LKE A;  4A8Z A;  1U18 A;  4O3Y A;  2X56 A;  5F58 A;  2W2F A;  4Z2O A;  1OSP O;  2IZG B;  2FR2 A;  5FQ8 E;  3WYQ A;  1SMP I;  3VG7 A;  2LFO A;  3KVN A;  2R74 A;  1HMT A;  1LCZ A;  1SA8 A;  2QO4 A;  2RCQ A;  2L9C A;  5BVT A;  2RTF B;  1PTS A;  4QYP A;  1ICM A;  1VWN B;  3CQR A;  1W4T A;  5K06 A;  4YDA A;  2OY1 O;  2ZAG A;  2ACP X;  5HZQ A;  2FS6 A;  3FID A;  3VG2 A;  1S2P A;  2AT5 X;  2X8S A;  2UYW A;  1SWO A;  4ODD A;  4ORX A;  3BRN A;  3VGW A;  3RDS A;  4BOE A;  1K3B A;  3OE3 A;  4YCH A;  2F09 A;  3EW2 A;  1ERX A;  3LTW A;  1SWE A;  1ZNK A;  4I95 A;  1VWO B;  2A0A A;  4O3X B;  5CYB A;  4U3Q A;  1PM1 X;  1E5P A;  4YH0 A;  1VWG B;  3SZH A;  5B5F A;  5EEE A;  3ELZ A;  3K3L A;  3F9D A;  2VDF A;  1CBI A;  1CBS A;  2CZT A;  2KTD A;  1SRE A;  2Z4H A;  4CK4 A;  4ZFX A;  4NW4 A;  3D9W A;  2X32 A;  1KQX A;  4O9S A;  1MUP A;  3FEK A;  3RBY A;  1JYD A;  2Z4I A;  4I9R A;  1QFT A;  2G7B A;  2IZL B;  1YWC A;  1I06 A;  3ZW0 B;  4U8U M;  5HCD C;  3CQN A;  3AKM A;  2OFR X;  4BX7 A;  4EDE A;  2ANS A;  1B0O A;  4Z2V A;  4JGL A;  2IZF B;  5FQ7 E;  1KT4 A;  3UEV A;  1EPA A;  1QY0 A;  1ZRY A;  1VWB B;  3ZI8 A;  1QG5 A;  4I3C A;  1IKJ A;  1KT6 A;  3VG4 A;  2GC9 A;  1BRP A;  3N91 A;  5FEN A;  4YFR A;  5D45 A;  4IB9 A;  2HKD A;  2Q2M A;  1OBQ A;  4NP1 A;  4XMD A;  2DM5 A;  4CPH A;  4HPA A;  5D48 A;  5EED A;  2MJI A;  1SWT A;  2ACO A;  1N43 A;  2QMI A;  2WR6 A;  4ORU A;  1VWL B;  5LJC A;  2AT0 X;  4BX5 A;  3IFB A;  2KW1 A;  1LIF A;  4NV7 A;  4I6S A;  1MVG A;  5HCC C;  2C4I A;  3ZW1 B;  1Y55 X;  1IW2 A;  3SLO A;  4YBP A;  1HXZ A;  3B2H A;  1D3S A;  3Q34 A;  1RLB E;  3APX A;  3CBS A;  5HCE C;  1OBP A;  4ALB A;  4NYQ A;  4QYN A;  3VPJ E;  2G78 A;  4YVB A;  3OD9 A;  1X8N A;  1NP1 A;  1N7Y A;  2X55 A;  2A8G A;  1N0S A;  3WJF A;  3FW4 A;  4I9S A;  5EPQ A;  1SRG A;  4QZU A;  2RTK A;  1N4J A;  2OY5 O;  3SAO A;  3T6L A;  1STS B;  1LDO A;  3ZW2 A;  1Y9T A;  2FGS A;  3MM0 A;  1AVE A;  2DJG A;  1I04 A;  3P6D A;  4GGZ A;  3G7X A;  5B5G A;  3ELX A;  2CM4 A;  2RTO B;  3FW5 A;  1LDQ A;  2P8G A;  4DCB A;  1TVQ A;  2RTH B;  1MEP A;  1JMZ A;  4TQ2 A;  1SWQ A;  3EBW A;  3VU1 A;  3TZS A;  3TF6 A;  1A18 A;  3RSW A;  1HMS A;  2BS5 A;  2UZ2 A;  2RTC B;  1B56 A;  5H9A A;  1TXL A;  1LPJ A;  3WJD A;  5HZ5 A;  1OBU A;  4IAW A;  2W2B A;  4A60 A;  1Y0G A;  5IRA A;  1T8V A;  2BC3 A;  3CR6 A;  3EW1 A;  3MVF A;  4MVI A;  4FBR A;  3APW A;  1FJ1 E;  2ASN X;  1CRB A;  1LIE A;  2CAM A;  1HMR A;  4Z6J A;  1SLD B;  2A3F X;  3FR4 A;  5JR8 A;  5LJE A;  4KC8 A;  3AEH A;  4OS3 A;  1ALB A;  3O19 A;  1SWP A;  1PMP A;  3VHM A;  4XMC A;  4BX7 B;  4DQ4 A;  2NNE A;  3FMZ A;  1O1V A;  1ZNL A;  1TW4 A;  2LBV A;  2R73 A;  1LKE A;  1T68 X;  3SZI A;  2JW1 A; 
#chains in the Genus database with same CATH homology
 4OMX A;  2XST A;  3BU9 A;  1AQB A;  1H91 A;  1KT5 A;  2CBS A;  4ORS A;  1GGL A;  2G79 A;  5D47 A;  4MIS A;  2AT6 X;  3BX7 A;  2JMB A;  3I0A A;  5LJK A;  3PED A;  1KOI A;  3EBK A;  3ZQ3 A;  3PQU A;  5FAZ A;  3VG3 A;  5IO5 A;  4EXZ A;  4U9C A;  2HLV A;  4Y0S A;  5DPQ A;  3EMM A;  2Q39 A;  4KH8 A;  1Y9L A;  3D97 A;  3F8A A;  3KFH A;  1OEE A;  1ZNH A;  4HPB A;  1GX8 A;  4RUN A;  1JJX A;  2FR3 A;  2QO5 A;  4ID2 A;  1MX7 A;  5HA0 A;  1JV4 A;  4KC7 A;  1S44 A;  4HWM A;  4ALO A;  3BDR A;  3NQ3 A;  1BWY A;  3BS2 A;  2MO5 A;  2WWP A;  4COT A;  2YG2 A;  3C78 X;  3QKG A;  4FGI B;  1FEM A;  2Q2P A;  5LJD A;  1X8O A;  2X46 A;  5LJH A;  4AZM A;  3NAD A;  2GTL M;  3FEN A;  2OVD A;  3P24 A;  3UEX A;  4OMW A;  1KT3 A;  3WJE A;  2RCT A;  4TKH A;  4LZV A;  3UEW A;  2RA6 A;  4GH7 A;  1BSO A;  2BHV A;  4TNN A;  4WBK A;  1DV9 A;  4BVM A;  1QFV A;  4U8U O;  1MX8 A;  2HMB A;  3HOE A;  4GRJ A;  2F73 A;  3C76 X;  1JBH A;  4GET A;  1SY0 A;  3NX1 A;  3DTQ A;  4AZR A;  3PP6 A;  1VYG A;  3S5V A;  1BLR A;  1X71 A;  4NNT A;  5AEO A;  1ZND A;  3D95 A;  3P6E A;  5F1E A;  3STM X;  4ZHD A;  3U9P C;  3S60 A;  1A2D A;  2CBR A;  4TJZ A;  1KZW A;  4INN A;  4ZHG A;  3BY0 A;  4Y0Q A;  1ZNG A;  2RN4 A;  1FEN A;  3EM0 A;  4YBU A;  4NLI A;  4DQ3 A;  3P6H A;  4IMN A;  1KXO A;  3FLL A;  3WJC A;  3OBL A;  2LKK A;  3WJB A;  1I05 A;  2BT9 A;  3JS1 A;  2HZQ A;  3FR2 A;  4IB7 A;  1EPB A;  5HTE A;  1JYJ A;  1NP4 A;  1PBO A;  4NNS A;  2KTS A;  1FEL A;  1ACD A;  1SY1 A;  2E4J A;  3CBC A;  3HTY A;  4ZHH A;  1BM5 A;  1HQP A;  3TGB A;  2AT8 X;  3CMP A;  4FBV A;  4IAB A;  3NR3 A;  2HNX A;  4ZJ0 A;  5HWZ A;  4QGV A;  4YGH A;  1G74 A;  3WJG A;  5HZ6 A;  5KIC A;  1SY3 A;  4D6A A;  3SOT A;  5FFH A;  1OPA A;  3KFG A;  2WSJ A;  1ERB A;  1DF3 A;  1L6M A;  1LIB A;  3P02 A;  4N7D A;  1X8P A;  4ZH9 A;  5B29 A;  1LFO A;  4YCE A;  1QQS A;  4TKB A;  2LBA A;  1NGL A;  4WFV A;  4ZH6 A;  3TGC A;  4IB6 A;  4YFP A;  4BQU A;  5DG4 A;  4NYR A;  3U03 A;  3D4R A;  1JZU A;  3HWG A;  2JU3 A;  4ZCB A;  2AKQ A;  4XMF A;  3NX2 A;  4QGX A;  5LJB A;  1QY1 A;  2GTF X;  1GKA A;  1P6P A;  3S5X A;  3TGA A;  2OZQ A;  2HYS A;  3CWK A;  1CJ5 A;  3PEC A;  1GT1 A;  5H9N A;  2CZU A;  2AH7 X;  4MIR A;  3HWF A;  3PPT A;  4GNW A;  2HZR A;  4K19 A;  5AJC A;  2FLJ A;  1DC9 A;  3WOV A;  3KZA A;  1JJJ A;  1PEE A;  3NQK A;  1D2U A;  5HZ9 A;  1VPR A;  4ZR2 A;  1R0U A;  2Q9S A;  4AZO A;  4NLJ A;  5KHP A;  3PH6 A;  3D96 A;  1G5W A;  1BEB A;  1QAB E;  1A57 A;  3HWE A;  4D6B A;  1URE A;  2KT4 B;  5IO6 A;  1EW3 A;  2X8F A;  2MM3 A;  3MX7 A;  4KCA A;  3IA8 A;  2LA7 A;  4QRL A;  3HK1 A;  4QZT A;  5D8J A;  1EUO A;  4O4O A;  3VG5 A;  4ARH A;  1B8E A;  2BS6 A;  4L3R A;  4O3W A;  1BSY A;  2X45 A;  3B2I A;  4IMO A;  1DZJ A;  4YKM A;  3FEL A;  5L8I A;  4ZGF A;  1LID A;  2ALL X;  4YKO A;  3B2J A;  3FEP A;  1LF7 A;  1GT5 A;  1IKE A;  1GT3 A;  2AMM X;  4YMY A;  4QGW A;  3S26 A;  5HBS A;  3WBG A;  3KQ0 A;  3ZWE A;  1A3Y A;  3BLG A;  5H8T A;  1DZK A;  2BLG A;  5HTD A;  3PQS A;  5HZ8 A;  1HBP A;  2JN3 A;  4AZP A;  4EEJ A;  2CM9 A;  2QOS C;  3GAQ A;  3FA9 A;  1U17 A;  3H3I A;  3KFF A;  4AZN A;  4QQ1 A;  3GE2 A;  5FQ6 E;  4GNY A;  4I3B A;  4QNI A;  3ZZV A;  4GZV A;  4XME A;  3VE1 A;  1DFV A;  4LQZ A;  2A2U A;  1FE3 A;  2GTL O;  4TKJ A;  4EQA C;  1EIO A;  1HN2 A;  3LHN A;  4R0B A;  1B4M A;  1YUP A;  3Q6L A;  4YFQ A;  2NP1 A;  2FT9 A;  5AQ6 A;  1YWA A;  4GE1 A;  1GKA B;  3P6C A;  4HPD A;  4ON1 A;  1KQW A;  3ZW0 A;  5BYP A;  1KZX A;  4N7C A;  1ML7 A;  1E02 A;  2R56 A;  3UAQ A;  4ML7 B;  4XMG A;  1EII A;  1YIV A;  5EDC A;  4QAE A;  3LV4 A;  1ADL A;  4U8U N;  4A1Y A;  4FBO A;  5EZ2 A;  2FTB A;  5F7G A;  2XKL A;  2FRS A;  5H9K A;  3RZY A;  2NND A;  1GM6 A;  3B2K A;  3APU A;  4UU2 A;  1QY2 A;  2WQA E;  4ORR A;  5H9L A;  1MDC A;  4Y0R A;  5HA1 A;  1KT7 A;  1EI5 A;  4YDB A;  4WFU A;  4O4U A;  2X8T A;  3FIQ A;  1E00 A;  1GXA A;  3FYF A;  3STN A;  2M4L A;  1JIW I;  2PY1 A;  4GDZ A;  1BJ7 A;  3NP1 A;  5D4A A;  1SXY A;  4L1N A;  4HPC A;  4YGG A;  3ZUI A;  3V8U A;  3RKG A;  1ZNE A;  4MVK A;  1LIC A;  1EQD A;  2L68 A;  1IFC A;  2K23 A;  1AVG I;  4O49 A;  1VYF A;  2EU7 X;  4MVE A;  4IAX A;  2KD2 A;  4YGZ A;  4ZHF A;  2WUT A;  4AW8 A;  2N93 A;  1AB0 A;  5B27 A;  4O4S A;  3VE2 A;  3WXQ A;  3FA8 A;  4WHI A;  4ZGU A;  1YP6 A;  1O8V A;  3KFI A;  2L67 A;  3P6G A;  2POA A;  1GT4 A;  2QO6 A;  4O4X A;  3VG6 A;  3U0D A;  4FQB B;  2FWV A;  3APV A;  1DZM A;  2RQ0 A;  1T0V A;  3B2L A;  3HOL A;  4LKT A;  2WEW A;  3JQO A;  1OEJ A;  1X8Q A;  2Q4N A;  2L5P A;  4GKC A;  1DZP A;  1BSQ A;  3FA6 A;  5EDB A;  4ZHC A;  1G85 A;  1YWD A;  4KII A;  1SXU A;  3C77 X;  1QWD A;  1YP7 A;  4LKP A;  2AL0 X;  3ZUO A;  3ZW0 B;  1YWB A;  5IO7 A;  4IB8 A;  4ORY A;  3F6Z B;  1GX9 A;  1KGL A;  4GU8 A;  4EFG A;  1CBQ A;  1G7N A;  2OVS A;  3MBT A;  4TLJ A;  4XMH A;  4CV7 A;  4UU3 A;  5BVS A;  1CBR A;  2YMS A;  3STK A;  2ZAI A;  3PH5 A;  4RUU A;  3AKN A;  1BRQ A;  1OEK A;  5BVQ A;  2JU8 A;  2A13 A;  1UZ2 X;  2OFM X;  2WEX A;  2MWH A;  3BX8 A;  1XKI A;  4LZU A;  1BBP A;  1Z24 A;  3UEU A;  1AEL A;  4MVL A;  3FA7 A;  2K62 A;  4I3D A;  4OS0 A;  3L4R A;  4OS8 A;  5CE4 A;  2WQ9 A;  5L8O A;  1TOU A;  1E06 A;  2NNQ A;  3BU1 A;  1TOW A;  3BSZ E;  4IBA A;  1SXX A;  2OVA A;  4ORW A;  4Y0P A;  3NPO A;  1FDQ A;  3FR5 A;  3NBX X;  3NQ9 A;  1S7D A;  5C0N A;  3RWX A;  3I17 A;  1U0X A;  2O62 A;  1O1U A;  1EXS A;  4AZQ A;  5L8N A;  2JOZ A;  2MHD A;  5F6Z A;  2GJ5 A;  1SXW A;  4M7M A;  4PSQ A;  1LNM A;  2FS7 A;  2LB6 A;  2A2G A;  4GK9 A;  3OJY C;  3HWD A;  5F6B A;  3O2Y A;  2W2A A;  5LKF A;  4ES7 A;  5HAE A;  4AYH A;  2OVE A;  2RD7 C;  3DSZ A;  2JU7 A;  3WVM A;  1FTP A;  2GTL N;  2QM9 A;  4KT5 A;  3T1D A;  2AT3 X;  1XCA A;  2IFB A;  4CSB A;  4A1H A;  1RBP A;  1X8U A;  1SY2 A;  4HFO A;  3E3C A;  1X89 A;  3P6F A;  1IFB A;  3ZW1 A;  1OPB A;  1EAL A;  4PJ2 A;  4O3Z A;  4M6S A;  5LJG A;  3EYC A;  3O22 A;  5KID A;  1HBQ A;  1ICN A;  1I4U A;  1IIU A;  3JSQ A;  5AJB A;  5LKE A;  4A8Z A;  1U18 A;  4O3Y A;  5F58 A;  2W2F A;  2FR2 A;  5FQ8 E;  1SMP I;  3VG7 A;  2LFO A;  2R74 A;  1HMT A;  1SA8 A;  2QO4 A;  2RCQ A;  5BVT A;  2L9C A;  4QYP A;  1ICM A;  3CQR A;  5K06 A;  4YDA A;  5HZQ A;  2ZAG A;  2ACP X;  2FS6 A;  3VG2 A;  1S2P A;  2AT5 X;  2X8S A;  4ODD A;  4ORX A;  3BRN A;  4BOE A;  3OE3 A;  4YCH A;  2F09 A;  1ERX A;  1ZNK A;  4I95 A;  2A0A A;  4O3X B;  5CYB A;  4U3Q A;  1PM1 X;  1E5P A;  4YH0 A;  5EEE A;  3ELZ A;  3K3L A;  3F9D A;  1CBI A;  1CBS A;  2CZT A;  2KTD A;  2Z4H A;  4CK4 A;  4ZFX A;  4NW4 A;  1KQX A;  4O9S A;  1MUP A;  3FEK A;  3RBY A;  1JYD A;  2Z4I A;  4I9R A;  1QFT A;  2G7B A;  1YWC A;  1I06 A;  5HCD C;  4U8U M;  3CQN A;  3AKM A;  2OFR X;  4EDE A;  2ANS A;  1B0O A;  4JGL A;  5FQ7 E;  1KT4 A;  3UEV A;  1EPA A;  1QY0 A;  1ZRY A;  3ZI8 A;  1QG5 A;  4I3C A;  1IKJ A;  1KT6 A;  3VG4 A;  2GC9 A;  1BRP A;  3N91 A;  5FEN A;  4YFR A;  5D45 A;  4IB9 A;  2Q2M A;  1OBQ A;  4NP1 A;  4XMD A;  2DM5 A;  4HPA A;  5D48 A;  5EED A;  2MJI A;  2ACO A;  2QMI A;  2WR6 A;  4ORU A;  5LJC A;  2AT0 X;  3IFB A;  2KW1 A;  1LIF A;  4I6S A;  1MVG A;  5HCC C;  3ZW1 B;  1IW2 A;  4YBP A;  3B2H A;  1D3S A;  1RLB E;  3APX A;  3CBS A;  5HCE C;  1OBP A;  4ALB A;  4NYQ A;  4QYN A;  3VPJ E;  2G78 A;  3OD9 A;  1X8N A;  1NP1 A;  1N0S A;  3WJF A;  3FW4 A;  4I9S A;  5EPQ A;  4QZU A;  3SAO A;  3ZW2 A;  1Y9T A;  1I04 A;  3P6D A;  3G7X A;  3ELX A;  2CM4 A;  3FW5 A;  2P8G A;  1TVQ A;  4TQ2 A;  3EBW A;  3VU1 A;  3TZS A;  3TF6 A;  1A18 A;  3RSW A;  1HMS A;  2BS5 A;  1B56 A;  5H9A A;  1TXL A;  1LPJ A;  3WJD A;  5HZ5 A;  1OBU A;  4IAW A;  2W2B A;  4A60 A;  1T8V A;  3CR6 A;  3MVF A;  4MVI A;  4FBR A;  3APW A;  2ASN X;  1CRB A;  1LIE A;  1HMR A;  2A3F X;  3FR4 A;  5JR8 A;  5LJE A;  4KC8 A;  4OS3 A;  1ALB A;  3O19 A;  1PMP A;  4XMC A;  4DQ4 A;  2NNE A;  3FMZ A;  1O1V A;  1ZNL A;  1TW4 A;  2LBV A;  2R73 A;  1LKE A;  1T68 X;  2JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...