2CBYA

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
169
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
total genus 63
structure length 169
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2cbyA00
1UYVA 1SG4A 3ZW8A 2HW5A 2DEOA 2VSUF 3K8XA 4NNQA 2BZRA 4ASIA 2J5II 5INFA 2PBPA 1Q51A 3DJAA 3H0QA 5DL1A 5MGBA 4MXIA 1XNVA 3KTGA 3H0JA 3I47A 3Q0GA 2A7KA 2FBMA 1W2XA 3U9SB 1NZYA 2X24A 1N6FA 3NJBA 5KJPA 3U9TB 2GTRA 4B3IA 4G2RA 3PEAA 4FN7A 4EMPA 1WDLA 3K50A 4QFEA 1ON9A 3KTHA 3T8AA 3DORA 1FC9A 4OG1A 3ZWAA 2Q34A 1WDKA 1N6DA 3GMAA 1VRGA 4QIIA 2ZL2A 5E0NX 3TVWA 5CTCA 5KDRA 2VSSE 4RYFA 1HNOA 4WCZA 3OC7A 1N6EA 3HP0A 4OMRA 3VIVA 3QXZA 4U18A 4MI2A 1UYRA 5G1SA 1PJHA 3TT7A 5DU4A 4KWBA 1EF8A 4NEKA 2VREA 1YG8A 3T8BA 4FNBA 4I42A 3PGQA 4JWVA 3RSIA 3V5IA 1XNYA 3U9RB 3T88A 5INGA 3TDCA 4RCNA 4DI1A 4JFCA 3QREA 4U0HA 4ELSA 2F6QA 4U0GA 5DUCA 2UZFA 2ZQRA 3QYRA 5DZKA 3M6NA 2J5GD 4JCSA 4B3JA 4F47A 2VSSA 1FCFA 3FDUA 4U0GH 4FJWD 3RRVA 3LKEA 1RJNA 3V5EA 1EY3A 5DKPA 4IZCA 1ON3A 3TV5A 3P5MA 4IZDA 2ZL3A 4IZBA 2VSSF 4KPKA 4ELWA 5DU6A 4K2NA 3OT6A 4Z0MA 2ZL0A 2PG8A 3T3WA 5INIA 4MOUA 4YLHA 3TVUA 4QIJA 4JYJA 3MFMA 5G1QA 3GKBA 4JSBA 5C9GA 1UYSA 3KTJA 2A7SA 3KQFA 4WYOB 1YG6A 4K29A 4U1AA 3TRRA 4L6WA 4GM2A 1TG6A 2X58A 4FNDA 4JJTA 5DZKH 3LAOA 4FB8A 2ZQQA 4ZDBA 5DTPA 3GF3A 2CBYA 3MT6A 4B3HA 1UYTA 1WZ8A 1FC6A 4RYFH 3MYBA 4FN8A 5DUFA 5FIFA 4ZDEA 1DCIA 4KD6A 5DU8A 4KNPA 1XNWA 2Q2XA 3PE8A 3G64A 1FC7A 3H0UA 3R9SA 2QQ3A 1XX4A 2EJ5A 2NP9A 4FZWC 5JBWA 2J5IB 3QKAA 1X0UA 2J5SA 3Q1TA 3Q0JA 3OMEA 3TLFA 4K3WA 3HINA 3ZW9A 3L3SA 4JYLA 1K32A 3RSTA 1Q52A 4I52A 4JCTA 1MJ3A 1WDMA 1XO6A 3T89A 2F9YB 1HNUA 4JOTA 1K39A 3TZ3A 4HNKA 2F9YA 4LK5A 2A81A 1PIXA 3P2LA 1OD2A 3Q7HA 3ISAA 4ZDCA 4ZDDA 5IKLB 3KTKA 3H81A 1JXZA 2PPYA 4ELXA 4FZWA 3R9QA 3HRXA 5DTWA 2F9IB 5G1RA 3HLN1 3P85A 3BPPA 3ST9A 5KDRB 3HE2A 2WTBA 2J5IA 2CE3A 2F6IA 4ZDFA 3SLLA 3PZKA 1EF9A 3KTIA 2C8TA 2Q35A 3STAA 3R9TA 3IBBA 1J7XA 3GF7A 3IAVA 1Y7OA 5JBXA 3MOYA 3JU1A 4ZU2A 4I4ZA 4WZ8B 1RJMA 2FZSA 4JVTA 3H0SA 4EMMA 3ZWBA 5CTBA 3WG5A 4HC8A 3R6HA 3QK8A 4U19A 4EMLA 3M6MA 3NJDA 1UIYA 3BF0A 3H02A 3R0OA 4GHNA 3QXIA 2VSUE 1OD4A 5E0SA 5E0SH 5C90A 1NZYB 3TT6A 1SZOA 3QMJA 2D3TA 1TYFA 2ZL4A 3BEZA 4Q0GA 1DUBA 4OLQA 2VSUC 2FW2A 4JCRA 4JCQA 2IEXA 3SWXA 3QWDA 4L8KA 2W3PA 2DUBA 1O8UA 1HZDA 2F9IA 3IB9A 4Q1IA 3FF6A 3N6RB 2J5GA 3ZWCA 3GLMA 2VX2A 2VSUA 5FUSA
chains in the Genus database with same CATH superfamily
1UYVA 1SG4A 3ZW8A 2HW5A 5HUQA 2DEOA 2VSUF 3K8XA 4NNQA 2BZRA 4ASIA 2J5II 5INFA 2PBPA 1Q51A 3DJAA 3H0QA 5DL1A 5MGBA 4MXIA 1XNVA 3KTGA 3H0JA 3I47A 3Q0GA 2A7KA 2FBMA 1W2XA 3U9SB 1NZYA 2X24A 1N6FA 3NJBA 5KJPA 2YJGA 3U9TB 2GTRA 4B3IA 4G2RA 3PEAA 4FN7A 4EMPA 1WDLA 3K50A 4QFEA 1ON9A 3KTHA 3T8AA 3DORA 1FC9A 4OG1A 3ZWAA 2Q34A 1WDKA 1N6DA 3GMAA 1VRGA 4QIIA 2ZL2A 5E0NX 3TVWA 5CTCA 5KDRA 2VSSE 4RYFA 1HNOA 4WCZA 3OC7A 1N6EA 3HP0A 4OMRA 3VIVA 3QXZA 4U18A 4MI2A 1UYRA 5G1SA 1PJHA 3TT7A 5DU4A 4KWBA 1EF8A 4NEKA 2VREA 1YG8A 3T8BA 4FNBA 4I42A 3PGQA 4JWVA 3RSIA 3V5IA 1XNYA 3U9RB 3T88A 5INGA 3TDCA 4RCNA 4DI1A 4JFCA 3QREA 4U0HA 4ELSA 2F6QA 4U0GA 5DUCA 2UZFA 2ZQRA 3QYRA 5DZKA 3M6NA 2J5GD 4JCSA 4B3JA 4F47A 2VSSA 1FCFA 3FDUA 4U0GH 4FJWD 3RRVA 3LKEA 1RJNA 3V5EA 1EY3A 5DKPA 4IZCA 1ON3A 3TV5A 3P5MA 4IZDA 2ZL3A 4IZBA 2VSSF 4KPKA 4ELWA 5DU6A 4K2NA 3OT6A 4Z0MA 2ZL0A 2PG8A 3T3WA 5INIA 4MOUA 4YLHA 3TVUA 4QIJA 4JYJA 3MFMA 5G1QA 3GKBA 4JSBA 5C9GA 1UYSA 3KTJA 2A7SA 3KQFA 4WYOB 1YG6A 4K29A 4U1AA 3TRRA 4L6WA 4GM2A 1TG6A 2X58A 4FNDA 4JJTA 5DZKH 3LAOA 4FB8A 2ZQQA 4ZDBA 5DTPA 3GF3A 2CBYA 3MT6A 4B3HA 1UYTA 1WZ8A 1FC6A 4RYFH 3MYBA 4FN8A 5DUFA 5FIFA 4ZDEA 1DCIA 4KD6A 5DU8A 4KNPA 1XNWA 2Q2XA 3PE8A 3G64A 1FC7A 4NARA 3H0UA 3R9SA 2QQ3A 1XX4A 2EJ5A 2NP9A 4FZWC 5JBWA 2J5IB 3QKAA 1X0UA 2J5SA 3Q1TA 3Q0JA 3OMEA 3TLFA 4K3WA 3HINA 3ZW9A 3L3SA 4JYLA 1K32A 3RSTA 1Q52A 4I52A 4JCTA 1MJ3A 1WDMA 1XO6A 3T89A 2F9YB 1HNUA 4JOTA 1K39A 3TZ3A 4HNKA 2F9YA 4LK5A 2A81A 1PIXA 3P2LA 1OD2A 3Q7HA 3ISAA 4ZDCA 4ZDDA 5IKLB 3KTKA 3H81A 1JXZA 2PPYA 4ELXA 4FZWA 3R9QA 3HRXA 5DTWA 2F9IB 5G1RA 3HLN1 3P85A 3BPPA 3ST9A 5KDRB 3HE2A 2WTBA 2J5IA 2CE3A 2F6IA 4ZDFA 3SLLA 3PZKA 1EF9A 3KTIA 2C8TA 2Q35A 3STAA 3R9TA 3IBBA 1J7XA 3GF7A 3IAVA 1Y7OA 5JBXA 3MOYA 4HDTA 3JU1A 4ZU2A 3BPTA 4I4ZA 4WZ8B 1RJMA 2FZSA 4JVTA 3H0SA 4EMMA 3ZWBA 5CTBA 3WG5A 4HC8A 3R6HA 3QK8A 4U19A 4EMLA 3M6MA 3NJDA 1UIYA 3BF0A 3H02A 3R0OA 4GHNA 3QXIA 2VSUE 1OD4A 5E0SA 5E0SH 5C90A 1NZYB 3TT6A 1SZOA 3QMJA 2D3TA 4J2UA 1TYFA 2ZL4A 3BEZA 4Q0GA 1DUBA 4OLQA 2VSUC 2FW2A 4JCRA 4JCQA 2IEXA 3SWXA 3QWDA 4L8KA 2W3PA 2DUBA 1O8UA 1HZDA 2F9IA 3IB9A 4Q1IA 3FF6A 3N6RB 2J5GA 3ZWCA 3GLMA 2VX2A 2VSUA 5FUSA
chains in the Genus database with same CATH topology
1UYVA 1SG4A 3ZW8A 2HW5A 5HUQA 2DEOA 2VSUF 3K8XA 4NNQA 2BZRA 4ASIA 2J5II 5INFA 2PBPA 1Q51A 3DJAA 3H0QA 5DL1A 5MGBA 4MXIA 1XNVA 3KTGA 3H0JA 3I47A 3Q0GA 2A7KA 2FBMA 1W2XA 3U9SB 1NZYA 2X24A 1N6FA 3NJBA 5KJPA 2YJGA 3U9TB 2GTRA 4B3IA 4G2RA 3PEAA 4FN7A 4EMPA 1WDLA 3K50A 4QFEA 1ON9A 3KTHA 3T8AA 3DORA 1FC9A 4OG1A 3ZWAA 2Q34A 1WDKA 1N6DA 3GMAA 1VRGA 4QIIA 2ZL2A 5E0NX 3TVWA 5CTCA 5KDRA 2VSSE 4RYFA 1HNOA 4WCZA 3OC7A 1N6EA 3HP0A 4OMRA 3VIVA 3QXZA 4U18A 4MI2A 1UYRA 5G1SA 1PJHA 3TT7A 5DU4A 4KWBA 1EF8A 4NEKA 2VREA 1YG8A 3T8BA 4FNBA 4I42A 3PGQA 4JWVA 3RSIA 3V5IA 1XNYA 3U9RB 3T88A 5INGA 3TDCA 4RCNA 4DI1A 4JFCA 3QREA 4U0HA 4ELSA 2F6QA 4U0GA 5DUCA 2UZFA 2ZQRA 3QYRA 5DZKA 3M6NA 2J5GD 4JCSA 4B3JA 4F47A 2VSSA 1FCFA 3FDUA 4U0GH 4FJWD 3RRVA 3LKEA 1RJNA 3V5EA 1EY3A 5DKPA 4IZCA 1ON3A 3TV5A 3P5MA 4IZDA 2ZL3A 4IZBA 2VSSF 4KPKA 4ELWA 5DU6A 4K2NA 3OT6A 4Z0MA 2ZL0A 2PG8A 3T3WA 5INIA 4MOUA 4YLHA 3TVUA 4QIJA 4JYJA 3MFMA 5G1QA 3GKBA 4JSBA 5C9GA 1UYSA 3KTJA 2A7SA 3KQFA 4WYOB 1YG6A 4K29A 4U1AA 3TRRA 4L6WA 4GM2A 1TG6A 2X58A 4FNDA 4JJTA 5DZKH 3LAOA 4FB8A 2ZQQA 4ZDBA 5DTPA 3GF3A 2CBYA 3MT6A 4B3HA 1UYTA 1WZ8A 1FC6A 4RYFH 3MYBA 4FN8A 5DUFA 5FIFA 4ZDEA 1DCIA 4KD6A 5DU8A 4KNPA 1XNWA 2Q2XA 3PE8A 3G64A 1FC7A 4NARA 3H0UA 3R9SA 2QQ3A 1XX4A 2EJ5A 2NP9A 4FZWC 5JBWA 2J5IB 3QKAA 1X0UA 2J5SA 3Q1TA 3Q0JA 3OMEA 3TLFA 4K3WA 3HINA 3ZW9A 3L3SA 4JYLA 1K32A 3RSTA 1Q52A 4I52A 4JCTA 1MJ3A 1WDMA 1XO6A 3T89A 2F9YB 1HNUA 4JOTA 1K39A 3TZ3A 4HNKA 2F9YA 4LK5A 2A81A 1PIXA 3P2LA 1OD2A 3Q7HA 3ISAA 4ZDCA 4ZDDA 5IKLB 3KTKA 3H81A 1JXZA 2PPYA 4ELXA 4FZWA 3R9QA 3HRXA 5DTWA 2F9IB 5G1RA 3HLN1 3P85A 3BPPA 3ST9A 5KDRB 3HE2A 2WTBA 2J5IA 2CE3A 2F6IA 4ZDFA 3SLLA 3PZKA 1EF9A 3KTIA 2C8TA 2Q35A 3STAA 3R9TA 3IBBA 1J7XA 3GF7A 3IAVA 1Y7OA 5JBXA 3MOYA 4HDTA 3JU1A 4ZU2A 3BPTA 4I4ZA 4WZ8B 1RJMA 2FZSA 4JVTA 3H0SA 4EMMA 3ZWBA 5CTBA 3WG5A 4HC8A 3R6HA 3QK8A 4U19A 4EMLA 3M6MA 3NJDA 1UIYA 3BF0A 3H02A 3R0OA 4GHNA 3QXIA 2VSUE 1OD4A 5E0SA 5E0SH 5C90A 1NZYB 3TT6A 1SZOA 3QMJA 2D3TA 4J2UA 1TYFA 2ZL4A 3BEZA 4Q0GA 1DUBA 4OLQA 2VSUC 2FW2A 4JCRA 4JCQA 2IEXA 3SWXA 3QWDA 4L8KA 2W3PA 2DUBA 1O8UA 1HZDA 2F9IA 3IB9A 4Q1IA 3FF6A 3N6RB 2J5GA 3ZWCA 3GLMA 2VX2A 2VSUA 5FUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYV A;  1SG4 A;  3ZW8 A;  2HW5 A;  2DEO A;  2VSU F;  3K8X A;  4NNQ A;  2BZR A;  4ASI A;  2J5I I;  5INF A;  2PBP A;  1Q51 A;  3DJA A;  3H0Q A;  5DL1 A;  5MGB A;  4MXI A;  1XNV A;  3KTG A;  3H0J A;  3I47 A;  3Q0G A;  2A7K A;  2FBM A;  1W2X A;  3U9S B;  1NZY A;  2X24 A;  1N6F A;  3NJB A;  5KJP A;  3U9T B;  2GTR A;  4B3I A;  4G2R A;  3PEA A;  4FN7 A;  4EMP A;  1WDL A;  3K50 A;  4QFE A;  1ON9 A;  3KTH A;  3T8A A;  3DOR A;  1FC9 A;  4OG1 A;  3ZWA A;  2Q34 A;  1WDK A;  1N6D A;  3GMA A;  1VRG A;  4QII A;  2ZL2 A;  5E0N X;  3TVW A;  5CTC A;  5KDR A;  2VSS E;  4RYF A;  1HNO A;  4WCZ A;  3OC7 A;  1N6E A;  3HP0 A;  4OMR A;  3VIV A;  3QXZ A;  4U18 A;  4MI2 A;  1UYR A;  5G1S A;  1PJH A;  3TT7 A;  5DU4 A;  4KWB A;  1EF8 A;  4NEK A;  2VRE A;  1YG8 A;  3T8B A;  4FNB A;  4I42 A;  3PGQ A;  4JWV A;  3RSI A;  3V5I A;  1XNY A;  3U9R B;  3T88 A;  5ING A;  3TDC A;  4RCN A;  4DI1 A;  4JFC A;  3QRE A;  4U0H A;  4ELS A;  2F6Q A;  4U0G A;  5DUC A;  2UZF A;  2ZQR A;  3QYR A;  5DZK A;  3M6N A;  2J5G D;  4JCS A;  4B3J A;  4F47 A;  2VSS A;  1FCF A;  3FDU A;  4U0G H;  4FJW D;  3RRV A;  3LKE A;  1RJN A;  3V5E A;  1EY3 A;  5DKP A;  4IZC A;  1ON3 A;  3TV5 A;  3P5M A;  4IZD A;  2ZL3 A;  4IZB A;  2VSS F;  4KPK A;  4ELW A;  5DU6 A;  4K2N A;  3OT6 A;  4Z0M A;  2ZL0 A;  2PG8 A;  3T3W A;  5INI A;  4MOU A;  4YLH A;  3TVU A;  4QIJ A;  4JYJ A;  3MFM A;  5G1Q A;  3GKB A;  4JSB A;  5C9G A;  1UYS A;  3KTJ A;  2A7S A;  3KQF A;  4WYO B;  1YG6 A;  4K29 A;  4U1A A;  3TRR A;  4L6W A;  4GM2 A;  1TG6 A;  2X58 A;  4FND A;  4JJT A;  5DZK H;  3LAO A;  4FB8 A;  2ZQQ A;  4ZDB A;  5DTP A;  3GF3 A;  2CBY A;  3MT6 A;  4B3H A;  1UYT A;  1WZ8 A;  1FC6 A;  4RYF H;  3MYB A;  4FN8 A;  5DUF A;  5FIF A;  4ZDE A;  1DCI A;  4KD6 A;  5DU8 A;  4KNP A;  1XNW A;  2Q2X A;  3PE8 A;  3G64 A;  1FC7 A;  3H0U A;  3R9S A;  2QQ3 A;  1XX4 A;  2EJ5 A;  2NP9 A;  4FZW C;  5JBW A;  2J5I B;  3QKA A;  1X0U A;  2J5S A;  3Q1T A;  3Q0J A;  3OME A;  3TLF A;  4K3W A;  3HIN A;  3ZW9 A;  3L3S A;  4JYL A;  1K32 A;  3RST A;  1Q52 A;  4I52 A;  4JCT A;  1MJ3 A;  1WDM A;  1XO6 A;  3T89 A;  2F9Y B;  1HNU A;  4JOT A;  1K39 A;  3TZ3 A;  4HNK A;  2F9Y A;  4LK5 A;  2A81 A;  1PIX A;  3P2L A;  1OD2 A;  3Q7H A;  3ISA A;  4ZDC A;  4ZDD A;  5IKL B;  3KTK A;  3H81 A;  1JXZ A;  2PPY A;  4ELX A;  4FZW A;  3R9Q A;  3HRX A;  5DTW A;  2F9I B;  5G1R A;  3HLN 1;  3P85 A;  3BPP A;  3ST9 A;  5KDR B;  3HE2 A;  2WTB A;  2J5I A;  2CE3 A;  2F6I A;  4ZDF A;  3SLL A;  3PZK A;  1EF9 A;  3KTI A;  2C8T A;  2Q35 A;  3STA A;  3R9T A;  3IBB A;  1J7X A;  3GF7 A;  3IAV A;  1Y7O A;  5JBX A;  3MOY A;  3JU1 A;  4ZU2 A;  4I4Z A;  4WZ8 B;  1RJM A;  2FZS A;  4JVT A;  3H0S A;  4EMM A;  3ZWB A;  5CTB A;  3WG5 A;  4HC8 A;  3R6H A;  3QK8 A;  4U19 A;  4EML A;  3M6M A;  3NJD A;  1UIY A;  3BF0 A;  3H02 A;  3R0O A;  4GHN A;  3QXI A;  2VSU E;  1OD4 A;  5E0S A;  5E0S H;  5C90 A;  1NZY B;  3TT6 A;  1SZO A;  3QMJ A;  2D3T A;  1TYF A;  2ZL4 A;  3BEZ A;  4Q0G A;  1DUB A;  4OLQ A;  2VSU C;  2FW2 A;  4JCR A;  4JCQ A;  2IEX A;  3SWX A;  3QWD A;  4L8K A;  2W3P A;  2DUB A;  1O8U A;  1HZD A;  2F9I A;  3IB9 A;  4Q1I A;  3FF6 A;  3N6R B;  2J5G A;  3ZWC A;  3GLM A;  2VX2 A;  2VSU A;  5FUS A; 
#chains in the Genus database with same CATH topology
 1UYV A;  1SG4 A;  3ZW8 A;  2HW5 A;  5HUQ A;  2DEO A;  2VSU F;  3K8X A;  4NNQ A;  2BZR A;  4ASI A;  2J5I I;  5INF A;  2PBP A;  1Q51 A;  3DJA A;  3H0Q A;  5DL1 A;  5MGB A;  4MXI A;  1XNV A;  3KTG A;  3H0J A;  3I47 A;  3Q0G A;  2A7K A;  2FBM A;  1W2X A;  3U9S B;  1NZY A;  2X24 A;  1N6F A;  3NJB A;  5KJP A;  2YJG A;  3U9T B;  2GTR A;  4B3I A;  4G2R A;  3PEA A;  4FN7 A;  4EMP A;  1WDL A;  3K50 A;  4QFE A;  1ON9 A;  3KTH A;  3T8A A;  3DOR A;  1FC9 A;  4OG1 A;  3ZWA A;  2Q34 A;  1WDK A;  1N6D A;  3GMA A;  1VRG A;  4QII A;  2ZL2 A;  5E0N X;  3TVW A;  5CTC A;  5KDR A;  2VSS E;  4RYF A;  1HNO A;  4WCZ A;  3OC7 A;  1N6E A;  3HP0 A;  4OMR A;  3VIV A;  3QXZ A;  4U18 A;  4MI2 A;  1UYR A;  5G1S A;  1PJH A;  3TT7 A;  5DU4 A;  4KWB A;  1EF8 A;  4NEK A;  2VRE A;  1YG8 A;  3T8B A;  4FNB A;  4I42 A;  3PGQ A;  4JWV A;  3RSI A;  3V5I A;  1XNY A;  3U9R B;  3T88 A;  5ING A;  3TDC A;  4RCN A;  4DI1 A;  4JFC A;  3QRE A;  4U0H A;  4ELS A;  2F6Q A;  4U0G A;  5DUC A;  2UZF A;  2ZQR A;  3QYR A;  5DZK A;  3M6N A;  2J5G D;  4JCS A;  4B3J A;  4F47 A;  2VSS A;  1FCF A;  3FDU A;  4U0G H;  4FJW D;  3RRV A;  3LKE A;  1RJN A;  3V5E A;  1EY3 A;  5DKP A;  4IZC A;  1ON3 A;  3TV5 A;  3P5M A;  4IZD A;  2ZL3 A;  4IZB A;  2VSS F;  4KPK A;  4ELW A;  5DU6 A;  4K2N A;  3OT6 A;  4Z0M A;  2ZL0 A;  2PG8 A;  3T3W A;  5INI A;  4MOU A;  4YLH A;  3TVU A;  4QIJ A;  4JYJ A;  3MFM A;  5G1Q A;  3GKB A;  4JSB A;  5C9G A;  1UYS A;  3KTJ A;  2A7S A;  3KQF A;  4WYO B;  1YG6 A;  4K29 A;  4U1A A;  3TRR A;  4L6W A;  4GM2 A;  1TG6 A;  2X58 A;  4FND A;  4JJT A;  5DZK H;  3LAO A;  4FB8 A;  2ZQQ A;  4ZDB A;  5DTP A;  3GF3 A;  2CBY A;  3MT6 A;  4B3H A;  1UYT A;  1WZ8 A;  1FC6 A;  4RYF H;  3MYB A;  4FN8 A;  5DUF A;  5FIF A;  4ZDE A;  1DCI A;  4KD6 A;  5DU8 A;  4KNP A;  1XNW A;  2Q2X A;  3PE8 A;  3G64 A;  1FC7 A;  4NAR A;  3H0U A;  3R9S A;  2QQ3 A;  1XX4 A;  2EJ5 A;  2NP9 A;  4FZW C;  5JBW A;  2J5I B;  3QKA A;  1X0U A;  2J5S A;  3Q1T A;  3Q0J A;  3OME A;  3TLF A;  4K3W A;  3HIN A;  3ZW9 A;  3L3S A;  4JYL A;  1K32 A;  3RST A;  1Q52 A;  4I52 A;  4JCT A;  1MJ3 A;  1WDM A;  1XO6 A;  3T89 A;  2F9Y B;  1HNU A;  4JOT A;  1K39 A;  3TZ3 A;  4HNK A;  2F9Y A;  4LK5 A;  2A81 A;  1PIX A;  3P2L A;  1OD2 A;  3Q7H A;  3ISA A;  4ZDC A;  4ZDD A;  5IKL B;  3KTK A;  3H81 A;  1JXZ A;  2PPY A;  4ELX A;  4FZW A;  3R9Q A;  3HRX A;  5DTW A;  2F9I B;  5G1R A;  3HLN 1;  3P85 A;  3BPP A;  3ST9 A;  5KDR B;  3HE2 A;  2WTB A;  2J5I A;  2CE3 A;  2F6I A;  4ZDF A;  3SLL A;  3PZK A;  1EF9 A;  3KTI A;  2C8T A;  2Q35 A;  3STA A;  3R9T A;  3IBB A;  1J7X A;  3GF7 A;  3IAV A;  1Y7O A;  5JBX A;  3MOY A;  4HDT A;  3JU1 A;  4ZU2 A;  3BPT A;  4I4Z A;  4WZ8 B;  1RJM A;  2FZS A;  4JVT A;  3H0S A;  4EMM A;  3ZWB A;  5CTB A;  3WG5 A;  4HC8 A;  3R6H A;  3QK8 A;  4U19 A;  4EML A;  3M6M A;  3NJD A;  1UIY A;  3BF0 A;  3H02 A;  3R0O A;  4GHN A;  3QXI A;  2VSU E;  1OD4 A;  5E0S A;  5E0S H;  5C90 A;  1NZY B;  3TT6 A;  1SZO A;  3QMJ A;  2D3T A;  4J2U A;  1TYF A;  2ZL4 A;  3BEZ A;  4Q0G A;  1DUB A;  4OLQ A;  2VSU C;  2FW2 A;  4JCR A;  4JCQ A;  2IEX A;  3SWX A;  3QWD A;  4L8K A;  2W3P A;  2DUB A;  1O8U A;  1HZD A;  2F9I A;  3IB9 A;  4Q1I A;  3FF6 A;  3N6R B;  2J5G A;  3ZWC A;  3GLM A;  2VX2 A;  2VSU A;  5FUS A; 
#chains in the Genus database with same CATH homology
 1UYV A;  1SG4 A;  3ZW8 A;  2HW5 A;  5HUQ A;  2DEO A;  2VSU F;  3K8X A;  4NNQ A;  2BZR A;  4ASI A;  2J5I I;  5INF A;  2PBP A;  1Q51 A;  3DJA A;  3H0Q A;  5DL1 A;  5MGB A;  4MXI A;  1XNV A;  3KTG A;  3H0J A;  3I47 A;  3Q0G A;  2A7K A;  2FBM A;  1W2X A;  3U9S B;  1NZY A;  2X24 A;  1N6F A;  3NJB A;  5KJP A;  2YJG A;  3U9T B;  2GTR A;  4B3I A;  4G2R A;  3PEA A;  4FN7 A;  4EMP A;  1WDL A;  3K50 A;  4QFE A;  1ON9 A;  3KTH A;  3T8A A;  3DOR A;  1FC9 A;  4OG1 A;  3ZWA A;  2Q34 A;  1WDK A;  1N6D A;  3GMA A;  1VRG A;  4QII A;  2ZL2 A;  5E0N X;  3TVW A;  5CTC A;  5KDR A;  2VSS E;  4RYF A;  1HNO A;  4WCZ A;  3OC7 A;  1N6E A;  3HP0 A;  4OMR A;  3VIV A;  3QXZ A;  4U18 A;  4MI2 A;  1UYR A;  5G1S A;  1PJH A;  3TT7 A;  5DU4 A;  4KWB A;  1EF8 A;  4NEK A;  2VRE A;  1YG8 A;  3T8B A;  4FNB A;  4I42 A;  3PGQ A;  4JWV A;  3RSI A;  3V5I A;  1XNY A;  3U9R B;  3T88 A;  5ING A;  3TDC A;  4RCN A;  4DI1 A;  4JFC A;  3QRE A;  4U0H A;  4ELS A;  2F6Q A;  4U0G A;  5DUC A;  2UZF A;  2ZQR A;  3QYR A;  5DZK A;  3M6N A;  2J5G D;  4JCS A;  4B3J A;  4F47 A;  2VSS A;  1FCF A;  3FDU A;  4U0G H;  4FJW D;  3RRV A;  3LKE A;  1RJN A;  3V5E A;  1EY3 A;  5DKP A;  4IZC A;  1ON3 A;  3TV5 A;  3P5M A;  4IZD A;  2ZL3 A;  4IZB A;  2VSS F;  4KPK A;  4ELW A;  5DU6 A;  4K2N A;  3OT6 A;  4Z0M A;  2ZL0 A;  2PG8 A;  3T3W A;  5INI A;  4MOU A;  4YLH A;  3TVU A;  4QIJ A;  4JYJ A;  3MFM A;  5G1Q A;  3GKB A;  4JSB A;  5C9G A;  1UYS A;  3KTJ A;  2A7S A;  3KQF A;  4WYO B;  1YG6 A;  4K29 A;  4U1A A;  3TRR A;  4L6W A;  4GM2 A;  1TG6 A;  2X58 A;  4FND A;  4JJT A;  5DZK H;  3LAO A;  4FB8 A;  2ZQQ A;  4ZDB A;  5DTP A;  3GF3 A;  2CBY A;  3MT6 A;  4B3H A;  1UYT A;  1WZ8 A;  1FC6 A;  4RYF H;  3MYB A;  4FN8 A;  5DUF A;  5FIF A;  4ZDE A;  1DCI A;  4KD6 A;  5DU8 A;  4KNP A;  1XNW A;  2Q2X A;  3PE8 A;  3G64 A;  1FC7 A;  4NAR A;  3H0U A;  3R9S A;  2QQ3 A;  1XX4 A;  2EJ5 A;  2NP9 A;  4FZW C;  5JBW A;  2J5I B;  3QKA A;  1X0U A;  2J5S A;  3Q1T A;  3Q0J A;  3OME A;  3TLF A;  4K3W A;  3HIN A;  3ZW9 A;  3L3S A;  4JYL A;  1K32 A;  3RST A;  1Q52 A;  4I52 A;  4JCT A;  1MJ3 A;  1WDM A;  1XO6 A;  3T89 A;  2F9Y B;  1HNU A;  4JOT A;  1K39 A;  3TZ3 A;  4HNK A;  2F9Y A;  4LK5 A;  2A81 A;  1PIX A;  3P2L A;  1OD2 A;  3Q7H A;  3ISA A;  4ZDC A;  4ZDD A;  5IKL B;  3KTK A;  3H81 A;  1JXZ A;  2PPY A;  4ELX A;  4FZW A;  3R9Q A;  3HRX A;  5DTW A;  2F9I B;  5G1R A;  3HLN 1;  3P85 A;  3BPP A;  3ST9 A;  5KDR B;  3HE2 A;  2WTB A;  2J5I A;  2CE3 A;  2F6I A;  4ZDF A;  3SLL A;  3PZK A;  1EF9 A;  3KTI A;  2C8T A;  2Q35 A;  3STA A;  3R9T A;  3IBB A;  1J7X A;  3GF7 A;  3IAV A;  1Y7O A;  5JBX A;  3MOY A;  4HDT A;  3JU1 A;  4ZU2 A;  3BPT A;  4I4Z A;  4WZ8 B;  1RJM A;  2FZS A;  4JVT A;  3H0S A;  4EMM A;  3ZWB A;  5CTB A;  3WG5 A;  4HC8 A;  3R6H A;  3QK8 A;  4U19 A;  4EML A;  3M6M A;  3NJD A;  1UIY A;  3BF0 A;  3H02 A;  3R0O A;  4GHN A;  3QXI A;  2VSU E;  1OD4 A;  5E0S A;  5E0S H;  5C90 A;  1NZY B;  3TT6 A;  1SZO A;  3QMJ A;  2D3T A;  4J2U A;  1TYF A;  2ZL4 A;  3BEZ A;  4Q0G A;  1DUB A;  4OLQ A;  2VSU C;  2FW2 A;  4JCR A;  4JCQ A;  2IEX A;  3SWX A;  3QWD A;  4L8K A;  2W3P A;  2DUB A;  1O8U A;  1HZD A;  2F9I A;  3IB9 A;  4Q1I A;  3FF6 A;  3N6R B;  2J5G A;  3ZWC A;  3GLM A;  2VX2 A;  2VSU A;  5FUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...