2CBYA

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
169
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
total genus 63
structure length 169
sequence length 179
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2cbyA00
1XNYA 3H0SA 2Q35A 4U19A 3HE2A 3JU1A 5FUSA 3TVWA 3BF0A 3T3WA 3IBBA 3KTGA 4I42A 3VIVA 3OMEA 3SLLA 4ELSA 4MXIA 3K8XA 3QXZA 2D3TA 5DU4A 1EF8A 1UYSA 5MGBA 4EMLA 1OD2A 4NEKA 4HNKA 4OG1A 4JJTA 3ISAA 2VSUC 5FIFA 1HNOA 2F9YA 4FN8A 4JSBA 1N6DA 4JOTA 4KPKA 3QMJA 3H0UA 3QXIA 1O8UA 2CE3A 3OC7A 5DZKA 2X24A 2IEXA 3R9QA 5E0SH 4JCRA 2Q34A 5DUCA 1SZOA 4JCQA 5JBWA 3N6RB 2PG8A 1W2XA 1Q51A 2VX2A 3MFMA 4FZWC 4Z0MA 3IB9A 3K50A 1TG6A 5DL1A 1NZYA 4EMMA 3RSTA 2HW5A 3QYRA 2J5IA 3R0OA 5KDRB 4GHNA 3TT7A 5C90A 3Q7HA 3WG5A 3HP0A 5C9GA 3Q0JA 1Q52A 1XNWA 4WZ8B 1XX4A 1JXZA 4K3WA 2PBPA 2F9YB 4ZDCA 3T8AA 4KNPA 3QREA 1FC7A 3M6MA 3TVUA 3BPPA 4EMPA 1YG6A 3HLN1 4K2NA 5DTPA 1ON9A 3GF3A 1EF9A 3KTKA 4L6WA 5INFA 2W3PA 3P85A 4ELXA 2VSUA 2VSSF 4K29A 5DUFA 2F9IA 3GKBA 2A7KA 1PIXA 4I4ZA 2CBYA 5E0SA 3PEAA 3KTIA 3KQFA 4I52A 3NJBA 3H02A 3PZKA 1HZDA 4QIIA 2PPYA 5DKPA 4B3IA 2DEOA 4OLQA 3P5MA 3TV5A 4QIJA 3T89A 2A81A 2QQ3A 3ZW9A 2Q2XA 1FCFA 4FJWD 4MI2A 4ASIA 5G1SA 3SWXA 1N6EA 1WDLA 2J5IB 2F6IA 5KJPA 4QFEA 2FZSA 1XNVA 3ST9A 4KD6A 3V5IA 1J7XA 4FNBA 3R6HA 1NZYB 3TZ3A 2FBMA 4Q0GA 3TDCA 3U9SB 4JFCA 5DTWA 4DI1A 1RJMA 4GM2A 1XO6A 3GMAA 4HC8A 3HINA 1RJNA 3U9RB 3RSIA 3KTJA 4JVTA 3I47A 4U0GA 3FDUA 3FF6A 5E0NX 3Q0GA 5INGA 3OT6A 3GF7A 4WYOB 3P2LA 4KWBA 2GTRA 4ELWA 1VRGA 4FNDA 3HRXA 4RYFA 3V5EA 3LAOA 1Y7OA 1UIYA 3KTHA 2F9IB 4L8KA 1MJ3A 3R9SA 3STAA 4FZWA 4ZDEA 1WZ8A 1K39A 2A7SA 4IZBA 3TT6A 3T88A 3LKEA 3MYBA 4JYLA 1WDMA 1X0UA 1SG4A 2VSSA 1UYVA 4OMRA 4MOUA 3ZWBA 3TRRA 4JCSA 3ZWAA 2ZQQA 3T8BA 2VSSE 1WDKA 2J5SA 4FB8A 4U18A 5JBXA 3ZW8A 1UYTA 4ZDBA 3IAVA 4U0HA 4ZDDA 4LK5A 3H81A 4JWVA 3GLMA 1PJHA 3U9TB 2FW2A 5DZKH 4RYFH 2UZFA 1YG8A 3MT6A 1ON3A 2J5GA 2F6QA 4F47A 2WTBA 3M6NA 5INIA 4JYJA 2ZL3A 1UYRA 1EY3A 3H0JA 3QKAA 3RRVA 1K32A 2C8TA 5DU6A 4Q1IA 2DUBA 4ZDFA 5G1RA 3DORA 4U1AA 2ZL2A 1OD4A 2J5II 3H0QA 4B3JA 2EJ5A 5IKLB 4G2RA 3Q1TA 3NJDA 4WCZA 4U0GH 2BZRA 3QWDA 4ZU2A 4NNQA 4B3HA 5DU8A 2ZL0A 3ZWCA 3G64A 2VREA 3PE8A 4JCTA 4IZDA 3MOYA 2ZL4A 1FC9A 1FC6A 3BEZA 1HNUA 4RCNA 3PGQA 3L3SA 5G1QA 5CTCA 1TYFA 3QK8A 4IZCA 3TLFA 3DJAA 2X58A 2ZQRA 2NP9A 5CTBA 1N6FA 4FN7A 5KDRA 1DCIA 2J5GD 2VSUF 1DUBA 3R9TA 4YLHA 2VSUE
chains in the Genus database with same CATH superfamily
1XNYA 3H0SA 2Q35A 4U19A 3HE2A 3JU1A 5FUSA 3TVWA 3BF0A 3T3WA 3IBBA 3KTGA 4I42A 3VIVA 3OMEA 3SLLA 4ELSA 4MXIA 3K8XA 3QXZA 2D3TA 5DU4A 1EF8A 1UYSA 5MGBA 4EMLA 1OD2A 4NEKA 4HNKA 4OG1A 4JJTA 3ISAA 2VSUC 5FIFA 1HNOA 2F9YA 4FN8A 4JSBA 1N6DA 4JOTA 4KPKA 3QMJA 3H0UA 3QXIA 4NARA 1O8UA 2CE3A 3OC7A 5DZKA 2X24A 2IEXA 3R9QA 5E0SH 4JCRA 2Q34A 5DUCA 1SZOA 4JCQA 5JBWA 3N6RB 2PG8A 1W2XA 1Q51A 2VX2A 3MFMA 4FZWC 4Z0MA 3IB9A 3K50A 1TG6A 5DL1A 1NZYA 4EMMA 3RSTA 2HW5A 2YJGA 3QYRA 2J5IA 3R0OA 5KDRB 4GHNA 3TT7A 5C90A 3Q7HA 3WG5A 3HP0A 5C9GA 3Q0JA 1Q52A 1XNWA 4WZ8B 1XX4A 1JXZA 4K3WA 2PBPA 2F9YB 4ZDCA 3T8AA 4KNPA 4HDTA 3QREA 1FC7A 3M6MA 3TVUA 3BPPA 4EMPA 1YG6A 3HLN1 4K2NA 5DTPA 1ON9A 3GF3A 1EF9A 3KTKA 4L6WA 4J2UA 5INFA 2W3PA 3P85A 4ELXA 2VSUA 2VSSF 4K29A 5DUFA 2F9IA 3GKBA 2A7KA 1PIXA 4I4ZA 2CBYA 5E0SA 3PEAA 3KTIA 3KQFA 4I52A 3NJBA 3H02A 3PZKA 1HZDA 4QIIA 2PPYA 5DKPA 4B3IA 2DEOA 4OLQA 3P5MA 3TV5A 4QIJA 3T89A 2A81A 2QQ3A 3BPTA 5HUQA 3ZW9A 2Q2XA 1FCFA 4FJWD 4MI2A 4ASIA 5G1SA 3SWXA 1N6EA 1WDLA 2J5IB 2F6IA 5KJPA 4QFEA 2FZSA 1XNVA 3ST9A 4KD6A 3V5IA 1J7XA 4FNBA 3R6HA 1NZYB 3TZ3A 2FBMA 4Q0GA 3TDCA 3U9SB 4JFCA 5DTWA 4DI1A 1RJMA 4GM2A 1XO6A 3GMAA 4HC8A 3HINA 1RJNA 3U9RB 3RSIA 3KTJA 4JVTA 3I47A 4U0GA 3FDUA 3FF6A 5E0NX 3Q0GA 5INGA 3OT6A 3GF7A 4WYOB 3P2LA 4KWBA 2GTRA 4ELWA 1VRGA 4FNDA 3HRXA 4RYFA 3V5EA 3LAOA 1Y7OA 1UIYA 3KTHA 2F9IB 4L8KA 1MJ3A 3R9SA 3STAA 4FZWA 4ZDEA 1WZ8A 1K39A 2A7SA 4IZBA 3TT6A 3T88A 3LKEA 3MYBA 4JYLA 1WDMA 1X0UA 1SG4A 2VSSA 1UYVA 4OMRA 4MOUA 3ZWBA 3TRRA 4JCSA 3ZWAA 2ZQQA 3T8BA 2VSSE 1WDKA 2J5SA 4FB8A 4U18A 5JBXA 3ZW8A 1UYTA 4ZDBA 3IAVA 4U0HA 4ZDDA 4LK5A 3H81A 4JWVA 3GLMA 1PJHA 3U9TB 2FW2A 5DZKH 4RYFH 2UZFA 1YG8A 3MT6A 1ON3A 2J5GA 2F6QA 4F47A 2WTBA 3M6NA 5INIA 4JYJA 2ZL3A 1UYRA 1EY3A 3H0JA 3QKAA 3RRVA 1K32A 2C8TA 5DU6A 4Q1IA 2DUBA 4ZDFA 5G1RA 3DORA 4U1AA 2ZL2A 1OD4A 2J5II 3H0QA 4B3JA 2EJ5A 5IKLB 4G2RA 3Q1TA 3NJDA 4WCZA 4U0GH 2BZRA 3QWDA 4ZU2A 4NNQA 4B3HA 5DU8A 2ZL0A 3ZWCA 3G64A 2VREA 3PE8A 4JCTA 4IZDA 3MOYA 2ZL4A 1FC9A 1FC6A 3BEZA 1HNUA 4RCNA 3PGQA 3L3SA 5G1QA 5CTCA 1TYFA 3QK8A 4IZCA 3TLFA 3DJAA 2X58A 2ZQRA 2NP9A 5CTBA 1N6FA 4FN7A 5KDRA 1DCIA 2J5GD 2VSUF 1DUBA 3R9TA 4YLHA 2VSUE
chains in the Genus database with same CATH topology
1XNYA 3H0SA 2Q35A 4U19A 3HE2A 3JU1A 5FUSA 3TVWA 3BF0A 3T3WA 3IBBA 3KTGA 4I42A 3VIVA 3OMEA 3SLLA 4ELSA 4MXIA 3K8XA 3QXZA 2D3TA 5DU4A 1EF8A 1UYSA 5MGBA 4EMLA 1OD2A 4NEKA 4HNKA 4OG1A 4JJTA 3ISAA 2VSUC 5FIFA 1HNOA 2F9YA 4FN8A 4JSBA 1N6DA 4JOTA 4KPKA 3QMJA 3H0UA 3QXIA 4NARA 1O8UA 2CE3A 3OC7A 5DZKA 2X24A 2IEXA 3R9QA 5E0SH 4JCRA 2Q34A 5DUCA 1SZOA 4JCQA 5JBWA 3N6RB 2PG8A 1W2XA 1Q51A 2VX2A 3MFMA 4FZWC 4Z0MA 3IB9A 3K50A 1TG6A 5DL1A 1NZYA 4EMMA 3RSTA 2HW5A 2YJGA 3QYRA 2J5IA 3R0OA 5KDRB 4GHNA 3TT7A 5C90A 3Q7HA 3WG5A 3HP0A 5C9GA 3Q0JA 1Q52A 1XNWA 4WZ8B 1XX4A 1JXZA 4K3WA 2PBPA 2F9YB 4ZDCA 3T8AA 4KNPA 4HDTA 3QREA 1FC7A 3M6MA 3TVUA 3BPPA 4EMPA 1YG6A 3HLN1 4K2NA 5DTPA 1ON9A 3GF3A 1EF9A 3KTKA 4L6WA 4J2UA 5INFA 2W3PA 3P85A 4ELXA 2VSUA 2VSSF 4K29A 5DUFA 2F9IA 3GKBA 2A7KA 1PIXA 4I4ZA 2CBYA 5E0SA 3PEAA 3KTIA 3KQFA 4I52A 3NJBA 3H02A 3PZKA 1HZDA 4QIIA 2PPYA 5DKPA 4B3IA 2DEOA 4OLQA 3P5MA 3TV5A 4QIJA 3T89A 2A81A 2QQ3A 3BPTA 5HUQA 3ZW9A 2Q2XA 1FCFA 4FJWD 4MI2A 4ASIA 5G1SA 3SWXA 1N6EA 1WDLA 2J5IB 2F6IA 5KJPA 4QFEA 2FZSA 1XNVA 3ST9A 4KD6A 3V5IA 1J7XA 4FNBA 3R6HA 1NZYB 3TZ3A 2FBMA 4Q0GA 3TDCA 3U9SB 4JFCA 5DTWA 4DI1A 1RJMA 4GM2A 1XO6A 3GMAA 4HC8A 3HINA 1RJNA 3U9RB 3RSIA 3KTJA 4JVTA 3I47A 4U0GA 3FDUA 3FF6A 5E0NX 3Q0GA 5INGA 3OT6A 3GF7A 4WYOB 3P2LA 4KWBA 2GTRA 4ELWA 1VRGA 4FNDA 3HRXA 4RYFA 3V5EA 3LAOA 1Y7OA 1UIYA 3KTHA 2F9IB 4L8KA 1MJ3A 3R9SA 3STAA 4FZWA 4ZDEA 1WZ8A 1K39A 2A7SA 4IZBA 3TT6A 3T88A 3LKEA 3MYBA 4JYLA 1WDMA 1X0UA 1SG4A 2VSSA 1UYVA 4OMRA 4MOUA 3ZWBA 3TRRA 4JCSA 3ZWAA 2ZQQA 3T8BA 2VSSE 1WDKA 2J5SA 4FB8A 4U18A 5JBXA 3ZW8A 1UYTA 4ZDBA 3IAVA 4U0HA 4ZDDA 4LK5A 3H81A 4JWVA 3GLMA 1PJHA 3U9TB 2FW2A 5DZKH 4RYFH 2UZFA 1YG8A 3MT6A 1ON3A 2J5GA 2F6QA 4F47A 2WTBA 3M6NA 5INIA 4JYJA 2ZL3A 1UYRA 1EY3A 3H0JA 3QKAA 3RRVA 1K32A 2C8TA 5DU6A 4Q1IA 2DUBA 4ZDFA 5G1RA 3DORA 4U1AA 2ZL2A 1OD4A 2J5II 3H0QA 4B3JA 2EJ5A 5IKLB 4G2RA 3Q1TA 3NJDA 4WCZA 4U0GH 2BZRA 3QWDA 4ZU2A 4NNQA 4B3HA 5DU8A 2ZL0A 3ZWCA 3G64A 2VREA 3PE8A 4JCTA 4IZDA 3MOYA 2ZL4A 1FC9A 1FC6A 3BEZA 1HNUA 4RCNA 3PGQA 3L3SA 5G1QA 5CTCA 1TYFA 3QK8A 4IZCA 3TLFA 3DJAA 2X58A 2ZQRA 2NP9A 5CTBA 1N6FA 4FN7A 5KDRA 1DCIA 2J5GD 2VSUF 1DUBA 3R9TA 4YLHA 2VSUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNY A;  3H0S A;  2Q35 A;  4U19 A;  3HE2 A;  3JU1 A;  5FUS A;  3TVW A;  3BF0 A;  3T3W A;  3IBB A;  3KTG A;  4I42 A;  3VIV A;  3OME A;  3SLL A;  4ELS A;  4MXI A;  3K8X A;  3QXZ A;  2D3T A;  5DU4 A;  1EF8 A;  1UYS A;  5MGB A;  4EML A;  1OD2 A;  4NEK A;  4HNK A;  4OG1 A;  4JJT A;  3ISA A;  2VSU C;  5FIF A;  1HNO A;  2F9Y A;  4FN8 A;  4JSB A;  1N6D A;  4JOT A;  4KPK A;  3QMJ A;  3H0U A;  3QXI A;  1O8U A;  2CE3 A;  3OC7 A;  5DZK A;  2X24 A;  2IEX A;  3R9Q A;  5E0S H;  4JCR A;  2Q34 A;  5DUC A;  1SZO A;  4JCQ A;  5JBW A;  3N6R B;  2PG8 A;  1W2X A;  1Q51 A;  2VX2 A;  3MFM A;  4FZW C;  4Z0M A;  3IB9 A;  3K50 A;  1TG6 A;  5DL1 A;  1NZY A;  4EMM A;  3RST A;  2HW5 A;  3QYR A;  2J5I A;  3R0O A;  5KDR B;  4GHN A;  3TT7 A;  5C90 A;  3Q7H A;  3WG5 A;  3HP0 A;  5C9G A;  3Q0J A;  1Q52 A;  1XNW A;  4WZ8 B;  1XX4 A;  1JXZ A;  4K3W A;  2PBP A;  2F9Y B;  4ZDC A;  3T8A A;  4KNP A;  3QRE A;  1FC7 A;  3M6M A;  3TVU A;  3BPP A;  4EMP A;  1YG6 A;  3HLN 1;  4K2N A;  5DTP A;  1ON9 A;  3GF3 A;  1EF9 A;  3KTK A;  4L6W A;  5INF A;  2W3P A;  3P85 A;  4ELX A;  2VSU A;  2VSS F;  4K29 A;  5DUF A;  2F9I A;  3GKB A;  2A7K A;  1PIX A;  4I4Z A;  2CBY A;  5E0S A;  3PEA A;  3KTI A;  3KQF A;  4I52 A;  3NJB A;  3H02 A;  3PZK A;  1HZD A;  4QII A;  2PPY A;  5DKP A;  4B3I A;  2DEO A;  4OLQ A;  3P5M A;  3TV5 A;  4QIJ A;  3T89 A;  2A81 A;  2QQ3 A;  3ZW9 A;  2Q2X A;  1FCF A;  4FJW D;  4MI2 A;  4ASI A;  5G1S A;  3SWX A;  1N6E A;  1WDL A;  2J5I B;  2F6I A;  5KJP A;  4QFE A;  2FZS A;  1XNV A;  3ST9 A;  4KD6 A;  3V5I A;  1J7X A;  4FNB A;  3R6H A;  1NZY B;  3TZ3 A;  2FBM A;  4Q0G A;  3TDC A;  3U9S B;  4JFC A;  5DTW A;  4DI1 A;  1RJM A;  4GM2 A;  1XO6 A;  3GMA A;  4HC8 A;  3HIN A;  1RJN A;  3U9R B;  3RSI A;  3KTJ A;  4JVT A;  3I47 A;  4U0G A;  3FDU A;  3FF6 A;  5E0N X;  3Q0G A;  5ING A;  3OT6 A;  3GF7 A;  4WYO B;  3P2L A;  4KWB A;  2GTR A;  4ELW A;  1VRG A;  4FND A;  3HRX A;  4RYF A;  3V5E A;  3LAO A;  1Y7O A;  1UIY A;  3KTH A;  2F9I B;  4L8K A;  1MJ3 A;  3R9S A;  3STA A;  4FZW A;  4ZDE A;  1WZ8 A;  1K39 A;  2A7S A;  4IZB A;  3TT6 A;  3T88 A;  3LKE A;  3MYB A;  4JYL A;  1WDM A;  1X0U A;  1SG4 A;  2VSS A;  1UYV A;  4OMR A;  4MOU A;  3ZWB A;  3TRR A;  4JCS A;  3ZWA A;  2ZQQ A;  3T8B A;  2VSS E;  1WDK A;  2J5S A;  4FB8 A;  4U18 A;  5JBX A;  3ZW8 A;  1UYT A;  4ZDB A;  3IAV A;  4U0H A;  4ZDD A;  4LK5 A;  3H81 A;  4JWV A;  3GLM A;  1PJH A;  3U9T B;  2FW2 A;  5DZK H;  4RYF H;  2UZF A;  1YG8 A;  3MT6 A;  1ON3 A;  2J5G A;  2F6Q A;  4F47 A;  2WTB A;  3M6N A;  5INI A;  4JYJ A;  2ZL3 A;  1UYR A;  1EY3 A;  3H0J A;  3QKA A;  3RRV A;  1K32 A;  2C8T A;  5DU6 A;  4Q1I A;  2DUB A;  4ZDF A;  5G1R A;  3DOR A;  4U1A A;  2ZL2 A;  1OD4 A;  2J5I I;  3H0Q A;  4B3J A;  2EJ5 A;  5IKL B;  4G2R A;  3Q1T A;  3NJD A;  4WCZ A;  4U0G H;  2BZR A;  3QWD A;  4ZU2 A;  4NNQ A;  4B3H A;  5DU8 A;  2ZL0 A;  3ZWC A;  3G64 A;  2VRE A;  3PE8 A;  4JCT A;  4IZD A;  3MOY A;  2ZL4 A;  1FC9 A;  1FC6 A;  3BEZ A;  1HNU A;  4RCN A;  3PGQ A;  3L3S A;  5G1Q A;  5CTC A;  1TYF A;  3QK8 A;  4IZC A;  3TLF A;  3DJA A;  2X58 A;  2ZQR A;  2NP9 A;  5CTB A;  1N6F A;  4FN7 A;  5KDR A;  1DCI A;  2J5G D;  2VSU F;  1DUB A;  3R9T A;  4YLH A;  2VSU E; 
#chains in the Genus database with same CATH topology
 1XNY A;  3H0S A;  2Q35 A;  4U19 A;  3HE2 A;  3JU1 A;  5FUS A;  3TVW A;  3BF0 A;  3T3W A;  3IBB A;  3KTG A;  4I42 A;  3VIV A;  3OME A;  3SLL A;  4ELS A;  4MXI A;  3K8X A;  3QXZ A;  2D3T A;  5DU4 A;  1EF8 A;  1UYS A;  5MGB A;  4EML A;  1OD2 A;  4NEK A;  4HNK A;  4OG1 A;  4JJT A;  3ISA A;  2VSU C;  5FIF A;  1HNO A;  2F9Y A;  4FN8 A;  4JSB A;  1N6D A;  4JOT A;  4KPK A;  3QMJ A;  3H0U A;  3QXI A;  4NAR A;  1O8U A;  2CE3 A;  3OC7 A;  5DZK A;  2X24 A;  2IEX A;  3R9Q A;  5E0S H;  4JCR A;  2Q34 A;  5DUC A;  1SZO A;  4JCQ A;  5JBW A;  3N6R B;  2PG8 A;  1W2X A;  1Q51 A;  2VX2 A;  3MFM A;  4FZW C;  4Z0M A;  3IB9 A;  3K50 A;  1TG6 A;  5DL1 A;  1NZY A;  4EMM A;  3RST A;  2HW5 A;  2YJG A;  3QYR A;  2J5I A;  3R0O A;  5KDR B;  4GHN A;  3TT7 A;  5C90 A;  3Q7H A;  3WG5 A;  3HP0 A;  5C9G A;  3Q0J A;  1Q52 A;  1XNW A;  4WZ8 B;  1XX4 A;  1JXZ A;  4K3W A;  2PBP A;  2F9Y B;  4ZDC A;  3T8A A;  4KNP A;  4HDT A;  3QRE A;  1FC7 A;  3M6M A;  3TVU A;  3BPP A;  4EMP A;  1YG6 A;  3HLN 1;  4K2N A;  5DTP A;  1ON9 A;  3GF3 A;  1EF9 A;  3KTK A;  4L6W A;  4J2U A;  5INF A;  2W3P A;  3P85 A;  4ELX A;  2VSU A;  2VSS F;  4K29 A;  5DUF A;  2F9I A;  3GKB A;  2A7K A;  1PIX A;  4I4Z A;  2CBY A;  5E0S A;  3PEA A;  3KTI A;  3KQF A;  4I52 A;  3NJB A;  3H02 A;  3PZK A;  1HZD A;  4QII A;  2PPY A;  5DKP A;  4B3I A;  2DEO A;  4OLQ A;  3P5M A;  3TV5 A;  4QIJ A;  3T89 A;  2A81 A;  2QQ3 A;  3BPT A;  5HUQ A;  3ZW9 A;  2Q2X A;  1FCF A;  4FJW D;  4MI2 A;  4ASI A;  5G1S A;  3SWX A;  1N6E A;  1WDL A;  2J5I B;  2F6I A;  5KJP A;  4QFE A;  2FZS A;  1XNV A;  3ST9 A;  4KD6 A;  3V5I A;  1J7X A;  4FNB A;  3R6H A;  1NZY B;  3TZ3 A;  2FBM A;  4Q0G A;  3TDC A;  3U9S B;  4JFC A;  5DTW A;  4DI1 A;  1RJM A;  4GM2 A;  1XO6 A;  3GMA A;  4HC8 A;  3HIN A;  1RJN A;  3U9R B;  3RSI A;  3KTJ A;  4JVT A;  3I47 A;  4U0G A;  3FDU A;  3FF6 A;  5E0N X;  3Q0G A;  5ING A;  3OT6 A;  3GF7 A;  4WYO B;  3P2L A;  4KWB A;  2GTR A;  4ELW A;  1VRG A;  4FND A;  3HRX A;  4RYF A;  3V5E A;  3LAO A;  1Y7O A;  1UIY A;  3KTH A;  2F9I B;  4L8K A;  1MJ3 A;  3R9S A;  3STA A;  4FZW A;  4ZDE A;  1WZ8 A;  1K39 A;  2A7S A;  4IZB A;  3TT6 A;  3T88 A;  3LKE A;  3MYB A;  4JYL A;  1WDM A;  1X0U A;  1SG4 A;  2VSS A;  1UYV A;  4OMR A;  4MOU A;  3ZWB A;  3TRR A;  4JCS A;  3ZWA A;  2ZQQ A;  3T8B A;  2VSS E;  1WDK A;  2J5S A;  4FB8 A;  4U18 A;  5JBX A;  3ZW8 A;  1UYT A;  4ZDB A;  3IAV A;  4U0H A;  4ZDD A;  4LK5 A;  3H81 A;  4JWV A;  3GLM A;  1PJH A;  3U9T B;  2FW2 A;  5DZK H;  4RYF H;  2UZF A;  1YG8 A;  3MT6 A;  1ON3 A;  2J5G A;  2F6Q A;  4F47 A;  2WTB A;  3M6N A;  5INI A;  4JYJ A;  2ZL3 A;  1UYR A;  1EY3 A;  3H0J A;  3QKA A;  3RRV A;  1K32 A;  2C8T A;  5DU6 A;  4Q1I A;  2DUB A;  4ZDF A;  5G1R A;  3DOR A;  4U1A A;  2ZL2 A;  1OD4 A;  2J5I I;  3H0Q A;  4B3J A;  2EJ5 A;  5IKL B;  4G2R A;  3Q1T A;  3NJD A;  4WCZ A;  4U0G H;  2BZR A;  3QWD A;  4ZU2 A;  4NNQ A;  4B3H A;  5DU8 A;  2ZL0 A;  3ZWC A;  3G64 A;  2VRE A;  3PE8 A;  4JCT A;  4IZD A;  3MOY A;  2ZL4 A;  1FC9 A;  1FC6 A;  3BEZ A;  1HNU A;  4RCN A;  3PGQ A;  3L3S A;  5G1Q A;  5CTC A;  1TYF A;  3QK8 A;  4IZC A;  3TLF A;  3DJA A;  2X58 A;  2ZQR A;  2NP9 A;  5CTB A;  1N6F A;  4FN7 A;  5KDR A;  1DCI A;  2J5G D;  2VSU F;  1DUB A;  3R9T A;  4YLH A;  2VSU E; 
#chains in the Genus database with same CATH homology
 1XNY A;  3H0S A;  2Q35 A;  4U19 A;  3HE2 A;  3JU1 A;  5FUS A;  3TVW A;  3BF0 A;  3T3W A;  3IBB A;  3KTG A;  4I42 A;  3VIV A;  3OME A;  3SLL A;  4ELS A;  4MXI A;  3K8X A;  3QXZ A;  2D3T A;  5DU4 A;  1EF8 A;  1UYS A;  5MGB A;  4EML A;  1OD2 A;  4NEK A;  4HNK A;  4OG1 A;  4JJT A;  3ISA A;  2VSU C;  5FIF A;  1HNO A;  2F9Y A;  4FN8 A;  4JSB A;  1N6D A;  4JOT A;  4KPK A;  3QMJ A;  3H0U A;  3QXI A;  4NAR A;  1O8U A;  2CE3 A;  3OC7 A;  5DZK A;  2X24 A;  2IEX A;  3R9Q A;  5E0S H;  4JCR A;  2Q34 A;  5DUC A;  1SZO A;  4JCQ A;  5JBW A;  3N6R B;  2PG8 A;  1W2X A;  1Q51 A;  2VX2 A;  3MFM A;  4FZW C;  4Z0M A;  3IB9 A;  3K50 A;  1TG6 A;  5DL1 A;  1NZY A;  4EMM A;  3RST A;  2HW5 A;  2YJG A;  3QYR A;  2J5I A;  3R0O A;  5KDR B;  4GHN A;  3TT7 A;  5C90 A;  3Q7H A;  3WG5 A;  3HP0 A;  5C9G A;  3Q0J A;  1Q52 A;  1XNW A;  4WZ8 B;  1XX4 A;  1JXZ A;  4K3W A;  2PBP A;  2F9Y B;  4ZDC A;  3T8A A;  4KNP A;  4HDT A;  3QRE A;  1FC7 A;  3M6M A;  3TVU A;  3BPP A;  4EMP A;  1YG6 A;  3HLN 1;  4K2N A;  5DTP A;  1ON9 A;  3GF3 A;  1EF9 A;  3KTK A;  4L6W A;  4J2U A;  5INF A;  2W3P A;  3P85 A;  4ELX A;  2VSU A;  2VSS F;  4K29 A;  5DUF A;  2F9I A;  3GKB A;  2A7K A;  1PIX A;  4I4Z A;  2CBY A;  5E0S A;  3PEA A;  3KTI A;  3KQF A;  4I52 A;  3NJB A;  3H02 A;  3PZK A;  1HZD A;  4QII A;  2PPY A;  5DKP A;  4B3I A;  2DEO A;  4OLQ A;  3P5M A;  3TV5 A;  4QIJ A;  3T89 A;  2A81 A;  2QQ3 A;  3BPT A;  5HUQ A;  3ZW9 A;  2Q2X A;  1FCF A;  4FJW D;  4MI2 A;  4ASI A;  5G1S A;  3SWX A;  1N6E A;  1WDL A;  2J5I B;  2F6I A;  5KJP A;  4QFE A;  2FZS A;  1XNV A;  3ST9 A;  4KD6 A;  3V5I A;  1J7X A;  4FNB A;  3R6H A;  1NZY B;  3TZ3 A;  2FBM A;  4Q0G A;  3TDC A;  3U9S B;  4JFC A;  5DTW A;  4DI1 A;  1RJM A;  4GM2 A;  1XO6 A;  3GMA A;  4HC8 A;  3HIN A;  1RJN A;  3U9R B;  3RSI A;  3KTJ A;  4JVT A;  3I47 A;  4U0G A;  3FDU A;  3FF6 A;  5E0N X;  3Q0G A;  5ING A;  3OT6 A;  3GF7 A;  4WYO B;  3P2L A;  4KWB A;  2GTR A;  4ELW A;  1VRG A;  4FND A;  3HRX A;  4RYF A;  3V5E A;  3LAO A;  1Y7O A;  1UIY A;  3KTH A;  2F9I B;  4L8K A;  1MJ3 A;  3R9S A;  3STA A;  4FZW A;  4ZDE A;  1WZ8 A;  1K39 A;  2A7S A;  4IZB A;  3TT6 A;  3T88 A;  3LKE A;  3MYB A;  4JYL A;  1WDM A;  1X0U A;  1SG4 A;  2VSS A;  1UYV A;  4OMR A;  4MOU A;  3ZWB A;  3TRR A;  4JCS A;  3ZWA A;  2ZQQ A;  3T8B A;  2VSS E;  1WDK A;  2J5S A;  4FB8 A;  4U18 A;  5JBX A;  3ZW8 A;  1UYT A;  4ZDB A;  3IAV A;  4U0H A;  4ZDD A;  4LK5 A;  3H81 A;  4JWV A;  3GLM A;  1PJH A;  3U9T B;  2FW2 A;  5DZK H;  4RYF H;  2UZF A;  1YG8 A;  3MT6 A;  1ON3 A;  2J5G A;  2F6Q A;  4F47 A;  2WTB A;  3M6N A;  5INI A;  4JYJ A;  2ZL3 A;  1UYR A;  1EY3 A;  3H0J A;  3QKA A;  3RRV A;  1K32 A;  2C8T A;  5DU6 A;  4Q1I A;  2DUB A;  4ZDF A;  5G1R A;  3DOR A;  4U1A A;  2ZL2 A;  1OD4 A;  2J5I I;  3H0Q A;  4B3J A;  2EJ5 A;  5IKL B;  4G2R A;  3Q1T A;  3NJD A;  4WCZ A;  4U0G H;  2BZR A;  3QWD A;  4ZU2 A;  4NNQ A;  4B3H A;  5DU8 A;  2ZL0 A;  3ZWC A;  3G64 A;  2VRE A;  3PE8 A;  4JCT A;  4IZD A;  3MOY A;  2ZL4 A;  1FC9 A;  1FC6 A;  3BEZ A;  1HNU A;  4RCN A;  3PGQ A;  3L3S A;  5G1Q A;  5CTC A;  1TYF A;  3QK8 A;  4IZC A;  3TLF A;  3DJA A;  2X58 A;  2ZQR A;  2NP9 A;  5CTB A;  1N6F A;  4FN7 A;  5KDR A;  1DCI A;  2J5G D;  2VSU F;  1DUB A;  3R9T A;  4YLH A;  2VSU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...