2CBYA

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
169
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 63
structure length 169
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2cbyA00
1NZYA 3M6MA 2X24A 1UYVA 3T3WA 3FDUA 4IZCA 1WDLA 2BZRA 3ZWBA 3H0JA 3RRVA 3NJBA 1YG6A 4B3IA 1O8UA 3ST9A 1UYTA 5DU4A 4ELSA 4WYOB 3PEAA 4K2NA 4B3HA 3IB9A 3ZW9A 2ZQRA 2EJ5A 3BPPA 3RSTA 3K8XA 1N6DA 3FF6A 1UYSA 5DL1A 1X0UA 3BF0A 2ZL0A 4OG1A 4WCZA 1OD4A 2J5IA 5DU6A 3PZKA 3MYBA 3U9SB 2VSUE 5KJPA 5IKLB 1PJHA 3DJAA 1PIXA 3MT6A 3ISAA 3QREA 4Q0GA 1XX4A 3HE2A 2Q34A 4U1AA 4FZWA 4MXIA 4DI1A 4RYFA 3K50A 3KTIA 4L6WA 3R6HA 3TLFA 4MI2A 2J5SA 3BEZA 4JWVA 3H81A 3Q0JA 3TVUA 2A7SA 5E0NX 5DUCA 3U9RB 3SLLA 2ZQQA 3GMAA 5FUSA 3TVWA 3QKAA 5DUFA 3DORA 3RSIA 3KTGA 1RJMA 5G1SA 2VSUC 2F6QA 1DUBA 1HNUA 2A7KA 5DKPA 2IEXA 3Q7HA 2F6IA 5C90A 3LAOA 2FBMA 2F9YA 3STAA 1K32A 1K39A 1HNOA 4JVTA 4B3JA 5CTCA 2J5GA 4ZDBA 3U9TB 3H02A 4RYFH 5KDRB 4HC8A 3I47A 2GTRA 4U0HA 2X58A 3H0SA 4ELXA 4FB8A 1WDKA 5E0SA 2F9IB 1N6FA 3GF7A 1UYRA 3R9SA 1YG8A 4KPKA 3KTJA 4EMMA 4G2RA 5MGBA 3OT6A 1XNWA 2D3TA 2ZL4A 4KD6A 3R0OA 4JFCA 4NEKA 3HLN1 2WTBA 5JBXA 4U0GA 4OLQA 4U18A 1J7XA 3QK8A 4Q1IA 3OMEA 3KQFA 3SWXA 2VSSF 1NZYB 3QWDA 3KTHA 4I4ZA 2ZL3A 4FN7A 4ZU2A 3H0UA 1XNVA 1XNYA 1EY3A 4EMPA 1VRGA 2VSUF 3T8BA 1UIYA 4IZBA 2J5II 3TV5A 4EMLA 4KNPA 3N6RB 4LK5A 3TZ3A 3MFMA 4HNKA 3PGQA 4JYLA 2QQ3A 3V5IA 4JJTA 3TT6A 1SG4A 1XO6A 4U0GH 4F47A 4GM2A 5DTPA 1WDMA 3R9TA 1ON9A 3T8AA 2CBYA 3IBBA 2Q2XA 2VX2A 5CTBA 1Q52A 2J5GD 4WZ8B 2J5IB 3R9QA 1TYFA 3GLMA 2FZSA 3VIVA 2C8TA 1FC7A 4MOUA 2PBPA 3H0QA 4I52A 3NJDA 1OD2A 2PPYA 5DU8A 1TG6A 2VSSA 4KWBA 3TRRA 3PE8A 4FNDA 4ZDFA 4QIJA 4L8KA 3ZWAA 4JOTA 3Q1TA 4IZDA 2DEOA 4QIIA 2W3PA 5INGA 4OMRA 4ZDDA 2UZFA 4K3WA 2VSUA 2VREA 3P85A 1MJ3A 5DTWA 3L3SA 5G1QA 2ZL2A 3QXIA 4U19A 5DZKA 1N6EA 4QFEA 1Q51A 1FC6A 4FZWC 4NNQA 3GF3A 2CE3A 1JXZA 4K29A 3WG5A 3GKBA 3M6NA 3IAVA 2VSSE 4FNBA 5JBWA 1EF9A 5INIA 3Q0GA 1WZ8A 4YLHA 3V5EA 4ZDCA 1W2XA 5C9GA 2A81A 2Q35A 4JCRA 2F9YB 5E0SH 3MOYA 4JCSA 2FW2A 3KTKA 2PG8A 2DUBA 5FIFA 4Z0MA 4JYJA 4JCQA 5INFA 4FJWD 5KDRA 4ZDEA 4ASIA 1Y7OA 3ZW8A 5G1RA 1EF8A 1FCFA 1DCIA 4GHNA 1HZDA 2F9IA 1FC9A 5DZKH 1RJNA 2NP9A 3TDCA 3HINA 3OC7A 3T88A 3HP0A 1ON3A 3QXZA 3T89A 2HW5A 3G64A 3P5MA 3TT7A 3HRXA 4JCTA 3QMJA 4ELWA 1SZOA 4JSBA 3LKEA 4I42A 4RCNA 3JU1A 3ZWCA 3QYRA 4FN8A 3P2LA
chains in the Genus database with same CATH superfamily
3BPTA 1NZYA 3M6MA 2X24A 1UYVA 3T3WA 3FDUA 4IZCA 1WDLA 2BZRA 3ZWBA 3H0JA 3RRVA 3NJBA 1YG6A 4B3IA 1O8UA 3ST9A 1UYTA 5DU4A 4ELSA 4WYOB 4HDTA 3PEAA 4K2NA 4B3HA 3IB9A 3ZW9A 2ZQRA 2EJ5A 3BPPA 3RSTA 3K8XA 1N6DA 3FF6A 1UYSA 5DL1A 1X0UA 3BF0A 2ZL0A 4OG1A 4WCZA 1OD4A 2J5IA 5DU6A 3PZKA 3MYBA 3U9SB 5HUQA 2VSUE 5KJPA 5IKLB 1PJHA 3DJAA 1PIXA 3MT6A 3ISAA 3QREA 4Q0GA 1XX4A 3HE2A 2Q34A 4U1AA 4FZWA 4MXIA 4DI1A 4RYFA 3K50A 3KTIA 4L6WA 3R6HA 3TLFA 4MI2A 2J5SA 3BEZA 4JWVA 3H81A 3Q0JA 3TVUA 2A7SA 5E0NX 5DUCA 3U9RB 3SLLA 2ZQQA 3GMAA 5FUSA 3TVWA 3QKAA 5DUFA 3DORA 3RSIA 3KTGA 1RJMA 5G1SA 2VSUC 2F6QA 1DUBA 1HNUA 2A7KA 5DKPA 2IEXA 3Q7HA 2F6IA 5C90A 3LAOA 2FBMA 2F9YA 4NARA 3STAA 1K32A 1K39A 1HNOA 4JVTA 4B3JA 5CTCA 2J5GA 4ZDBA 4RYFH 3H02A 3U9TB 5KDRB 4HC8A 3I47A 2GTRA 4U0HA 2X58A 3H0SA 4ELXA 4FB8A 1WDKA 5E0SA 2F9IB 1N6FA 3GF7A 1UYRA 3R9SA 1YG8A 4KPKA 3KTJA 4EMMA 4G2RA 5MGBA 3OT6A 1XNWA 2D3TA 2ZL4A 4KD6A 3R0OA 4JFCA 4NEKA 3HLN1 2WTBA 5JBXA 4U0GA 4OLQA 4U18A 1J7XA 3QK8A 4Q1IA 3OMEA 3KQFA 3SWXA 2VSSF 1NZYB 3QWDA 3KTHA 4I4ZA 2ZL3A 4FN7A 4ZU2A 3H0UA 1XNVA 1XNYA 1EY3A 4EMPA 1VRGA 2VSUF 3T8BA 1UIYA 4IZBA 2J5II 3TV5A 4EMLA 4KNPA 3N6RB 4LK5A 3TZ3A 3MFMA 4HNKA 3PGQA 4JYLA 2QQ3A 3V5IA 4JJTA 3TT6A 1SG4A 1XO6A 4U0GH 4F47A 4GM2A 5DTPA 1WDMA 3R9TA 1ON9A 3T8AA 2CBYA 3IBBA 2Q2XA 2VX2A 5CTBA 1Q52A 2J5GD 4WZ8B 2J5IB 3R9QA 1TYFA 3GLMA 2FZSA 3VIVA 2C8TA 1FC7A 2YJGA 4MOUA 2PBPA 3H0QA 4I52A 3NJDA 1OD2A 2PPYA 5DU8A 1TG6A 2VSSA 4KWBA 3TRRA 3PE8A 4FNDA 4ZDFA 4QIJA 4L8KA 3ZWAA 4JOTA 3Q1TA 4IZDA 2DEOA 4QIIA 2W3PA 5INGA 4OMRA 4ZDDA 2UZFA 4K3WA 2VSUA 2VREA 3P85A 1MJ3A 5DTWA 3L3SA 5G1QA 2ZL2A 3QXIA 4U19A 5DZKA 1N6EA 4QFEA 1Q51A 1FC6A 4FZWC 4NNQA 3GF3A 2CE3A 1JXZA 4K29A 3WG5A 3GKBA 3M6NA 3IAVA 2VSSE 4FNBA 5JBWA 1EF9A 5INIA 3Q0GA 1WZ8A 4YLHA 3V5EA 4ZDCA 1W2XA 5C9GA 2A81A 2Q35A 4JCRA 2F9YB 5E0SH 3MOYA 4JCSA 2FW2A 3KTKA 2PG8A 2DUBA 5FIFA 4Z0MA 4JYJA 4JCQA 5INFA 4FJWD 5KDRA 4ZDEA 4ASIA 1Y7OA 4J2UA 3ZW8A 5G1RA 1EF8A 1FCFA 1DCIA 4GHNA 1HZDA 2F9IA 1FC9A 5DZKH 1RJNA 2NP9A 3TDCA 3HINA 3OC7A 3T88A 3HP0A 1ON3A 3QXZA 3T89A 2HW5A 3G64A 3P5MA 3TT7A 3HRXA 4JCTA 3QMJA 4ELWA 1SZOA 4JSBA 3LKEA 4I42A 4RCNA 3JU1A 3ZWCA 3QYRA 4FN8A 3P2LA
chains in the Genus database with same CATH topology
3BPTA 1NZYA 3M6MA 2X24A 1UYVA 3T3WA 3FDUA 4IZCA 1WDLA 2BZRA 3ZWBA 3H0JA 3RRVA 3NJBA 1YG6A 4B3IA 1O8UA 3ST9A 1UYTA 5DU4A 4ELSA 4WYOB 4HDTA 3PEAA 4K2NA 4B3HA 3IB9A 3ZW9A 2ZQRA 2EJ5A 3BPPA 3RSTA 3K8XA 1N6DA 3FF6A 1UYSA 5DL1A 1X0UA 3BF0A 2ZL0A 4OG1A 4WCZA 1OD4A 2J5IA 5DU6A 3PZKA 3MYBA 3U9SB 5HUQA 2VSUE 5KJPA 5IKLB 1PJHA 3DJAA 1PIXA 3MT6A 3ISAA 3QREA 4Q0GA 1XX4A 3HE2A 2Q34A 4U1AA 4FZWA 4MXIA 4DI1A 4RYFA 3K50A 3KTIA 4L6WA 3R6HA 3TLFA 4MI2A 2J5SA 3BEZA 4JWVA 3H81A 3Q0JA 3TVUA 2A7SA 5E0NX 5DUCA 3U9RB 3SLLA 2ZQQA 3GMAA 5FUSA 3TVWA 3QKAA 5DUFA 3DORA 3RSIA 3KTGA 1RJMA 5G1SA 2VSUC 2F6QA 1DUBA 1HNUA 2A7KA 5DKPA 2IEXA 3Q7HA 2F6IA 5C90A 3LAOA 2FBMA 2F9YA 4NARA 3STAA 1K32A 1K39A 1HNOA 4JVTA 4B3JA 5CTCA 2J5GA 4ZDBA 4RYFH 3H02A 3U9TB 5KDRB 4HC8A 3I47A 2GTRA 4U0HA 2X58A 3H0SA 4ELXA 4FB8A 1WDKA 5E0SA 2F9IB 1N6FA 3GF7A 1UYRA 3R9SA 1YG8A 4KPKA 3KTJA 4EMMA 4G2RA 5MGBA 3OT6A 1XNWA 2D3TA 2ZL4A 4KD6A 3R0OA 4JFCA 4NEKA 3HLN1 2WTBA 5JBXA 4U0GA 4OLQA 4U18A 1J7XA 3QK8A 4Q1IA 3OMEA 3KQFA 3SWXA 2VSSF 1NZYB 3QWDA 3KTHA 4I4ZA 2ZL3A 4FN7A 4ZU2A 3H0UA 1XNVA 1XNYA 1EY3A 4EMPA 1VRGA 2VSUF 3T8BA 1UIYA 4IZBA 2J5II 3TV5A 4EMLA 4KNPA 3N6RB 4LK5A 3TZ3A 3MFMA 4HNKA 3PGQA 4JYLA 2QQ3A 3V5IA 4JJTA 3TT6A 1SG4A 1XO6A 4U0GH 4F47A 4GM2A 5DTPA 1WDMA 3R9TA 1ON9A 3T8AA 2CBYA 3IBBA 2Q2XA 2VX2A 5CTBA 1Q52A 2J5GD 4WZ8B 2J5IB 3R9QA 1TYFA 3GLMA 2FZSA 3VIVA 2C8TA 1FC7A 2YJGA 4MOUA 2PBPA 3H0QA 4I52A 3NJDA 1OD2A 2PPYA 5DU8A 1TG6A 2VSSA 4KWBA 3TRRA 3PE8A 4FNDA 4ZDFA 4QIJA 4L8KA 3ZWAA 4JOTA 3Q1TA 4IZDA 2DEOA 4QIIA 2W3PA 5INGA 4OMRA 4ZDDA 2UZFA 4K3WA 2VSUA 2VREA 3P85A 1MJ3A 5DTWA 3L3SA 5G1QA 2ZL2A 3QXIA 4U19A 5DZKA 1N6EA 4QFEA 1Q51A 1FC6A 4FZWC 4NNQA 3GF3A 2CE3A 1JXZA 4K29A 3WG5A 3GKBA 3M6NA 3IAVA 2VSSE 4FNBA 5JBWA 1EF9A 5INIA 3Q0GA 1WZ8A 4YLHA 3V5EA 4ZDCA 1W2XA 5C9GA 2A81A 2Q35A 4JCRA 2F9YB 5E0SH 3MOYA 4JCSA 2FW2A 3KTKA 2PG8A 2DUBA 5FIFA 4Z0MA 4JYJA 4JCQA 5INFA 4FJWD 5KDRA 4ZDEA 4ASIA 1Y7OA 4J2UA 3ZW8A 5G1RA 1EF8A 1FCFA 1DCIA 4GHNA 1HZDA 2F9IA 1FC9A 5DZKH 1RJNA 2NP9A 3TDCA 3HINA 3OC7A 3T88A 3HP0A 1ON3A 3QXZA 3T89A 2HW5A 3G64A 3P5MA 3TT7A 3HRXA 4JCTA 3QMJA 4ELWA 1SZOA 4JSBA 3LKEA 4I42A 4RCNA 3JU1A 3ZWCA 3QYRA 4FN8A 3P2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZY A;  3M6M A;  2X24 A;  1UYV A;  3T3W A;  3FDU A;  4IZC A;  1WDL A;  2BZR A;  3ZWB A;  3H0J A;  3RRV A;  3NJB A;  1YG6 A;  4B3I A;  1O8U A;  3ST9 A;  1UYT A;  5DU4 A;  4ELS A;  4WYO B;  3PEA A;  4K2N A;  4B3H A;  3IB9 A;  3ZW9 A;  2ZQR A;  2EJ5 A;  3BPP A;  3RST A;  3K8X A;  1N6D A;  3FF6 A;  1UYS A;  5DL1 A;  1X0U A;  3BF0 A;  2ZL0 A;  4OG1 A;  4WCZ A;  1OD4 A;  2J5I A;  5DU6 A;  3PZK A;  3MYB A;  3U9S B;  2VSU E;  5KJP A;  5IKL B;  1PJH A;  3DJA A;  1PIX A;  3MT6 A;  3ISA A;  3QRE A;  4Q0G A;  1XX4 A;  3HE2 A;  2Q34 A;  4U1A A;  4FZW A;  4MXI A;  4DI1 A;  4RYF A;  3K50 A;  3KTI A;  4L6W A;  3R6H A;  3TLF A;  4MI2 A;  2J5S A;  3BEZ A;  4JWV A;  3H81 A;  3Q0J A;  3TVU A;  2A7S A;  5E0N X;  5DUC A;  3U9R B;  3SLL A;  2ZQQ A;  3GMA A;  5FUS A;  3TVW A;  3QKA A;  5DUF A;  3DOR A;  3RSI A;  3KTG A;  1RJM A;  5G1S A;  2VSU C;  2F6Q A;  1DUB A;  1HNU A;  2A7K A;  5DKP A;  2IEX A;  3Q7H A;  2F6I A;  5C90 A;  3LAO A;  2FBM A;  2F9Y A;  3STA A;  1K32 A;  1K39 A;  1HNO A;  4JVT A;  4B3J A;  5CTC A;  2J5G A;  4ZDB A;  3U9T B;  3H02 A;  4RYF H;  5KDR B;  4HC8 A;  3I47 A;  2GTR A;  4U0H A;  2X58 A;  3H0S A;  4ELX A;  4FB8 A;  1WDK A;  5E0S A;  2F9I B;  1N6F A;  3GF7 A;  1UYR A;  3R9S A;  1YG8 A;  4KPK A;  3KTJ A;  4EMM A;  4G2R A;  5MGB A;  3OT6 A;  1XNW A;  2D3T A;  2ZL4 A;  4KD6 A;  3R0O A;  4JFC A;  4NEK A;  3HLN 1;  2WTB A;  5JBX A;  4U0G A;  4OLQ A;  4U18 A;  1J7X A;  3QK8 A;  4Q1I A;  3OME A;  3KQF A;  3SWX A;  2VSS F;  1NZY B;  3QWD A;  3KTH A;  4I4Z A;  2ZL3 A;  4FN7 A;  4ZU2 A;  3H0U A;  1XNV A;  1XNY A;  1EY3 A;  4EMP A;  1VRG A;  2VSU F;  3T8B A;  1UIY A;  4IZB A;  2J5I I;  3TV5 A;  4EML A;  4KNP A;  3N6R B;  4LK5 A;  3TZ3 A;  3MFM A;  4HNK A;  3PGQ A;  4JYL A;  2QQ3 A;  3V5I A;  4JJT A;  3TT6 A;  1SG4 A;  1XO6 A;  4U0G H;  4F47 A;  4GM2 A;  5DTP A;  1WDM A;  3R9T A;  1ON9 A;  3T8A A;  2CBY A;  3IBB A;  2Q2X A;  2VX2 A;  5CTB A;  1Q52 A;  2J5G D;  4WZ8 B;  2J5I B;  3R9Q A;  1TYF A;  3GLM A;  2FZS A;  3VIV A;  2C8T A;  1FC7 A;  4MOU A;  2PBP A;  3H0Q A;  4I52 A;  3NJD A;  1OD2 A;  2PPY A;  5DU8 A;  1TG6 A;  2VSS A;  4KWB A;  3TRR A;  3PE8 A;  4FND A;  4ZDF A;  4QIJ A;  4L8K A;  3ZWA A;  4JOT A;  3Q1T A;  4IZD A;  2DEO A;  4QII A;  2W3P A;  5ING A;  4OMR A;  4ZDD A;  2UZF A;  4K3W A;  2VSU A;  2VRE A;  3P85 A;  1MJ3 A;  5DTW A;  3L3S A;  5G1Q A;  2ZL2 A;  3QXI A;  4U19 A;  5DZK A;  1N6E A;  4QFE A;  1Q51 A;  1FC6 A;  4FZW C;  4NNQ A;  3GF3 A;  2CE3 A;  1JXZ A;  4K29 A;  3WG5 A;  3GKB A;  3M6N A;  3IAV A;  2VSS E;  4FNB A;  5JBW A;  1EF9 A;  5INI A;  3Q0G A;  1WZ8 A;  4YLH A;  3V5E A;  4ZDC A;  1W2X A;  5C9G A;  2A81 A;  2Q35 A;  4JCR A;  2F9Y B;  5E0S H;  3MOY A;  4JCS A;  2FW2 A;  3KTK A;  2PG8 A;  2DUB A;  5FIF A;  4Z0M A;  4JYJ A;  4JCQ A;  5INF A;  4FJW D;  5KDR A;  4ZDE A;  4ASI A;  1Y7O A;  3ZW8 A;  5G1R A;  1EF8 A;  1FCF A;  1DCI A;  4GHN A;  1HZD A;  2F9I A;  1FC9 A;  5DZK H;  1RJN A;  2NP9 A;  3TDC A;  3HIN A;  3OC7 A;  3T88 A;  3HP0 A;  1ON3 A;  3QXZ A;  3T89 A;  2HW5 A;  3G64 A;  3P5M A;  3TT7 A;  3HRX A;  4JCT A;  3QMJ A;  4ELW A;  1SZO A;  4JSB A;  3LKE A;  4I42 A;  4RCN A;  3JU1 A;  3ZWC A;  3QYR A;  4FN8 A;  3P2L A; 
#chains in the Genus database with same CATH topology
 3BPT A;  1NZY A;  3M6M A;  2X24 A;  1UYV A;  3T3W A;  3FDU A;  4IZC A;  1WDL A;  2BZR A;  3ZWB A;  3H0J A;  3RRV A;  3NJB A;  1YG6 A;  4B3I A;  1O8U A;  3ST9 A;  1UYT A;  5DU4 A;  4ELS A;  4WYO B;  4HDT A;  3PEA A;  4K2N A;  4B3H A;  3IB9 A;  3ZW9 A;  2ZQR A;  2EJ5 A;  3BPP A;  3RST A;  3K8X A;  1N6D A;  3FF6 A;  1UYS A;  5DL1 A;  1X0U A;  3BF0 A;  2ZL0 A;  4OG1 A;  4WCZ A;  1OD4 A;  2J5I A;  5DU6 A;  3PZK A;  3MYB A;  3U9S B;  5HUQ A;  2VSU E;  5KJP A;  5IKL B;  1PJH A;  3DJA A;  1PIX A;  3MT6 A;  3ISA A;  3QRE A;  4Q0G A;  1XX4 A;  3HE2 A;  2Q34 A;  4U1A A;  4FZW A;  4MXI A;  4DI1 A;  4RYF A;  3K50 A;  3KTI A;  4L6W A;  3R6H A;  3TLF A;  4MI2 A;  2J5S A;  3BEZ A;  4JWV A;  3H81 A;  3Q0J A;  3TVU A;  2A7S A;  5E0N X;  5DUC A;  3U9R B;  3SLL A;  2ZQQ A;  3GMA A;  5FUS A;  3TVW A;  3QKA A;  5DUF A;  3DOR A;  3RSI A;  3KTG A;  1RJM A;  5G1S A;  2VSU C;  2F6Q A;  1DUB A;  1HNU A;  2A7K A;  5DKP A;  2IEX A;  3Q7H A;  2F6I A;  5C90 A;  3LAO A;  2FBM A;  2F9Y A;  4NAR A;  3STA A;  1K32 A;  1K39 A;  1HNO A;  4JVT A;  4B3J A;  5CTC A;  2J5G A;  4ZDB A;  4RYF H;  3H02 A;  3U9T B;  5KDR B;  4HC8 A;  3I47 A;  2GTR A;  4U0H A;  2X58 A;  3H0S A;  4ELX A;  4FB8 A;  1WDK A;  5E0S A;  2F9I B;  1N6F A;  3GF7 A;  1UYR A;  3R9S A;  1YG8 A;  4KPK A;  3KTJ A;  4EMM A;  4G2R A;  5MGB A;  3OT6 A;  1XNW A;  2D3T A;  2ZL4 A;  4KD6 A;  3R0O A;  4JFC A;  4NEK A;  3HLN 1;  2WTB A;  5JBX A;  4U0G A;  4OLQ A;  4U18 A;  1J7X A;  3QK8 A;  4Q1I A;  3OME A;  3KQF A;  3SWX A;  2VSS F;  1NZY B;  3QWD A;  3KTH A;  4I4Z A;  2ZL3 A;  4FN7 A;  4ZU2 A;  3H0U A;  1XNV A;  1XNY A;  1EY3 A;  4EMP A;  1VRG A;  2VSU F;  3T8B A;  1UIY A;  4IZB A;  2J5I I;  3TV5 A;  4EML A;  4KNP A;  3N6R B;  4LK5 A;  3TZ3 A;  3MFM A;  4HNK A;  3PGQ A;  4JYL A;  2QQ3 A;  3V5I A;  4JJT A;  3TT6 A;  1SG4 A;  1XO6 A;  4U0G H;  4F47 A;  4GM2 A;  5DTP A;  1WDM A;  3R9T A;  1ON9 A;  3T8A A;  2CBY A;  3IBB A;  2Q2X A;  2VX2 A;  5CTB A;  1Q52 A;  2J5G D;  4WZ8 B;  2J5I B;  3R9Q A;  1TYF A;  3GLM A;  2FZS A;  3VIV A;  2C8T A;  1FC7 A;  2YJG A;  4MOU A;  2PBP A;  3H0Q A;  4I52 A;  3NJD A;  1OD2 A;  2PPY A;  5DU8 A;  1TG6 A;  2VSS A;  4KWB A;  3TRR A;  3PE8 A;  4FND A;  4ZDF A;  4QIJ A;  4L8K A;  3ZWA A;  4JOT A;  3Q1T A;  4IZD A;  2DEO A;  4QII A;  2W3P A;  5ING A;  4OMR A;  4ZDD A;  2UZF A;  4K3W A;  2VSU A;  2VRE A;  3P85 A;  1MJ3 A;  5DTW A;  3L3S A;  5G1Q A;  2ZL2 A;  3QXI A;  4U19 A;  5DZK A;  1N6E A;  4QFE A;  1Q51 A;  1FC6 A;  4FZW C;  4NNQ A;  3GF3 A;  2CE3 A;  1JXZ A;  4K29 A;  3WG5 A;  3GKB A;  3M6N A;  3IAV A;  2VSS E;  4FNB A;  5JBW A;  1EF9 A;  5INI A;  3Q0G A;  1WZ8 A;  4YLH A;  3V5E A;  4ZDC A;  1W2X A;  5C9G A;  2A81 A;  2Q35 A;  4JCR A;  2F9Y B;  5E0S H;  3MOY A;  4JCS A;  2FW2 A;  3KTK A;  2PG8 A;  2DUB A;  5FIF A;  4Z0M A;  4JYJ A;  4JCQ A;  5INF A;  4FJW D;  5KDR A;  4ZDE A;  4ASI A;  1Y7O A;  4J2U A;  3ZW8 A;  5G1R A;  1EF8 A;  1FCF A;  1DCI A;  4GHN A;  1HZD A;  2F9I A;  1FC9 A;  5DZK H;  1RJN A;  2NP9 A;  3TDC A;  3HIN A;  3OC7 A;  3T88 A;  3HP0 A;  1ON3 A;  3QXZ A;  3T89 A;  2HW5 A;  3G64 A;  3P5M A;  3TT7 A;  3HRX A;  4JCT A;  3QMJ A;  4ELW A;  1SZO A;  4JSB A;  3LKE A;  4I42 A;  4RCN A;  3JU1 A;  3ZWC A;  3QYR A;  4FN8 A;  3P2L A; 
#chains in the Genus database with same CATH homology
 3BPT A;  1NZY A;  3M6M A;  2X24 A;  1UYV A;  3T3W A;  3FDU A;  4IZC A;  1WDL A;  2BZR A;  3ZWB A;  3H0J A;  3RRV A;  3NJB A;  1YG6 A;  4B3I A;  1O8U A;  3ST9 A;  1UYT A;  5DU4 A;  4ELS A;  4WYO B;  4HDT A;  3PEA A;  4K2N A;  4B3H A;  3IB9 A;  3ZW9 A;  2ZQR A;  2EJ5 A;  3BPP A;  3RST A;  3K8X A;  1N6D A;  3FF6 A;  1UYS A;  5DL1 A;  1X0U A;  3BF0 A;  2ZL0 A;  4OG1 A;  4WCZ A;  1OD4 A;  2J5I A;  5DU6 A;  3PZK A;  3MYB A;  3U9S B;  5HUQ A;  2VSU E;  5KJP A;  5IKL B;  1PJH A;  3DJA A;  1PIX A;  3MT6 A;  3ISA A;  3QRE A;  4Q0G A;  1XX4 A;  3HE2 A;  2Q34 A;  4U1A A;  4FZW A;  4MXI A;  4DI1 A;  4RYF A;  3K50 A;  3KTI A;  4L6W A;  3R6H A;  3TLF A;  4MI2 A;  2J5S A;  3BEZ A;  4JWV A;  3H81 A;  3Q0J A;  3TVU A;  2A7S A;  5E0N X;  5DUC A;  3U9R B;  3SLL A;  2ZQQ A;  3GMA A;  5FUS A;  3TVW A;  3QKA A;  5DUF A;  3DOR A;  3RSI A;  3KTG A;  1RJM A;  5G1S A;  2VSU C;  2F6Q A;  1DUB A;  1HNU A;  2A7K A;  5DKP A;  2IEX A;  3Q7H A;  2F6I A;  5C90 A;  3LAO A;  2FBM A;  2F9Y A;  4NAR A;  3STA A;  1K32 A;  1K39 A;  1HNO A;  4JVT A;  4B3J A;  5CTC A;  2J5G A;  4ZDB A;  4RYF H;  3H02 A;  3U9T B;  5KDR B;  4HC8 A;  3I47 A;  2GTR A;  4U0H A;  2X58 A;  3H0S A;  4ELX A;  4FB8 A;  1WDK A;  5E0S A;  2F9I B;  1N6F A;  3GF7 A;  1UYR A;  3R9S A;  1YG8 A;  4KPK A;  3KTJ A;  4EMM A;  4G2R A;  5MGB A;  3OT6 A;  1XNW A;  2D3T A;  2ZL4 A;  4KD6 A;  3R0O A;  4JFC A;  4NEK A;  3HLN 1;  2WTB A;  5JBX A;  4U0G A;  4OLQ A;  4U18 A;  1J7X A;  3QK8 A;  4Q1I A;  3OME A;  3KQF A;  3SWX A;  2VSS F;  1NZY B;  3QWD A;  3KTH A;  4I4Z A;  2ZL3 A;  4FN7 A;  4ZU2 A;  3H0U A;  1XNV A;  1XNY A;  1EY3 A;  4EMP A;  1VRG A;  2VSU F;  3T8B A;  1UIY A;  4IZB A;  2J5I I;  3TV5 A;  4EML A;  4KNP A;  3N6R B;  4LK5 A;  3TZ3 A;  3MFM A;  4HNK A;  3PGQ A;  4JYL A;  2QQ3 A;  3V5I A;  4JJT A;  3TT6 A;  1SG4 A;  1XO6 A;  4U0G H;  4F47 A;  4GM2 A;  5DTP A;  1WDM A;  3R9T A;  1ON9 A;  3T8A A;  2CBY A;  3IBB A;  2Q2X A;  2VX2 A;  5CTB A;  1Q52 A;  2J5G D;  4WZ8 B;  2J5I B;  3R9Q A;  1TYF A;  3GLM A;  2FZS A;  3VIV A;  2C8T A;  1FC7 A;  2YJG A;  4MOU A;  2PBP A;  3H0Q A;  4I52 A;  3NJD A;  1OD2 A;  2PPY A;  5DU8 A;  1TG6 A;  2VSS A;  4KWB A;  3TRR A;  3PE8 A;  4FND A;  4ZDF A;  4QIJ A;  4L8K A;  3ZWA A;  4JOT A;  3Q1T A;  4IZD A;  2DEO A;  4QII A;  2W3P A;  5ING A;  4OMR A;  4ZDD A;  2UZF A;  4K3W A;  2VSU A;  2VRE A;  3P85 A;  1MJ3 A;  5DTW A;  3L3S A;  5G1Q A;  2ZL2 A;  3QXI A;  4U19 A;  5DZK A;  1N6E A;  4QFE A;  1Q51 A;  1FC6 A;  4FZW C;  4NNQ A;  3GF3 A;  2CE3 A;  1JXZ A;  4K29 A;  3WG5 A;  3GKB A;  3M6N A;  3IAV A;  2VSS E;  4FNB A;  5JBW A;  1EF9 A;  5INI A;  3Q0G A;  1WZ8 A;  4YLH A;  3V5E A;  4ZDC A;  1W2X A;  5C9G A;  2A81 A;  2Q35 A;  4JCR A;  2F9Y B;  5E0S H;  3MOY A;  4JCS A;  2FW2 A;  3KTK A;  2PG8 A;  2DUB A;  5FIF A;  4Z0M A;  4JYJ A;  4JCQ A;  5INF A;  4FJW D;  5KDR A;  4ZDE A;  4ASI A;  1Y7O A;  4J2U A;  3ZW8 A;  5G1R A;  1EF8 A;  1FCF A;  1DCI A;  4GHN A;  1HZD A;  2F9I A;  1FC9 A;  5DZK H;  1RJN A;  2NP9 A;  3TDC A;  3HIN A;  3OC7 A;  3T88 A;  3HP0 A;  1ON3 A;  3QXZ A;  3T89 A;  2HW5 A;  3G64 A;  3P5M A;  3TT7 A;  3HRX A;  4JCT A;  3QMJ A;  4ELW A;  1SZO A;  4JSB A;  3LKE A;  4I42 A;  4RCN A;  3JU1 A;  3ZWC A;  3QYR A;  4FN8 A;  3P2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...