2CCGA

Crystal structure of his-tagged s. aureus thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
202
structure length
202
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Structures of S. Aureus Thymidylate Kinase Reveal an Atypical Active Site Configuration and an Intermediate Conformational State Upon Substrate Binding
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 87
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ccgA00
1U0LA 2NO6A 1Z08A 3TLXA 4BFWA 4C0LA 1XFAA 2P0EA 4JSYA 4PC7A 2V1XA 3TVTA 2OFOA 1XTJA 2GDJA 4XWOA 4TYWA 5L3RA 5AJYA 1NN3A 4C0BA 4P33A 4HB3A 2JLWA 3O8BA 1KGDA 1KDOA 1PUJA 3DVLA 4R2IA 4PHGA 5A0FA 4FIDA 2REOA 1DAEA 1ZNZA 1J90A 2VHTA 4L16A 2EFDB 3ADKA 2YWEA 5E7IA 5H8WA 2GXAA 1AK2A 1Z29A 2QP3A 5JWHA 4BFTA 3TGPA 2LKDA 1V43A 2F9MA 2QAGA 4UNQA 4O2LA 3NDPA 4TL9A 1NMXA 4C0KA 1GNRA 3UANA 1WBBA 4TQAA 2WTUA 1JJ7A 4M21A 4DBLC 4ZCMA 4FCTA 2ZEJA 1MO6A 4B32A 2AFIE 3L8ZA 1E6CA 1BO6A 4HZIA 2WJIA 4YMSA 4XWKA 2EFHB 3LW8A 1EFHA 2KI5A 1XCMA 5EE3A 1G5PA 1KI8A 2OCBA 3EPLA 1JB1A 1CF4A 4JLVA 1L8QA 1VCNA 1Z6YA 4TLAA 3GLGB 1R4AA 3PV0A 5K8UA 2HF9A 4ZKEA 1L7VC 1T3SA 4BGDA 3NDBB 2GF0A 4TTPA 2AHOA 4FI3C 3EG5A 2IYWA 3C4JA 3NEJA 3R20A 2JLZA 3IO5A 4QGHA 3EZ9A 4BLPA 3WYAA 4A15A 3DOFA 4XTCS 2A30A 3LLMA 4YONB 5L3SA 2VHCA 4Q9IA 2C9CA 3W8NA 1NN1A 5C46F 1E2IA 1RPZA 4CIDA 5FUWA 3THWA 4U7DA 4TLCA 5EZ5A 3RRZA 1QHNA 2QE7A 1ZP6A 2KBEA 4AG6A 4CEIA 2QNRA 2WPDA 2HYIC 5GJCA 1XD2A 1E4YA 2OV2A 4MGIR 2GZHA 3WRYC 3R9IA 2FFAA 1YVDA 4Q03A 1U9IA 4TMKA 4HLQB 4LZZA 3Q85A 1OIVA 1G5TA 2GCNA 2HYDA 3MJRA 2OE2A 2QPOA 5FPSA 3LD9A 2PCLA 2BBTA 2QPAA 1YR8A 2A7QA 2PLRA 4A6XA 4Z8YA 2ZYVX 2D74A 2OG2A 1I2MA 1ZIOA 4W7SA 1RJ9A 1QRAA 1TUEA 3JZMA 4BUJA 2WKRA 4CZ2A 4NL4H 2NO0A 3W3AA 4LSGA 5CB8A 4W9MC 1FX0B 1Q12A 3PEVA 2AL7A 1FTSA 4QGFA 5KDDA 3AVTA 2RGCA 2D62A 3W6OA 1C9KA 3MUFA 1E2KA 3EIEA 4WZBE 2IK8A 1W36D 4HAUA 4FWTA 1F2UB 2F3TA 1Q1BA 1VCIA 1UBGA 1VKJA 4A8JC 1M1YE 4OI2A 5TVKA 3OZXA 3QI2A 4DEXA 1TQ4A 3RC3A 4BWYA 4JLOA 2BMJA 1JALA 2W2VA 5F3WB 1CU1A 5JEDA 1HEIA 4PANA 3K70B 1GDDA 1N6PA 2RGAA 3K0FB 3K0CA 4DSOA 3ADCA 3RRMA 1M7BA 1RFLA 2BMDA 3HPQA 1G8HA 3GCGA 2VTKA 3HWSA 1XPUA 1UM8A 4WXPA 2QRZA 2Z4RA 2BMFA 1Q44A 4TWZA 4BZPA 2XSZA 4E22A 2CHVA 4DLVA 4G5OA 5JS7A 1QHYA 4GMDA 1R0ZA 1SVSA 4YC7A 4KYIB 4HAYA 1KI9A 1SHZA 3BE4A 4DSNA 4ARZB 1XD8A 2ZJZA 3SDZA 2B8TA 2NGRA 2RH5A 3LY5A 4Q18A 2AR7A 3FPAA 3KFVA 4B3CA 4K46A 4ESHA 1E99A 4BECA 2PZFA 4UNSA 1BYIA 2AD1A 3I73A 4RD3A 3T1TA 1TTTA 3CRQA 2QSZA 2FFHA 2Z43A 1GIAA 1EFRD 3PUYA 1AGPA 4D4MA 3ZZ0A 5IF9A 1DAHA 4LBVA 2ZVPX 5BXQC 4CEHA 1OH8A 3K9HA 5FL7A 3MLEA 4JIMA 3A4LA 3RVBA 1XBTA 1E0AA 2JJ2D 2JJ8A 3BFVA 1X8LA 5AK0A 1A7JA 3NTUA 4UKDA 5KUTA 1SXJD 4QGGA 2WKQA 1Q1QA 3I4LA 4TQ9A 5BWMA 3CNNA 1US8A 3QE0A 3PUXA 3FHTA 2ZS8A 1RRPA 4EJSC 5FI0B 1EX6A 1OXXK 2O8CA 2ERYA 4LJYA 4NCKA 2WSMA 1D2NA 1G6HA 3N2IA 4FMCB 1P9WA 2YV5A 3KKPA 1LF5A 2QTFA 4PFSA 3NXSA 4BFSA 3R8FA 4N0DA 4FCWA 3ASYA 4PZYA 621PA 3F8TA 2O8FA 4AWXA 4I1VA 5KYKA 5HCNA 3X1WA 3KTAB 1S3GA 2FEOA 1Z22A 3TAHA 4NKRA 1XU4A 1XTRA 1MT0A 3CO5A 2ECKA 5FL3A 1F60A 1TQ2A 1W36B 3RRYA 4I4LA 3OESA 1IXZA 1T5LA 1DG3A 1OLOA 4XIGS 3EWAA 5LD2C 2R9VA 4KVAA 1A2BA 2AWOA 1JECA 3L0IB 4PC6A 4BLRA 3QF4B 1W48A 1P2SA 2NO1A 4MKGA 2JIZA 4LUCA 4DEYA 2C96A 3TKLA 1XMIA 2QU8A 5LBIA 3R8CA 2O8DB 1UKZA 2BVNA 3VR3A 2NOAA 3LFUA 4KLNA 4XVRA 1ZVQA 121PA 2IUTA 1W2HA 2N1BA 3CPJB 1HT2E 1C4OA 4IOJA 1FL9A 3RYTC 1AGRA 1DEKA 2EQBA 3U7EB 1ZM2A 2ZJOA 5EXSA 3THXB 5DI3B 5AUNB 2Q3MA 1HUQA 3NWJA 4GT1A 2R44A 1U90A 2WWXA 1WDTA 1E2JA 4GSYA 4PC2A 4Q7KA 4A0HA 3BD9A 3K0EA 2CLCX 1YU9A 1S2MA 4A82A 1TU4A 3DMNA 1GRQA 2PJRA 1GKUB 4N0EA 3VMFA 1XPOA 2ORWA 1F6BA 2WJVA 1CR1A 1VMAA 2XNDD 4E07A 2DWOA 1YZTA 3KB1A 2DWQA 4HDCA 1G8GA 2ZSEA 3GFOA 4IEIA 3KL4A 4HYYA 4LV6A 2J59A 3A1WA 5DLQC 4GP6A 4MGKR 3EW9A 4Q4LA 4CRWB 3BERA 3KQNA 3LVRE 2GNOA 4LV5B 1G19A 2B21A 3FOZA 3ZVMA 2YZ2A 3AF2A 4OKSA 3ZS9A 5B58C 4KJZA 2OBMA 4CEJB 1W49A 1ZM3A 2VH5R 2PX0A 1Z0IA 1EK0A 4KODA 3UMFA 1SKYE 2J46A 1R5BA 3IEUA 1SKYB 2F3RA 1XRJA 3OAAD 4Q4JA 4WA7A 1N6RA 1SXJE 1R10A 4RFSB 2GILA 1UEJA 1SXJB 2PH1A 4LYJA 1C1YA 4XVQA 1KSGA 4A2PA 4BFXA 3W6PA 3WNBA 2GJKA 1Z5ZA 2JLRA 2Q9CA 4GZLA 2PT5A 3CX8A 3QVVA 1N6HA 2GXUA 5HE8A 1GUAA 5DI9A 2ORIA 1CKEA 4V0LA 4FWIB 4HATA 4MRVA 3KJIA 3E1SA 1ZCAA 4D4LA 2WM9B 3ADDA 1KKMA 4G01B 3IDQA 3ZJYA 1RZ3A 2QGZA 3IEVA 2KJQA 4IJMA 1N3BA 3KJEA 1R8QA 4I99A 3Q3JB 4HUQB 4H1UA 1MR3F 4DB4A 2JLYA 1P2VA 3FFBA 2BBSA 5AJWA 3PENA 5FPYA 2ZTSA 1QHSA 4Q9HA 5FBLB 4ZV4A 5DN6D 5EXTA 4DCSA 3G82C 2ORVA 2YWHA 4V0NA 3QXJA 5KSOA 1EESA 3CWZA 2ZSAA 4B2LA 3A58B 3LRPA 2QROA 5DIFA 1KK2A 3C8UA 5BYJA 4I1SA 3ND9A 5K8LA 3ZVNA 1CS4C 1W2GA 2A5JA 2ZU6A 1AM4D 1TF5A 4CT4B 2IEYA 5L3QB 1MOZA 4Q4AA 4Z1MD 1Q21A 3I3SR 4XSGA 4Q4HA 1Z8FA 5D3QA 1KI4A 1TAGA 1PVOA 2V3CC 2IWHA 3L2OB 1KI3A 4H1VA 4AYWA 4M9SA 4F7WA 4MRPA 1NSTA 1P72A 3BGWA 2XNDA 4HZUB 2WSSD 4LI0A 1TADA 4H9GA 1AZSC 1II0A 3B60A 1G7CA 1Q20A 2QG6A 3S1AA 4KXFB 2H18A 4OI1A 1OKKD 3TSWA 2J0SA 4LJ9A 4IDNA 4IHQA 4GPTA 4UJ5A 2EVWX 4IEEA 5IHPA 2BBOA 1M6NA 2P5SA 4P32A 4XOIA 3GD7A 3GEHA 1J8YF 3EARA 4IDQA 4PC3A 3TRFA 3BH0A 2BHRA 4V0MA 2GVZC 2O0KA 3CM0A 4OHZA 3SQWA 2A5YB 3CZPA 3OAAA 1Z07A 3T15A 1E9BA 4ABYA 3IIJA 2C2HA 2RGNA 4QM6A 4A8JB 4MA4A 2QT0A 1KMQA 4TMXA 5H70A 1P75A 2ZJYA 5DHFA 5FBRB 3AKCA 4J0QA 5AR1A 1P9NA 1DTSA 4JBYA 2FV8A 221PA 2ZETA 5J4LA 3GP8A 3GJ3A 1OH5A 4NCIA 2YOHA 4BEBA 2ZS7A 1SQ5A 4LJ5A 3AVUA 1U2RA 5DHAA 4RVCA 1GOTA 2REBA 2ZRLA 4QGAA 2EU8A 3MGCA 1VDZA 3FE2A 4Q1DA 4LPSA 3QEOA 1VHTA 5JRZA 1MKYA 4TLDA 1AKEA 2QRNA 5C18A 5DN6A 1KTVA 3EXAA 3RS2A 4C0AC 3I32A 3PEWA 2K5UA 3IO3A 3P4YA 1QF9A 5FTKA 4DHEA 5CM8B 1NP6A 4GP7A 1KJWA 1YZLA 1BIFA 2BBWA 3RWOA 3U7FB 1ESNA 3H86A 1R7RA 2L0XA 2WWGA 1XD9A 4XD7D 1UBCA 3AP1A 1G3QA 1U9IC 4JYBA 4XTRA 3RHFA 3THYA 2VP5A 1ZD8A 1NVVR 2IWRA 4D80A 1D2MA 1OB2A 2G3YA 2NIPA 1DO0A 2ZUDA 1XJ0A 1LF0A 1OFHA 3DZ8A 2VP4A 2ZJAA 3B1VA 2V8OA 3C7KA 3GJ7A 1NVXQ 3BAFA 1E69A 3GLHA 1KNXA 4Z1MA 3ZH9B 5F9HA 4HEJA 4A9AA 3CNOA 5JECA 2I1VB 4URYR 1CJMA 1AKYA 4JLMA 5KNCA 3DO6A 4KCGA 2P2LA 3QKUA 2DY1A 2WMOB 4JLJA 1JR6A 3BIFA 1I4DD 1KY2A 3WBKA 4NYIR 2WSSA 1P73A 1MABA 4DLYA 1DAFA 4D4JA 2V7QD 3E2IA 3A1SA 3GLHE 2F6RA 1XB2A 2PMDA 3A1UA 1FP6A 3VAAA 3B7GA 3KUDA 5AUQA 3RS4A 4EJSB 2RB4A 4MRSA 3LAWA 5FTJA 1SVLA 1OKKA 3PG5A 4LPKA 2GK7A 2JATA 5CLLA 2GJAA 1CJUC 2MSCB 1XEXA 1OH7A 4JVLA 2FWRA 2H5EA 4TSFD 4URUR 3FTQA 1RYFA 2BCJQ 1G1MA 2YNMA 4NPHA 5H68A 3EZ2A 1Z2AA 3A4MA 1UFQA 4OQLA 4KBFA 3B1WA 4KYUA 4Q9KA 1MV5A 1A1VA 3U4QA 2IYZA 3K0CC 3CPHA 3A8TA 3L82B 1DE0A 721PA 4WZ6A 3VNVA 1U99A 4L5BA 4UJ3A 5FTMA 2B6HA 3QKSA 1P2UA 4QBIA 5LD2B 2JCSA 2WWIA 4JLPA 2ZR0A 2QMHA 3GJ6A 2WIAA 2W2XA 4URWR 4KSCA 1HYQA 3PEYA 5EP2A 1KI1A 1G18A 1YZUA 3QKRA 3UKDA 3P1JA 3B82A 3SS8A 1CULC 2BJVA 1KZ7B 3LXRA 4HAVA 2PT7A 3RSOA 1QHIA 5J4YA 2IS6A 1M34E 3D6TB 3HR7A 5SZKB 3MMPA 2OESA 2H17A 2AXPA 4GBMA 3K0SA 3AVWA 1M74A 4AKHA 2EYUA 2ZYTX 4NCJA 2OO7A 4HDOB 4PPNA 4DT1B 3DM9B 4GRAA 4DLWA 2VPPA 4LJ4A 2ZI3A 4BFYA 5BN3A 3NKVA 1NNEA 3UXMA 2B92A 1DPFA 2G0NA 4O2RA 2H1LA 2V6JA 1NL3A 5JHHB 1CJTC 4G0NA 3I92A 3K9GA 3B9PA 3SJCA 3U61B 4XD7A 5B30A 2F43A 4P4SA 3OFND 4C7OA 3UMRA 4HB0A 4DCUA 1U8AA 3SC3A 3NBFA 4Q47A 3I61A 3GJ5A 3VX3A 3WMEA 3L0OA 4B74A 3LBIA 2IYVA 2VSFA 3ND8A 3WHLA 2IS4A 1DAIA 4R98A 4KU4A 3T1VA 4N1AA 2VHQA 2CJWA 3X1XA 3K09A 5EXXA 3B1YA 4W5WA 2AFHE 2BM0A 2J7KA 2HCJB 2V7QA 2GETA 1DBSA 1KO8A 3MWYW 4RJLA 3N70A 1EG7A 4FMDB 1P7CA 3ZZTA 4Q9LA 4NONA 4URVR 1JJVA 1FZQA 1KO4A 1BKDR 3REGA 5EE9A 1NI3A 2QN6A 2D7DA 5DYIA 5DYGA 2KB0A 1HE1C 3NBYC 5C1BA 4FN5A 4TSFA 4QL3A 5KDLA 2F7SA 4GMXA 3H0KA 3PUVA 5HZHA 4GI7A 4BRUA 5JWRA 3EPJA 2GBLA 3BOSA 2ZRFA 3TMKA 3HYRA 4C0JA 4HSEA 3EAQA 4IVQA 5GJVC 1R2QA 3RS5A 3CPEA 2TMKA 3WBJA 4HLCA 4JKYA 1BMFD 4OK3A 1GP2A 1P5ZB 2V54A 2AN9A 4AURA 3AF3A 2AXNA 2UVQA 1XJCA 3QIAA 2FFQA 1DELA 5IT5A 4IOLA 4C0HA 5JCZA 4AIIA 4Q1BA 2P3SA 4II7A 5LB4A 2GCOB 1S0UA 3LX8A 4DUGD 5SZHB 1S8FA 4PAQA 1U0JA 5KOYA 1ZC3A 5EQTA 4BLQA 4DCNA 4MGYR 3K70D 5GJBA 1HTWA 1JI0A 1VYUA 2ZJBA 4ZKDA 2R6GA 3QXHA 2ZJ8A 2DR3A 2VHUA 1OXVA 3SBDA 4Q66C 1XEFA 2ZI5A 3X2SA 1H8ED 3KZ1E 2ZROA 5FR1A 4WW0A 3AKYA 1ZNWA 4A2QA 3VU9B 1ZBDA 2YWFA 3CUEF 4B2IA 2DWPA 4RZUA 1CR0A 2W6IA 2ZRAA 4PAMA 3SR0A 2ZJ5A 1S1CA 3GLGE 1F2TB 4MUBA 4QRHA 2G83A 5E3HA 4D2IA 3WY9A 5EXPA 2C8VA 4DSTA 1GKYA 3FGNA 4LX0A 1T8TA 2AK3A 2Z83A 3VR2A 4C2TA 2ZSFA 3WP1B 1A82A 2YHSA 3J81k 2ZRPA 1OH6A 4TL7A 1NY5A 4NTZA 3U44B 2ZRCA 3HU1A 4BZXA 2ZREA 2GJ9A 1KI7A 1PLJA 2CLSA 2YC4C 4LY6A 3C15C 2JEOA 1Q3TA 3BXZA 5DGXA 2A3RA 3MD0A 3DMDA 2IXFA 3RANA 4DDVA 4A1FA 1I4LD 4PR0A 4HLUA 2CCGA 5JSZB 4PX9A 3DKVA 1FNNA 5EE1A 5G3YA 1YR7A 2MMCA 5CYPA 3BH6A 5JZVA 2H8KA 3EPHA 4M22A 1FX0A 5G53C 3LQQA 3Q5DA 3RC8A 2RAPA 1N2CE 1Q57A 3FKSD 5J40A 3T5GA 4TMWA 421PA 1LNZA 2IXEA 4C0QC 5IK2D 2JLXA 3GEIA 4OK5A 4IRUB 1IY2A 4XJXA 3AB3A 1N6NA 2C77A 1BMFA 2QQ0A 1F2UA 4QHYA 4ZCLA 4A92A 3IQWA 1AA9A 1ZIPA 2ASEA 3QPWA 1CBUA 1FPMA 4WZAE 4BZQA 3QSYA 1PLLA 1GNQA 1B0UA 2XJ9A 1II8A 1ZM4A 1JQJC 2QQEA 4EDHA 4Q48A 3LH5A 4I1UA 1MO5A 1P4SA 1CJKC 4TYQA 1D8TA 3ZVLA 3FDIA 3RABA 4HI0E 4LBYA 4NHOA 3K0FA 4IOKA 5FPTA 3NH6A 3PR1A 2H7VA 6Q21A 4YLGA 3D3QA 3K8YA 1SKQA 1ZUIA 2QA5A 1UDXA 4Q1EA 3DEFA 3H2YA 1HURA 1ZC4A 2JGNA 3CH4B 2RGDA 2WKPA 3CR8A 2C03A 4OQNA 2QSYA 4NYJR 1QBKC 4DDTA 2YYZA 3IHLA 4ARZA 1RJ9B 4NCHA 4RD1A 2XZLA 4A2WA 5DE3A 2OLKA 1G17A 5AUOB 3CKLA 4Q5IA 4MRRA 1KI6B 1XMSA 2ZYWX 5ELXA 4BPBA 2KE5A 1SVIA 4F38A 3R9XA 5P21A 3QXCA 3TH5A 3B13B 3FKQA 2EWVA 3PITA 2WWHA 1W4AA 3TW4A 1A4RA 4QOSA 1HY3A 2IYUA 1PLKA 3G5UA 3OIUA 2RGNC 1UADA 1XXHB 1U8YA 4R9UC 3CR7A 4AYXA 4F92B 3BRWD 5DO9A 3ZDQA 2QY9A 4DLUA 3X1YA 1YR9A 2ZS9A 1J99A 1G8PA 2FF7A 1GVNB 4JBWA 2I4IA 1YZQA 4JSTA 4ZDJA 1Q0UA 2ZR9A 5EP3A 5JCPA 5HPYB 4DKXA 5B2ZA 3SNHA 4NH0A 5D3MB 4A6PA 2ZI6A 2HDNB 4PPFA 4R7ZA 1UAAA 3TUIC 4YDHB 1EGAA 2CMKA 3AVQA 4ZPXA 2J87A 4QBGB 2FEMA 1XWIA 2CHQA 2GHIA 2D4HA 3BFXA 3FKSA 5J4VA 2FZ4A 4LYHA 4QKQA 5KSYA 5LPNA 3EASA 4QC2A 5IK2A 4TMZA 4RD0A 5J4KA 3FWYA 3TSZA 2OSBA 3EIQA 1CRPA 4DIEA 2W58A 2Q6TA 3QJYA 1EFTA 2VP6A 4B2PA 1W5TA 1OYYA 3KTAA 2QGNA 1OYWA 1NMZA 2DHRA 4YDSA 2FH5B 1G16A 1NY6A 2R6DA 3IBYA 5K8IA 1E96A 1SVKA 2A5DA 4I81A 3B5JA 4PAOA 2QI9C 4R71A 1RYHA 2WBLC 4IOMA 2WAYA 4EPTA 5CB6A 2OFWA 2IHYA 1VECA 2REXB 1E0KA 2OLJA 1SULA 3KJHA 4G5RA 3KFXA 2OBLA 3CWQA 4EQ6B 2WJGA 3QF4A 4EPRA 3O8CA 1ZD9A 1Z0FA 2P6RA 2WAXA 3U7GA 4NBSA 2ZRMA 3AF0A 4M8NE 2O8DA 3KXIA 1GZSA 5JI2E 1HT1E 4U00A 2WWWA 4HAZA 3GPLA 5CIWA 2QAJA 1T8UA 3KKQA 2ATXA 1VIAA 1SGWA 3W3ZB 2ATVA 1ETUA 1AZTA 4M1YA 2XTNA 2X77A 1E9CA 4B43A 3IIKA 2XTZA 4Y0VA 1E2GA 1U98A 4KV9A 3THXA 5DI3A 2O52A 4A0RA 2SHKA 3TQFA 2XXAA 1F3OA 1X86B 2V9PA 3FMFA 1H8HD 1QHGA 4ASUD 2FOLA 1LFDB 5FR2A 2ZANA 2GK6A 2FA9A 5CYOA 4LRWA 3TAUA 1ZMXA 3UIEA 3ZGXA 4AK9A 2FPMA 2PZEA 5IRCD 1S9DA 1E1QD 3MJHA 2BJWA 1VIYA 1KK1A 4QHTA 3TR5A 1II9A 3LVQE 2FSHA 5KDOA 3WP0A 3QXXA 1DADA 3HYTA 3OHMA 1CXZA 5JEEA 3G0HA 1EFRA 3UG6A 4B3FX 2BKEA 4M1TA 1T6NA 1QG4A 1EX7A 1SVMA 4PQFA 3ONWA 5LDDC 1ZU4A 2CNWD 4CEJA 2C04A 2I1QA 4G1UC 4QM7A 1E9FA 4LHYA 4OBEA 4GOXA 4WXRA 1XF9A 2C99A 1CJVC 3KXKA 5TB5A 4Q01A 4PXAA 1NG1A 5JMTA 2JJ2A 2OILA 3PIRA 5HE9A 2QTHA 4OHXA 1NIJA 1L2TA 4KFUA 4UNNA 1XTQA 2ODEA 1SXJA 1ZD1A 1FUUA 4M1OA 2RGEA 1OHHD 3DDCA 4X8HA 1W4CA 2NG1A 3T34A 3EIHA 5JI3E 3C5CA 3MSXA 1AQYA 1BS1A 3QKTA 3CRRA 2W0SA 2B8WA 1E3MA 3T06B 5M04A 4C2UA 3BB1A 2DFNA 3HP1A 4FD2A 1IOZA 2GVDC 1FW6A 2IHBA 5CM9C 5CJPA 5FOTA 4TL8A 3QQ5A 1G3MA 2EFEB 2Q9BA 2FJUA 2J7PD 5J5CA 3AP2A 4TZ6A 3TUJC 2IS2A 2CVFA 5CDFA 4TT3D 1IJEA 1K6MA 4JVMA 4MYTA 3DZDA 4AKGA 1N5JA 2D06A 3P4XA 3DM5A 3OEED 2W0MA 4GNKA 3A4NA 3AF1A 4Q19A 1IXSB 1GITA 2DPXA 2G77B 4PSKA 4AY2A 4E03A 2BEJA 5FBWB 1XMVA 2IEZA 2A78A 2YWGA 5AJXA 3K09C 5CDFE 3UPUA 1XEWY 3OIVA 5JBQA 2N46A 2PLFA 3ZD7A 2P6UA 1KSHA 2R62A 1VG1A 4LJ6A 1NJGA 2Q9AA 4B33A 4OQMA 2QP4A 4OQXA 3D7MA 2O5VA 1V5WA 3BB4A 5L3QA 1H8HA 1TF7A 1XCPA 3EWSA 2UZIR 1GWNA 2XITA 4IW3B 4GDFA 5L3VA 3AP3A 1HH4A 2A5FA 3ECCA 5CLQA 2GESA 1GL7A 2JA1A 5JJIA 1HQYE 1G21E 1E1QA 3U3JA 5KNBA 4D26A 3LA6A 4HZUA 1XP8A 1E2FA 2GBLC 1IN8A 1GL9B 1JBKA 1GAJA 4R2HA 4ZI2A 4V0OA 3RLFA 4W5JA 2JLVA 2ZVQX 4M1KA 4I1OA 1XJQA 2IL1A 4B34A 3ZYCA 1KHTA 2VA8A 5FH9A 1YZKA 2BV3A 2E1RA 3Q7PA 3SBEA 3QENA 3W8RA 5HKKD 2CNWA 4QFMA 4LHXA 2QM8A 1COWD 2DYKA 2Y8EA 821PA 2V55B 4KBGA 3RAPR 3LW7A 1RW4A 3HPRA 4LCBA 3T35A 3AVXA 1IN7A 1Z0DA 4NU0A 3IQXA 2J5XA 3FFAA 2P6NA 1ZAKA 4BFVA 3RSLA 2DFLA 2QAGC 4CF7A 4YMUA 4IFBA 4ERNA 1G8FA 1D9ZA 3EC2A 1RKBA 5KO2A 4ACAA 4KFSA 1E9AA 5FTNA 2YC2C 1OHHA 3SHFA 3VR5A 3GFTA 5F98A 4A0FA 4DRZA 1W0JD 3ZQ6A 4JJKA 4TLEA 3T1OA 4ZO4A 4PPGA 3KQUA 3VNUA 4MRNA 1VYTA 3RS7A 3O47A 3OEHD 2E9SA 5KU1A 1IN6A 1NBMD 3IBGA 1P61B 4D0NA 1HV8A 2XAUA 3C14C 1NVWQ 1NKTA 2BDTA 3CH5A 4FMCF 3TBKA 4F93B 3DPUA 4TT3A 1QVAA 4ZDIA 1CRQA 4C30A 2CE7A 4PO1A 4Q1CA 4D0LB 2D2EA 4PZZA 3OEEA 3D31A 4Q7JB 4L9WA 1KKLA 4Q21A 2GWHA 5TY0A 5EUMA 1WE2A 1XTKA 4DLSA 1W4BA 1L4UA 2F55A 1YR6A 4UQOA 3E70C 3AF4A 2IYYA 1D9XA 5TXGA 3A1VA 1JNYA 3ETLA 4M9QA 3R7WA 2XNSA 5AUPB 3M0EA 4IXNA 2ZE5A 4MKHA 3AV0B 2WWFA 4HLUC 4A36A 1NLZA 4P31A 3UWKA 2QBYB 2AKYA 3C41J 2A9KA 2BWJA 4EFNA 5JJKA 2ZYUX 3WMFA 4XVUA 4YMTA 2F9LA 1Z28A 2F1HA 3N5CA 4KSBA 5CK4A 4F91B 1RRCA 3TW8B 1NF3A 2BC9A 2O8EB 1DOAA 1UBFA 4MDFA 1W47A 4A0GA 3T5DA 4JL8A 3FMPB 3NEYA 4AKIA 2P5TB 2YOFA 4EPWA 1ELOA 3TSOA 1SVOA 1RRGA 3TIFA 4E5UA 3EZ6A 4LGMA 2O0HA 1JEEA 1E2LA 2PEYA 2VBCA 1N6KA 4L4UA 4LHVA 3THOA 2ZRDA 2G88A 3JVVA 5UKDA 1A2KC 3IKJA 3K1JA 1K5GA 1Z0JA 3A1TA 4G5SA 2ZAMA 4O3MA 4HAXA 3K0AB 4ZI3A 2WICA 3K9LA 1G64A 4HDQB 1GTVA 3IGFA 4EAQA 5TMPA 1Z0AA 3AUYA 5LB2A 1G20E 4YXWD 4O0MA 1AS3A 5TARA 2J41A 5JLJA 2NQ2C 1DG1G 1E2QA 4ZIRB 1NLFA 2OFXA 2YJTD 1GL6A 2XX3A 3CB4A 3I72A 2XTMA 5CITA 2WWYA 2PBRA 1OT3A 1LVGA 2ZRKA 3VR1A 4URZR 1E2PA 5FUXA 1R8SA 1W0JA 2FZLA 4DLZA 4PHHA 3MAAC 1JR3D 3SJAA 4IFEA 4XWAA 2J0UA 5C4GB 2ODNA 3LBNA 5EP4A 2ZIAA 1XPRA 3BK7A 5FOWA 3V9PA 1F5NA 2YVUA 4OQFA 5EE5B 5H1YA 4EPYA 2ZPTX 4KHZA 4TZ0A 2J3EA 5KSPA 3LX5A 4TTRA 1LS6A 1O87A 2FPKA 2GKSA 5AWFC 3TJZA 4LV8B 4EFMA 4JVSB 4TYYA 4GOKA 4TYPA 3VTKA 4P0TA 1NBME 1NLYA 2Q0HA 3H1TA 1NMYA 2Z5FA 4CT5A 1XDBA 4DT1A 3QNUA 1Y3AA 3DOEA 3NH9A 4FW9A 2XZOA 4M2LA 3U3RA 1R0XA 2HV8A 3K9NA 5B57C 2VIIA 1OJLA 4B76A 1WBDA 2HT1A 2IF0A 1NN5A 2GAOA 4NYJQ 5HTKA 1ZM9A 1MO4A 4ZDWA 4S2EA 4ZDKA 3MWLA 4RD4A 1Z6GA 4CYMA 1TUIA 2NZ8A 2CBZA 5KPJA 3KQLA 1SZPA 1J70A 2G6BA 3AKDA 4MKIA 4BEJA 4OHVA 3AQ4A 1KJYA 2OCYC 1HA3A 3SZRA 5KTYA 2QORA 4PQYA 3NHAA 1NG9A 2WVJA 1KDPA 2HLDD 2ODBA 1Z0KA 1W44A 4IVRA 4IVPA 4MYCA 3U5ZB 2JLSA 1KDTA 1UJ2A 3VR4A 1FUKA 2CHGA 1U8ZA 3QKSB 2IYLD 2OT3B 1IN5A 3N2EA 3QUSA 4OHWA 4EPVA 2E87A 2V1UA 2C78A 1KZGB 2IYTA 2WJJA 4OI4A 3SYKA 3BFKA 1CLUA 2MMGA 1AS0A 2R8RA 3C16C 2ZRIA 3U7HB 1U94A 5CIQA 1PV4A 1WP9A 2VP0A 1W36C 4G5QA 4MH0R 1N0VC 4Z54A 1LW7A 3D8BA 1ZNYA 1WQ1R 1R5NA 2HUPA 4FMBB 5DNYB 2VHJA 3H4MA 3AVOA 4BE7B 1T0HB 1T9HA 4DZZA 1IY0A 3SJBA 2C98A 4RKFA 1MH1A 3P26A 3GLIB 2V4ZA 5E95A 1G5RA 3B78A 2J45A 1O3YA 1JAIA 3CLVA 3UATA 2FPLA 1G6OA 2O8BB 4NYMR 2IS1A 1A5TA 1E2MA 1KAGA 3IUYA 4V0KA 5GVSA 4MGZR 3ZLJA 2A5GA 1Q1ZA 2GCOA 1XZPA 3R9WA 3A36A 1E98A 1JR3A 3RDPA 4CW7A 4M1WA 1GNPA 2OXRA 1M8PA 2QE7D 4LYFA 2NPFA 2GCPA 3ICQB 1QHHB 2ZQ5A 1WA5A 2VLIA 1OFTA 4MKFA 1ONBA 2CJWB 4OL0A 5G40A 1T5IA 4QJ4A 1XX6A 1U0HC 1JR3E 1GG2A 1KO7A 1S9HA 5J47A 2QMUA 4LYAA 1TEVA 1U81A 1OFIA 2BEKA 4UNPA 1TEXA 2A2ZA 3M4YA 1KMHB 4JMPA 1P60A 4C0SA 4PTLA 2FSGA 2FGJA 2GA8A 1ZW6A 2V6IA 3RRNA 3VU9A 4C3ZA 1G3RA 2X2FA 1NKSA 3GLFB 3KKOA 1AJEA 4PZLA 1OF1A 2XOKD 1G7TA 1TQDA 1XNJA 3LV8A 4HAWA 3JZAA 5EZ6B 2IX3A 2NZJA 2ONKA 1KY3A 1JEDA 2GJSA 2OHFA 1F2TA 4NCNA 3GLGA 1T91A 2IYRA 3U3MA 1VYVA 1IAQA 2CK3D 4MDEA 3OF5A 4RY2A 2YOGA 3EZFA 4KAXA 2XEXA 4B44A 2HLDA 2I3BA 2R6AA 3TK1A 3PCRB 2KBFA 3U44A 2C9YA 4QNMA 1RIFA 3VKGA 1SVWA 3OFNA 2HT6A 5AJVB 1YJ5A 1DARA 1P3JA 3Q5EA 4OK6A 2ZM5A 4D82A 2JAQA 5FPKA 1FP7A 1MO3A 1SXJC 1T4GA 5FTLA 2QUZA 2N42A 3W34A 1GRRA 2JDID 1P2TA 2FGKA 1R0WA 4DCVA 3IPYA 4YMVA 4LBZA 2QEQA 5JSZA 1Z83A 1X6VA 3CRVA 4GL2A 1YRBA 2W00A 2R6FA 2XJ4A 2OAP1 2QAGB 1E32A 1KOFA 1Q22A 2PX3A 5FOVA 3V00A 3EPKA 2NMVA 2OAQ1 1RRFA 1TNDA 4JLDA 5KHOC 3U60B 4NZYA 3A37A 1I2DA 2W6JD 4B3DA 2QT1A 4CDGA 1E9RA 2YINC 3JVUA 3HU2A 4AG5A 2XSZD 3OE7D 2CXXA 3Q72A 3QBVA 3BJIC 3CRMA 2ZE8A 1N6OA 3FMOB 3WMGA 4B75A 1E79D 1CR2A 1YKSA 2OEPA 4B3BA 1FTNA 1BYUA 1GM5A 3OIWA 1LV7A 2OM2A 3SOPA 1S1MA 4F4JA 4ON9A 4Z51A 4ZCIA 1IY1A 1ZNXA 1DO2A 2J0QA 3CNLA 3WXMA 1OFUX 1OSNA 4RCZA 1ZU5A 4X8LA 5TDHA 1DAMA 4IDPA 4M0LA 1T0JB 1MRNA 5BQ5A 2FG5A 1WCV1 1FOEB 5JS8A 4AKEA 3U6KA 1K8RA 2G1KA 2XZPA 4NE2A 1N0WA 3IIMA 5CK5A 3TR0A 1OPXA 1QZXA 5L3SB 5FL7D 4KFRA 1DAKA 2VSXA 3HR8A 3L0SA 1UKVY 3THWB 4DUGA 1DS6A 1JPJA 3GJ4A 2ODWA 2ERXA 4CEIB 1UDWA 3KDSE 4F4CA 4P3YA 5A4JA 4KVGA 1XD2B 4DSUA 3ZD6A 4IDHA 4JS0A 1M7HA 2RMKA 4D81A 4M53A 1Z6AA 2XOKA 4OHYA 1H8EA 1KI6A 3ZIAD 1N25A 4PSVA 5G3ZA 4LOAA 4RCYA 1FNMA 1UPTA 2CK3A 3B2EA 4RD2A 5FI1B 2Z6VA 4WAUA 2D3WA 1OXTA 1N5KA 3Q7QA 3KUCA 1M2OB 1NRJB 3EC1A 4JLNA 3BORA 3CF0A 3WRXC 4TL6A 1VG8A 3SHWA 2WOJA 5K8TA 5DSZA 3I1FA 4PHFA 2GXSA 1XXHA 4DXAA 1N6IA 4DVGA 1II8B 4LJ8A 2UZ3A 4QG7A 2GEUA 2ZRBA 2QENA 3TNFA 2BM1A 1ZUHA 2JDIA 1TL7C 1W46A 5TV2A 4M4SA 1OXUA 2HCBA 2X2EA 1OXSC 2WHXA 3LLUA 1XXHE 5D3MA 2PEZA 2P67A 2QP9X 4LHZA 2JIZD 1EWQA 2FE4A 1W4RA 2ANCA 2IXGA 4FINA 5BN4A 1IM2A 2PZGA 3CRW1 2W6JA 5KPDA 4U5XA 4K81B 2H57A 4WVFA 2LKCA 3P32A 3OE7A 1LY1A 3W6NA 1TF2A 2C95A 4B3XA 1L4YA 5SZIA 1VCMA 3FMIA 4D6PA 5HR5A 2AK2A 4BLTA 3EZ7A 3CF2A 1E79A 1KSFX 2HEIA 4FMDF 1XEWX 1TMKA 2G1JA 4GOJA 3B6EA 4YMWA 2NO7A 4UXIA 1RVDA 3TUZC 1ODFA 1R0YA 2IW3A 4FCVA 1ANKA 2OZEA 2WOOA 1FQKA 3VHLB 2Z0MA 4M1SA 5DH9A 1D6JA 3AUXA 1UKYA 4EQ6A 4F4IA 2ZXUA 3GFPA 4YQFA 1K5DA 4DWJA 3KQHA 3EX7C 5G41A 3AEZA 1W7AA 1P6XA 1S4QA 2Q3FA 2VO1A 2ZITA 3WYFA 2VP2A 2RHMA 2H92A 3Q9LA 3U3OA 3BB3A 4B71A 5HZKA 5L8VA 3GJXC 4A4DA 1E2DA 3QVUA 4CEHB 3SYLA 3VQTA 3U2QA 3NIBA 2KWIA 1QHXA 2VP9A 3KX2A 1ZYUA 2IYQA 3ZIAA 3WNDA 3ZQJA 4HB4A 1TU3A 1UF9A 2BCGY 3QOFA 3LQRA 4TTQA 2QPTA 4D0GA 4X8MA 1T3LA 1VG9B 1US8B 2HJGA 1TX4B 3MRSA 1X1RA 1Z3IX 4JL5A 2PCJA 1G4UR 4JVNA 4JKIA 4LBWA 2ZUBA 5FBQB 2O8CB 1NVVQ 1Z06A 4QXAA 3W5JA 4BLSA 2IUSA 2WMNB 1YHNA 4D4KA 1CR4A 3BH7A 3AKEA 2RKOA 3BS4A 5AJZA 3OIYA 1VG0B 4RD6A 2GEVA 2O8FB 2DFTA 4PHTA 4TQUS 3NBXX 5FUVA 3GEEA 1Z6TA 4NYIQ 4BFZA 4LC0A 1ZCBA 8OHMA 4QHSA 1X3SA 1J7KA 2CDNA 2JASA 3SJZA 1W0KD 4US0R 4B35A 5FOSA 4W5HA 2ANBA 2D2FA 4JBXA 4RKEA 1FFHA 2B7CA 4BLOA 2PJZA 2GEDA 1DVRA 4Q9JA 1AN0A 4JT2A 5DISB 1HE8B 2ZI4A 3QG5A 2QTVB 3DHWC 4RSGA 2WJYA 3RS0A 5JWOA 2XXAB 2F1RA 2RCNA 4DIDA 1AQUA 2X1VA 3PFIA 4RFSA 3MG9A 4BRWA 1KJZA 1KDRA 2IYSA 2JLUA 1XCGB 4PPQA 2XGJA 3M1IA 2GZDA 1R6BX 1Y63A 3W90A 4PO9A 2BIFA 2C9OA 1GILA 1YRAA 1E2EA 2X8AA 1G3IA 4QNRA 1Z63A 2HXYA 3L8YA 3T61A 2ZRNA 3C5HA 3A6PC 1KK3A 3ICEA 2Q21A 4CGZA 2ONJA 1E9EA 1S96A 3ADBA 1X1SA 3QY0A 2MSDB 2ZJ2A 2ZRJA 1AS2A 1GFIA 4RZXA 1GSIA 5EJEA 2OCPA 3DKPA 2GAAA 1Z6XA 2J1LA 4HUQA 3CW2A 2R65A 2FU5C 5E7MA 3NHBA 3T1QA 1D5CA 5EUQB 4NP6A 4Q7LA 2DFKB 1XTIA 5A5GA 1WF3A 1ZRHA 1IXRC 3ZS8A 4WOPA 5JFGA 1QVRA 2OCAA 4EFLA 3QG1A 4JLBA 2IBMA 3O8RA 1WXQA 1JAHA 1KO1A 4Y0AA 3TVDA 3VKHA 1E0SA 2GF9A 4TMVA 3CX6A 2HJVA 2RGGA 2FSFA 5EP1A 1G9XA 2Z4SA 3FB4A 3P20A 4RFVA 1F48A 1IBRA 4G3XA 2HF8A 3LBHA 3SN6A 1SHKA 3LNCA 4JJZA 3UG7A 3UK6A 3ASZA 4JL6A 3LWNA 3QXSA 4Q4JB 4ASUA 4NDZA 1UKEA 1LTQA 2VL7A 2ZUCA 1P9RA 1VTKA 3VFDA 2RGBA 1VCOA 3X1ZA 4BASA 1KO5A 1KNQA 1EFCA 5FOXA 3T12A 1KK0A 1IQPA 3I8SA 4BQSA 2IF2A 5FBVB 1E2NA 3CX7A 4TN1A 4TMTA 3I5YA 4L15A 3REFA 3GJ8A 3GQBA 2CVHA 4DB2A 1Q3HA 1E1RD 1PZNA 3NG1A 5GVRA 1W0KA 1X8KA 4TLBA 1RE0A 3AH8A 3RWMB 2DB3A 1OV4A 4AD8A 2Q3HA 2ZAOA 1JQLB 2ZR7A 2EW1A 4RZ2A 1OW3B 1CIPA 1T3HA 2EFGA 3VHXA 1N6LA 3GMTA 1ESMA 4NMMA 4NYMQ 1MRSA 4EKDA 4P4TA 3ZZUA 1R5OA 4OYHA 4A8JA 2G9NA 3H84A 1VPLA 3SE0A 2VSOA 5EE0A 1GKIA 4DLTA 1ZUNB 3RS3A 4B48A 1JPNA 2GXQA 2O0JA 3IHWA 1JXOA 3WNCA 2XB2A 5FFMA 3CZQA 4MYUA 4OI0A 1EXMA 2VYFA 1JXMA 3PEUA 4ESVA 5HCIA 2FFBA 2IT1A 4Q4AB 2LWIA 4KITB 4Q4HB 1KSJA 1KYIA 1J8MF 2J7PA 2VEDA 1YE8A 2XB4A 3UWOA 4N3NA 4L9SA 3KJGA 2VF7A 1CEEA 3KKMA 3KKNA 3SFVA 1G8YA 4M1MA 1EFUA 2WZQA 4JLAA 3WHKA 3VKWA 1G41A 3S1AB 2F1IA 3HU3A 4GZMA 1W1WA 4CVNA 2YKGA 2ZSBA 2P65A 2QBYA 1QG2A 1KIMA 2ZRGA 3W5IA 4PSAA 4XH9B 2D7CA 4O25A 4ACBA 1D2EA 2EYQA 4QJ3A 2J0VA 4Q02A 4QBFA 3FYHA 2JJ1D 2O8EA 2GTPA 3GJ0A 4V03A 2RHDA 4V0ME 3IILA 1G3UA 2WJHA 2ZE7A 3QEJA 1WRBA 1IN4A 3V4FA 2IUUA 2OUKA 3AVPA 4LC1A 5C2JB 4PQRA 4TYNA 1OIXA 2FNAA 3B1ZA 2BKUA 4WBSA 3PUWA 2UKDA 4Q7MB 3I8XA 4HB2A 3MWKA 3TQCA 3F0TA 3AGPA 2B7BA 3W9YA 3U6BA 2FDCA 4ILEA 2FMXA 1LB1B 3CIOA 4EIWA 4KFTA 3FVQA 1Z2CA 3K0AA 1XZQA 2KSQA 1FQJA 2J9RA 4EJSA 3I5XA 5FPHA 1FMLA 1E1RA 3PQCA 4M9ZA 4EPXA 1N5IA 4OJQA 4B6FA 3LXXA 1CP2A 4AC9A 2GZAA 5KNDA 2CL0X 1CTQA 1QDEA 1ZJ6A 1N5LA 3B85A 4X8OA 2QMEA 521PA 4JYCA 4ZIRA 5HKKA 3AVVA 2GJ8A 3U3KA 1COWA 2IC5A 4OJKA 2QZ4A 3R7WB 2C5LA 5GJWC 1FMJA 4BFUA 1E0JA 1UEIA 2NO9A 4IDOA 4L8GA 2WIBA 4P4UA 3VR6A 3KXLA 4AYTA 4DLRA 1E2HA 1H65A 4KLZA 1I4TD 1GRNA 4RZ3A 3K70C 4MUAA 3F3YA 4MITA 5J4HA 2HXSA 3LDAA 5JHGB 4POAA 2IYXA 4KO8A 4LDJA 3CF6R 4XSHA 5B64A 4C9BA 2H16A 3THYB 3AGQA 3CBQA 2VQSA 4GFDA 4B6EA 4DC9A 4Z8XA 2EWWA 4HLDA 3MWJA 5SZJA 1BOFA 3P27A 4DDWA 4LWZA 3L0PA 1P62B 3GLHB 4U02A 1HQCA 3CONA 4Q00A 3OEHA 1NBMA 2QL6A 4D25A 2R6CA 4E09A 3ZVRA 1YQTA 5F2EA 4JZKA 2OBNA 4LJAA 1LS1A 2QMOA 2AD5A 2ZSDA 1MABB 3RNLA 1WB9A 1N0UA 3TE6A 1G4AE 2ZRHA 1G7SA 2CCKA 1VHLA 2FN4A 3IPXA 1RC8A 1W5SA 2CCJA 1NJFA 2CEAA 3PVSA 3B1XA 4MYHA 3VX4A 2CLDX 4DCTA 1Z47A 5KSZA 1XEXB 2WV9A 4US1R 1OE0A 4QBHA 3PXGA 3X1DA 2IA5A 2JJ1A 3QPVA 3I62A 4IXMA 2LCFA 2ZU0C 3E5HA 1B23P 4UXHA 3KB2A 5F9FA 3HJNA 2VRWA 4K8OA 2CE2X 2BMEA 1KAOA 4UNRA 5JJLA 1WMSA 5JRJA 2J0UB 3U4QB 1E94E 4PO8A 4AI6A 1NIPA 3SI7A 1UBEA 2AKAB 4US2R 3B9QA 3Q8XB 4JT4A 1PUIA 2PL3A 3BWDD 1OB5A 2BOVA 3B8HA 5ANRB 1XTSA 4FXPA 1IONA 3V4RA 1ZM7A 1E9SA 4DDUA 2NPIA 3MCAA 4KI0A 2F1JA 3LO5A 2EFCB 3SQXA 3EA5A 3QKRB 3FHOA 2ZI7A 2CL6X 1NN0A 2JLQA 3SU8A 4EUNA 4QJ5A 4Q1FA 5FUYA 3GLIA 1DAGA 1ZINA 3NBZC 3MFYA 1G7RA 2VF8A 1YZGA 2W6ID 4B47A 4PC1A 4UXJA 1KI2A 2O8BA 4JLKA 2W83A 1XMJA 2OXCA 4MQBA 4C4PA 3L43A 5CJ2A 4LHWA 5BN5A 4B3GA 2R2AA 4S35A 4YXWA 1IJFA 2G0TA 2AWNA 2NTYC 3NC1C 3BC1A 4M9XA 3UMSA 3GLIE 2DBYA 1G291 3FHCB 1NVUQ 1Q1EA 1QHHA 3EA0A 3QPUA 3SFZA 2FX3A 2MSEB 1EWRA 4LK2A 3F5FA 2F43B 4P4SB 4Q1AA 1YZNA 2FSIA 4G5GA 5FOUA 1PJRA 4C7OB 1OIWA 3PUZA 3QF7A 5BW8A 1S3SA 3DL0A 3KQKA 4URXR 1E9DA 4DJTA 1TQ6A 2W2TA 4ITRC 5E4FA 5BYKA 1E4VA 2QM7A 5IDVA 2RGXA 3AVYA 3M6AA 3K53A 1KMHA 5C4MA 2X19A 3NVAA 2DCUA 2PMKA 1NSFA 4IKEA 2WPDD 3PJRA 3GLFA 1BH2A 3AM1A 1TPZA 3WYGA 1AIPA 4DLXA 4LJ7A 3NC0C 1M7GA 3SEAA 3SYNA 1IHUA 4WIAA 5GADl 2AX4A 1X8JA 2ZI9A 1J2JA 4B73A 3GLFE 3O8DA 2GRJA 3BBPA 3HDTA 4HUTA 3QBTA 4V02A 2ZE6A 5E7JA 2CL7X
chains in the Genus database with same CATH superfamily
1OASA 4YK7A 2VJPA 2WWVD 2PMBA 1J2TA 5JC1A 5EVJA 4C0LA 1Z8NA 3NTQA 4JUCA 1WXHA 2V1XA 3TVTA 3UTCA 1XTJA 3NOQA 4YRLA 2GDJA 3TZQA 2PRJA 4ZHQF 3PGJA 4HB3A 2Y3IA 3QPAA 4AJHA 4CM5A 1KGDA 3NM5A 2QF7A 1IE3A 4IYRA 4MUEA 4HL6A 3R7NA 1A9XA 4GNRA 3ZCPA 2VK4A 4FIDA 4ED9A 1DAEA 1ZNZA 3ROPA 2QTCA 3I2YX 1F51E 1VE1A 4JI6B 1HZZC 2EFDB 2P0AA 3ADKA 4BKUA 1Z29A 3IQIX 1Y1KE 4BFTA 2DJIA 3NDPA 1IEWA 4TL9A 1NMXA 2H06A 5AICA 2J67A 4C0KA 1BCRA 4K28A 5JDIA 3WX0A 1QV9A 3DXZA 5TPWB 3EMBA 3K0HA 1O77A 1XTVA 1JJ7A 1U1FA 2J3KA 4XCQA 4DBLC 4GPD1 4IXDA 4YLYA 3S4YA 1J56A 4RGBA 4BE9A 5B1DA 5FYDA 1Q7GA 3M89A 2DXIA 4CMIB 1UDCA 3TRKA 4C7MA 3P0HA 1ACLA 2ACKA 2BW0A 3LW8A 1Z5WA 2VF5X 3Q1LA 1QPGA 1G5PA 2ORED 3ESBA 3EQZA 1O97D 5JXJA 3EPLA 1JB1A 3IV6A 3VPSA 3I83A 3S68A 4JLVA 5HKBA 3L1JA 3OKFA 2X40A 1Z6YA 4AUEA 4O5AA 3GLGB 5K8UA 1R8XA 1C1DA 2AG0A 3OA2A 4Q12A 3MTIA 3VRHA 1EK2A 1WPXA 4O4HF 4TTPA 1NV8A 2JLZA 3C4JA 1ZD2P 4CGYA 3IO5A 3CKYA 1W29A 3PC2A 5H0IA 4C89A 3EZ9A 5ELLA 3WLNA 3WYAA 3EZGA 4MQFA 5KTNA 2HTEA 4LDAA 3E9QA 1GU1A 1P9OA 2V7TA 5I9SA 1E5XA 5L3SA 1D0VA 2VHCA 4Q9IA 2C9CA 1NN1A 4KV7A 2GZ2A 2G17A 2L19A 2PWBA 1E2IA 4XX0B 3ZEIA 4X7RA 1QVVA 3Q2OA 1WZ2A 2H9IA 3OCWA 1MAAA 1KZ6A 2EEZA 3BHNA 4GC9A 1JVBA 1WUTA 2ZDHA 3LYHA 4W1SA 5EZ5A 1F8XA 3T95A 2HA3A 3FYCA 4BV3A 1Q15A 3A2MA 3HA3A 1XFDA 3L1KA 3DLBA 3KJFA 2Y9MB 4EJ6A 2GM4A 2I6QA 4QTTB 3FTCA 2Z8ZA 5DM0A 2UUAB 1YVEI 4E11A 1D2GA 1C2YA 2GVNA 3CB2A 3VYUB 5I51A 2V4MA 3N58A 3IOEA 4RL6A 2WF5A 1OGIA 3HHPA 4LZZA 4RJIA 4H60A 3Q85A 4OSOA 1OIVA 1G5TA 4R1UA 2X1HA 4PHCA 5BSTA 2QPOA 3LD9A 2PCLA 2BBTA 3F96A 2QUKA 3M82A 3BGDA 4M1EA 4OG2A 3TINA 4A6XA 2ZYVX 2J5BA 4I1PA 5C8YF 1M2OA 1Q77A 1XVTA 4BHTA 3JZMA 2IHVA 5DNAA 4II2A 2FEXA 1QGYA 4DC1A 5KDDA 2I3ZA 4JWKA 4R8VA 1F9EA 1OTYA 4JXKA 2RGCA 1LC0A 2PKEA 1X2BA 3FNRA 3WICA 2RD2A 4EF6A 4MB6A 1GPH1 5TF4A 3UK0A 4BL5A 4KAAA 2HY7A 1QMGA 5I8WA 1W36D 4NMHA 3E9EA 3BQ9A 2GN8A 3H9BA 1X7DA 5AK4A 1F2UB 1L7NA 3G5AA 3IEIA 5CYFA 3IMKA 1T1IA 1I1OA 2OQ2A 1JG3A 1VCIA 3W5DA 4XWTA 3WIDA 5B6JA 6ADHA 3R74A 4RK0A 2B99A 3VHRA 2I54A 1M8JA 3GMDA 1AHHA 2H54A 3G8YA 2GRAA 4Z4CA 3F98A 2M6LA 2P2YA 4M37A 4RS3A 1J1IA 1RXWA 3F78A 3I6YA 5CYGA 5KYNA 2BMJA 3WTBA 1JALA 1EG2A 3OLYA 4QO8A 3SNKA 3W9BA 4EZEA 5CB4B 4PANA 4M6WB 1E5QA 1BHJA 3FWZA 1N6PA 3FYTA 3EVCA 4F9GA 4F97A 4RULA 3IP6A 3RRMA 4XEHA 4P6VF 1CCWA 2Q2WA 5FWXA 2VKTA 4YVFA 1G8HA 4IHJB 3HWSA 3N8DA 5LZ2A 4WXPA 1FVXA 5COQA 3CSUA 3UAGA 4BZPA 2OQIA 4AW9A 4BLWA 3E9DA 5F7ZA 1N4DA 4E22A 1QHYA 4BNXA 4E08A 3QLJA 1GL3A 4QUJA 1KI9A 1SHZA 2F62A 4B6PA 5JRDS 3RBZA 3SDZA 3LY5A 2FJ0A 2XQVA 3TZCA 3NUQA 3DAFA 3ZDZB 3C45A 2W2QA 1G2IA 1VLQA 4EBFA 2IP4A 4EHAA 4ZTZB 3U3XA 4BECA 3KOYA 2PZFA 5B7GA 4IKPA 3JQ9C 4UNSA 3L4BA 3KU1A 2Z43A 3RK0A 4A8JA 4D9HA 3PUYA 2IUYA 3BM5A 1V3UA 4D4MA 1G9TA 4FNMA 2NUTB 1M10A 3DTVA 1X0XA 4FKZA 2OXFA 2ZVPX 5AYVA 5ILGA 4CEHA 4YI3A 3K9HA 1Y33E 1RQ7A 2A7XA 3MEQA 4JIMA 4U2BA 5FL7A 1XBTA 4IILA 2J3JA 4Q24A 4GZ6A 4ARUA 4TWZA 2JJ2D 3IXLA 2JJ8A 2XYVA 4O5OA 1SQ0A 3RGGA 1QK3A 1X8LA 2J3MA 3OOEA 5AK0A 4B8ZA 4U2FA 2C4WA 1PBTA 1P4GA 4D9NA 2IJGX 5BWMA 1Q1QA 4MEBA 4NOLA 1X39A 2X8JA 3JAKB 2IODA 1QG0A 4R40A 5HGXA 3D3EA 4L95C 4LW8A 5IDXA 2ZS8A 2QYTA 3NW9A 4X66B 3FHTA 1ID8A 3E61A 1RWOA 1IQUA 2GEKA 3ESZA 3H11B 3K15A 2CNDA 2WSMA 4LJYA 3KZKA 4ZFNA 4NCBA 4FMCB 3KWFA 1IATA 3WYDA 3FZQA 1W8IA 1XLVA 2JVIA 2O2DA 4N0PA 4UZSA 2QTFA 4BNLA 5H9VA 3FLMA 1NHWA 2G0AA 3DNMA 3ASYA 3CZ9A 4FCWA 4KVZA 2XVZA 4KMOA 1F0KA 1O6CA 3O73A 4I1VA 5I9BA 4TVBA 4YUVA 5KYKA 5HCNA 3A6ZA 4ESEA 2HA0A 1VI2A 3KQSA 4J16A 1U0RA 4K05A 2FEOA 3TAHA 3VU8A 2PE5A 2ARKA 1XU4A 1XTRA 2QDKA 3PUHA 4D9FA 2FPGA 3WFZA 3PS9A 1CUWA 3I9LA 1W36B 2J5KA 3ILSA 3URMA 1P2FA 3GDHA 4FHGA 1DG3A 2P9GA 5HILA 3RB8A 1SQSA 3VH4A 3AUFA 1E1NA 3AI3A 1VMDA 4KVAA 4JNKA 5EWLA 1A2BA 1XL1A 2ATIA 3HCWA 4L5AA 4Q37A 3QF4B 4NS1A 4DTIA 4MKGA 4JROA 2B83A 4OHPA 4DEYA 1JPVA 5BVGA 2W4IA 3R8CA 1XV5A 3LUKA 1V7QA 1K86A 1UKZA 2BVNA 2XMBA 2O8DB 2CMGA 5G02A 1JJFA 3LFUA 1LSSA 3L6CA 3IUPA 2QOEA 5J1TB 3I9NA 3VVMA 3KWLA 4DXDA 4P3OA 5IKXA 1UR5A 5HF6A 1UXHA 4PYLA 4ALIA 3S5UA 2QB5A 5EIHA 1H9CA 3MZ0A 2VBFA 2ZJOA 2HN9A 2CJXA 3DDZX 1OWNA 1WB4A 2D1QA 2VG8A 4WKGA 4GT1A 1IBMB 2ZT8A 3DBIA 2BEWB 3DPSA 4QRDA 5BWOA 4PC2A 4E7PA 5CUQA 4F96A 4XE5A 3SC2A 1BA2A 2YWBA 3K4HA 4A82A 1FFEA 5HVNA 1GKUB 1ZVMA 2K7ZA 2Z3VA 2IGTA 2NXNA 2ORWA 2XE4A 1X1TA 4H17A 4MARA 5D8DA 1CR1A 4DPLA 1MW8X 1GGKA 3IHKA 3KB1A 2VNIA 2DWQA 2C0QA 3HACA 2XT9A 1YJAA 3GLVA 3S55A 1H2FA 3UICA 5A03A 3NTXA 4LJKA 1GV0A 3KL4A 1Q6YA 2JGKA 4CLHA 3TG8A 2R5FA 5DLQC 4LZOA 3HP7A 3LQ1A 4MZDA 4MB2A 3KQNA 3Q8KA 3HMKA 1G19A 2B21A 1IY8A 4H7JA 3ZS9A 2EZ4A 2P78A 2FCAA 1Q0LA 4KJZA 1N7IA 3I04A 4U8HA 2PX0A 1ODJA 1A27A 4KODA 3ZHXA 2PLNA 5KWIA 3JPWA 2HNKA 1KRXA 2LW7A 2WZDA 3AEUB 3ESDA 4JJEA 2F3RA 3AEKA 3OAAD 3RRXA 1JFSA 4HXEB 1W96A 4IIVA 3DOHA 1RACA 1R10A 5BW5A 1FP4A 5I01A 2PH1A 5HUHA 3HS3A 3DFUA 3JZDA 2I7VA 4GZLA 2DCMA 3PGLA 3CX8A 4MP3A 3QVVA 5FWYA 2VTBA 3F6SA 1G4HA 3T41A 3SD7A 1CKEA 2WU1A 4V0LA 1RBZA 1G0OA 4LFAB 2C2YA 5BWBA 1M5UA 5A02A 5F23A 3FPJA 2B94A 4KE6A 3CJTA 3Q7RA 1UBNA 4WJZA 1TVCA 4PYRA 4XM0A 4G01B 4IJVA 1PR4A 3O94A 4WQMA 3IPCA 2P4SA 4G97A 2DUUA 4G63A 4RGVA 4RABA 5FNVB 3UGQA 4AZWA 5K0FA 4A6EA 3Q3JB 2ACEA 4F85A 1YT5A 4HUQB 1HQDA 4H1UA 1LBEA 1MX9A 2C5HA 3AZQA 5K4HA 2AFRA 2GASA 3ZV5A 4CM1A 1OWOA 3QV1A 6CHYA 2ZIXA 3EY9A 4LAFA 1K9VF 2EP7A 5DGCA 3V1NA 5EIEA 2ZTSA 1PQ4A 2HMSA 2QPLA 2VTVA 3KLNA 3KQYA 4LDRA 5EXTA 1E60A 3G82C 2ZLBA 4V0NA 1D1TA 2A0UA 2DTXA 3FG9A 3QXJA 1AH2A 2MR5A 2X4DA 4IHAA 4B2LA 1ST3A 2OO5A 1UT8A 2JHAA 4CFYA 4M0PA 3PEEA 3R3ZA 4TKVB 3C7DB 1KJ8A 4QIHA 4J7AA 5H82A 5AD1A 3PHJA 4WL0A 3ZVNA 2H2WA 3NAMA 4QDOA 4I5GA 4NNOA 4R8RA 4IIBA 4B7CA 5ESWA 1LLQA 1DC4A 4DSZA 1P7ZA 1ISMA 1L9KA 2IEYA 4U7DA 1U2GC 2UXCB 4Q4AA 3HH8A 4Z1MD 4LOHA 3G89A 4CM4B 1Q21A 4OXYA 5B7NA 4ZT3A 1DHTA 3I6BA 1WUYA 2C5EA 4O2BF 3CX4A 3LX6A 4N5DA 2FOXA 4ZT4A 2EL9A 3BGWA 3GRUA 2WSSD 3IRUA 4ZQGA 5C5DA 1TADA 4H9GA 4FEAA 2HPZA 1TK2A 4HXYA 3C7CB 5LQJA 1OU0A 2QTLA 4ENRA 5LZ7A 3KXDA 1OKKD 3OJCA 4B8YA 1ZN2A 5BRNA 3TIGA 1ORRA 3A27A 2C5GA 2Y99A 2YYYA 1OZFA 2V6BA 3UOAB 4Z49A 1O6FA 4IEEA 4AZ0B 3Q3GE 5IHPA 1M6NA 4Q9AA 2RAFA 1WPQA 5K6AC 1J2RA 4EG6A 4X6YA 3AFNA 4P36A 1J8YF 4GP9A 1HYGA 2YNMD 3MF4A 2K2WA 2ZYHA 1FRZA 4OHZA 4DZTA 5FI5A 5F35A 4E88A 4B81A 3IOYA 1NQAO 1X77A 1E3DA 3W1WA 4RS4A 1BE8A 4RGQA 1OWLA 4FKMA 3NDIA 1DFHA 5JC8A 3B20A 1E6MA 4TMXA 4D79A 3IKTA 1TLTA 1ZMTA 3TS1A 4P7KA 4DM4A 4LY9A 1PR6A 4EFKA 2ZYAA 3KYDA 4LKOA 5DK4A 4JJGA 1DTSA 2QL5A 3WWDA 3ZE6A 3I9OA 3PIIA 3BWEA 2W2PA 4TWJA 2FV8A 2UYGA 3HBLA 1EUYA 3CRZA 5J4LA 3IOCA 3D4LA 2AGVA 4S0ZA 3NWBA 1C4KA 2A35A 4H3KB 5FOQA 3PJFA 3AVUA 1IWOA 4H7HA 4RVCA 1IXYA 2ZRLA 4TWBA 1Z7BA 3DKKA 3NIGB 4UTZA 4FR2A 4LPSA 4NWIA 4MLZA 4DEVA 3CZ5A 5JZBA 2RHJA 1W5BA 1AMOA 1E62A 4WNYA 2X0JA 2QRNA 4BNGA 4W1RA 2AOTB 4C4YA 1KERA 4LZLA 2O3TA 3DDSA 3RS2A 1OOEA 4NESA 3YASA 1WW8A 3AL3A 4L5CA 1ZGHA 2IHKA 2ZPAA 5FTKA 2X22A 1GYPA 1NP6A 2QTWB 1KJWA 2HCTA 1TLLA 1WEHA 1YZLA 3FDJA 3TM4A 3N53A 3N8HA 5EJFA 2ZBDA 3RWOA 5GGXA 1GG5A 2QW8A 1U4SA 3H86A 1R7RA 2VXCA 3BK2A 3A0UA 4XD7D 1UBCA 1G3QA 1U9IC 1DFGA 3ACBA 3THYA 1QIHA 2QZ9A 2VP5A 3IDFA 3C3KA 3VR4D 3ZXIA 4PN7A 1V6CA 1CD5A 1OB2A 4WCVA 1Y5LA 2NIPA 3ENKA 4DMCA 3FUVA 3P9CA 5LBUA 1XJ0A 2HPAA 1LF0A 1OFHA 4WV3A 1DEOA 1JU9A 2G36A 2ZJAA 3B1VA 3GJ7A 3DB2A 1KNXA 3F6YA 4HEJA 2Q99A 3L8CA 3CNOA 3U3DA 2DH6A 1CJMA 1T4DA 2GM3A 3FPGA 4BAGA 4EYSA 5KNCA 2DY1A 2Q46A 2W2KB 1THZA 3JYQA 1EIZA 3TFWA 3CYFA 4D1YA 1MABA 4Y2PA 2X6TA 2NM0A 4D4JA 2ATEA 2PJUA 4DPKA 3WS7A 5C8YA 1XZBA 1M9NA 2OK8A 3LA8A 1FP6A 3NIWA 4KREA 3KUDA 1C3OA 4FEEA 4IBOA 3LAWA 2AZDA 5FTJA 1T1GA 4DGSA 4IUBS 4E30A 2BSQA 4LPKA 4XCXA 2KPOA 4NG5A 4OAPA 1RPJA 1VA4A 1CJUC 1TT5A 2VNAA 3LFTA 4BKOA 1V8PA 4YX9A 2AUMA 1FVOA 3T4PA 1OH7A 3BDIA 1OZAA 3OFKA 2C94A 3GOHA 3AETA 3DGFC 4TSFD 4M7PA 3UAWA 1CB0A 1RYFA 1EFVB 2BCJQ 2XDAA 3G2LA 4I5IA 1O9GA 4FX5A 2IV2X 3IRVA 4AIRA 1UFQA 1QGAA 3Q9SA 4FQ8A 5LQCA 1G6Q1 4WBXC 4F1KA 2A8YA 3B1WA 4Q9KA 3RS9A 4H0NA 1O6BA 3TQIA 1BRMA 1GAEO 1PW7A 2I7XA 2IYZA 2QDXA 3OVMA 4EITA 1OLSB 5JMWA 1L7DA 5KCMA 1KFEB 1V8DA 5JSYA 3D0QA 2GZSA 1B4DA 1V5IA 2DZDA 3KC2A 4H6VA 1JIQA 3FOAA 4KK4A 2ZBEA 4L5BA 5DW3A 3VKVA 5JASA 1ADGA 2B6HA 4QYSA 4QBIA 5JD5A 2JFGA 1P7YA 2WWIA 3QFRA 3L4JA 2JKYA 3I2JA 3RADC 5JNVA 2HD4A 5CT9A 4O1HA 1L7AA 3EVTA 1RYZA 5A1TA 2EIHA 2WIFA 2ZTHA 4G23A 4I2NA 3B5EA 4BJ3A 4Y8VA 1KI1A 3PTZA 1RWWA 3QX3A 4QFBA 1QB8A 3VBCA 3IUEA 1UJNA 2H9YA 3FVVA 2SECE 3IURA 4J2OA 1JHUA 5KNBH 3AERB 4J43A 3UKDA 1TQ8A 3C3JA 3B82A 4AM8A 2PT7A 1IPFA 4J1TC 3E8SA 1VPVA 1Y9ZA 1DC3A 2O07A 2Q41A 2QX6A 3HR7A 4NABA 3WKAA 1S2OA 3I4CA 3EEOA 1T9DA 3S44A 4RIEA 3OY7A 4N7RA 3G23A 4Q3LA 4XIJA 4AKHA 3ETCA 1W9MA 2DPMA 4ETWA 5CAEA 1WHTB 3OFSA 4PPNA 4H16A 4WLVA 3LLSA 2OLEA 4GMFA 4GRAA 4LJ4A 1IM5A 1QUFA 2ZI3A 4YQYA 3SIPA 4DLWA 5BN3A 3UXMA 4L8VA 3T7KA 4D7AA 2V6JA 1UBOS 4MW4A 1UPUA 2O1WA 3QLVC 4G0NA 2OQVA 4EHJA 2ZTVA 3SJCA 3U61B 4RVDA 3S0JA 5KU7A 1XXLA 2X58A 3E7FA 4O1IA 2V3WA 4LFCB 2HMVA 3GZJA 3EH2A 3FWNA 3NHLA 1MNQA 1T24A 1UXIA 3IAEA 3OJLA 4DCUA 4IL5A 1GG9A 1LU9A 1MPTA 5B5SA 2BI4A 4Q47A 4XRRA 3VR2D 3I61A 4OO3A 1NXSA 1SC3A 5E4YA 1NBAA 2VSFA 4XIYA 1CQPA 5IBRA 2CWDA 2QM0A 4Z7OB 4AQYB 1TA4A 3JASB 5IVDA 3OSZA 1L5YA 4HVTA 4C07A 3VTZA 4RXTA 5EL0A 4RM3A 3HB1A 5EXXA 1WO8A 4W5WA 1ZGAA 3WLOA 2AFHE 5J2TA 3NANA 1EVQA 2V7QA 4L0DA 2ZUTA 4DUPA 4RJLA 2VWQA 3T9AA 2PKXA 1EG7A 4FMDB 4NPCA 3LWBA 1W88A 3ZZTA 4Q9LA 3IP1A 5F1PA 4QDZA 3TRJA 5J47A 2Z56A 1FZQA 3N5KA 4BB5A 1BKDR 2I9KA 2C54A 4Y2RA 2Q3EA 3RYIB 1P6UA 1O5TA 2QN6A 3DWFA 1DKRA 1B2LA 2FPSA 3M7IA 3GJSA 4AY5A 1HE1C 4PLCA 3P97A 2V7XA 4FN5A 1MEJA 1SCJA 2F7SA 1U63A 1RBQA 1SCAA 3PUVA 4ZVPA 4PFQA 2Y0CA 1RZRD 2V03A 5JWRA 1DJLA 3FYUA 2GBLA 1TIBA 3BOSA 3KOUA 1L9XA 3TMKA 2WV7A 2IIQA 2D1SA 1YB5A 1W59A 4QLOA 4X20B 3AHFA 4IVQA 2B82A 4PZUA 5GJVC 2Q1TA 3A10A 3TNLA 1PV1A 2ZJ7A 1QOQB 4O3FA 2TMKA 4EENA 4HLCA 4OK3A 5C34B 1GP2A 3AJAA 4JI7B 2F48A 4BBJA 3AF3A 2AXNA 2UVQA 1XJCA 4P2BA 4RXMA 3QIAA 2CXQA 4KWIA 2H59A 1NRIA 1WCIB 2OBYA 4AIIA 4RGYA 4XYGA 2VQ6A 2W4QA 2P3SA 4II7A 3ZYZA 5LB4A 4AMVA 4ETMA 4NSNA 4HO1X 1DT5A 3VDNB 4LVNA 5AJUA 4ZARA 1S8FA 2BH2A 1U0JA 3UNXA 1ZC3A 5EJ5A 2BR3A 3DPIA 2AFIA 5E6RB 1JI0A 1MXFA 4Y0NA 5CHYA 4ZKDA 3QXHA 4PYOA 3ZG6A 3IB3A 1ILWA 5E6UA 3WB0A 4JR2A 1XEFA 1NXQA 4A6DA 3PFNA 1Q7TA 4LQLA 2IPXA 3MINB 2XH8A 1GCOA 1H3NA 4WW0A 3H8WA 3DLCA 1NXVA 3A7DA 3GV0A 4RF4A 4MYDA 3W9UA 4MV3A 1SCDA 4C20A 3QGMA 1RJWA 3ZV7A 2ZATA 2UVDA 1M73E 2DWPA 1CJCA 1CR0A 2BFBA 4PGGA 2ZRAA 2AUNA 3HJGA 4AJ9A 4HV4A 3A6HA 2WUFA 3TB6A 3H5TA 3RC7A 5CIYA 3ZHYA 1SAYA 1N92A 2DX7A 1Z5NA 4FYMA 1RTKA 4GC5A 4I5FA 4J9VA 4YT2A 5MN4A 1F2TB 4D2IA 5KJCA 2G83A 4I9HA 5BP7A 1GKYA 3FGNA 1T8TA 2AK3A 5JNLA 4W9NA 5C3MA 3H87A 1FYWA 2PL9A 2ZSFA 5LLDA 2YHSA 4YCNA 1RP1A 1Z16A 2VJDA 2YC4C 1CWUA 3SEFA 3AUJB 1ZMBA 3CWCA 2WHPA 4OTZA 2JEOA 3FTDA 1E58A 4LXGA 2A3RA 5ALZA 2YWJA 1C1XA 3GPIA 2XV1A 1BGVA 1Z18A 2PS9A 1ZSYA 3PJEA 4A1FA 5IDYA 3NS7A 4KE8A 4UU7A 4PR0A 3U7QA 2TMGA 3V1MA 2ZPUA 3PU6A 1YDFA 3FTPA 4I9NA 3ZXUB 2PYDA 1YE5A 1O6ZA 4UAVA 2GF2A 1GXSA 5CYPA 5ARBA 2I9PA 5JZVA 1R50A 3KM0A 4RTLA 4M36A 5KTPA 3PHGA 4G4JA 3D0KA 2FQXA 1YZVA 3GRZA 2WTNA 1M1NA 3WK7A 3ODGA 1I13A 2JBAB 5IK2D 1KDZA 2GO1A 2FP4A 1R00A 4NV1A 1S8OA 4WACA 3AB3A 3R0JA 4WZBA 3NBKA 5ALYA 1BMFA 3WQQA 5CPBA 2ISCA 2FPWA 4A92A 1ZIPA 2ASEA 3MWEA 1O8CA 4WZAE 2PUTA 4KEAA 4X95A 1S7CA 4BB9A 1GNQA 1B0UA 1DJOA 1II8A 3A70A 4HMQA 3NVMB 2J32A 2NN3C 1R4MA 3LH5A 2EGHA 3KWJA 3Q9UA 3VC1A 4I1UA 4C78A 4FJ2A 5IAGA 1CJKC 2O2HA 4O4IB 4YI5A 1D3AA 3FDIA 3NTOA 3RABA 3WMWA 1V35A 4LY0A 5A6VA 3EBLA 2CL5A 1HM5A 4IOKA 1JG4A 4YJ3B 3G8BA 4X6XA 2O3UA 4EEZA 1YCFA 6Q21A 5GINE 1J1ZA 1V37A 1EP1B 4FFWA 4QUDA 3UT0A 4NEGA 3KDAA 2XNJA 3LT4A 4DLNA 4ZVNA 3B3AA 3V7FA 2B69A 3DULA 4Q1EA 3S3TA 2N3ZA 3H2YA 1VB5A 1ZC4A 3CH4B 1ZXBA 3W4KA 2RGDA 3I9JA 4R1MA 2QN9A 3WG9A 5JNUA 4BJHB 2HEGA 3C3EA 1JYSA 2QSYA 3C43A 1XMOB 1JEOA 1IOLA 4MQUA 1FEZA 3O83A 4XA8A 1R74A 3R7SA 2VNSA 5G4LA 2HU2A 4AZ3A 4DQXA 1G17A 1PN3A 1T26A 4LOJA 4Q5IA 3M8KA 4O2BA 1G6KA 4IMRA 1ZQ1A 2MHCA 1XMSA 1R37A 3R9XA 4RVUA 2WHQA 3I0NA 2W6NA 3QXCA 3TEMA 1HQKA 1ORHA 4D6YA 1YQ9A 2WWHA 1I4WA 3IJRA 3OZTA 3K71B 1P9LA 3HDHA 2QD1A 1TYEB 4FFRA 1IEQA 5B55A 1HY3A 1JQBA 1YOVB 4JP8A 1DX4A 1LTKA 4LE0A 4OREX 2CNKA 3H4IA 5JY1A 1JEJA 4CXMA 3OIUA 3N74A 2XWSA 4YCBA 2RGNC 1UADA 4R9UC 4AYXA 5LBTA 1BQ3A 3CR7A 4GLLA 5J9FA 5JIBA 5DO9A 3ZDQA 4NZMA 3TRIA 5BV1A 2A1TS 4R0NA 2BGUA 1J99A 1U3DA 1VLZA 2DOKA 3KZVA 5K3CA 4QU8A 4KPFC 4JI0B 3KAPA 2ZR9A 3F4BA 3KP1A 3H13A 1GPKA 2YMQA 4DKXA 2W5UA 1T3TA 5B2ZA 3LDGA 1DBVO 3EGEA 4ALMA 2HDNB 1NNSA 3AFOA 4RKYA 3UJ6A 3DR3A 3RYCB 1UAAA 4YDHB 1EGAA 2BY4A 2CMKA 2R96A 3AVQA 3FUXA 2YBDA 5DPMA 4YRQA 3B6KA 3C6BA 1LPSA 2FEMA 4OQ4A 1YONA 2D4HA 3BFXA 3E3AA 3MMNA 4GXQA 4QKQA 5LPNA 1J8QA 2J85A 4BMCA 3FZYA 3U80A 1W30A 4TMZA 2IH5A 3FWYA 3TSZA 3BGIA 4MW5A 1PEYA 1REQB 1UBMS 1URPA 2PT9A 2ADFA 2W58A 3T7SA 6REQB 3ZNNA 2BELA 4UREA 3R7AA 1MUUA 3QJYA 4ONEA 3QLTA 4Q3CA 4B2PA 2Q7XA 4P53A 1OYYA 1IMJA 1JL3A 3EHEA 2B5OA 1LK0A 2DHRA 4L51A 5HUQA 1G5FA 1E6KA 2GEJA 5K8IA 1N3LA 1E96A 1WMDA 3ZXSA 4PAOA 5IP5A 1Z7WA 4R71A 3TW6A 1QE5A 3L02A 3OTIA 4EPTA 3OIFA 1G8MA 4F3NA 3CRNA 3EXFA 3KD2A 1ADJA 1NUHA 1H42A 1TLFA 1XQ1A 2EKQA 4GM0A 2XUGA 3UVEA 4EPRA 3K2IA 5LQDA 1ZD9A 3FN4A 3N8KA 2XDQB 3SEQA 5JCXA 4J76A 3IL2A 1V7PC 2WE7A 4NBSA 2GN6A 2ZRMA 4XDHA 4M8NE 3CLKA 4P7FA 3FDZA 3OD1A 3Q6IA 1JLMA 1GZSA 4R3NA 2XUZA 2EDAA 3FZEA 1ZOPA 2WWWA 2VJCA 3COSA 5CIWA 3F5QA 1T8UA 1X87A 3GPLA 1N9GB 3H5AA 4MV1A 1QYCA 1AZTA 4M1YA 4RHUA 4RV4A 4B43A 1ZR4A 4AO8A 1B7GO 5H80A 2W6PA 3OM8A 4KV9A 4N8DA 3TTYA 4EJ0A 2XCIA 1QGED 3BGSA 3H2SA 2LGJA 2R00C 2O4UX 4BNKA 1J22A 2GZMA 4JOQA 1SVUA 3RGWS 5A0TA 2P79A 2GK6A 3FAZA 5JCJD 1EEHA 5LP6F 4TWAA 1BMQA 4E46A 1NF2A 3C6MA 1UXGA 5B1IA 1K75A 4KGDA 2PZEA 1VJ5A 1S9DA 3HCPA 3MJHA 4LRYA 4R84A 1KOLA 1PF7E 2DP4E 3KKLA 1II9A 5JD6A 1HR0B 2O4CA 5JOQA 4G09A 3WP0A 1Q3KA 2BUCA 3RSGA 1UP7A 1YI0A 3LCUA 2G04A 1DADA 4V3BA 3HYTA 4X3OA 3NT2A 3DYIA 3WK9A 1NFRA 4O33A 2AOUA 4CM9A 2FPIB 1U80A 2IXTA 4ENVA 1GY8A 1QG4A 1EX7A 1J09A 1T6NA 2EJTA 2Z9BA 5HUJA 1ZWLA 1PQPA 1L3CA 1ULUA 2JGDB 4TKUA 1A9TA 3E18A 2BEVA 3AINA 2JI6A 1XELA 3HBMA 3KQVA 3LCCA 4ND2A 4OBEA 1QE0A 5ECYA 5T6BA 3AY6A 3IQGX 4WXRA 2C99A 3S70A 1TEZA 2UZAA 1W8DA 1MH9A 2IP1A 1NG1A 5K51A 5JXGA 2XUFA 1LWOA 3PIRA 1RI3A 1RXSA 1EUQA 1L2TA 4KFUA 2AJCA 4YJFB 5TX7A 4UNNA 1XTQA 2CLHB 2ODEA 4FUTA 4M88A 2QY6A 1VM6A 1FSGA 4KPUB 2H00A 3OBIA 3SIRA 1OHHD 2YX1A 4C87A 1W4CA 1V41E 1VRWA 3T34A 3EIHA 2DWCA 3C5CA 2XMQA 3MSXA 3DBRA 1AQYA 1TZJA 2YH2A 3AYXB 4C2UA 4LOKA 2HA5A 3ZZ1A 5A9RA 2AFVA 2ZJ6A 1IM8A 3FPHA 1IOZA 2BZGA 2GVDC 1FW6A 2IHBA 5CM9C 5CJPA 2WU3A 3WLMA 2YUIA 1Z75A 1ECFA 1LI4A 1ORTA 2CLKB 4IH4A 3W77A 2F3SA 2JGAA 4GSKA 4P58A 3PQFA 1IJEA 3F7OA 3M83A 3TQHA 3VNRA 4GM4A 3DZDA 5ECGC 1SKAA 3C3DA 1SCKA 3H9CA 3NFYA 821PA 5HM8A 2RHBA 3D59A 1DRUA 1MAUA 2HIAA 3KZOA 3A4NA 4PXYA 2YJGA 2VT2A 4PSKA 5E8JA 2C4NA 4AY2A 2O6HA 4OFBA 2IEZA 2A78A 3N0WA 1DKQA 1H5NA 1OY1A 1YDMA 3AHGA 4MMZB 4MVJD 4UQLA 3EGCA 2NP6A 1E7RA 1L8OA 5KC9A 2BD0A 2N46A 3WWOA 1TMOA 2PLFA 3ILXA 2DF8A 2QT9A 3H9GA 1KSHA 1MP0A 1NAIA 3JXEA 4KN9S 1Z4IA 2EF0A 1SBCA 2IQIA 2FMUA 2R85A 3E3LA 4UD6A 1GLVA 3PNKA 1C0IA 2CDBA 4WFIA 2ICAA 2X42A 3W2IA 3C98A 2RK6A 1NATA 1WAMA 3D7MA 1JDPA 3GJTA 4RPIA 4WK6A 2YXPX 1PEAA 3FW1A 5U4QA 4MIYA 4J7XA 1GWNA 3BYZA 3E2MA 4IW3B 4Z7JA 4GDFA 5L3VA 3AP3A 3I5MA 1Y3BE 4WFJA 3ECCA 4W5OA 5HK8A 4G26A 2QRKA 3JQ7A 1Q84A 5BRJA 4C0XA 1JG2A 1EPUA 1XZEA 3FSJX 2ASVA 5CH8A 4EYOA 4D26A 1YK0A 1YF3A 2P9CA 5JAZA 4B46A 5F3DA 4MA0A 3ZEAA 4W5JA 2WFMA 1SD2A 5AW4A 3H65A 3F6BX 4KN5A 2IL1A 3PZRA 3VZDA 3ELWA 2X0FA 2CEKA 2VA8A 4OX9Y 3JTEA 2GNAA 3FPCA 4RF2A 4JB0A 1YZKA 1BWSA 2BV3A 3AR7A 2WKWA 2FMKA 3QVOA 1Z2EA 2Y1EA 3RRJA 5CVTA 3EIFA 3DCYA 1PR0A 3W8RA 3UBTA 1A4IA 1K7CA 2JFZA 1COWD 1TVKB 5BVHB 4UUMA 4KBGA 2YRXA 4GSLA 3RAPR 3COWA 4QYWA 3JWEA 1CVLA 1P0QA 2ENUA 2PN1A 3GZTB 4LCBA 3T35A 3U9LA 4ADSG 4YCLA 3I9V1 1KS2A 1Z0DA 2FR0A 3IQXA 2HFJA 4NU0A 4GI3A 1QYRA 4B4WA 1WVIA 4BFVA 3MWDA 2Q1YA 1XZHA 2N47A 4TX1A 3TCXB 5KO2A 1LXCA 4NBUA 2ZSUA 4IQ0A 4ACAA 4KFSA 5FI3A 3HVIA 2HA6A 1JV2B 4JK3A 4KIUA 4GBJA 1PJAA 3AR3A 4GR9A 1VXRA 4KP7A 1MQ8B 4L8LA 4WY8A 5E2AA 1T13A 3VR5A 3H0CA 2EQ5A 2WFZA 3IV9A 4A0FA 2JVJA 3Q11A 4GPAA 3PGXA 3G5LA 4CI9A 5K0GA 2C3UA 1W0JD 3C6YA 3ZQ6A 4GEKA 5TR9A 1R66A 4GI2A 4Y7CA 4PPGA 4ZO4A 3PKJA 4ZYLA 2BHLA 1V0JA 2QTZA 1Q0PA 4HDSA 4C6TB 3DBVO 4DYDA 2UU9B 3IBGA 1P61B 2YVLA 3NEPX 1HV8A 1TYBE 1NVWQ 5I5EA 4YJGB 4C7BA 2QMQA 1TO1E 1NXWA 1V95A 3TBKA 4BNDA 3GHHA 3A3YA 5B53A 4ZDIA 5ALMA 1CDOA 1K06A 3EF3A 1X0VA 5BXYA 4Q1CA 3PWSA 4KQHA 2D2EA 1ZY2A 3ZWOA 4MQ5A 4PZZA 1E6WA 3ZHSA 5I7EA 2PUGA 4P80A 3L18A 4Q7JB 3CXUA 1C7FA 1N36B 3VH1A 3JQ6A 4NJOA 5JQGA 1H0SA 1Q0QA 3FPKA 4OQDA 3N6RA 3RK1A 2W6CX 3HO1A 4NJMA 1W1IA 1NE7A 3BMXA 5TY0A 1QFYA 2JAOA 5DRYA 5IM4A 2UXDB 4ZK6A 1YR6A 1DUVG 4Q6WA 2A84A 4UQOA 4UTPA 2G76A 4BIIA 3SX2A 4HVLA 1GCIA 1YS2X 2EXXA 2VDWB 2W2LA 4KQ9A 3A1VA 3WFIA 3ETLA 3R7WA 3DBLA 3P9KA 4UUOA 4X90A 4NFHA 4C14A 4RX1A 2VN8A 2NV2B 4CRWB 1Y1PA 2WWFA 5JPIA 4YBZA 1NLZA 1FMTA 1MIOB 4MVJE 2GLXA 2A9KA 4WXHA 3DDNA 5JJKA 2ZYUX 2BE7A 2HIMA 2HK8A 2PX5A 3N5CA 5CK4A 2BFCA 1RLMA 2FX5A 3PNOA 1XI2A 2BC9A 3GX1A 3IAM1 2X5JO 3GBSA 4HUJA 3WLAA 3UUFA 1W47A 2JIOA 3TTVA 1ORWA 4S1WA 2CXPA 2P5TB 2JIPA 4LZNA 3TSOA 1CNFA 1SA0B 1KVQA 2XE8A 4UUNA 4E5UA 1RXUA 3OPNA 1QC5B 1J20A 1E2LA 1JEEA 3GGOA 1Q95A 2NO5A 5TVGA 4LHVA 4OQEA 3PGMA 3HSSA 1G20A 2V9CA 3F2IA 3THOA 3B8EA 4DQDA 2ZRDA 1AO3A 2G88A 3OX3A 3U4IA 4A8HA 1DKLA 1DRVA 2OHVA 2WT4A 2B35A 4NFSA 5ALPA 1IG3A 4O3MA 3A1TA 1OVGA 2OM6A 4D3ZA 4HAXA 1CS0A 4QOHA 1SOMA 4C1NA 2G40A 1RMQA 4HDQB 1UH5A 4YUZA 2F8LA 5ABPA 6LDHA 4UQPA 3CKKA 3T5MA 1G2OA 1Z4KA 3GBPA 3TAXA 4YXWD 1ZVKA 4ZICA 1L5O<