2CBYA

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
169
Chain Sequence
b'SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 63
structure length 169
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2cbyA00
5KJPA 1RJMA 4I52A 3WG5A 3T8AA 4JVTA 3TT6A 1O8UA 4OG1A 2F9YB 1XO6A 2VX2A 1W2XA 4JCRA 2F9IB 2HW5A 2VSUA 3SWXA 2VSSE 3HINA 1UYVA 1ON3A 3MFMA 3TRRA 4I42A 2C8TA 4MI2A 4GM2A 3PE8A 4B3JA 1UYSA 1XNWA 4JCSA 3V5EA 2VSUE 4ZDEA 3KTHA 3T88A 3DJAA 3T89A 2VSUC 4OLQA 4EMLA 5INFA 3K50A 2D3TA 1VRGA 4MOUA 3GLMA 3MOYA 1X0UA 5DL1A 2ZQQA 5DZKA 3HE2A 1NZYA 4Z0MA 1SG4A 3KTKA 3HLN1 1UYTA 4JYLA 3NJBA 4RYFA 5DUCA 4HC8A 3TVUA 3ZW8A 5KDRB 4G2RA 3I47A 4L8KA 2VSSF 3L3SA 1UYRA 3KTJA 3IB9A 1SZOA 4LK5A 3M6MA 4FNDA 3ISAA 1N6DA 5JBWA 3U9SB 5C90A 3R9SA 1K32A 1TYFA 2VSUF 1EF8A 1NZYB 4DI1A 1EY3A 2DUBA 3OC7A 1TG6A 3LKEA 3PGQA 2VSSA 4FB8A 2Q2XA 1XX4A 4U0GH 2ZL3A 3TT7A 2J5II 4FNBA 2DEOA 1Q52A 3NJDA 4U0HA 5MGBA 4B3HA 5FUSA 1HNOA 4Q0GA 3OMEA 2FW2A 1OD4A 1N6FA 2J5IB 3P85A 3ZWBA 3ZWAA 1XNYA 4ZDDA 2X58A 3QXIA 3QMJA 2ZQRA 3QKAA 1N6EA 1JXZA 1FC9A 1WDLA 3H0JA 1EF9A 3FDUA 4WYOB 2J5GA 3RSTA 4JSBA 4I4ZA 3T8BA 2WTBA 4MXIA 1PIXA 4WCZA 5E0SH 2BZRA 3IAVA 1FC7A 3ST9A 5DUFA 2A81A 4HNKA 2J5GD 3R0OA 4JYJA 3FF6A 1RJNA 1WDMA 3U9RB 3P2LA 5C9GA 5IKLB 4U0GA 1HZDA 2EJ5A 3STAA 3N6RB 3GF7A 1MJ3A 4FZWC 1UIYA 2PPYA 3K8XA 3H0SA 2UZFA 3G64A 4L6WA 4B3IA 3BF0A 5DTWA 1FCFA 1J7XA 3BEZA 2X24A 3ZW9A 1PJHA 4IZBA 5CTBA 1OD2A 5E0NX 3BPPA 4GHNA 5G1RA 3MT6A 1HNUA 2CE3A 3GMAA 4K29A 2F9IA 3H0UA 4K3WA 1FC6A 3GKBA 4ZDCA 3KQFA 5E0SA 3QK8A 4KWBA 2Q34A 2ZL2A 3RSIA 3SLLA 4EMPA 2VREA 3JU1A 4RCNA 3P5MA 4ELXA 5FIFA 4K2NA 1YG8A 5G1QA 3QWDA 4JCQA 3H81A 2A7SA 3TVWA 5DU4A 4JOTA 2IEXA 1XNVA 3TZ3A 4KD6A 2W3PA 5INGA 5DZKH 3H0QA 1Q51A 3GF3A 4KPKA 4ZU2A 4JFCA 1ON9A 4FN8A 4RYFH 4OMRA 3MYBA 4NEKA 3R6HA 5INIA 3TLFA 4JCTA 2FZSA 3HP0A 4FZWA 3VIVA 3PEAA 3QYRA 4JJTA 5KDRA 3HRXA 3TV5A 3Q0JA 3R9TA 3U9TB 3Q1TA 4KNPA 3PZKA 4ELWA 2Q35A 4ASIA 4U1AA 5DKPA 4ZDBA 4FJWD 4U18A 4Q1IA 4F47A 2FBMA 3TDCA 2PG8A 2J5SA 5CTCA 4ELSA 3R9QA 1Y7OA 1DCIA 1WZ8A 3DORA 2NP9A 2F6IA 2QQ3A 4EMMA 3V5IA 3ZWCA 1WDKA 4WZ8B 4YLHA 2CBYA 2F9YA 2GTRA 4ZDFA 3H02A 4JWVA 3QREA 3IBBA 1DUBA 3QXZA 2A7KA 3M6NA 2ZL4A 2ZL0A 4QIJA 3KTIA 4IZCA 3OT6A 2J5IA 3RRVA 2F6QA 3Q0GA 4QFEA 3LAOA 4NNQA 3KTGA 4FN7A 1K39A 1YG6A 3Q7HA 5G1SA 5JBXA 4U19A 5DTPA 4QIIA 5DU8A 2PBPA 4IZDA 3T3WA 5DU6A
chains in the Genus database with same CATH superfamily
5KJPA 1RJMA 4I52A 3WG5A 3T8AA 4JVTA 3TT6A 1O8UA 4OG1A 2F9YB 1XO6A 2VX2A 1W2XA 4JCRA 2F9IB 2HW5A 2VSUA 3SWXA 2VSSE 3HINA 1UYVA 1ON3A 3MFMA 3TRRA 4I42A 2C8TA 4MI2A 4GM2A 3PE8A 4B3JA 1UYSA 1XNWA 4JCSA 3V5EA 2VSUE 4ZDEA 3KTHA 3T88A 3DJAA 3T89A 2VSUC 4OLQA 4EMLA 5INFA 3K50A 2D3TA 1VRGA 4MOUA 3GLMA 3MOYA 1X0UA 3BPTA 5DL1A 2ZQQA 5DZKA 3HE2A 1NZYA 4Z0MA 1SG4A 3KTKA 3HLN1 1UYTA 4JYLA 3NJBA 4RYFA 5DUCA 4HC8A 2YJGA 3TVUA 3ZW8A 5KDRB 4G2RA 3I47A 4L8KA 2VSSF 3L3SA 1UYRA 3KTJA 3IB9A 1SZOA 4LK5A 3M6MA 4FNDA 3ISAA 1N6DA 5JBWA 3U9SB 5C90A 3R9SA 1K32A 1TYFA 2VSUF 1EF8A 1NZYB 4DI1A 1EY3A 2DUBA 3OC7A 1TG6A 3LKEA 3PGQA 2VSSA 4FB8A 2Q2XA 1XX4A 4U0GH 2ZL3A 3TT7A 2J5II 4FNBA 2DEOA 1Q52A 3NJDA 4U0HA 5MGBA 4B3HA 5FUSA 1HNOA 4Q0GA 3OMEA 2FW2A 1OD4A 1N6FA 2J5IB 3P85A 3ZWBA 3ZWAA 1XNYA 4ZDDA 2X58A 3QXIA 3QMJA 2ZQRA 3QKAA 1N6EA 1JXZA 1FC9A 1WDLA 3H0JA 1EF9A 3FDUA 4WYOB 2J5GA 3RSTA 4JSBA 4I4ZA 3T8BA 2WTBA 4MXIA 1PIXA 4WCZA 5E0SH 2BZRA 3IAVA 1FC7A 3ST9A 5DUFA 2A81A 4HNKA 2J5GD 3R0OA 4JYJA 3FF6A 1RJNA 1WDMA 3U9RB 3P2LA 5C9GA 5IKLB 4U0GA 1HZDA 2EJ5A 3STAA 3N6RB 3GF7A 1MJ3A 4FZWC 1UIYA 2PPYA 3K8XA 3H0SA 2UZFA 3G64A 4L6WA 4B3IA 3BF0A 5DTWA 1FCFA 1J7XA 3BEZA 2X24A 3ZW9A 1PJHA 4IZBA 5CTBA 1OD2A 5E0NX 3BPPA 4GHNA 5G1RA 3MT6A 1HNUA 2CE3A 3GMAA 4K29A 2F9IA 3H0UA 4K3WA 1FC6A 3GKBA 4ZDCA 3KQFA 5E0SA 3QK8A 4KWBA 2Q34A 2ZL2A 3RSIA 3SLLA 4EMPA 2VREA 3JU1A 4RCNA 3P5MA 4ELXA 5FIFA 4K2NA 1YG8A 5G1QA 3QWDA 4JCQA 3H81A 2A7SA 3TVWA 5DU4A 4JOTA 2IEXA 1XNVA 3TZ3A 4KD6A 2W3PA 5INGA 5DZKH 3H0QA 1Q51A 3GF3A 4KPKA 4ZU2A 4JFCA 1ON9A 4J2UA 4FN8A 4RYFH 4OMRA 3MYBA 4NEKA 3R6HA 5INIA 3TLFA 4JCTA 2FZSA 3HP0A 4FZWA 3VIVA 3PEAA 3QYRA 4JJTA 5KDRA 3HRXA 3TV5A 3Q0JA 3R9TA 3U9TB 3Q1TA 4KNPA 3PZKA 4ELWA 2Q35A 4ASIA 4U1AA 5DKPA 4ZDBA 4FJWD 4U18A 4Q1IA 4F47A 2FBMA 3TDCA 2PG8A 2J5SA 5CTCA 4ELSA 3R9QA 5HUQA 1Y7OA 1DCIA 1WZ8A 3DORA 2NP9A 2F6IA 2QQ3A 4EMMA 3V5IA 3ZWCA 1WDKA 4WZ8B 4YLHA 2CBYA 2F9YA 2GTRA 4ZDFA 3H02A 4JWVA 3QREA 3IBBA 1DUBA 3QXZA 2A7KA 3M6NA 2ZL4A 2ZL0A 4QIJA 4NARA 3KTIA 4IZCA 3OT6A 2J5IA 3RRVA 2F6QA 3Q0GA 4QFEA 3LAOA 4NNQA 3KTGA 4FN7A 1K39A 1YG6A 3Q7HA 5G1SA 5JBXA 4U19A 5DTPA 4QIIA 5DU8A 2PBPA 4IZDA 3T3WA 4HDTA 5DU6A
chains in the Genus database with same CATH topology
5KJPA 1RJMA 4I52A 3WG5A 3T8AA 4JVTA 3TT6A 1O8UA 4OG1A 2F9YB 1XO6A 2VX2A 1W2XA 4JCRA 2F9IB 2HW5A 2VSUA 3SWXA 2VSSE 3HINA 1UYVA 1ON3A 3MFMA 3TRRA 4I42A 2C8TA 4MI2A 4GM2A 3PE8A 4B3JA 1UYSA 1XNWA 4JCSA 3V5EA 2VSUE 4ZDEA 3KTHA 3T88A 3DJAA 3T89A 2VSUC 4OLQA 4EMLA 5INFA 3K50A 2D3TA 1VRGA 4MOUA 3GLMA 3MOYA 1X0UA 3BPTA 5DL1A 2ZQQA 5DZKA 3HE2A 1NZYA 4Z0MA 1SG4A 3KTKA 3HLN1 1UYTA 4JYLA 3NJBA 4RYFA 5DUCA 4HC8A 2YJGA 3TVUA 3ZW8A 5KDRB 4G2RA 3I47A 4L8KA 2VSSF 3L3SA 1UYRA 3KTJA 3IB9A 1SZOA 4LK5A 3M6MA 4FNDA 3ISAA 1N6DA 5JBWA 3U9SB 5C90A 3R9SA 1K32A 1TYFA 2VSUF 1EF8A 1NZYB 4DI1A 1EY3A 2DUBA 3OC7A 1TG6A 3LKEA 3PGQA 2VSSA 4FB8A 2Q2XA 1XX4A 4U0GH 2ZL3A 3TT7A 2J5II 4FNBA 2DEOA 1Q52A 3NJDA 4U0HA 5MGBA 4B3HA 5FUSA 1HNOA 4Q0GA 3OMEA 2FW2A 1OD4A 1N6FA 2J5IB 3P85A 3ZWBA 3ZWAA 1XNYA 4ZDDA 2X58A 3QXIA 3QMJA 2ZQRA 3QKAA 1N6EA 1JXZA 1FC9A 1WDLA 3H0JA 1EF9A 3FDUA 4WYOB 2J5GA 3RSTA 4JSBA 4I4ZA 3T8BA 2WTBA 4MXIA 1PIXA 4WCZA 5E0SH 2BZRA 3IAVA 1FC7A 3ST9A 5DUFA 2A81A 4HNKA 2J5GD 3R0OA 4JYJA 3FF6A 1RJNA 1WDMA 3U9RB 3P2LA 5C9GA 5IKLB 4U0GA 1HZDA 2EJ5A 3STAA 3N6RB 3GF7A 1MJ3A 4FZWC 1UIYA 2PPYA 3K8XA 3H0SA 2UZFA 3G64A 4L6WA 4B3IA 3BF0A 5DTWA 1FCFA 1J7XA 3BEZA 2X24A 3ZW9A 1PJHA 4IZBA 5CTBA 1OD2A 5E0NX 3BPPA 4GHNA 5G1RA 3MT6A 1HNUA 2CE3A 3GMAA 4K29A 2F9IA 3H0UA 4K3WA 1FC6A 3GKBA 4ZDCA 3KQFA 5E0SA 3QK8A 4KWBA 2Q34A 2ZL2A 3RSIA 3SLLA 4EMPA 2VREA 3JU1A 4RCNA 3P5MA 4ELXA 5FIFA 4K2NA 1YG8A 5G1QA 3QWDA 4JCQA 3H81A 2A7SA 3TVWA 5DU4A 4JOTA 2IEXA 1XNVA 3TZ3A 4KD6A 2W3PA 5INGA 5DZKH 3H0QA 1Q51A 3GF3A 4KPKA 4ZU2A 4JFCA 1ON9A 4J2UA 4FN8A 4RYFH 4OMRA 3MYBA 4NEKA 3R6HA 5INIA 3TLFA 4JCTA 2FZSA 3HP0A 4FZWA 3VIVA 3PEAA 3QYRA 4JJTA 5KDRA 3HRXA 3TV5A 3Q0JA 3R9TA 3U9TB 3Q1TA 4KNPA 3PZKA 4ELWA 2Q35A 4ASIA 4U1AA 5DKPA 4ZDBA 4FJWD 4U18A 4Q1IA 4F47A 2FBMA 3TDCA 2PG8A 2J5SA 5CTCA 4ELSA 3R9QA 5HUQA 1Y7OA 1DCIA 1WZ8A 3DORA 2NP9A 2F6IA 2QQ3A 4EMMA 3V5IA 3ZWCA 1WDKA 4WZ8B 4YLHA 2CBYA 2F9YA 2GTRA 4ZDFA 3H02A 4JWVA 3QREA 3IBBA 1DUBA 3QXZA 2A7KA 3M6NA 2ZL4A 2ZL0A 4QIJA 4NARA 3KTIA 4IZCA 3OT6A 2J5IA 3RRVA 2F6QA 3Q0GA 4QFEA 3LAOA 4NNQA 3KTGA 4FN7A 1K39A 1YG6A 3Q7HA 5G1SA 5JBXA 4U19A 5DTPA 4QIIA 5DU8A 2PBPA 4IZDA 3T3WA 4HDTA 5DU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJP A;  1RJM A;  4I52 A;  3WG5 A;  3T8A A;  4JVT A;  3TT6 A;  1O8U A;  4OG1 A;  2F9Y B;  1XO6 A;  2VX2 A;  1W2X A;  4JCR A;  2F9I B;  2HW5 A;  2VSU A;  3SWX A;  2VSS E;  3HIN A;  1UYV A;  1ON3 A;  3MFM A;  3TRR A;  4I42 A;  2C8T A;  4MI2 A;  4GM2 A;  3PE8 A;  4B3J A;  1UYS A;  1XNW A;  4JCS A;  3V5E A;  2VSU E;  4ZDE A;  3KTH A;  3T88 A;  3DJA A;  3T89 A;  2VSU C;  4OLQ A;  4EML A;  5INF A;  3K50 A;  2D3T A;  1VRG A;  4MOU A;  3GLM A;  3MOY A;  1X0U A;  5DL1 A;  2ZQQ A;  5DZK A;  3HE2 A;  1NZY A;  4Z0M A;  1SG4 A;  3KTK A;  3HLN 1;  1UYT A;  4JYL A;  3NJB A;  4RYF A;  5DUC A;  4HC8 A;  3TVU A;  3ZW8 A;  5KDR B;  4G2R A;  3I47 A;  4L8K A;  2VSS F;  3L3S A;  1UYR A;  3KTJ A;  3IB9 A;  1SZO A;  4LK5 A;  3M6M A;  4FND A;  3ISA A;  1N6D A;  5JBW A;  3U9S B;  5C90 A;  3R9S A;  1K32 A;  1TYF A;  2VSU F;  1EF8 A;  1NZY B;  4DI1 A;  1EY3 A;  2DUB A;  3OC7 A;  1TG6 A;  3LKE A;  3PGQ A;  2VSS A;  4FB8 A;  2Q2X A;  1XX4 A;  4U0G H;  2ZL3 A;  3TT7 A;  2J5I I;  4FNB A;  2DEO A;  1Q52 A;  3NJD A;  4U0H A;  5MGB A;  4B3H A;  5FUS A;  1HNO A;  4Q0G A;  3OME A;  2FW2 A;  1OD4 A;  1N6F A;  2J5I B;  3P85 A;  3ZWB A;  3ZWA A;  1XNY A;  4ZDD A;  2X58 A;  3QXI A;  3QMJ A;  2ZQR A;  3QKA A;  1N6E A;  1JXZ A;  1FC9 A;  1WDL A;  3H0J A;  1EF9 A;  3FDU A;  4WYO B;  2J5G A;  3RST A;  4JSB A;  4I4Z A;  3T8B A;  2WTB A;  4MXI A;  1PIX A;  4WCZ A;  5E0S H;  2BZR A;  3IAV A;  1FC7 A;  3ST9 A;  5DUF A;  2A81 A;  4HNK A;  2J5G D;  3R0O A;  4JYJ A;  3FF6 A;  1RJN A;  1WDM A;  3U9R B;  3P2L A;  5C9G A;  5IKL B;  4U0G A;  1HZD A;  2EJ5 A;  3STA A;  3N6R B;  3GF7 A;  1MJ3 A;  4FZW C;  1UIY A;  2PPY A;  3K8X A;  3H0S A;  2UZF A;  3G64 A;  4L6W A;  4B3I A;  3BF0 A;  5DTW A;  1FCF A;  1J7X A;  3BEZ A;  2X24 A;  3ZW9 A;  1PJH A;  4IZB A;  5CTB A;  1OD2 A;  5E0N X;  3BPP A;  4GHN A;  5G1R A;  3MT6 A;  1HNU A;  2CE3 A;  3GMA A;  4K29 A;  2F9I A;  3H0U A;  4K3W A;  1FC6 A;  3GKB A;  4ZDC A;  3KQF A;  5E0S A;  3QK8 A;  4KWB A;  2Q34 A;  2ZL2 A;  3RSI A;  3SLL A;  4EMP A;  2VRE A;  3JU1 A;  4RCN A;  3P5M A;  4ELX A;  5FIF A;  4K2N A;  1YG8 A;  5G1Q A;  3QWD A;  4JCQ A;  3H81 A;  2A7S A;  3TVW A;  5DU4 A;  4JOT A;  2IEX A;  1XNV A;  3TZ3 A;  4KD6 A;  2W3P A;  5ING A;  5DZK H;  3H0Q A;  1Q51 A;  3GF3 A;  4KPK A;  4ZU2 A;  4JFC A;  1ON9 A;  4FN8 A;  4RYF H;  4OMR A;  3MYB A;  4NEK A;  3R6H A;  5INI A;  3TLF A;  4JCT A;  2FZS A;  3HP0 A;  4FZW A;  3VIV A;  3PEA A;  3QYR A;  4JJT A;  5KDR A;  3HRX A;  3TV5 A;  3Q0J A;  3R9T A;  3U9T B;  3Q1T A;  4KNP A;  3PZK A;  4ELW A;  2Q35 A;  4ASI A;  4U1A A;  5DKP A;  4ZDB A;  4FJW D;  4U18 A;  4Q1I A;  4F47 A;  2FBM A;  3TDC A;  2PG8 A;  2J5S A;  5CTC A;  4ELS A;  3R9Q A;  1Y7O A;  1DCI A;  1WZ8 A;  3DOR A;  2NP9 A;  2F6I A;  2QQ3 A;  4EMM A;  3V5I A;  3ZWC A;  1WDK A;  4WZ8 B;  4YLH A;  2CBY A;  2F9Y A;  2GTR A;  4ZDF A;  3H02 A;  4JWV A;  3QRE A;  3IBB A;  1DUB A;  3QXZ A;  2A7K A;  3M6N A;  2ZL4 A;  2ZL0 A;  4QIJ A;  3KTI A;  4IZC A;  3OT6 A;  2J5I A;  3RRV A;  2F6Q A;  3Q0G A;  4QFE A;  3LAO A;  4NNQ A;  3KTG A;  4FN7 A;  1K39 A;  1YG6 A;  3Q7H A;  5G1S A;  5JBX A;  4U19 A;  5DTP A;  4QII A;  5DU8 A;  2PBP A;  4IZD A;  3T3W A;  5DU6 A; 
#chains in the Genus database with same CATH topology
 5KJP A;  1RJM A;  4I52 A;  3WG5 A;  3T8A A;  4JVT A;  3TT6 A;  1O8U A;  4OG1 A;  2F9Y B;  1XO6 A;  2VX2 A;  1W2X A;  4JCR A;  2F9I B;  2HW5 A;  2VSU A;  3SWX A;  2VSS E;  3HIN A;  1UYV A;  1ON3 A;  3MFM A;  3TRR A;  4I42 A;  2C8T A;  4MI2 A;  4GM2 A;  3PE8 A;  4B3J A;  1UYS A;  1XNW A;  4JCS A;  3V5E A;  2VSU E;  4ZDE A;  3KTH A;  3T88 A;  3DJA A;  3T89 A;  2VSU C;  4OLQ A;  4EML A;  5INF A;  3K50 A;  2D3T A;  1VRG A;  4MOU A;  3GLM A;  3MOY A;  1X0U A;  3BPT A;  5DL1 A;  2ZQQ A;  5DZK A;  3HE2 A;  1NZY A;  4Z0M A;  1SG4 A;  3KTK A;  3HLN 1;  1UYT A;  4JYL A;  3NJB A;  4RYF A;  5DUC A;  4HC8 A;  2YJG A;  3TVU A;  3ZW8 A;  5KDR B;  4G2R A;  3I47 A;  4L8K A;  2VSS F;  3L3S A;  1UYR A;  3KTJ A;  3IB9 A;  1SZO A;  4LK5 A;  3M6M A;  4FND A;  3ISA A;  1N6D A;  5JBW A;  3U9S B;  5C90 A;  3R9S A;  1K32 A;  1TYF A;  2VSU F;  1EF8 A;  1NZY B;  4DI1 A;  1EY3 A;  2DUB A;  3OC7 A;  1TG6 A;  3LKE A;  3PGQ A;  2VSS A;  4FB8 A;  2Q2X A;  1XX4 A;  4U0G H;  2ZL3 A;  3TT7 A;  2J5I I;  4FNB A;  2DEO A;  1Q52 A;  3NJD A;  4U0H A;  5MGB A;  4B3H A;  5FUS A;  1HNO A;  4Q0G A;  3OME A;  2FW2 A;  1OD4 A;  1N6F A;  2J5I B;  3P85 A;  3ZWB A;  3ZWA A;  1XNY A;  4ZDD A;  2X58 A;  3QXI A;  3QMJ A;  2ZQR A;  3QKA A;  1N6E A;  1JXZ A;  1FC9 A;  1WDL A;  3H0J A;  1EF9 A;  3FDU A;  4WYO B;  2J5G A;  3RST A;  4JSB A;  4I4Z A;  3T8B A;  2WTB A;  4MXI A;  1PIX A;  4WCZ A;  5E0S H;  2BZR A;  3IAV A;  1FC7 A;  3ST9 A;  5DUF A;  2A81 A;  4HNK A;  2J5G D;  3R0O A;  4JYJ A;  3FF6 A;  1RJN A;  1WDM A;  3U9R B;  3P2L A;  5C9G A;  5IKL B;  4U0G A;  1HZD A;  2EJ5 A;  3STA A;  3N6R B;  3GF7 A;  1MJ3 A;  4FZW C;  1UIY A;  2PPY A;  3K8X A;  3H0S A;  2UZF A;  3G64 A;  4L6W A;  4B3I A;  3BF0 A;  5DTW A;  1FCF A;  1J7X A;  3BEZ A;  2X24 A;  3ZW9 A;  1PJH A;  4IZB A;  5CTB A;  1OD2 A;  5E0N X;  3BPP A;  4GHN A;  5G1R A;  3MT6 A;  1HNU A;  2CE3 A;  3GMA A;  4K29 A;  2F9I A;  3H0U A;  4K3W A;  1FC6 A;  3GKB A;  4ZDC A;  3KQF A;  5E0S A;  3QK8 A;  4KWB A;  2Q34 A;  2ZL2 A;  3RSI A;  3SLL A;  4EMP A;  2VRE A;  3JU1 A;  4RCN A;  3P5M A;  4ELX A;  5FIF A;  4K2N A;  1YG8 A;  5G1Q A;  3QWD A;  4JCQ A;  3H81 A;  2A7S A;  3TVW A;  5DU4 A;  4JOT A;  2IEX A;  1XNV A;  3TZ3 A;  4KD6 A;  2W3P A;  5ING A;  5DZK H;  3H0Q A;  1Q51 A;  3GF3 A;  4KPK A;  4ZU2 A;  4JFC A;  1ON9 A;  4J2U A;  4FN8 A;  4RYF H;  4OMR A;  3MYB A;  4NEK A;  3R6H A;  5INI A;  3TLF A;  4JCT A;  2FZS A;  3HP0 A;  4FZW A;  3VIV A;  3PEA A;  3QYR A;  4JJT A;  5KDR A;  3HRX A;  3TV5 A;  3Q0J A;  3R9T A;  3U9T B;  3Q1T A;  4KNP A;  3PZK A;  4ELW A;  2Q35 A;  4ASI A;  4U1A A;  5DKP A;  4ZDB A;  4FJW D;  4U18 A;  4Q1I A;  4F47 A;  2FBM A;  3TDC A;  2PG8 A;  2J5S A;  5CTC A;  4ELS A;  3R9Q A;  5HUQ A;  1Y7O A;  1DCI A;  1WZ8 A;  3DOR A;  2NP9 A;  2F6I A;  2QQ3 A;  4EMM A;  3V5I A;  3ZWC A;  1WDK A;  4WZ8 B;  4YLH A;  2CBY A;  2F9Y A;  2GTR A;  4ZDF A;  3H02 A;  4JWV A;  3QRE A;  3IBB A;  1DUB A;  3QXZ A;  2A7K A;  3M6N A;  2ZL4 A;  2ZL0 A;  4QIJ A;  4NAR A;  3KTI A;  4IZC A;  3OT6 A;  2J5I A;  3RRV A;  2F6Q A;  3Q0G A;  4QFE A;  3LAO A;  4NNQ A;  3KTG A;  4FN7 A;  1K39 A;  1YG6 A;  3Q7H A;  5G1S A;  5JBX A;  4U19 A;  5DTP A;  4QII A;  5DU8 A;  2PBP A;  4IZD A;  3T3W A;  4HDT A;  5DU6 A; 
#chains in the Genus database with same CATH homology
 5KJP A;  1RJM A;  4I52 A;  3WG5 A;  3T8A A;  4JVT A;  3TT6 A;  1O8U A;  4OG1 A;  2F9Y B;  1XO6 A;  2VX2 A;  1W2X A;  4JCR A;  2F9I B;  2HW5 A;  2VSU A;  3SWX A;  2VSS E;  3HIN A;  1UYV A;  1ON3 A;  3MFM A;  3TRR A;  4I42 A;  2C8T A;  4MI2 A;  4GM2 A;  3PE8 A;  4B3J A;  1UYS A;  1XNW A;  4JCS A;  3V5E A;  2VSU E;  4ZDE A;  3KTH A;  3T88 A;  3DJA A;  3T89 A;  2VSU C;  4OLQ A;  4EML A;  5INF A;  3K50 A;  2D3T A;  1VRG A;  4MOU A;  3GLM A;  3MOY A;  1X0U A;  3BPT A;  5DL1 A;  2ZQQ A;  5DZK A;  3HE2 A;  1NZY A;  4Z0M A;  1SG4 A;  3KTK A;  3HLN 1;  1UYT A;  4JYL A;  3NJB A;  4RYF A;  5DUC A;  4HC8 A;  2YJG A;  3TVU A;  3ZW8 A;  5KDR B;  4G2R A;  3I47 A;  4L8K A;  2VSS F;  3L3S A;  1UYR A;  3KTJ A;  3IB9 A;  1SZO A;  4LK5 A;  3M6M A;  4FND A;  3ISA A;  1N6D A;  5JBW A;  3U9S B;  5C90 A;  3R9S A;  1K32 A;  1TYF A;  2VSU F;  1EF8 A;  1NZY B;  4DI1 A;  1EY3 A;  2DUB A;  3OC7 A;  1TG6 A;  3LKE A;  3PGQ A;  2VSS A;  4FB8 A;  2Q2X A;  1XX4 A;  4U0G H;  2ZL3 A;  3TT7 A;  2J5I I;  4FNB A;  2DEO A;  1Q52 A;  3NJD A;  4U0H A;  5MGB A;  4B3H A;  5FUS A;  1HNO A;  4Q0G A;  3OME A;  2FW2 A;  1OD4 A;  1N6F A;  2J5I B;  3P85 A;  3ZWB A;  3ZWA A;  1XNY A;  4ZDD A;  2X58 A;  3QXI A;  3QMJ A;  2ZQR A;  3QKA A;  1N6E A;  1JXZ A;  1FC9 A;  1WDL A;  3H0J A;  1EF9 A;  3FDU A;  4WYO B;  2J5G A;  3RST A;  4JSB A;  4I4Z A;  3T8B A;  2WTB A;  4MXI A;  1PIX A;  4WCZ A;  5E0S H;  2BZR A;  3IAV A;  1FC7 A;  3ST9 A;  5DUF A;  2A81 A;  4HNK A;  2J5G D;  3R0O A;  4JYJ A;  3FF6 A;  1RJN A;  1WDM A;  3U9R B;  3P2L A;  5C9G A;  5IKL B;  4U0G A;  1HZD A;  2EJ5 A;  3STA A;  3N6R B;  3GF7 A;  1MJ3 A;  4FZW C;  1UIY A;  2PPY A;  3K8X A;  3H0S A;  2UZF A;  3G64 A;  4L6W A;  4B3I A;  3BF0 A;  5DTW A;  1FCF A;  1J7X A;  3BEZ A;  2X24 A;  3ZW9 A;  1PJH A;  4IZB A;  5CTB A;  1OD2 A;  5E0N X;  3BPP A;  4GHN A;  5G1R A;  3MT6 A;  1HNU A;  2CE3 A;  3GMA A;  4K29 A;  2F9I A;  3H0U A;  4K3W A;  1FC6 A;  3GKB A;  4ZDC A;  3KQF A;  5E0S A;  3QK8 A;  4KWB A;  2Q34 A;  2ZL2 A;  3RSI A;  3SLL A;  4EMP A;  2VRE A;  3JU1 A;  4RCN A;  3P5M A;  4ELX A;  5FIF A;  4K2N A;  1YG8 A;  5G1Q A;  3QWD A;  4JCQ A;  3H81 A;  2A7S A;  3TVW A;  5DU4 A;  4JOT A;  2IEX A;  1XNV A;  3TZ3 A;  4KD6 A;  2W3P A;  5ING A;  5DZK H;  3H0Q A;  1Q51 A;  3GF3 A;  4KPK A;  4ZU2 A;  4JFC A;  1ON9 A;  4J2U A;  4FN8 A;  4RYF H;  4OMR A;  3MYB A;  4NEK A;  3R6H A;  5INI A;  3TLF A;  4JCT A;  2FZS A;  3HP0 A;  4FZW A;  3VIV A;  3PEA A;  3QYR A;  4JJT A;  5KDR A;  3HRX A;  3TV5 A;  3Q0J A;  3R9T A;  3U9T B;  3Q1T A;  4KNP A;  3PZK A;  4ELW A;  2Q35 A;  4ASI A;  4U1A A;  5DKP A;  4ZDB A;  4FJW D;  4U18 A;  4Q1I A;  4F47 A;  2FBM A;  3TDC A;  2PG8 A;  2J5S A;  5CTC A;  4ELS A;  3R9Q A;  5HUQ A;  1Y7O A;  1DCI A;  1WZ8 A;  3DOR A;  2NP9 A;  2F6I A;  2QQ3 A;  4EMM A;  3V5I A;  3ZWC A;  1WDK A;  4WZ8 B;  4YLH A;  2CBY A;  2F9Y A;  2GTR A;  4ZDF A;  3H02 A;  4JWV A;  3QRE A;  3IBB A;  1DUB A;  3QXZ A;  2A7K A;  3M6N A;  2ZL4 A;  2ZL0 A;  4QIJ A;  4NAR A;  3KTI A;  4IZC A;  3OT6 A;  2J5I A;  3RRV A;  2F6Q A;  3Q0G A;  4QFE A;  3LAO A;  4NNQ A;  3KTG A;  4FN7 A;  1K39 A;  1YG6 A;  3Q7H A;  5G1S A;  5JBX A;  4U19 A;  5DTP A;  4QII A;  5DU8 A;  2PBP A;  4IZD A;  3T3W A;  4HDT A;  5DU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...