2CBZA

Structure of the human multidrug resistance protein 1 nucleotide binding domain 1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
NSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Bound to Mg(2+)/ATP Reveals a Non-Productive Catalytic Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport
molecule keywords MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
total genus 72
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2006-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cbzA00
2G0TA 3K0SA 1NRJB 3ZGXA 2GAAA 1D2NA 4NP6A 3X1ZA 1KIMA 5BN3A 1J7KA 3DO6A 3GJXC 4LJ9A 1KOFA 1XEXB 4HLDA 1LF5A 1U0JA 2YOFA 4I1UA 3LO5A 5CM8B 1JXMA 4IDQA 2F7SA 1A1VA 2D74A 1YKSA 2VSFA 4R7ZA 1JR3A 4QJ3A 1U9IA 1G19A 3FMPB 3L0IB 1N5IA 3VR6A 4MITA 3ZVLA 3RHFA 3LBNA 3IHWA 3QE0A 4DXAA 2VH5R 3GLIA 1DVRA 2H8KA 5DI3A 3TMKA 5AUOB 4I99A 3OESA 3IBGA 5EP3A 4AG5A 4GDFA 1WRBA 4YC7A 2JLZA 2ZRMA 3O8BA 1US8A 3LV8A 5FI1B 5DI9A 3EZ2A 2RGNA 3C7KA 1AN0A 1Z29A 2HDNB 1YZNA 3T06B 2ZI7A 2AD1A 2E9SA 2ZJ8A 3KKMA 4LCBA 4UKDA 4OHZA 1E79A 1FX0A 4HSEA 1T3LA 2RAPA 1UM8A 3O47A 4XTCS 1KJYA 2OCBA 1ZNYA 2QN6A 2O8EA 5FL7D 4DCTA 5AUPB 1U8ZA 3UXMA 1GDDA 1KNQA 2YOGA 3PR1A 5KYKA 2EFHB 1JAIA 3GFOA 1EGAA 1KI3A 2BMJA 5LBIA 2O8CA 2OBMA 4TN1A 4GZLA 3THWA 2GJ9A 3IQXA 3KJGA 4QGFA 4BFVA 4YQFA 4OJQA 5LB2A 1AK2A 5B58C 4PC6A 1A2KC 2GVDC 3A4LA 3L82B 4NYMQ 3SJCA 4Q47A 4HLQB 1CLUA 1XZQA 4PPQA 1KZ7B 1CJKC 1W46A 1FTSA 1KSJA 3DM9B 4AI6A 4AY2A 2J5XA 3PEYA 3D31A 3P20A 1W0JD 1JR3D 2PCLA 4LY6A 4FCWA 4DLSA 1HYQA 1R6BX 1P7CA 5FPHA 1GITA 1KI8A 5FPYA 2RGAA 1G16A 1FPMA 1KI4A 4EIWA 4PC7A 1F48A 5DE3A 2OXCA 4OQFA 4XJXA 3ZJYA 1UKVY 4KAXA 3QKRB 1OFHA 3NWJA 1AGPA 2V9PA 4OQXA 3PITA 4DKXA 4AIIA 1Q1EA 1XBTA 3RS2A 1T8TA 3U5ZB 3VKHA 4H9GA 3UWOA 4AD8A 2AL7A 3FFAA 4P0TA 3IPYA 3WNBA 3Q7PA 2AK3A 1KO1A 1XP8A 4LHVA 2K5UA 3MSXA 3LNCA 2BEJA 3VU9B 4ITRC 3BFKA 4G5RA 1X1SA 4WW0A 5DHAA 1II8A 3MGCA 1Z2AA 2KBFA 1NBMD 3A8TA 4A8JC 2GESA 1J8MF 1R7RA 3B7GA 3MWLA 3LLUA 1S4QA 1T4GA 1E2QA 1GM5A 5TARA 1ELOA 1Q1BA 3GLIB 1EWRA 4FW9A 5A5GA 1TADA 3IIMA 2VP4A 1C9KA 4J0QA 4YMSA 5BYKA 2DYKA 2PZFA 1FOEB 3AVOA 3ZZUA 3NH9A 2ORVA 1N5KA 4L9SA 1E2KA 1NSTA 2HF8A 2WVJA 1E98A 1CRQA 3TR5A 4ACBA 2NO9A 2AHOA 5H68A 1TL7C 3ZVNA 3T15A 3QPUA 1UKZA 3P27A 5FBWB 3AVPA 2LWIA 2BMDA 2YNMA 3H4MA 4C0SA 5KU1A 4GL2A 1SVKA 2R9VA 4HAZA 4Q9LA 2R6FA 3UIEA 2VHQA 1E2DA 2ODBA 1U8AA 5E7JA 4D2IA 5KSYA 2ZRPA 2XOKD 2BM1A 3OF5A 1ZCBA 5F3WB 1ZNXA 3WHKA 1WBDA 1OHHA 3DMNA 4HLUC 3TUZC 3HYRA 3W6NA 3IUYA 3L8YA 1ZM2A 1NJGA 3FDIA 4AKIA 1SHZA 4HB3A 3R9IA 1CJMA 4X8OA 3BE4A 1Q12A 4QGHA 1GOTA 3B9PA 2J0VA 1GKYA 4P4SB 1V43A 1OXVA 2J1LA 1SXJD 3TUJC 3KXLA 3WHLA 4C0KA 1Z08A 3CF0A 4RFSB 2F1JA 4E07A 3CRQA 2HXSA 3EWSA 2JJ1D 4OKSA 1T5LA 1MRNA 3SI7A 3PENA 1S96A 2ZRFA 5JCPA 4IJMA 1ESNA 2YJTD 2CCGA 5AJXA 1ZC3A 1P75A 2BKUA 2OE2A 4DLXA 3PUXA 1OXUA 4ZDIA 4E5UA 1FX0B 4D0LB 2NMVA 4FWTA 4IDPA 2JJ2D 1IAQA 5FBQB 4DDVA 4M1SA 5G3ZA 2YKGA 4BLRA 3CF2A 1H8HA 3EA0A 4BEJA 4JVLA 1N6PA 3FPAA 4O2RA 4BE7B 1N6NA 1EFRD 1JI0A 1QZXA 4HZIA 2JDIA 2ZRAA 3CB4A 4QJ4A 4WXRA 3D6TB 3QVUA 1P73A 3JVVA 4PQRA 1VCOA 2BJVA 3TW8B 4HI0E 5AJVB 2VRWA 3AVTA 5DI3B 3THXA 4IXMA 4B3BA 2XNDA 3VHLB 4CIDA 3A6PC 2AXPA 2IYYA 4XD7A 1OLOA 3HU3A 2JEOA 2W00A 1ZINA 4GOKA 3NG1A 5JS8A 4JBYA 2F55A 3CBQA 3C4JA 3WMFA 1BKDR 1YU9A 1Q21A 2J0UB 4NHOA 4KSBA 3QY0A 5L3QB 1T3SA 2QSZA 2J0SA 1W2HA 2A2ZA 4W7SA 4AK9A 4NPHA 4XTRA 2Z83A 3GLFB 1N5JA 3KQLA 2ZRKA 3NEYA 4TLCA 3KXKA 4QGGA 2YV5A 4LV8B 1VG9B 4R2HA 2AFHE 2HCJB 2IS1A 5JRJA 2FEMA 2NZ8A 1XEXA 2GXAA 4HAVA 4K8OA 3CRRA 5DIFA 3RDPA 3T12A 3S1AA 3U3OA 1DAIA 3K0CC 5FFMA 1TUIA 5JHHB 2H18A 3U3RA 1ZMXA 3LWNA 4LPSA 4GMDA 2J7PA 2QE7A 3MWKA 1CEEA 4HAUA 4AWXA 4OBEA 4QL3A 1KK0A 1FUUA 1ZRHA 1GRQA 1XU4A 1YZTA 3LQRA 2WJIA 1AZTA 4GBMA 1ZUIA 5EP1A 3DPUA 2ANCA 3ZIAD 2CHVA 2ZTSA 2GNOA 4URWR 4ZDKA 2P2LA 4B2PA 1XJQA 1SVIA 2FSGA 2VL7A 1OHHD 2Q0HA 4IOMA 1CR1A 5ANRB 1Z0DA 4G5QA 4PSKA 1U81A 3FGNA 5SZIA 4II7A 1W47A 3K0EA 3I61A 2W83A 2BJWA 4JLNA 3OHMA 2EFCB 2A5JA 3B78A 3K09A 4EPWA 2VP2A 3QIAA 4ERNA 4D0NA 1AIPA 3TNFA 3OFNA 2GEVA 1NLFA 5IHPA 1G8FA 4IVPA 1PUIA 2BCJQ 2WZQA 1JEEA 3BFVA 4UNQA 3W90A 4PHFA 2FPKA 1NSFA 3CUEF 1M7BA 3A1UA 2A9KA 3AVUA 4O3MA 3T35A 1AZSC 1GKUB 3GLHB 1G7CA 1S0UA 1TQDA 3OIVA 1ONBA 5FOXA 1II0A 4TYQA 5C4MA 1RVDA 2EU8A 1MABB 5C18A 3AVYA 3EPLA 2JCSA 3OIYA 2HLDD 1N6HA 1FQKA 4MRSA 1MRSA 3E70C 2ONKA 1N0WA 1E2EA 1R0WA 4UXIA 4BRUA 2JJ2A 3NHBA 1XF9A 4DDWA 2VF8A 1J90A 4KBGA 2WMNB 1QHGA 4YDSA 1G5TA 3IEUA 2PZEA 4GNKA 1SVSA 4DUGD 3BBPA 2ZJAA 5JEDA 4Q4JA 1CP2A 3K1JA 4QM6A 2VEDA 2R65A 4ZCLA 3R9XA 1X8JA 4DLTA 5AK0A 3GPLA 1SKYE 1P72A 2JLUA 2CE7A 2IK8A 1G3IA 2CDNA 4MKFA 1NKSA 2ZXUA 1OH6A 2F6RA 3KL4A 4JLPA 3IKJA 2V3CC 2JIZA 4B3GA 3EC1A 1NF3A 5DISB 1S9HA 1HURA 2O8FB 1KMQA 1E94E 2IYWA 2WBLC 3B13B 2ZSDA 4JL6A 1VYVA 4LHYA 3THYB 3A4NA 4XWOA 2VP9A 5AJWA 2BOVA 1UBCA 5AR1A 5D3MB 1EESA 3QF4B 2CJWA 4CEJB 3N2EA 5EJEA 2IUSA 4D0GA 4NBSA 1KZGB 3FKQA 2IS2A 1Q1ZA 1M2OB 2ZRIA 3A1TA 4N0DA 5SZJA 2YC2C 4PPFA 4PXAA 2VF7A 4NCKA 2ZITA 1KY2A 3SU8A 3OEHD 1AQUA 1P3JA 1Z06A 1OH7A 1NKTA 4MRRA 4X8LA 4FI3C 4HAXA 3KUCA 1OW3B 2FFHA 4I81A 4QXAA 1R10A 2J0QA 1BMFD 4C7OB 2ZROA 2YWFA 1P9WA 4JZKA 2BEKA 1X8KA 2W2XA 4Q01A 4OHVA 4A36A 1MV5A 2HXYA 4MH0R 4IDOA 4ABYA 3CW2A 4M9SA 1Z6GA 3EC2A 721PA 1IBRA 2F3RA 5FUVA 5DYIA 1G8PA 3BK7A 3DDCA 3V4FA 1NJFA 2PT5A 1CXZA 2J7PD 4JL8A 3F0TA 1S3GA 1E9SA 1LVGA 1W1WA 3ZD7A 3BFXA 4HUTA 2UZIR 3U4QB 1XJ0A 2QAGB 2PX0A 4KHZA 3RSOA 2FDCA 3ZD6A 2QTFA 3QXXA 1XPUA 4D4LA 4A9AA 2BBWA 4FWIB 4R98A 1JQJC 2GXSA 2JIZD 1SVOA 2H17A 3VMFA 1GNQA 5B30A 2H7VA 1P4SA 3KKPA 5EXSA 4NCIA 1EK0A 3EWAA 4XVRA 5LB4A 1ZM7A 3HP1A 4RSGA 4WVFA 3DOFA 1F5NA 3PQCA 4AG6A 1BYUA 1BOFA 4UJ3A 4DLZA 3K09C 3X1DA 1QG2A 3L2OB 5JJKA 1KO5A 2NO0A 4TYYA 4DCUA 3P4YA 1NN3A 1AKYA 2KBEA 3I73A 4MQBA 1EFRA 4NKRA 3SZRA 4A0GA 1HQYE 4FMBB 3IO5A 2FGKA 3U44B 3MJRA 2FE4A 5FUXA 6Q21A 1FW6A 4RKEA 4V0MA 4LYAA 2H16A 3C14C 2CVFA 2A7QA 2RCNA 5EP2A 3H84A 2O5VA 2ZRCA 3OEEA 4KVAA 3CX8A 3WNDA 2ZYTX 1W4CA 1DO2A 3UMSA 2XB2A 4MKHA 2AX4A 4AURA 3DVLA 5E95A 2G9NA 5FUYA 2QAJA 4EQ6B 1EWQA 4ASUD 4P4UA 3C8UA 2JJ1A 3EZ6A 4I4LA 2ZJOA 5P21A 5HE8A 1S3SA 4G5SA 3KKOA 1E2HA 2BVNA 2CL6X 4KI0A 3DZ8A 3AP2A 1R8SA 1P2SA 1TQ2A 1Z22A 2GHIA 3A1SA 1A5TA 1SVWA 3TSWA 4A2WA 3VNVA 4LHWA 1UPTA 2MSCB 3W6PA 4Q1DA 4RCZA 5K8IA 5K8UA 4B71A 3BRWD 3CNOA 2CK3A 1KYIA 1FP6A 4Q02A 3NDBB 1VIAA 2IT1A 2XGJA 1ZVQA 3SN6A 3LLMA 3RS5A 3WP1B 4TL7A 4KYUA 3NVAA 2H5EA 3AP3A 4Q4HB 3HPQA 3WMGA 2CK3D 1JEDA 3GLFE 4DEYA 1S9DA 1NIPA 4W5HA 4B74A 1EX6A 1CR0A 1M6NA 1YZUA 4TMWA 4U7DA 3BAFA 1YE8A 1DBSA 3CF6R 3CWZA 1KTVA 2A78A 1JR6A 4ZKDA 4H1VA 2VSOA 4DCSA 4EFLA 1U2RA 5D3QA 4B32A 2QP4A 1NBME 2ONJA 1W0JA 3EZ7A 1HE1C 2ZIAA 2ERXA 2YHSA 3B1VA 3GP8A 5BWMA 5KHOC 1OFTA 1QHSA 3OIWA 1FQJA 1E9AA 1EFCA 3QEOA 1NLYA 3T61A 2GWHA 1KI7A 5KDLA 1K6MA 3AKYA 3REFA 1WBBA 4RD3A 1N6RA 3DHWC 1RE0A 2ZM5A 3FTQA 2OO7A 1HUQA 4G5GA 3GMTA 1XTRA 4OK6A 1TF2A 4AYTA 4M1WA 5FPTA 3WRYC 3RRMA 1GNRA 2D4HA 4LOAA 2C8VA 4BZPA 3MG9A 2IXEA 1LFDB 5J4VA 1RYFA 2GF9A 1Z83A 2I1VB 4LPKA 4DSTA 5B57C 4DDUA 3QXSA 1MO3A 1Z28A 2GCOB 1G3MA 4ESVA 4A8JA 1ANKA 1G4UR 4BASA 4LJAA 3U6BA 2HCBA 1CJUC 2UVQA 4QBFA 5DGXA 4F7WA 3RS0A 5BN5A 4B44A 3LRPA 2OV2A 3QKTA 2GXUA 4PQFA 1Z6XA 1YRAA 1MR3F 4EUNA 2ZJBA 2V1UA 2QTHA 3AEZA 1CJTC 1Q57A 2ZRLA 3VR2A 4WBSA 4URUR 4NZYA 1U90A 1ZD9A 2CNWD 2FZLA 3B9QA 2XOKA 3CZQA 4JT2A 3Q85A 2IWHA 1LS1A 3GLGB 4NDZA 2FF7A 1ETUA 3KZ1E 3ONWA 3LW8A 3LXRA 4C7OA 4C0AC 4GZMA 2REXB 5EZ6B 1BIFA 5JZVA 1IOZA 1IM2A 4Q9IA 4QG7A 5KSZA 2CNWA 2FV8A 2GEDA 5EE1A 4QKQA 4JVNA 2BBTA 2REBA 1ZNWA 4HDCA 4EPRA 3GEHA 5FOTA 3QG5A 2A5DA 3U7EB 2P6NA 3SHFA 4KFSA 4B48A 3SFZA 2AR7A 2P6UA 1KHTA 1XXHB 2D2FA 3CRMA 2WTUA 2F43A 1SZPA 4RD2A 4P4TA 2QAGA 1F2TB 1IXSB 1JECA 3FHCB 1N0UA 3VR3A 3AUYA 3IPXA 1G3QA 3OAAA 1E2FA 2IYTA 4C2TA 4ZCIA 2CVHA 2DFNA 4M0LA 4BFSA 1X1RA 4OI0A 3O8RA 4Z1MA 5KOYA 521PA 1D2EA 3QKSA 4LJ7A 2OXRA 3E5HA 3GJ5A 1DEKA 3ZDQA 3AQ4A 1QVRA 1HQCA 3EW9A 2PEZA 2OCYC 2ZREA 4JKIA 1VYUA 2XJ9A 2PMKA 3T5DA 1P9NA 4PC1A 4DIDA 1JJ7A 1CIPA 2GK7A 4PZZA 5DYGA 1XTKA 3M1IA 1OV4A 3W3ZB 3H1TA 1OKKD 1XD2A 2VP6A 1R4AA 2GZAA 2HYIC 2MMGA 2G0NA 2BHRA 3CR7A 2XTZA 5CIQA 1CS4C 2AN9A 2ZJYA 4EPTA 4P3YA 1RJ9A 4K81B 2Z5FA 4A82A 1ZD8A 2JASA 3GQBA 1ESMA 4GOXA 3TJZA 3H86A 1JALA 1X3SA 4OHXA 4M2LA 4XVUA 4JJKA 2EWVA 5KPJA 4MKIA 2JGNA 3BS4A 3UATA 4TSFD 1DG3A 1MOZA 2PLRA 2AKAB 3BB3A 4CEIB 3CX7A 1IN8A 5FOSA 1OB5A 3FMOB 1VECA 5D3MA 2X19A 5ELXA 1ZD1A 2GJAA 2W6IA 2FWRA 4D26A 1P62B 2PEYA 3VU9A 3ZVRA 2XZOA 3A37A 5JJIA 5J4YA 2ZE8A 4NTZA 2V4ZA 3KFXA 5HCIA 4TL8A 3HU2A 2VP5A 1T3HA 1XB2A 1LTQA 4BLQA 4LJ6A 2BWJA 4QBIA 4C9BA 4LBZA 4PHTA 1KO4A 3I92A 2X1VA 4TMXA 2J3EA 2W6JA 2ZRNA 4DLVA 4EAQA 2IYLD 1HY3A 4KFRA 1IN4A 3Q72A 2VHTA 3RAPR 4C0BA 2ZJZA 4HATA 5G53C 4XWAA 4QOSA 2ECKA 2VIIA 2QRZA 3NC1C 1AS3A 2F43B 3DKVA 3X1XA 4PO8A 4Z54A 4KXFB 5CYOA 3ZIAA 5E7IA 4ZDJA 5J47A 1PV4A 4EPYA 3U44A 3NH6A 4Q9KA 4MYUA 3QEJA 1RPZA 1CU1A 2G83A 3LVQE 8OHMA 1E1QA 2WKRA 2WIBA 2WOJA 1AS0A 4MRVA 2RH5A 1T8UA 1NL3A 3TLXA 3X1YA 5AJYA 3SJZA 2DR3A 2AD5A 2XAUA 3CONA 3PXGA 1OFUX 221PA 3QBVA 3RC3A 1QHHA 4BEBA 4Q21A 1SQ5A 1XXHE 3MMPA 1PJRA 1OXXK 1M1YE 4US0R 4XSHA 3WBJA 3LVRE 3HU1A 1VCNA 2ZR9A 1ZBDA 3HWSA 4QC2A 5J4LA 1VHTA 4ZCMA 4IOJA 4TQAA 4JSTA 4Z51A 1I4TD 4M1TA 1DG1G 3QXCA 4L4UA 2VPPA 1XDBA 1OFIA 1JNYA 1Q22A 1Q0UA 2DFLA 4DIEA 3W5JA 3KQHA 3RVBA 5IT5A 2IYZA 4RVCA 3GJ6A 2XSZD 3B8HA 3RS7A 1E79D 1T0JB 3MWYW 1AM4D 1H8EA 1QDEA 4AKHA 1E9FA 1KMHA 4TTQA 1G17A 1JQLB 4YLGA 1EXMA 4N0EA 3CM0A 3D3QA 4YONB 3TVDA 2O8BB 2YWGA 2JLVA 3ZQJA 4Q4AB 3B1XA 3EARA 4RZXA 1RKBA 1ZU4A 3EAQA 3IBYA 4YXWD 4LBVA 2HYDA 1VYTA 1WCV1 4G0NA 3BXZA 3WRXC 2VA8A 2O8EB 3K53A 5JJLA 1IJEA 1E2GA 1N2CE 1QHXA 2ZR0A 1IXZA 3EIHA 1EX7A 1M8PA 5G41A 4NMMA 5CDFA 4C0LA 1J70A 2VHCA 2KI5A 1QHNA 4TYNA 1W36B 2FFBA 5B64A 3ASYA 2NPFA 1W44A 1CULC 1DOAA 4B3CA 4ACAA 4JKYA 4PHGA 3EX7C 5JEEA 3MJHA 1E9CA 4LJ4A 1AKEA 3ADBA 2EYQA 1G41A 1TAGA 3BC1A 1PUJA 2IF0A 2ORIA 2IYRA 1DADA 1XEWY 3DEFA 1NN1A 4NONA 3IO3A 1LY1A 3LY5A 5EXTA 1W4AA 2QY9A 5EE9A 3NBYC 5SZKB 3EIQA 4E09A 2ZRDA 3VNUA 2EYUA 1G8YA 4B47A 3KUDA 1UBEA 2WPDA 3QG1A 3VHXA 5TMPA 3TAHA 2JAQA 2OEPA 3QKRA 2XXAA 3RRYA 2GAOA 1N25A 1RZ3A 2R44A 1SVLA 4WZAE 1R5BA 1RRPA 2J41A 4URXR 1GL9B 2GZDA 2IXFA 2FN4A 3CPEA 3TQCA 2GKSA 1KI6A 4LV6A 3NEJA 4TTRA 2H92A 1K5DA 1F6BA 3I1FA 4KO8A 4R71A 1FMLA 2Z4RA 5BYJA 2DPXA 2GDJA 1R5OA 4UJ5A 3U7GA 1JR3E 2DHRA 2FSFA 5FI0B 3KB1A 5CLQA 2PJRA 4G3XA 4NYIQ 5KPDA 2ZU0C 1XD9A 1MH1A 2ZS7A 4JVMA 4DT1A 1KKLA 3U3JA 2XZLA 3LQQA 2N1BA 5AUQA 3OAAD 3C16C 3RLFA 3K0CA 3KQKA 2YZ2A 4BZXA 2JLYA 1IQPA 4RFSA 3FE2A 4DSUA 2R6DA 5JHGB 3MD0A 4Q9HA 2UKDA 1M74A 2ZRBA 5TDHA 5FL3A 4RZ3A 3SHWA 3QNUA 2QROA 5CM9C 2AKYA 3CH4B 1F3OA 3Q5DA 4BLOA 4ZIRB 4M22A 2V54A 5CITA 5JI3E 3ASZA 5A0FA 4IDNA 2QM8A 3QF7A 4XWKA 1E4VA 2V55B 5KUTA 1TUEA 621PA 1VG8A 2X8AA 3R20A 2JATA 1GNPA 1DAGA 1DAKA 1B0UA 1QG4A 3SS8A 5AJZA 2ZI3A 2BV3A 2KE5A 2ZSFA 3SBDA 4M1YA 3B1WA 3NBZC 1KAOA 1XX6A 2WJYA 4OI4A 1TX4B 1BMFA 1MO4A 1Q20A 4OHWA 1U0LA 2B92A 4Q4LA 1GRRA 5H70A 4PZYA 2HUPA 3ZS9A 4U02A 2JDID 4YMWA 4B6EA 4BUJA 3SNHA 3T34A 1FNNA 1Z6YA 3PCRB 3UKDA 2ZI5A 4AKGA 3ZZ0A 2JLXA 3ICEA 3AVWA 3FVQA 2ZE5A 1KDOA 1ZUNB 2OBNA 2EWWA 3BGWA 1ZJ6A 3KJIA 4M9QA 1KI9A 1SULA 5EXPA 4NCNA 1L2TA 1XWIA 1XZPA 1G64A 1F2TA 4PR0A 3B1ZA 5CIWA 3EZ9A 2CLDX 1KSHA 2Q6TA 2YWHA 3IDQA 4GFDA 1RC8A 2CBZA 1G6HA 2WWWA 3ECCA 3NXSA 1ZIOA 4LHXA 4TMVA 3THOA 4C4PA 1V5WA 1OYWA 4DLUA 4OI1A 2WSMA 4B3XA 2G6BA 3EIEA 2ZANA 3V00A 1OJLA 4F4IA 1NY6A 2YOHA 5E4FA 2F3TA 3AVQA 1MO6A 2E1RA 2DFTA 4B34A 4ASUA 2IYQA 2WJJA 3C5HA 2WJVA 3R7WA 2FZ4A 4E22A 3RABA 2IL1A 3QPWA 4Q9JA 2IWRA 4B33A 4KFUA 2H1LA 1XEFA 2NGRA 5HKKD 1KI1A 4JLBA 1HV8A 3U3KA 1XRJA 1A4RA 2B8WA 3CNLA 4MYTA 1BH2A 4XD7D 4JLVA 4GI7A 4JLKA 3W9YA 1CR4A 3HR7A 2Q21A 2QGNA 4A0RA 4RJLA 4O25A 4V0OA 2F1IA 3LFUA 5FBLB 2O0HA 1GKIA 4JLMA 3U3MA 4CEIA 2IC5A 1NMXA 1S1MA 1I4LD 2CJWB 1E2IA 3QOFA 4NYJQ 5DN6D 5LD2B 5EE3A 121PA 4JBWA 2EFDB 5GJWC 3O8DA 3EA5A 4FMCB 4UNRA 4UNSA 3TAUA 2QT1A 2OUKA 4NYIR 2ZJ2A 3TBKA 4JT4A 3GCGA 5E7MA 2X2FA 4IOKA 5DNYB 4DBLC 4C0QC 4TL9A 2FJUA 5CK5A 3AGQA 1XXHA 5JCZA 3VX3A 1W0KD 4QNMA 1G8HA 1SXJB 4BFTA 1GTVA 3PFIA 1WQ1R 3LAWA 1SKYB 4LI0A 5JWHA 1W7AA 821PA 1HT1E 2REOA 1E9BA 4BPBA 1TF7A 4PAOA 3OEED 4M1MA 2J59A 4U00A 1A82A 1U8YA 3OEHA 3DKPA 1Z6AA 5J4KA 1D9ZA 2GBLA 3F3YA 4MGYR 1KO8A 4MGIR 1XFAA 2V8OA 1JAHA 4Q1EA 3UK6A 5FPKA 4PO9A 4HB0A 1IJFA 1Q3TA 4LV5B 2I4IA 2IYUA 5FH9A 3GLHA 1A2BA 1E9DA 1G21E 2RHDA 4B2LA 1ZM9A 4DB4A 4KODA 3CPHA 2FMXA 3UMRA 1UDWA 2WJHA 3QI2A 4ZO4A 4A6XA 2JLQA 3LX8A 3OFND 4US1R 3FMIA 3B60A 2NOAA 4PAQA 4B43A 3SE0A 4GT1A 1E0JA 1OIXA 5EE5B 3NKVA 1KMHB 3LBIA 1G7RA 1ZW6A 3AF0A 2G1KA 1ZAKA 2ZUBA 1X86B 4DT1B 2ZVQX 3QPVA 4DRZA 3RRNA 5GJBA 3KTAB 1QF9A 3FKSD 1CR2A 3GFTA 2GZHA 4PX9A 4R2IA 1R0YA 3TQFA 5FTNA 2GETA 2QRNA 1LV7A 4PC2A 4IHQA 3VFDA 4BECA 2Y8EA 1EFUA 1W0KA 2QPOA 3GFPA 2OFOA 4BFXA 1NY5A 2RHMA 4Q18A 2Z0MA 2Q9BA 2ZAMA 4EQ6A 5JMTA 2WPDD 1LB1B 3CRVA 1UEJA 3U6KA 4YXWA 4PAMA 1RFLA 3NTUA 5GJVC 2CCKA 1U94A 2WSSA 2WMOB 3NDPA 3TGPA 4URVR 3AF2A 2P5TB 5KO2A 3M4YA 1FMJA 2RKOA 2IW3A 3KQNA 1QHIA 1UKYA 5FTKA 1Q44A 1Z0AA 4HLUA 2LCFA 3ADCA 4HUQA 5A4JA 2OM2A 4I1OA 2IS4A 3H0KA 2OFXA 1N6IA 3N70A 3GJ7A 1A7JA 2QMHA 4IDHA 1G7TA 5DN6A 4IVRA 4RZUA 4Y0VA 4D25A 1KDRA 4GMXA 2XB4A 1ZNZA 2P0EA 4CW7A 4WXPA 1XTSA 1XMJA 3LBHA 1I4DD 4OL0A 5CK4A 2ZJ5A 4LWZA 2IYVA 2QG6A 4KBFA 2WKPA 1Z0IA 5FR1A 5BQ5A 5CDFE 1Z2CA 3THWB 3AF3A 1T9HA 1U0HC 3BB1A 1PLJA 2A5YB 3M0EA 3HJNA 4QHSA 4DLRA 3W8NA 3K9NA 4KFTA 3CX6A 1HT2E 3GJ0A 2NPIA 2ODWA 1G6OA 1XMIA 3BERA 3EPKA 1YVDA 2ZRJA 5L3VA 1KJZA 1XNJA 2CLCX 1F2UB 1G1MA 1FNMA 3I3SR 4WAUA 2GJKA 2HJVA 4RKFA 1T0HB 2ZYUX 2RGEA 4TL6A 1RYHA 1IY1A 1TMKA 3BWDD 4Q4JB 5G40A 1DAEA 3AP1A 4DJTA 4JLJA 4EDHA 5FR2A 2QUZA 1DAMA 3C15C 4UXJA 3SR0A 3U7HB 1WB9A 2VQSA 2GVZC 1E32A 4V02A 2DB3A 1T91A 5C2JB 3PUZA 1PLLA 4PZLA 3ZQ6A 3TSOA 1UEIA 1E2LA 4QGAA 2E87A 4JBXA 2NQ2C 4A0FA 5KTYA 1YZLA 1TQ6A 4JLOA 2O8BA 1CBUA 3MAAC 1U9IC 1YZQA 5JSZB 1G8GA 2FA9A 5IF9A 5M04A 4DSNA 2MSDB 2ZU6A 4Q7JB 1VG1A 4DSOA 2FEOA 2GJSA 3I32A 2BBSA 4KJZA 4HDOB 5LD2C 1NMYA 1Q1QA 3I62A 5G3YA 1YR9A 4TZ6A 1E1QD 3K0FB 3B1YA 1Z6TA 2G88A 1E2NA 1G3UA 2WV9A 4IOLA 2FPLA 1S2MA 2YINC 2IUTA 1D8TA 1NG1A 3KKNA 3RRZA 2CEAA 1XCMA 1LNZA 1JB1A 2NO1A 1WMSA 2JJ8A 4NCJA 3SBEA 4TT3D 3BJIC 3ND8A 4MA4A 2IF2A 3WBKA 2IS6A 2QT0A 1KK2A 4Q1AA 1OXTA 4PSAA 2OBLA 2HJGA 2A30A 3NC0C 1TTTA 5IRCD 2XEXA 1VDZA 2R8RA 4I1VA 3TRFA 3JVUA 3WYFA 4LYJA 2UZ3A 3W6OA 4OK5A 3WP0A 3TSZA 3CRW1 2P5SA 3FOZA 3ZZTA 3GJ8A 4XSGA 5L3SB 3B2EA 5H1YA 4KU4A 1P2UA 3RS4A 1QVAA 1UBGA 4TYPA 4B35A 1E9RA 1G7SA 4LUCA 2P67A 5AUNB 3X2SA 2IHBA 1YR8A 3N5CA 1UDXA 2EQBA 3R7WB 1XPRA 4MGKR 4IKEA 2W6ID 5L3RA 3ADKA 4QFMA 3A36A 2QMOA 2O8DB 4MDEA 1M7HA 3ADDA 2ASEA 3W3AA 4A1FA 1YRBA 1P2VA 4CEHB 2C98A 4PPGA 1D9XA 4FMDB 4D82A 2AK2A 1AA9A 4NH0A 2GCPA 2WAXA 3HYTA 3F8TA 1CJVC 1RIFA 2D7CA 1CKEA 4QHYA 3TE6A 1VKJA 1Y3AA 2XJ4A 3LD9A 3Q9LA 2IUUA 3R8FA 1W36C 3BH6A 4MUBA 1W2GA 1IN7A 2RGNC 1GP2A 5JFGA 4ZKEA 4ILEA 3AF1A 4OHYA 4PQYA 4TZ0A 2TMKA 3IGFA 3I5XA 2QENA 3I8XA 1E2PA 1BO6A 5EXXA 1L4UA 4B75A 2D7DA 4UXHA 1US8B 1GVNB 2Q9CA 2GTPA 3LDAA 3AKEA 3DL0A 4PTLA 4F91B 3ZS8A 1UADA 2P6RA 2CLSA 1FTNA 4HUQB 2ZI4A 2RMKA 4IEEA 2BBOA 1OIWA 1OH5A 3B82A 3A4MA 2CL7X 1R0XA 2WOOA 3IQWA 4PSVA 4FN5A 1G4AE 2WHXA 1G5RA 4V0ME 1VCIA 2X2EA 4JMPA 5JS7A 2PJZA 4QNRA 1ZC4A 1WE2A 2ZUCA 3U4QA 2KB0A 2SHKA 1XMSA 4BFWA 1SXJA 1VHLA 2L0XA 4NYJR 1L8QA 3R8CA 3TH5A 4BQSA 4TQ9A 3EPJA 2CHQA 2FG5A 1LW7A 2GRJA 3CKLA 4CDGA 5IK2A 2ZE6A 2QL6A 1F60A 1XEWX 1YZGA 3KXIA 2DFKB 1H8ED 4Q4HA 3L8ZA 2O52A 1WDTA 1YZKA 4TTPA 3T1VA 2AWNA 2XTMA 1VCMA 3CNNA 1QRAA 2D2EA 1KI2A 1E2JA 5CYPA 1OKKA 2PLFA 4IRUB 4PPNA 4GOJA 3K0AB 2ZI9A 4URYR 4CVNA 3WXMA 1NVWQ 1YHNA 1ZU5A 4Q7LA 2ZE7A 1Z0KA 2XNSA 3AKDA 4B3FX 3QSYA 3AF4A 2D3WA 4S35A 4YMTA 1O3YA 2WWYA 1N6KA 4YDHB 1OB2A 1DO0A 3FYHA 5CB6A 4TQUS 4M53A 1J99A 5EZ5A 1IONA 2Q3HA 1P6XA 1SXJE 2HT6A 2R62A 1SXJC 3LA6A 4WZ6A 1OH8A 2YC4C 3AVVA 4CEHA 3OE7A 2QORA 2YWEA 2PMDA 4PHHA 3K9GA 4Q48A 4BFYA 2GCOA 1WF3A 5E3HA 1KGDA 2CL0X 3BH7A 3M6AA 2C2HA 1TU4A 3RNLA 4C0HA 2OAP1 4M9ZA 2PCJA 4HB4A 1KK1A 2PZGA 3KQUA 2IXGA 2QI9C 1K8RA 1H8HD 2ODEA 3GEIA 1J2JA 1LF0A 5CJPA 3SJBA 2QQ0A 4EJSC 4CRWB 4JJZA 1NP6A 2W0SA 3UPUA 2XZPA 4DHEA 3VR4A 3CO5A 3MRSA 4F4JA 4ARZA 1UBFA 4MRPA 3OIUA 1G9XA 2G1JA 2ZS9A 4QHTA 1B23P 2VP0A 5FTJA 3DM5A 1XMVA 1OSNA 2VBCA 4OQNA 1XD8A 3WNCA 2OCPA 4HAWA 1GL7A 1GUAA 3PUYA 4N3NA 3Q3JB 3IIKA 2FU5C 5HZKA 3VKGA 3FHTA 1NMZA 2P65A 1VPLA 1JXOA 2I3BA 4OI2A 4L16A 4Q19A 1W48A 3K70C 4OK3A 3SYLA 5TXGA 3TVTA 4RD1A 5L3QA 5AWFC 2QP9X 4B6FA 2Q3FA 2HT1A 1E96A 1N6OA 2NO6A 3WYAA 2GXQA 4F38A 4OJKA 3PIRA 4A2PA 1UJ2A 4JYCA 1SKQA 1X6VA 2FX3A 2JLSA 2NTYC 2R2AA 1G3RA 4U5XA 5TY0A 2FH5B 5BW8A 3SYKA 4Q03A 1Z3IX 1JPJA 3BOSA 2XSZA 1DPFA 1N6LA 4O2LA 4EFNA 2FOLA 2DCUA 4JLAA 5CB8A 2ZPTX 1W5TA 3HDTA 3K0AA 4QBGB 3L43A 1E69A 4EPVA 5EE0A 4F4CA 2P3SA 1P9RA 3UMFA 1E1RA 3QXHA 4XOIA 4XIGS 5FUWA 2WJGA 2OAQ1 4TT3A 4TLBA 3X1WA 2OFWA 4RZ2A 5DHFA 5C4GB 1KY3A 4EJSB 2C96A 1C1YA 5JBQA 1KO7A 2LKCA 2WSSD 3SEAA 5IK2D 1FL9A 1T5IA 4LYHA 2D06A 4C30A 1YQTA 3GJ4A 421PA 4D80A 1QHHB 2C04A 2EVWX 2KJQA 2LKDA 2QA5A 2FPMA 3EASA 1NLZA 1Z8FA 4FINA 4ESHA 4D4KA 2OHFA 4B2IA 3THYA 5DSZA 3RSLA 4KITB 3GLGE 5K8TA 2VYFA 1JPNA 2PL3A 3KX2A 4F92B 1RJ9B 1UKEA 4NE2A 2D62A 1II8B 4IFEA 4G1UC 2F1HA 4DCNA 2QMEA 2RGGA 4P4SA 4TYWA 4V0KA 2O0JA 2VHUA 4LC0A 4LJ5A 1WP9A 3MUFA 4UNNA 2X77A 1N0VC 3K70D 3B6EA 4NU0A 2HLDA 4M1KA 1NVVR 5L3SA 4ZIRA 2BM0A 4AYXA 5HZHA 2QAGC 3WMEA 2B7CA 2A5FA 4C2UA 2ZSAA 3G5UA 2ZS8A 3T5GA 3KFVA 3KKQA 1E0SA 1TNDA 4LJ8A 1P60A 1R8QA 4DWJA 4Q1BA 5JI2E 3AVXA 3MFYA 2WWGA 3Q5EA 1GWNA 1Z0JA 3FKSA 2MSEB 2Z6VA 4Q1FA 4FMDF 3H2YA 3TKLA 2XX3A 3P4XA 1DARA 4OQMA 4WA7A 1W4RA 4BLTA 4A0HA 2G77B 3W5IA 4B73A 3TK1A 2B6HA 1O87A 2WIAA 3UG6A 3F5FA 3D7MA 3OZXA 4MUAA 2ANBA 4P33A 1W49A 4Q7KA 1S1CA 2B7BA 1XCPA 5HE9A 1ZM4A 3UANA 2FNAA 3PV0A 2C99A 2C9OA 3FHOA 1NBMA 2ZAOA 4BRWA 4CYMA 4ZI3A 1II9A 2W0MA 2BIFA 4M21A 4AKEA 2XTNA 1P61B 1GSIA 2PT7A 3BORA 4L8GA 3AGPA 4XVQA 3NBXX 2ATXA 2C95A 2WWIA 4JLDA 2O8FA 1XJCA 2YVUA 4O0MA 4GP6A 5FPSA 4QJ5A 3J81k 2QZ4A 3U7FB 3V4RA 5B2ZA 3O8CA 1COWA 3A58B 3ZH9B 3T1QA 4Y0AA 4GSYA 3S1AB 3QUSA 1HA3A 2N42A 4DLYA 3CPJB 4CEJA 4LJYA 4A6PA 5FTLA 3GJ3A 2RGDA 4OQLA 1BYIA 3KB2A 3EPHA 3EXAA 3BIFA 4FIDA 4OYHA 4AYWA 2GCNA 3QVVA 5F9HA 2Z43A 1I2MA 1ODFA 2QU8A 2W6JD 3SQWA 4I1SA 2N46A 2IYSA 4ARZB 1QHYA 5JECA 3LX5A 2NIPA 1AQYA 3RWMB 1KSFX 1FZQA 3WYGA 3VQTA 4Q66C 2W2TA 3CIOA 1G5PA 1DAFA 1D5CA 2IEZA 4BLSA 4F93B 1GZSA 4M9XA 1NVXQ 5EUMA 5J40A 2JA1A 4ON9A 1FP7A 2GBLC 2OZEA 3FFBA 4L9WA 2KWIA 1GG2A 2VSXA 4V0LA 3ICQB 1UAAA 5C46F 4UNPA 2ORWA 1UF9A 4IVQA 2EW1A 4PFSA 2ZRHA 4A4DA 2ZRGA 3I4LA 1JJVA 5FTMA 4N1AA 2JLRA 2ZQ5A 4B76A 2V7QD 4G5OA 4D6PA 1MKYA 1ZYUA 2C78A 4Q5IA 4MRNA 3DZDA 1ZIPA 1N3BA 4PO1A 2ZYWX 1DAHA 4HZUA 4L5BA 3T1TA 4MKGA 5TB5A 1U99A 4US2R 4FMCF 4HEJA 2ZYVX 1D6JA 4E03A 2J0UA 2ODNA 2QSYA 4DB2A 2V7QA 4EFMA 4JIMA 1KDTA 4A2QA 3BH0A 1KNXA 4DLWA 2QPTA 3L0PA 4MDFA 4ZV4A 1EG7A 2ZSEA 1DE0A 4IW3B 4RD0A 1L4YA 2ZUDA 2O8DA 1Y63A 1GRNA 3CLVA 1NIJA 1RRFA 1E0KA 4MGZR 2F9MA 2RGBA 1XCGB 5FOWA 2EFGA 3T1OA 2Z4SA 5LDDC 1J8YF 3A1WA 1FFHA 3IHLA 5GJCA 3SOPA 2F9LA 2J7KA 2OILA 4EJSA 4CT4B 1DTSA 3CR8A 4FXPA 1K5GA 4LC1A 3QF4A 3I5YA 1KI6B 3FMFA 2FSHA 4WOPA 4S2EA 5HCNA 5JWRA 2A3RA 2ZEJA 4CGZA 2GA8A 3E1SA 3N2IA 1HTWA 4KLNA 4GPTA 4BWYA 1TF5A 3GD7A 4QRHA 2YYZA 4V0NA 5HR5A 2QBYA 5FOVA 1M7GA 4DUGA 2RB4A 2OLKA 3ETLA 3KJHA 2C03A 2O0KA 3BB4A 1M34E 4JS0A 2NG1A 4HDQB 1E4YA 2AXNA 4POAA 2GILA 5UKDA 1W4BA 3WY9A 5LPNA 2XITA 4TMZA 4C0JA 3L0OA 1MO5A 1OXSC 2AWOA 3PVSA 3VR5A 4MYCA 2OCAA 2FGJA 2CCJA 3JZMA 1Q3HA 4DCVA 1COWD 1VG0B 5KNDA 2R6AA 5FL7A 1OF1A 1E2MA 1YJ5A 2BKEA 3QBTA 4L15A 4GRAA 4AC9A 4DDTA 5KNBA 2B21A 4W5WA 2KSQA 4Q1CA 4Z1MD 3PEUA 1E0AA 1XTIA 5BXQC 1W5SA 2CHGA 3ZYCA 4B3DA 1GFIA 2F1RA 4UQOA 5CLLA 1TU3A 4YMUA 4BZQA 3KJEA 2EFEB 1WXQA 4P31A 4PANA 5DLQC 3HR8A 5FBVB 1DELA 1S8FA 3QJYA 2AFIE 1CF4A 4CT5A 1MABA 3V9PA 1NG9A 2PBRA 4GP7A 3QENA 4Z8YA 2IHYA 3IEVA 1G20E 4D4MA 1U98A 2MMCA 1OPXA 1R2QA 5JWOA 3AB3A 3QKUA 4URZR 3ZLJA 5HTKA 2QEQA 4LSGA 2ATVA 3GEEA 4FCTA 4G01B 2JLWA 4IXNA 1ZM3A 4LGMA 1IHUA 1RW4A 2OSBA 4PC3A 2XNDD 5IDVA 2IBMA 4DEXA 1NVUQ 1X8LA 2CXXA 4TLEA 1JBKA 5FBRB 3IILA 1VTKA 4FCVA 3MCAA 5K8LA 2GJ8A 3SC3A 3G0HA 1RRCA 1R5NA 1KDPA 3U61B 4A8JB 3W34A 4LBYA 1BS1A 3K70B 2VHJA 1IXRC 2BMEA 4HYYA 2DBYA 5EQTA 3LH5A 3PUWA 2J46A 4X8HA 3K9LA 3GLIE 4IEIA 1F2UA 3AV0B 5C1BA 5F9FA 4YMVA 1G291 3PG5A 3MLEA 1CRPA 4Q00A 1KJWA 3U2QA 1KK3A 1ZUHA 4CF7A 5DH9A 4QBHA 2CMKA 3MWJA 3R9WA 3SQXA 5H8WA 4KSCA 1DS6A 5J5CA 3P1JA 2NZJA 4M1OA 2WWXA 5CJ2A 1E1RD 3KTAA 1P5ZB 3Q8XB 2PH1A 5BN4A 4RY2A 4NYMR 1EFHA 4A15A 4JVSB 2IX3A 3D8BA 2VTKA 4W5JA 1GAJA 2BC9A 4RCYA 3G82C 4BFZA 5KNCA 1GL6A 2C77A 3VKWA 4TWZA 1R0ZA 3AM1A 2J45A 3QXJA 4DZZA 3RWOA 2BMFA 2C9CA 4KLZA 2OESA 1PLKA 4JL5A 1NI3A 2ZI6A 3AUXA 2W2VA 2DWQA 4ZI2A 1FUKA 4DVGA 2DWOA 1IN5A 2OG2A 4DC9A 3L0SA 2O8CB 4KCGA 3VTKA 1QBKC 1RRGA 4NCHA 3ND9A 3GLHE 2DY1A 2QP3A 4WIAA 3AKCA 2ZETA 5HPYB 4V03A 3W8RA 1TPZA 2VO1A 3C41J 2RGCA 2FFQA 2BCGY 1NNEA 5HKKA 4EKDA 1OYYA 2WICA 4TMTA 1Z5ZA 5KDOA 4TSFA 3TIFA 4Q7MB 2R6CA 4D81A 5DO9A 2C9YA 3THXB 1VIYA 3REGA 1YR6A 4P32A 1NVVQ 1IY2A 1W36D 2RGXA 4LDJA 2OLJA 1SVMA 3UG7A 4TLAA 3SFVA 4LHZA 3QKSB 2IEYA 4FD2A 3B85A 1NN5A 3VR1A 3QQ5A 3CH5A 4HLCA 1CTQA 1WA5A 1L7VC 1SGWA 3SJAA 1N5LA 5EUQB 4R9UC 3TR0A 1PVOA 3BD9A 1GILA 4JSYA 4Z8XA 3DMDA 3EG5A 3Q7QA 5TVKA 2WWHA 3HPRA 1VMAA 4D4JA 1LS6A 1Z0FA 1Z47A 2I1QA 1E3MA 1AGRA 2V1XA 1D2MA 2WWFA 3NIBA 3PUVA 3NBFA 2QGZA 2QPAA 1HEIA 2ZVPX 2G3YA 1XTJA 1E99A 2HEIA 2Q3MA 3TW4A 2OT3B 3RANA 3I72A 2R6GA 3P26A 1OIVA 5JRZA 2QNRA 4LK2A 4MYHA 4BLPA 3I8SA 4LBWA 4LYFA 1HE8B 2WM9B 4BGDA 2ERYA 3CWQA 1NN0A 2GEUA 3K9HA 1KAGA 3OE7D 3NHAA 4HAYA 1C4OA 4RFVA 5GVRA 5JSZA 3PEVA 4K46A 3DOEA 1E9EA 1OE0A 2HV8A 2WAYA 4LZZA 5J4HA 5KSOA 1UFQA 3KDSE 3JZAA 4KYIB 3SDZA 3IIJA 3RC8A 1ZCAA 2H57A 4HB2A 2QQEA 2QE7D 1H65A 4Q4AA 2B8TA 4RD4A 2CE2X 3K8YA 4RD6A 2FSIA 3RS3A 1MT0A 4KVGA 3AH8A 4QM7A 2J87A 3P32A 3LXXA 4LRWA 1E6CA 4W9MC 1XPOA 2VLIA 1IY0A 2ZR7A 3GLGA 5F98A 3PEWA 4ZDWA 3UWKA 1TEVA 1AS2A 2PX3A 5F2EA 2NO7A 1T6NA 2GF0A 2QM7A 1TEXA 3C5CA 3K0FA 4IFBA 3A1VA 3CZPA 2FFAA 4LX0A 5L8VA 2DWPA 1XTQA 4M4SA 3SYNA 2QTVB 5TV2A 3PJRA 3B5JA 4WZBE 5FOUA 1SHKA 3E2IA 1I2DA 3FWYA 4TLDA 1EFTA 1YR7A 4BFUA 1TQ4A 4X8MA 5JLJA 2IA5A 1ZP6A 4JYBA 3U60B 2V6JA 3ZVMA 4HZUB 1KSGA 5KDDA 4H1UA 1IN6A 2QMUA 1PZNA 3TUIC 2ZSBA 1HH4A 4M8NE 4TMKA 4A92A 1Z63A 5EP4A 1G18A 2GK6A 2V6IA 3LW7A 2IYXA 4NL4H 5SZHB 2Q9AA 4ZPXA 1P2TA 1XD2B 1Z07A 2BDTA 2W58A 2XXAB 4KV9A 1AJEA 5GVSA 1KKMA 3FB4A 5GADl 3VAAA 2C5LA 2HF9A 2QBYB 4EPXA 5KSPA 3RYTC 3VX4A 4XH9B 1GIAA 2A5GA 4CZ2A 4C3ZA 2J9RA 3GLFA 3EZFA 1OT3A 2WKQA
chains in the Genus database with same CATH superfamily
2G0TA 3IR5A 4YP0A 1CEXA 1TYDE 3JVDA 1K86A 2GTHA 3X1ZA 3DT9A 1PJTA 5EEGA 3T7AA 3BE6A 5BN3A 5MN4A 5EOVA 3R0JA 4LJ9A 2EP7A 3PS9A 4EOGA 4X0EA 2O2ZA 4JP1A 1LF5A 2FUG1 2OB2A 3NBAA 4HSGA 3C7DB 2XYQA 4UCXA 5KYTA 1U0JA 4I1UA 4EHJA 1JQKA 4IDQA 1A1VA 5JYEA 3EFOB 5A02A 3U80A 3KYDB 1U9IA 2WJ6A 4ZQFA 4F96A 5K09A 4BLUA 4G0ZA 4NABA 5DT2A 3TX6A 2WMDA 1AQJA 2BTOA 3D3KA 2WY2D 2VH5R 4M1ZA 1DVRA 1G2OA 4ND6A 1Q0QA 1ULUA 5K51A 2OP0A 3IBGA 4KYTA 1UEXC 1IHOA 4YC7A 1MGPA 2YXPX 4AMBA 5BVGB 3O8BA 2B98A 4LSZA 5KTNA 5F51A 1B3BA 4GH5A 3RPEA 4FS3A 4AQDA 3L79A 4GMFA 3TLCA 3KHTA 3RIXA 1KC3A 3CG4A 3EZ2A 4WNAB 2PUCA 4DA4A 3J7TA 4ICIA 4M9RA 1YZNA 1M54A 3T06B 2PQ6A 3LDHA 2ZSKA 4H6WA 1E79A 1H5QA 1T3LA 4ZV9A 5BUQA 1GTSA 4YMHA 5NULA 1KJYA 2OCBA 1ZNYA 1Q1NA 4KGZA 2DWUA 4IQ8A 5GV7A 1TJYA 4DCTA 3SVLA 3JQDA 3KLBA 1KNQA 5COQA 4DIUA 3AHEA 3CXUA 2EFHB 3FN4A 3HWX1 5JRDS 3SS9X 1JAIA 2QZSA 2W6OA 3FSGD 5DOVA 3GFOA 1EGAA 1NLUA 2V6BA 2DKFA 3KE9A 3OQHA 2A14A 5AI5A 4XGRA 4FILA 1P7PA 1N8NA 4ZI7A 1E6WA 4BFVA 5LB2A 1AK2A 1Y8RA 3BILA 2WUVA 1A2KC 3UA4A 1B8NA 3EH2A 2BY4A 4PYMA 5GONB 4W7HA 3ENWA 4PPQA 1CLUA 1PP4A 2D5IA 4F2DA 1KZ7B 4Y6OA 3F71A 1CJKC 3QLTA 3H5AA 3R5JA 4BYMA 4QAJA 1FTSA 1CJSA 2RARA 1EBFA 3A3YA 3H9BA 4XIIA 2Q5FA 3DLPX 4QEDA 3P20A 3WGYA 3AEKA 3QZUA 5L7WA 1ACLA 1GY8A 3DDWA 5AXDA 5TGDA 1KI8A 2NU9A 2RGAA 4KPUB 1G16A 1K7EB 1PJCA 4XIJA 1FPMA 4ZXPA 4L8YA 3U4HA 2BFDA 2ZTHA 5FWXA 4PSUA 4BX8A 4EIWA 2A94A 4TXLA 1YFLA 1K92A 3WGIA 4YACA 4G24A 1OXBB 3WK9A 3N87A 3F7OA 3VKUA 2WYUA 1OFHA 3KZKA 1ZZGA 3QFCA 5J9FA 5JVDF 3QEAZ 4V3BA 2GX6A 2V9PA 1LKZA 2HIGA 4MA0A 1FS4A 2GD1O 3PITA 3I0NA 4DKXA 1OOEA 1B76A 1GZHB 1RLJA 1VZ3A 4NBTA 4AIIA 2HCRA 4H9GA 3RVJA 3UWOA 1AB6A 2V0GA 2OP1A 3ONFA 1P4AA 4M7PA 2VUTA 4AWBA 5A9SB 2FPOA 2ESRA 1T8PA 3A04A 3TBFA 5K8VA 1MVNA 1WDWB 3W9SA 5KQRA 3P9SA 5M2QA 3TS1A 3ER9A 2N1MA 2RFLA 2WJ3A 2HMYB 4YAOA 3BFKA 3RUIA 1F2VA 1X1SA 3EC7A 5G4LA 3PNMA 5KCMA 3RJ9A 1II8A 1KVRA 3B38A 2KBFA 5BNFA 4AAYA 4A8JC 1R7RA 1ZMOA 3LHFA 4XLZA 2W2MA 4Y18A 3LNTA 1QGUB 3NBQA 2O1SA 1ELOA 4L7QA 3KELA 4LXYA 3GYGA 3IIMA 1GU1A 2A84A 2VP4A 5ES4B 3DYBA 4ARCA 3DBLB 1W2WB 2D5CA 5A3SA 1PNQA 4J0QA 1MHPA 2HPHA 4RF2A 4AZTA 3V6LA 2AG8A 3CWCA 2DTEA 5K3FB 1MT3A 3PL1A 4YMSA 2WJPA 1UMDB 2DYKA 1DEHA 2IX9A 2WR8A 2PZFA 1KQGA 2VNAA 1XN4A 2ORVA 4MQ5A 1N5KA 2P5YA 4E1BA 4M7WA 1WXXA 4KWCA 2FXIA 4OLAA 3KR2A 2HF8A 2WVJA 1CRQA 1B6TA 1SCIA 2Q0XA 2NO9A 2H4WA 1TL7C 1GNLA 1W75A 3QPUA 4GS5A 3P27A 3DMYA 5FBWB 4BWFB 2WI8A 1IPFA 1JA9A 2YNMA 4C0SA 1RJWA 2CMDA 2FQ1A 3GYBA 2G5TA 4QDZA 2YN2A 4G6ZA 4DCGA 1ODCA 1SVKA 4J07A 2OD9A 3KAPA 1Y3HA 1DC6A 5DP2A 4Q9LA 2VHQA 1ZGZA 2PWZA 3PNVA 1U8AA 3LGSA 3ZXSA 5B6IA 5ECGC 3QITA 5E7JA 3KEOA 2XWSA 1IBCA 5DV9A 5HIMA 3SVZA 3AG5A 3AEXA 3QYAA 4BNMA 4CDRA 1WBDA 5EWLA 3R6WA 1MPTA 1OHHA 4PYIA 3LK7A 1L4KA 2XV1A 1H0KA 4XFJA 3SXUB 2H0RA 4RVDA 3UTCA 1GTZA 3HYRA 3VPBA 2GBIA 1YDEA 3L8YA 1ZM2A 2LDBA 5DHPA 1HX7A 1FDOA 1PCXA 1RXIA 2SNIE 3NOOA 4HB3A 4RM3A 4AKIA 1P8AA 3GEMA 2VCYA 3M9LA 2Z6UA 5DNWA 4GRIA 1Q12A 4RVHA 5L7TA 2HUNA 4QGHA 1LTKA 3V2HA 1PZEA 2A6PA 3FFWA 1DT3A 1GOTA 2OORC 1BXGA 4J1TA 4HV4A 1Q6ZA 2BKLA 1PTJA 4G8JA 3FSJX 2I2AA 4KN6A 4L51A 5IWAB 4CE6A 1GGKA 2VTDA 5CIYA 3NVMB 2J1LA 4MVJF 1CC1S 1NXOA 2Y1FA 3HDJA 2GRUA 2GD0A 1UJ5A 2PRSA 2RH4A 2WQ6A 4AJOA 2XMBA 4FC6A 2XXBA 4RFSB 2VYNA 2CZCA 3CRQA 3A1DA 4MIYA 1B8PA 1Y3FE 3R3JA 5BMVF 1S96A 3EEYA 4C6HA 2B7LA 4GPD1 3L7KA 1ESNA 1T5SA 4XX0A 2CCGA 4W9NA 4IH1A 3MJSA 5AJXA 3ZUPA 1SC1A 1CQWA 1ZHOA 3NUZA 2BKUA 2NWQA 1B26A 2DQ4A 2AQKA 3HCPA 4GDMA 1OXUA 1NASA 4E5YA 4EHAA 5BYAA 2JFOA 3ZKAA 3RTGA 3O26A 3N2LA 4KNYA 4GOOD 4ETNA 1KQOA 2C5GA 3B2QA 4FE3A 1HYEA 2BFFA 2UUOA 4D8UA 1IZYA 2H1CA 2PKWA 4MSUA 1TUGA 4JVLA 3TMYA 1PX2A 4BE7B 4AMVA 1EFRD 1JI0A 1O0SA 1QZXA 5ER6A 4HZIA 2JDIA 3Q40A 4WXRA 2FWIA 2Q6VA 2PGLA 4AMUA 4HWKA 2V6GA 2BJVA 1KJIA 3A9WA 3BGOS 1DEOA 4HI0E 1UCFA 4PIPA 3TW8B 5IC4A 3THXA 4IXMA 4B3BA 2EKLA 4XJTA 3RODA 1Z13A 2IGTA 4PZPA 4UTPA 3HU3A 5FLEX 4OHBA 3HP7A 5KTTA 3QLEA 2W00A 1S2OA 1ZINA 4GOKA 3NG1A 4DARA 3O74A 1CG6A 2IJGX 3C4JA 3LKDA 3ADOA 1BKDR 3TD2A 1YU9A 2QL7A 3V1TC 2W98A 4KSBA 2WM8A 3QY0A 4NZ9A 1T3SA 4Q4AA 2QSZA 1OLUB 2ZVJA 5C5EA 1A5ZA 1LXCA 3BCSA 2ECQA 2YWCA 3H16A 3E7WA 1QE0A 5C0OE 2OFFA 2GN4A 3R9KA 3TTYA 4AK9A 2WTAA 4YRMA 3EVAA 4FQ5A 1WX1A 1A7KA 1P1RA 4NPHA 3UQYS 1CP3A 3P9RA 1FF9A 3GLFB 4X20B 3DUFA 2FKAA 3KQLA 4JOQA 4F3NA 4TLCA 3KXKA 4FHZA 4MV5A 1ES9A 4QGGA 4ZRMA 3C5WP 3ELWA 5KX5F 3HUFA 4PCAA 4P0PB 2HCJB 5AKEA 3EQ6A 3BPSA 2FLKA 4B4VA 3OCVA 1L5MA 2FW8A 1XEXA 3R3HA 4G1EB 4XPIB 4K8OA 3T12A 1U3CA 4DCJA 5FFMA 1BW9A 5A4FS 4EEZA 4FFDA 4U7WA 3JD4A 1O57A 1CEEA 3DZCA 1DCMA 3GDWA 3MERA 2YV1A 2MR6A 4Y6QA 5I7HA 2ZRQA 4R2KA 3RAFC 4WFJA 3W1EA 5J5AA 2JLCA 4YX9A 3LQRA 3PFGA 4I6JA 3Q1LA 1AZTA 3B3GA 1TIPA 2NU9B 5EP1A 3UAWA 5DBFA 2ANCA 4Y2GA 2CHVA 3WX0A 5KTKA 4IXWA 4PYNA 2FDRA 2HGZA 3GJZA 1EZZA 3ND7A 4NULA 2CLLB 4I55A 4ZDKA 2P2LA 4X1YB 4B2PA 1KE2A 2FSGA 2VL7A 3HJCA 1DBWA 2Q3JA 1BEEA 3KAKA 4EB0A 1U81A 5SZIA 2I2FA 4II7A 3V2GA 2G08A 2R4TA 5IN5A 2W5UA 5FUBA 4C2TA 3T94A 2Z2JA 4JLNA 1O4WA 2OGWA 2BEWA 1IFXA 4C3OB 4AXBA 4RNDB 4R2MA 4CQMB 1RYNA 3QIAA 4XOUA 5TPZD 3ENZA 4FFPA 1AIPA 1FSSA 2P40A 2GEVA 1NLFA 4PS1A 3TNFA 1G8FA 4AMYA 4ER3A 1QGUA 4XE5A 1KEZA 5E9QA 3W90A 2JK0A 4BV9A 1KH1A 3PDJA 2BZ0A 1CRZA 4PHFA 2O48X 1GD1O 4NS1A 2VXOA 3INTA 1NW3A 2AZ4A 2PX8A 4H3VA 3W06A 4ZN6A 3BK1A 4XA8A 1TE2A 3TOVA 4O3MA 2VJCA 3GLHB 1X1BA 2B2XA 3ETHA 1JR2A 3OIVA 1X14A 1ONBA 2JFPA 1ORVA 1SZDA 4U9IS 2PFGA 5FOXA 5IVDA 4EJ0A 3UHJA 5CT9A 4G97A 5IC6A 1PO7A 4NNOA 4BV3A 1DC7A 1EK1A 1MABB 1Q2XA 1USIA 3UCXA 2IDJA 4E2FA 2HLDD 4JGGA 1UXIA 3PDIB 4MRSA 3E70C 1ML4A 1N0WA 2ONKA 2OVFA 2VF5X 1E2EA 3KHSA 2C3MA 2XEDA 3DLCA 5J59A 2MINB 4ROSA 4P98A 1J8VA 1QH1B 2OPBA 3JQGB 3R8XA 4ZOAA 4YUWA 3RK1A 4YDSA 4C43A 1EJ2A 2PZEA 2GR9A 3BTVA 4GNKA 4JI5B 2OAEA 4S1PA 1G2IA 1OU4A 2VNHA 3FPCA 2GPWA 3DE3X 3LX4A 4QM6A 3JQ7B 4F06A 3VDRA 3G2OA 3DXXA 3T9EA 5LZ9A 4ZCLA 1D0VA 4ND8B 4RGYA 3AEUB 4A6DA 1Z68A 2ZPUA 3HVHA 1TAQA 3GPLA 1GZDA 4YP5A 4MKFA 2CDNA 1S2DA 4UDYX 3UJ6A 3GFFA 2XTJA 1NUPA 2HHJA 3IKJA 2JIZA 4TVBA 5JQGA 4B3GA 5A7FA 1NF3A 2WF9A 3PP8A 3BWBA 1GT6A 1AC5A 1OX4B 3IULA 3B13B 2IYWA 1VJTA 2WBLC 3JQAD 2V3VA 1I5RA 3ZGNA 4B6SA 1XA4A 2BOVA 4XWOA 1FRNA 3DYVA 3MHTA 4AVYA 5D3MB 2Z09A 3OPYB 1KYTA 2FZCA 2VJDA 2VS1A 2H2GA 4A23A 1ST3A 2AG1A 2GZ3A 5TMBA 5CDUA 5EJEA 3OM8A 3OQIB 1KZGB 2BTEA 1RQ2A 2PN1A 1Z26A 4X24A 3IT2A 4NCBA 1Z4OA 3SIWA 5SZJA 2VF7A 2ZITA 5CB4A 1CF2O 3FDJA 4ZYVA 4MVXA 4OU4A 1P3JA 4QRIA 2Q7DA 3F2VA 3IODA 4IAOA 4UU0A 5EMLA 4U6QA 5THKA 1P1IA 2I7DA 1JA0A 5G0WA 3N53A 3RSQA 4QXAA 3H0EA 3ZNQA 1XK6A 2AMYA 1LZLA 4LVNA 1RSZA 3DDOA 3EDRA 4JZKA 1QMPA 4O2BB 4Q01A 4IDOA 3PUHA 4RLHA 4GM0A 4TKVA 5GIOE 1ZESA 3A4VA 1QX3A 2ZWPA 3EGXB 3I6YA 3KWJA 4G09A 5EL0A 4J0GA 4FYKA 4BP8A 2OCKA 2WD8A 1TTHA 4ZGBA 5BQFA 2XWPA 5D3KA 5KNBD 1I94B 1G8PA 4F1WA 3DDCA 5HQTA 3DBLA 4FN4A 3IPRA 1JEAA 5KQPA 4RWEA 4Z6KA 3V4FA 4XWTA 2PT5A 1CXZA 3KVVA 3F0TA 2W93A 1BA3A 4DLKA 5AVQA 1E9SA 1H2AS 1VA5A 1LQTA 3C2QA 5KBYA 3BFXA 5LLTA 4LRYA 3U4QB 5FI3A 1R66A 3RVNA 4DMLA 1RWQA 3EEFA 3GCDA 1XPUA 5F33A 3MXOA 5ARDA 4PTYA 1YUBA 2IHVA 4HNAB 3UT0A 2CW5A 4K1LA 1CZNA 4KQGA 1JQJC 2FW7A 1G0OA 2GXSA 2OGZA 2IY7A 2OFPA 4RS4A 4B7ZA 2ECPA 3IRUA 4JX8A 3ZE0B 3HCFA 5EXSA 3F6SA 1OILA 3FNGA 3ID6C 4NCIA 2H1WA 5HF8A 1QF6A 5E7QA 2CXSA 3SLRA 4PONA 1ZLYA 1GUYA 1PHPA 3PQCA 5J23A 1GDTA 4AUEA 2LW7A 2AR9A 4DLZA 1YBFA 2COUA 5TE9A 3K09C 4ER7A 4RH0A 5DBOA 2CNLA 4LISA 2WF6A 3O83A 3L2OB 2YHIA 3GPCA 1SCJA 4CKWA 4CU2A 3P4YA 3DFIA 5DTJA 4YRJA 1AKYA 1K2WA 2EGHA 1BMQA 3I73A 3Q2IA 1IB0A 1KF0A 4HPJB 1JQEA 3F2IA 3R7BA 3MELA 4EA8A 3MWEA 3MJRA 3O38A 3T3HA 2Z6QA 1L7AA 2PD3A 5CLHA 5F1PA 5J3JA 3VDXA 2BE7A 4MQFB 3RYHB 5KQLA 3ROEA 1Q1GA 2A4KA 5D86A 2ID8A 3CX8A 3EQ7A 3G1WA 1ZLXA 5DXFA 1EDEA 1ONSA 4F85A 5LDGA 3I4FA 3DVLA 5E95A 5D51S 5TJ9A 4NH4A 2QAJA 5MFZA 3WYCA 2C2OA 3T3MB 1M83A 2VDWB 4ASUD 4RGVA 4EW2A 2B4QA 3VR6H 1CFJA 3EZ6A 4I4LA 2E2WA 4IX1A 1PN3A 1T9GS 5P21A 4G5SA 4K9DA 4PGFA 2Q1TA 4J9UE 4V2IA 4LJSA 4EMUA 1TQ2A 1KPIA 1RJFA 3OFVA 4G67A 1Q7RA 1E3DA 3UV6A 2O20A 3SIXA 5IKEA 1N8TA 4KPEC 2QRGA 4PIVA 5K3OA 1PT6A 1UPTA 2MSCB 1KXZA 2UUPA 3W6PA 2QVXX 3IV9A 4K28A 3WOHA 3S81A 3I9V1 3BD7A 5K8IA 5SYNA 3CNOA 2CK3A 3CMCO 2PUGA 2CKMA 4KRGA 4HWSA 2FG7C 3NDBB 1XCOA 4LN1A 2F8SA 4KFCA 1AX9A 2WABA 1EIWA 2AH5A 4EGAA 1GGHA 1W88A 2GM5A 1W9MA 3LLMA 4TL7A 4TKZA 3R5HA 3NVAA 2H5EA 4M8LA 1EHIA 3WMGA 5DM60 1T26A 3FPJA 3HDQA 4DEYA 2IRWA 4W5HA 4B74A 4J0JA 2NXEA 3SQDA 3DPSA 4FGWA 1TZJA 1ULAA 4ZVKA 3PJDA 1P33A 3GT3A 4U7DA 1YE8A 3OZWA 3ZBQA 3CWZA 3CZRA 4YAGA 1UDBA 4ZKDA 2R0QC 1JHVA 4FHGA 4DCSA 4H7EA 3RUHA 4ONEA 1SU4A 3ZU3A 1HFWA 2JCXA 3ZY3A 3AESB 3EZ7A 3KYIB 2ZIAA 2FWJA 2YHSA 1QGDA 2ZT5A 4KTTE 4KQMA 5BWMA 1QHSA 2A0KA 3QEOA 4MPTA 1IM5A 4M0KA 3T61A 1ZZEA 5DFAA 4ECEA 5CH8A 1NHGA 3PFWO 1K98A 4MINA 4LDPA 4RD3A 4RTLA 5TVGA 1QGAA 1QS0B 2R3SA 4C2BA 2ZM5A 3FTQA 1ZI8A 3MJDA 4EA7A 4O0LA 4A5SA 5EUBA 3GMTA 2EZUA 3N8GA 4BMCA 4QOGA 2AN3A 1FTWA 2EARA 4AYTA 2VDMB 3AFHA 5B7PA 3RRMA 1WPRA 1GNRA 3SC2B 2M1ZA 1XROA 4LOAA 3VPXA 1U63A 3R7AA 3VOBA 2CHFA 2IXEA 2PQMA 1LFDB 3FBTA 3OSZA 1RYFA 2GF9A 2LV8A 2Y71A 2ZIFA 4MWSA 3H6GA 3L07A 4WKPA 2GPTA 5SYMA 4EB3A 4HRVA 4DDUA 2VNKA 3QXSA 4AM8A 4GWGA 3VPGA 5T64A 3ZY6A 1G3MA 2FLWA 3ZU5A 4QTYA 4ESVA 2W2LA 2Y1WA 3KOZA 4EI7A 1V8PA 2ORYA 1SCUA 1DSSG 2K4MA 4LJAA 3U6BA 2HCBA 3F3KA 1R4NB 5DGXA 4F7WA 4YRGA 2W8BB 3PJEA 3U4DA 4HJXA 2GXUA 1C81A 3DWGA 5ELLA 4P58A 2C82A 3PNYA 4EUNA 4EZEA 2F59A 3JQBA 1MEEA 4KWHA 4G1MB 2QTHA 2OHVA 1RRVA 2NAFA 4YCNA 2I4TA 2WD7A 4LQDA 1NMQA 4ID3A 4TGLA 3VR2A 1ZD9A 5E1OA 5KYYA 4G4SP 1VP3A 2PD6A 3ZZMA 4NDZA 4QXRA 1U3UA 3LXRA 4QVGA 3WZ2A 2EWMA 3QW2A 5CFZA 2X4IA 4GZMA 4HQ6A 4O2BA 5FJJA 3RC1A 4G23A 5EZ6B 4GXRA 2IKQA 1IOZA 5JZVA 4QG7A 1RI1A 2CNWA 4NATA 5IBCA 1GNTA 3KB8A 4U2FA 4CMAA 4LGVA 3URKA 5A5DA 1O5TA 3WK4A 3GEHA 5FOTA 1H85A 1NYRA 2RK4A 2A5DA 1DKLA 4G89A 4ZVUA 1CUHA 5JCJD 3SWWA 1H3NA 2FSVC 2D2FA 4I8DA 1QDLB 4N54A 4P4TA 2QAGA 4LK3A 3ZE7A 4Q6BA 2W2LD 1JECA 2HX1A 1MC1A 4F5EA 4AMGA 1OLXB 3N0VA 2VJOA 1AK9A 5BY2A 3AUYA 3OIGA 3O1LA 1G3QA 2E4ZA 5HP4A 8LDHA 1A7AA 1YO6A 2WM3A 2HSEA 2X5XA 3LCCA 2CVHA 1CUUA 2DFNA 1IZ7A 1X1RA 1YC5A 4MZXA 5EVCA 5FULA 5G02A 1BWQA 1TLTA 3O94A 4EY4A 1FUYB 2AMLA 5J1TB 3ZJ5A 2PWYA 5T41A 5IG2A 2OXRA 1FYDA 1USKA 2HRRA 1CB7A 2PEZA 5AO9A 2QTZA 1VYUA 1WNTA 1LA2A 2WNHA 3FM9A 3OWOA 1R8YA 1KP2A 3RC9A 1TA0A 1P9NA 4EQZA 1YF3A 4H7DA 4UUPA 2IELA 5ETJA 2GT1A 2Q3BA 3C6YA 3C70A 7MDHA 1OV4A 4WTOA 3W3ZB 1OKKD 1XD2A 2HIMA 4ECAA 1R4AA 2GZAA 3FPBA 2G0NA 5LJLA 3EIUA 3GP3A 1EVIA 1G8KA 2BHRA 3CR7A 2PM8A 5AKXA 5F3RA 2AN9A 1EUDB 3NTQA 1JHYA 4EPTA 5KTSA 1RBYA 1RWMA 3A6LA 5FT9A 2DERA 4A82A 1YQDA 2YY7A 3LPMA 3G89A 3GQBA 2W6CX 2CD7A 5KNCH 5EJMA 4G8DA 1X74A 2BW0A 2QTBA 3D0OA 5GGYA 3OO0A 4PRYA 1WXEA 2WB4A 2XRMA 4MVJM 1P8JA 4OJMX 1H9BA 5JAQA 1L1FA 4WFQA 3T5CA 5KPJA 4MKIA 3IP1A 3QPCA 3U7QB 3NT2A 5FIUA 4ITUA 5T4EA 5CB4B 1J0CA 4JJ8A 4HD8A 1OLSB 1U8TA 3N74A 2P9EA 1TM2A 2WU8A 1JVBA 1QVZA 2P11A 2X19A 2H2AA 4TXHA 5G2OA 4DMMA 2BDEA 1QFJA 4MR9A 1U0OC 1JGTA 1UJ6A 2NUTB 4WUTA 1AKRA 4D26A 1B15A 1NONA 5J4YA 2ZE8A 4NTZA 4WUVA 4C76A 4Z0HO 1MFZA 2XKKA 4CTMA 2FRVA 3IQIX 4R2JA 1DX6A 1T3HA 2RKBA 3E2PA 4I5EA 4BXOA 1XB2A 4YJ2A 3HH8A 2O54A 3E2MA 4LF5B 1P1CA 2VPYA 2BWJA 4IHJA 3C3EA 3FMVA 3PT9A 1KO4A 4PHTA 3DVAA 3FVWA 4J1SA 4TMXA 3PQ8A 1WMAA 2IEGA 1DOHA 1G42A 2J9FB 4NFLA 4WJKB 1UZMA 3VR4D 2VAPA 3BF7A 4FKMA 3PCTA 1ZIDA 3LTNC 1X42A 4AFNA 3AESA 1ENYA 3Q72A 4F3KA 1IB6A 1F1BA 1RKXA 2X23A 3H83A 2WAAA 2ZT7A 4HATA 1XQ9A 3QVLA 1XZMA 2BI8A 1SCDA 2I33A 3CX4A 2HREA 3NWEA 4INPA 4QOSA 3L8EA 1ZUNA 1PR6A 4MMXB 1AS3A 4RSRA 4UUNA 3ER6A 5J58A 3OZBA 4PO8A 5CX4A 1PV4A 1PL6A 3PDHA 1YRYE 2EW2A 2QLTA 2CYAA 2XUPA 3G49A 5LMZA 3U44A 2H4JA 5L6LB 4MYUA 3WMWA 4YXFA 3VZCA 1RKQA 8OHMA 3IVXA 2Q8QA 2PY6A 5GPBA 4TVKA 2ZXFA 3TLXA 1JU9A 3SJZA 3QWHA 4R1UA 3ZGZA 2C4TA 1W85A 3LECA 3RC3A 221PA 3QBVA 5BPHA 1QHHA 3GRRA 2FAXA 3MMPA 1CUIA 1FDIA 5C3UA 1M1YE 1GTMA 3MD9A 3B3FA 1VCNA 3HU1A 1JIQA 2GHRA 5ADUS 3HWSA 4QC2A 4TQAA 3BT7A 4L4RA 3C0KA 1SU6A 1UK7A 2RSLA 4JUAA 4M1TA 4L4UA 3SZOA 4HX9A 3A2LA 4KXVA 2Q07A 3W5JA 3QPBA 1CIVA 1TO1E 5IT5A 4TM7A 3USCS 2WWVD 2Y76A 2L82A 3B8HA 3RS7A 5L4SA 4IGIA 3KQWA 4MJLA 1TVCA 4TT8A 3LRTA 2L17A 1H8EA 4JEUA 5DGHA 1JQLB 4ZV7A 1KZ6A 4I7EA 1EXMA 3DFKA 3HN6A 3TPCA 1WPQA 4Z3OA 3NLLA 3TVDA 4AZSA 1HDZA 2CMGA 2YWGA 2B5VA 3ZQJA 3OCCA 3O3CA 3INRA 1G55A 4XB6B 4IEFB 2DTXA 3I12A 1LNSA 5LZ5A 3F3MA 2Q29A 5LNK6 1UWVA 1J8FA 3U0VA 4EUFA 3EAQA 5K2MA 4DA8A 4YXWD 1E3SA 2HYDA 3FCXA 1UBOS 1VYTA 3P2MA 3BKWA 1ECBA 2QJFA 3JS5A 1IL0A 2BFNA 3PD1A 4IJWA 3K53A 4L8LA 4IHKA 1IJEA 1E2GA 1MB3A 5JJLA 4HLNA 5IWCA 3ZOKA 1QHXA 1BDHA 1HEUA 1KYQA 1P91A 4YIKA 3M1AA 4NMMA 4QQ8A 2GKOA 4RK4A 4EGFA 4CCWA 2B2NA 1P2FA 2VHCA 3DMTA 1QHNA 1XZJA 4TSRA 4N6NA 4M0UA 3S8MA 2NPFA 5B64A 1W44A 1F4VA 4F2HA 2JHAA 4QLBA 4GOND 3AI3A 3KNZA 3EX7C 2X9QA 3IOBA 1HGXA 3MJHA 1NVBA 2HEGA 4FHEA 1VL6A 2P2NA 4BN0A 3CJRA 4LJ4A 4B3RB 4V24A 3ADBA 4K2HA 4DILA 2NNWB 5E6RB 1RYDA 4X61A 4D43A 1G41A 3H2KA 4OBBA 5A7GA 1FLAA 1R6AA 1PT9A 4FR2A 4URFA 2YJZA 3IO3A 4EVRA 1TQHA 3ZU4A 4P86A 4IXTA 3QHPA 4EUKA 4JP5A 4QZVA 1QFZA 2XVMA 4UBJA 1L5OA 4LJKA 3NBYC 4QU8A 4Y2TA 1LBSA 3KJQA 4E09A 4F5DA 4F2WA 2ZRDA 5C8ZA 2O1WA 2HJSA 1LJ8A 1SBYA 1RWWA 1T9DA 4F8JA 4IDDA 2QUIA 3TOCA 1G8YA 2RIPA 3DVQX 1WPXA 3VR6D 3QG1A 4ZVMA 3VHXA 1EIZA 2J6CA 2JAQA 3HBMA 3OQ1A 3QKRA 5IAEA 3RRYA 1EUCA 4HS4A 1TKCA 1IZ0A 4NENA 1QIFA 3SGLA 4WZAE 1RLMA 1SVLA 2R44A 2BFPA 3V7WA 5KWEA 1N77A 3NEAA 2C0CA 4MUFA 4H6PA 3BRWA 1KI6A 1E5XA 1QP0A 3NEJA 2JANA 4KIJA 4MHSA 1CQPA 5FWXB 1CE8B 4ZHQB 4TTRA 4R71A 1MQSA 3KQPA 5BYJA 3GFBA 4CBVA 5TLSA 3W5CA 3U7GA 5KC9A 2Z9DA 4UM9D 1Q84A 1JR3E 4IMJB 4TLMB 3BWXA 4LGCA 3AEQB 4OLHA 4EHFA 4FGSA 5IKMA 2HRZA 4BFCA 2ZU0C 3BA1A 3O93A 1MH1A 3RYIA 4ARVA 4Y1FA 4RCVA 4DT1A 3U3JA 1PJ2A 5AUQA 2G67A 3ISJA 5AK5A 2AV6A 3NNNA 1XLTA 3K0CA 3UA3A 2OC4A 2P1ZA 3SMQA 3TRHA 4RFSA 1QTQA 4MS4A 1HKHA 4DSUA 5JHGB 1ISMA 1SC3A 2J0EA 4NF2A 2UKDA 2ZRBA 4AJPA 1JG6A 1NP7A 1VLHA 3AHIA 4ID9A 4W5RA 3CH4B 3IR6A 3D5EA 3K92A 3IQEA 5CM2Z 5KUTA 4N12A 1HDOA 4Y6SA 2ZB2A 1UBTS 2B8NA 2V55B 1TUEA 3UJCA 4XWKA 1VG8A 3ZWAA 621PA 2Q4DA 4PFJA 4RK5A 4EGJA 5ED4A 2QK4A 4FJ0A 3Q7SA 1EE1A 13PKA 1K3TA 2IP2A 4P22A 3E9CA 4X1KB 3H6HA 3PFHA 1Q19A 1YAHA 2ALJA 3B1WA 3MYYA 4OI4A 1FRVA 2HN9A 5E1BA 5CA0F 1TX4B 2PIAA 1OFVA 3CUSA 2O5EA 1BCRB 3O4FA 2VH1A 4M60A 5FLXA 3NAZA 3CZ4A 1U0NA 4K6CA 4PZYA 1KVUA 3COZA 4AF7A 2VRCD 1PFWA 3TVYA 3VR4H 1MDBA 1E4OA 1FNNA 3M49A 1KOLA 4HN9A 1ZAYA 3ICEA 3R0XA 3AVWA 5EEHA 3R7LA 2ZE5A 1ZUNB 2OBNA 3UJDA 2PAFA 4MI6A 2CVZA 2JIOA 4ND1A 3RAEC 3ZZNA 3NRCA 2P9YA 3N86A 5EXPA 1L2TA 1PX0A 2V7BA 1XWIA 5KSYA 4R83A 3CEMA 1WULS 5CIWA 5D7NA 3VYVA 1RC8A 2GLUA 2YWHA 3NGXA 4GFDA 4KOAA 1N9KA 2LRHA 3UMMA 3ECCA 1SIUA 3NZEA 1SIWA 1GLNA 2XA9A 1XLUA 1RCFA 2XKBA 1BZYA 3ABZA 3V00A 3TZ6A 1QVWA 4F4IA 2PV0A 4RXUA 1X7DA 1KYVA 3FZEA 3Q2KA 1BCSA 3V8NA 4XQEA 2LTAA 1XE3A 3O2NA 5KYWB 3MT9A 1UKCA 2IYQA 2QN1A 5AOCA 3OA2A 3USES 1QRDA 5C18A 4I55F 3KT3A 1QC5A 4MEJA 4Q9JA 2IWRA 2IP4A 5G0VA 4KR3A 3ZWOA 2RC6A 1KI1A 2P90A 4XX0B 5IH7A 1J7JA 1XRJA 3CNLA 4BHTA 2GB4A 1WXDA 2IYAA 1ADBA 2YFHA 3LKVA 3T7JA 1E63A 1ESDA 3DR5A 5LP6A 3MINA 1WW3A 1THZA 3IJEB 3HR7A 2R68A 3A7EA 2JVKA 2JIDA 4O25A 4YP6A 4V0OA 4DNXA 2F1IA 4UATA 4WJZA 5FBLB 2IZ0A 4YH1A 4O4JA 3ZHCA 4DUZB 5INTA 1YA4A 1S1MA 1I4LD 2H5LA 1RQLA 2NZVG 3G2MA 3GQBB 1J00A 3QOFA 3TZHA 5DN6D 3CA8A 1I8TA 5LD2B 3PUJA 4H77A 4JBWA 4R2LA 5ARCA 3WGMA 4UFNA 1GHTA 1H5NA 3T38A 5DM70 5K6AC 3ZJUA 1U7XA 2GI4A 3O8DA 4NAHA 2ZWIA 3EA5A 4UNRA 2NO4A 1ZI9A 2OUKA 4FDLA 2ZJ2A 4IRXA 3RUDA 3IURA 1UQTA 5E7MA 1F17A 1L8XA 1QQTA 3DWIA 2ZQYA 3GUVA 1VLQA 4KEAA 4XKJA 1XQ1A 4DBLC 3IRVA 4NMLA 2DPYA 2IPMA 1RXWA 2G36A 3O8OB 3I6MA 5FYQA 2EJUA 3MCZA 1HFEL 1U7DA 4ZZIA 4DMUB 5JCZA 1ZVKA 4BFTA 1Q1AA 5IBPA 2B4RO 3ZY5A 4CI9A 1IC6A 1NI5A 4K9PA 5K0FA 1HT1E 5LP6C 3O03A 2P8JA 1E9BA 2VQEB 2CNKA 1TF7A 4PAOA 3TD9A 2O7NA 4HDNB 5E4JA 5JCOA 1DIAA 3LT1A 4TKUB 5J4KA 3H1AA 5FEMA 3Q3GE 1FSZA 2GBLA 3H17A 2FCRA 3EDOA 4WCDA 4A0QA 4E5KA 1EFAA 5ALPA 1JHXA 1IDN1 4S04A 4Q1EA 2V8OA 3SHTA 5FPKA 3DG9A 4WNYA 5IU6A 1E64A 3KWMA 3B5EA 5FH9A 3GLHA 2DSTA 3MSCA 4UZFA 5ALFA 3HEAA 4B2LA 1ZM9A 4JFRA 3W5HA 4P3NA 3B6MA 4HO1X 3AIIA 3AETB 3CPHA 3UMRA 1QIHA 1UDWA 2MWMA 4E3ZA 3QI2A 4S1WA 2VUSA 4DTCA 1JHZA 3LX8A 3OFND 1NBIA 4CIXA 1FRQA 3COWA 3HO8A 4P4LA 4PAQA 9GPBA 2MR5A 1E0JA 1GZVA 1RT9A 1TK3A 3DHVA 3HO1A 5I8WA 3AF0A 3AW8A 4EM6A 2G1KA 4E31A 1CUXA 1P0FA 5LQSA 4JJGA 1YS9A 3RRNA 3TGLA 3ZD9A 1ODLA 4N82A 2P9BA 3KTAB 4X71A 3FKSD 1JWBB 1CR2A 4DVJA 5JPCA 4ZOBA 4JASB 4M3NA 2XQVA 3IKMB 4LYGA 4DANA 3B9RA 2GETA 1BS9A 1K06A 2QRNA 4J1TC 3ZE2B 1PSDA 5B1HA 2Y8EA 1A8QA 5CLIA 1VB5A 4HKTA 4P84A 3ZK7A 1ZL0A 4BFXA 5JXHA 3D2LA 2Q4BA 1KWGA 4UTZA 3KJNA 1FDSA 1PNOA 3KZXA 4ZTZB 2O2XA 2OAGA 3TTXA 3KSUA 4DR5B 3BYZA 5AHWA 3P7MA 2LBPA 3OLYA 4ZVPA 2O2DA 4AJEA 1LB1B 3CRVA 4LC9A 4AKSA 2V7WA 4ZGWA 2C2GA 4YXWA 1UJNA 4GF5A 5K7SA 1RFLA 3NTUA 4FD3A 3HY3A 3G0GA 3BIXA 4AX8A 1Z36A 2Z3WA 1HYHA 3KPWA 2ZSHA 3QYFA 4URVR 1XWFA 2F48A 2OV4A 2FQYA 3AF2A 4UPDA 5LOVA 3DYIA 4GR4A 5ALZA 1VE1A 4Y6PA 3ONEA 1FMJA 3PXDA 2EBWA 1XNQB 2AG6A 4RBNA 2J08A 4BMVA 2JL1A 4ZEXA 3I5UA 3QFSA 5AQ1A 4GIBA 3TFWA 2IV7A 1DBIA 4UBNA 1M8FA 2OM2A 3C3MA 3O95A 4I1OA 2HA7A 3IEKA 3H0KA 2QAIA 2VK2A 3SBOA 1BJRE 3S40A 1DUSA 4X1IB 5CLGA 1FVHA 3TLBA 2QMHA 3H9UA 1TUBB 1J6UA 1G7TA 4MW5A 4YBRA 1BA2A 4TZKA 2PAAA 1JLSA 1ZSVA 3BMCA 3IPLA 1QH0A 1TYCA 1E3IA 1ZNZA 1U0BB 1GXSB 1XTSA 1M2HA 4WJLA 4PU0A 2REQB 4Q39A 3JQEA 3R6LA 4P82A 3GROA 3N3BC 5KCZA 2R8OA 3FUXA 1K63A 3KJZA 2XIJA 2ZOSA 3HCCA 1NZFA 1Z0IA 3C3KA 2VHZA 2IBSA 2APJA 1YQQA 2CNOA 3BGIA 4KX3A 2ZJ3A 2YJ4A 4MVJD 3JALA 1PLJA 3GF4A 3HJNA 3ANLA 4DLRA 4UBOA 1HT2E 5JUWA 4IIFA 3ENQA 2NPIA 4BJ3A 4E13A 3EPKA 4YCLA 5L6MB 2FW1A 1MB0A 2F3QA 3QMVA 1PR2A 5TQ0A 2JGDB 4KLAA 1NM5C 4B9EA 3FR8A 1G1MA 2GLTA