2CCGA

Crystal structure of his-tagged s. aureus thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
202
structure length
202
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of S. Aureus Thymidylate Kinase Reveal an Atypical Active Site Configuration and an Intermediate Conformational State Upon Substrate Binding
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 87
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ccgA00
4MKIA 4YC7A 2ZSAA 2IWRA 2V6IA 3L8YA 1SVSA 3K70B 5KPJA 1OIWA 2KE5A 3RWMB 4QOSA 1GNPA 1VHLA 3RS5A 1TTTA 1S96A 1UKZA 4KFSA 3GLIA 3V4FA 1LTQA 3VX4A 1E2HA 3QJYA 2PZGA 1F2UB 4IEEA 3FOZA 2GAAA 1TF2A 5FPTA 1KSHA 4Q9IA 3QEOA 2ANBA 1G8PA 3UMFA 3X1YA 2C8VA 2BCJQ 2FGJA 3TSWA 1XEFA 4GBMA 3IO5A 3UMSA 4DVGA 1L7VC 1E2DA 3FHCB 3A1UA 2KJQA 5JS8A 1AGRA 2REOA 4ACAA 5DIFA 4LJAA 2ZROA 1XTQA 1EWRA 3EWAA 1OH7A 2CL0X 3VFDA 3QF7A 3PG5A 3B82A 5EXXA 4HZUB 4KVGA 3WMGA 3KQHA 4LBYA 2J0SA 3JZMA 1TF7A 1WQ1R 2B21A 2IHBA 3LNCA 4C0KA 3NIBA 2Q3MA 1OJLA 2FV8A 2R65A 2PX0A 4HB4A 1OLOA 2ZVPX 2J87A 4LC0A 4NDZA 1R5NA 4BFTA 2WJYA 4PHTA 5SZIA 1Z5ZA 4B74A 2IHYA 5B30A 1BIFA 3THYA 4TTRA 1GG2A 2WKQA 5FUWA 1H8HA 3W6NA 4YMUA 4Q7JB 1AS0A 1MH1A 1IXZA 3W8RA 1XPUA 1E2IA 1WDTA 1Z6XA 2W58A 3GLHE 2ZREA 1UBCA 2GNOA 2JATA 2WKRA 1RC8A 3RVBA 4NU0A 1N6KA 4FD2A 3X2SA 5HE9A 1NSFA 4GT1A 4PQYA 4OBEA 4JL6A 1L8QA 3QQ5A 4A15A 2VA8A 2G1JA 1U0LA 1GILA 1G9XA 1Z6TA 3KQUA 1VYTA 1SZPA 2RGEA 4B6FA 5CB6A 3BJIC 1PLLA 3OEHA 1LW7A 1SVMA 1LB1B 3NH9A 3K70C 1NI3A 4H1UA 2NPFA 4EPXA 5EE3A 1COWD 1HE8B 3IIMA 3QXJA 4HB3A 2IF0A 5JLJA 1E2QA 4Q4HA 3RANA 3KKNA 1ZUHA 5FR2A 3EPHA 5KNBA 1CULC 1W0KD 4PX9A 1JJVA 2Z5FA 1W5SA 2P6UA 4C0HA 3FTQA 1GFIA 2OE2A 5FI1B 4URXR 2ATXA 4B44A 4BFVA 1G7SA 1P6XA 5K8IA 4XWOA 1W4CA 1ZNWA 3L0PA 4I1OA 4LI0A 2JLWA 3AGQA 2O8DB 3TUJC 2VP9A 2JLYA 3PEVA 1NBMD 1TQ6A 4V0NA 5FBQB 1ZUNB 3LBNA 4PR0A 3P26A 4M1MA 3RS0A 4E09A 4KU4A 2JJ1D 3AKCA 4JVSB 3U6BA 4CEIB 2C95A 1KK2A 3TUIC 1ZM2A 2BM1A 3EA5A 1AM4D 3B60A 2CL7X 1Q12A 5G40A 5KNDA 3IHLA 2ZR0A 4QNRA 2TMKA 1II9A 1TL7C 3R8FA 1E96A 2PJZA 2AFHE 2AD5A 1WA5A 1FPMA 4WOPA 1NLYA 1FTNA 1EFCA 4BWYA 3T12A 5KPDA 2CHQA 5GADl 4TLDA 1Z22A 3C5HA 1NN0A 4NCNA 2O0KA 5CK4A 2WWFA 1RRCA 4M1TA 2FFHA 3AVQA 3DDCA 2QPAA 1FUUA 4Q01A 3X1ZA 1FZQA 1UBGA 5JFGA 2GJAA 2O8EB 2WJIA 2WSSD 4RY2A 5D3MB 3LAWA 4IHQA 1WBDA 2EYQA 3KFVA 4BFYA 2RCNA 1RJ9B 4OHYA 4KYIB 4Z1MA 1KAOA 4TL7A 1XD2B 4PPNA 4DSNA 2ZRNA 3GLFB 3CWQA 3E2IA 1S2MA 3CKLA 2ZRCA 5BQ5A 1TQ2A 2O8EA 5FUXA 4X8HA 4NE2A 4QC2A 2DHRA 2OV2A 5DI3B 4DC9A 1VECA 4PANA 1MT0A 3BOSA 3KXKA 4A36A 1MRSA 2L0XA 5H68A 5L3VA 4PO8A 4LBVA 3KB2A 1J8MF 5ANRB 4Q48A 3OEED 2QP4A 4JVMA 5C18A 3KDSE 1GKIA 4PO1A 1NVWQ 1G3RA 1AS3A 4Z54A 1XRJA 4KHZA 2WSMA 1GDDA 3FWYA 3B7GA 4AI6A 1VCMA 1R0WA 2GA8A 5KTYA 3DVLA 4LYHA 2PZFA 4NCKA 1J90A 1XCMA 3CF6R 3V9PA 2OAP1 1IY0A 2FE4A 2H1LA 1XTIA 1ZD8A 2GK7A 4CF7A 2V8OA 4DIDA 1OV4A 1MO6A 4BEJA 2F1JA 2B92A 3HJNA 3RHFA 2EW1A 4M1SA 4PHGA 2ORWA 1XTSA 1ZM7A 3Q8XB 3ZS9A 2AKYA 4EAQA 3NBZC 4G5GA 4X8LA 1VCOA 4IDPA 2BBSA 4BFWA 2BV3A 1Z0AA 1TMKA 4A2QA 4MRPA 4KCGA 1NNEA 3T5GA 4CEJA 1W46A 2X77A 1E1RD 3EPLA 3LV8A 1ZC4A 4B3FX 3THYB 3THXB 2D7CA 4D4KA 1GWNA 1DEKA 1DAEA 2EFHB 1E99A 1E1QA 1ZD1A 2IBMA 1WB9A 2FFQA 3ZVLA 3LH5A 1N6OA 2BMFA 1YR8A 2R8RA 2CXXA 3REGA 2YOHA 4DLUA 4HAVA 1KO4A 1MO4A 1ZYUA 5J5CA 1GUAA 4QHTA 2XSZA 2A5FA 3Q9LA 1AQUA 5FBWB 2LCFA 1GSIA 2V6JA 3ND9A 2YHSA 3LDAA 3ADDA 1EX7A 1M2OB 4G3XA 1VIYA 2NG1A 2NZ8A 2F3RA 3LVRE 1US8A 4ZO4A 3T61A 3IBGA 1WMSA 3BC1A 1UADA 1IJFA 3CR8A 3K9LA 1CIPA 2BKUA 5FTMA 3AVUA 4BFZA 3SBEA 3WY9A 4XWKA 1M7BA 2REBA 2XZOA 4TLBA 1DELA 4OJKA 2YWGA 1XZQA 4RKFA 4V0MA 1JPNA 4Z1MD 5KO2A 4ARZB 4CRWB 3EPJA 1E9AA 1KJWA 2JDIA 3UG7A 2VHCA 2WPDA 5DISB 3FMIA 3KXIA 1Y63A 5AUPB 4JKIA 4PPFA 4XSHA 3EC2A 5GVSA 1PVOA 2A3RA 5JRZA 2CL6X 1XXHA 5BXQC 1VHTA 4LDJA 2C99A 3I5XA 4AYWA 3GJ8A 4MKGA 4B35A 3A1TA 4HLUC 3GD7A 3NXSA 3DMDA 2PCLA 2XOKD 4AKHA 4KODA 1Y3AA 2C9CA 4F4IA 2GWHA 1KK0A 3QG1A 1TPZA 1KI6B 1X6VA 3QNUA 4OKSA 3TLXA 3QXSA 1VG8A 4EJSA 1E32A 1XEWY 1Z0IA 1PUIA 2GRJA 4GL2A 1G6HA 2R6CA 3K0CC 1U0JA 3OEEA 5TXGA 5B58C 3SYLA 4XTRA 5F2EA 4ZV4A 5KYKA 2JLUA 4KFUA 5JRJA 4I81A 4DEXA 1XEXB 5L3SB 521PA 2WJHA 3AGPA 3A4MA 4TYPA 1Z0JA 2X2EA 3KKOA 3OE7D 5FPSA 4P4TA 4B71A 3IKJA 3PUZA 1IHUA 3CRW1 4W5JA 2A78A 1ZU5A 4URZR 1Q1QA 3NBXX 4ON9A 4DDUA 2QMUA 2CK3A 5HCNA 4D4MA 3MWYW 4IEIA 4ITRC 3P27A 4FMDF 4X8OA 2I1QA 3U3OA 1S1MA 1FNMA 3RSLA 4C7OB 5FI0B 2ZRGA 1JJ7A 3RWOA 5HZKA 1D8TA 1ZCAA 4QG7A 4IVPA 121PA 1DPFA 2HLDA 5B64A 4HLDA 2XAUA 3QKUA 4QFMA 3B13B 3K8YA 2A7QA 1CEEA 4TYNA 3ADBA 1KMHA 2XXAB 2DY1A 2JJ2A 3CPEA 4FWIB 4YXWD 4HEJA 4LBZA 4AKIA 2NO7A 2PMKA 2OCAA 1J2JA 2BEJA 3GJ6A 3WP1B 4XTCS 4FCWA 5AR1A 1T3SA 4IOMA 4LJ4A 3K0AB 4NYJQ 1ESMA 4RZ2A 4DDVA 4TYYA 4PHHA 5TMPA 5FOXA 1XTKA 4P32A 3CB4A 1E9RA 1FP7A 1PZNA 1WRBA 4GFDA 3M0EA 1CS4C 4K81B 3QSYA 3LD9A 2FFAA 3VKWA 5DI9A 4XIGS 5EXTA 2OZEA 5M04A 2JJ2D 4M9XA 5CM9C 4NHOA 4Q4JA 2JCSA 421PA 4POAA 1U9IA 3ZJYA 3RC8A 1YZGA 3VR3A 4U00A 2DFLA 4TSFD 3GEHA 1DVRA 1ZM3A 2AX4A 1KOFA 2AD1A 4I1VA 4QGHA 3AF2A 1LF0A 1AZSC 3B1YA 4Q1DA 2ZI9A 2C96A 2BKEA 5BYJA 4BECA 4O2RA 4LJ9A 3PXGA 2J46A 5KU1A 4MA4A 2OCPA 3A37A 5DHFA 2IS4A 1D2NA 4GOJA 3I5YA 4ZCLA 2O8DA 4QJ5A 3WYGA 1R0ZA 1DG1G 4QBIA 1Q44A 3NG1A 2GJSA 3NVAA 3AKEA 4RCZA 4QM6A 4ZIRB 1X86B 1KK3A 4C9BA 4B76A 4AD8A 1EWQA 3AB3A 5G3YA 2RHDA 4C30A 2HF8A 1QHSA 1S4QA 2G1KA 3LLUA 1QRAA 1L4UA 1T9HA 3KQLA 2OBNA 2E87A 5J4YA 3KUDA 4DZZA 2KBEA 3GMTA 4ZI2A 4EQ6B 2WOJA 4EPRA 4HDCA 4PAOA 1N0UA 4QM7A 4LV5B 3C4JA 3TAUA 1P62B 5FBLB 2J7KA 4Q7MB 1ZW6A 1M7GA 2IT1A 4V03A 1XP8A 1CR0A 5JI2E 4OI0A 4KAXA 2C77A 2RGNC 4G5RA 1JNYA 1UKEA 3NDBB 2ZI5A 1FOEB 2QENA 3B78A 5J40A 1XJ0A 4MRRA 1E9CA 3QPVA 1YZLA 5DSZA 2P2LA 4JLOA 3AVYA 2ZUCA 4MITA 3MJRA 3A8TA 2V3CC 5EP2A 2O8BA 2SHKA 3ZIAA 5HKKD 2W6IA 4IFEA 3THXA 4LJYA 4PSAA 2F1HA 1IOZA 2IYRA 2QPTA 4IFBA 1E2MA 2FN4A 4P31A 3SJAA 2ZU6A 5J4LA 2V7QA 2W0SA 3VAAA 4AG5A 3O8DA 3GFOA 3QXCA 3QKRB 2BOVA 5IK2A 3K0SA 4HI0E 4FCTA 4CEJB 5CITA 3VU9A 1T6NA 1KSGA 3IO3A 4HLCA 1ZNYA 5KOYA 2N42A 1MOZA 5FTKA 1UPTA 2VL7A 2VP4A 4U02A 1AGPA 4XOIA 3SOPA 2FA9A 5KSZA 2GJKA 3T1OA 1OXUA 2JASA 4ZKEA 3TVTA 2HT6A 2BM0A 4LJ6A 4OK6A 2JLXA 4G5OA 5H8WA 1NN5A 3U5ZB 2IYQA 4BFXA 5EZ6B 4OHZA 3HPQA 4HB2A 4EFLA 2LWIA 3A1SA 3I61A 2WIBA 2WVJA 3A6PC 4EKDA 3HYRA 3B1ZA 4BPBA 3REFA 3KXLA 2YC4C 2R6GA 3AF1A 3BRWD 3WXMA 4MDFA 4US2R 4JIMA 2OESA 2ZRFA 5J4VA 1S3GA 3GFTA 4Q9LA 2RHMA 4CGZA 4KXFB 1FW6A 4GZLA 1U9IC 2YZ2A 5EP3A 4M9QA 3W3ZB 4KFRA 1KKMA 5JMTA 2PX3A 1SKYE 1HH4A 2WMNB 3GPLA 2V1UA 1Q0UA 4KI0A 4TN1A 3WMEA 2REXB 3TH5A 1KY3A 3I72A 4NYMR 2IW3A 3ZS8A 3SC3A 1KHTA 1P72A 1XU4A 3QUSA 3R8CA 2GEUA 3PEWA 4I99A 3GCGA 2F7SA 2J1LA 2GEVA 4HAXA 4XVRA 4D80A 3K09A 4L15A 4NYIR 1TX4B 4C0BA 3U4QB 1JB1A 1SULA 3SR0A 4JLAA 1IQPA 4U7DA 3GLGB 4ZDWA 3MCAA 1FX0B 1G20E 1WP9A 4LPSA 1GM5A 4QGAA 2GZHA 2EWVA 2QBYA 2JIZA 1I2DA 4QGFA 3IUYA 4XWAA 3UMRA 3UPUA 3ONWA 1X8LA 2DR3A 3TR0A 4A92A 5FOTA 2N46A 3AF3A 4P4SA 1C4OA 1Q21A 2OBLA 1IN7A 2BBOA 2ZEJA 2IEYA 3SYNA 4IJMA 5BN5A 3ICEA 2P67A 1E98A 3TBKA 4RFSA 4WIAA 4M1KA 1U90A 3ND8A 2IXGA 2GXAA 1MABB 1N5IA 3B9PA 2D06A 5KDDA 1KI6A 3QI2A 4D4JA 3UWOA 3FFAA 4D4LA 2C04A 2ZQ5A 4N0EA 4R7ZA 3T1QA 4MYUA 1FP6A 2J0UB 1P75A 4Y0VA 4QXAA 3SDZA 4LHVA 4W9MC 2Z0MA 2KBFA 1R0XA 4JLNA 3WRYC 3GP8A 1TF5A 5JCPA 1EESA 3CZPA 2CLCX 1YE8A 2UZ3A 2ZS7A 3G82C 2OILA 3AVTA 3B1WA 2AWNA 3WYAA 4I1UA 5FL3A 5FR1A 2WM9B 2JJ1A 1VIAA 4A2WA 4ARZA 1RJ9A 2O52A 3IBYA 4AIIA 3FFBA 2QUZA 3RS3A 4LYFA 1N3BA 4B3BA 1Z0KA 4RD2A 4P4SB 1W48A 3DO6A 1KSJA 1BMFD 3TJZA 4TMZA 1Z0DA 3TKLA 5KDOA 3RS7A 1X1RA 1IM2A 4GI7A 3JVUA 4JSYA 1YU9A 2ZM5A 3K70D 4F93B 4K8OA 5LBIA 2OUKA 3DZ8A 1ZUIA 2WSSA 4PC7A 2F6RA 4GZMA 1ZIPA 2Q9BA 1S9HA 1N6HA 3I92A 3GJXC 3RSOA 1KNXA 2FJUA 2ZJ8A 3PVSA 4Q03A 2BJVA 1DARA 2WWXA 2QORA 4M1YA 2BC9A 2Z83A 2O8FB 3I32A 4NP6A 2FPMA 2QTHA 3QPUA 4EFNA 4C2UA 2GXUA 4M9SA 5EE1A 3C14C 2ANCA 1LNZA 2DFNA 1OXVA 4HZIA 5FBRB 1E9EA 3C15C 3FYHA 2C5LA 1KYIA 2IYUA 3AUXA 4DRZA 1GRNA 2CJWA 4JLPA 4BFSA 2VP6A 3C5CA 2DB3A 1IBRA 4JVNA 5DLQC 4GMDA 1H8ED 4TQUS 1A2BA 2ZANA 3C41J 1DE0A 3AP3A 3HR7A 5CJPA 4JJKA 2QZ4A 3AV0B 4ESHA 3M6AA 1OXTA 4UNQA 3SQXA 1F3OA 1KZ7B 3R7WA 4DWJA 1KO1A 3OEHD 5KSPA 3KZ1E 3K09C 2XSZD 2ZI7A 1Q3TA 4TYWA 3TGPA 1KI9A 2ECKA 2YWFA 4MRSA 2X19A 5K8LA 4EUNA 2J0QA 4WW0A 4Q9HA 5F9HA 3KKMA 4J0QA 1HT1E 2FOLA 1FQJA 3EA0A 3I8SA 3LA6A 4URVR 5FPHA 5C4MA 3Q7QA 3ZH9B 3AVVA 3ZD6A 3PV0A 1E0SA 3M4YA 5F3WB 1LS6A 3LBHA 1EG7A 1M6NA 4OQXA 4AWXA 2XGJA 1E6CA 4CYMA 1TUEA 4TMVA 4G1UC 2WKPA 4EPYA 2GCNA 3Q5EA 2ATVA 1P5ZB 2DYKA 2AR7A 1DAMA 4JYBA 4E03A 3MUFA 2PJRA 2NMVA 1N25A 2IYTA 2B8WA 4TYQA 4UXHA 2HT1A 5CYPA 4K46A 2GDJA 2LKDA 2YINC 3GFPA 4G0NA 4TQ9A 3IGFA 1W36D 1U81A 4DCVA 4MGIR 3LBIA 1CBUA 4MYHA 1UFQA 3NEYA 2Q3FA 2AXPA 4M21A 1CP2A 2RGNA 3KQKA 5DE3A 2G77B 1N5KA 1T0JB 1VG1A 2QP3A 5LB2A 2R6DA 1E9FA 5A4JA 2FEOA 1RRFA 4TTPA 4DLYA 5EP1A 2PLFA 3B9QA 2CK3D 2GJ8A 1G8FA 5SZKB 2R9VA 1FQKA 2VLIA 3EG5A 3PITA 2GBLC 5FOUA 4DLXA 3VR4A 3U60B 2QMOA 5AUQA 1ZAKA 2F55A 2BVNA 1G3QA 2XB2A 3VR2A 2W2VA 4GRAA 1TAGA 3DOFA 4FINA 4MGZR 3Q72A 3L0SA 1SVWA 3H1TA 2QMHA 4LHWA 4A8JB 4B75A 5L3QB 3KJGA 1E69A 4KVAA 2FDCA 1NRJB 2UVQA 3CIOA 4Q5IA 3FVQA 4NCJA 4US1R 4B2PA 3R9IA 2CBZA 1WBBA 4OYHA 1N0WA 3MWKA 4XJXA 4QJ4A 4DUGD 3U4QA 1XJQA 2RGDA 2PMDA 4HB0A 1D9ZA 3EAQA 3EWSA 1UM8A 4TL9A 1DBSA 1Q1EA 2Z43A 3NH6A 4OHWA 3AP2A 4GMXA 1CJVC 2OCBA 2YNMA 2J45A 1JXOA 1P2TA 3FB4A 4MUAA 3S1AB 2D74A 3U7FB 2J59A 1ELOA 2HJVA 2HUPA 3HWSA 5CM8B 3GLIB 4XVQA 2E1RA 2OFWA 4JLDA 1ETUA 1Z28A 3DZDA 3N70A 1P7CA 5EP4A 2VQSA 2W6JA 5E7IA 1ZNXA 1GKUB 2EFEB 1EK0A 4M1WA 5TV2A 2D2EA 2Q6TA 1D9XA 4D2IA 3M1IA 4TTQA 1R7RA 4D0LB 2G88A 3DMNA 1L4YA 5J4HA 2XITA 5G3ZA 2FH5B 3KB1A 3W34A 2PZEA 5CDFA 1QG2A 3P1JA 4IW3B 4ILEA 3QIAA 2QQEA 1GVNB 1XZPA 3THOA 4RJLA 1LS1A 3DL0A 3AF0A 2VO1A 3BB1A 3VR1A 1Z29A 3DM9B 4B6EA 1W36B 2F43A 5UKDA 4C2TA 4NPHA 4PAQA 4TL6A 3R9XA 3FE2A 2CCKA 2WIAA 2OAQ1 3T15A 4F92B 1TEVA 4JL5A 1KI2A 4C3ZA 1KJZA 1LFDB 2WWIA 5EUQB 4ASUA 1ONBA 1Z2CA 1XMJA 3EZ6A 4PZLA 3C7KA 1KGDA 2RKOA 2FSHA 5JWOA 1NMXA 2JLSA 2O8CB 1W47A 4AYXA 3D7MA 2GTPA 1G64A 3R9WA 1XDBA 4A8JC 3QE0A 1Q20A 4IDOA 4UNPA 4XVUA 5KHOC 3GLHA 2ZE6A 4XH9B 3RNLA 2ZSFA 3I4LA 4MUBA 2A9KA 1NMYA 1ZU4A 2OXCA 4QJ3A 2AWOA 1LY1A 3MWLA 3CO5A 4ABYA 3T1VA 2FZ4A 5CIWA 5EJEA 3H0KA 4RD4A 2FSIA 2CCJA 1G3IA 3MSXA 3VKGA 4KO8A 5SZHB 2B7BA 1M7HA 3CNOA 4FMCF 4NH0A 4LHYA 1YHNA 1II8A 5HTKA 4DDTA 2ZRIA 2RH5A 3ZZ0A 2CNWA 3LRPA 5P21A 3K9GA 3T06B 1T3LA 3SU8A 3TVDA 1NP6A 1R8QA 4GOKA 2WZQA 2XOKA 4R2HA 5TARA 4LUCA 3V4RA 1G8HA 2C03A 3R20A 3PQCA 5DN6A 1FMLA 5HR5A 1P9NA 1F48A 2HCJB 4MQBA 3K0FB 2XTMA 4BZXA 1HA3A 1Z63A 4BEBA 4V0OA 3IILA 5E4FA 2VSOA 5GJWC 4B32A 4TT3D 3U3KA 2QE7A 4G5SA 3K53A 3LO5A 4B43A 4MDEA 3D31A 2CLSA 4LHZA 4II7A 3ZLJA 5JEDA 1NJGA 3HU2A 2OFOA 1W36C 4PFSA 5FUYA 2EVWX 3W6PA 3ADCA 1G5RA 4PTLA 1S8FA 2J0UA 2KWIA 3SHWA 3IEUA 3RYTC 4WZ6A 3EIEA 3SEAA 2G83A 3U44B 1ANKA 3EZ9A 3QBTA 4IRUB 4JBYA 3AUYA 4JLJA 2OLJA 1UEJA 3U61B 3PUYA 1W4AA 2GKSA 1NSTA 5GJCA 5B2ZA 2JAQA 3LW7A 3W5IA 1DAHA 1F2TA 3HU1A 1T5IA 1KIMA 1R0YA 4UJ5A 2H17A 2C98A 3CUEF 3SHFA 4B47A 1GTVA 1YJ5A 4HDQB 4RD1A 5E7JA 1DO0A 3DM5A 5DYIA 2I4IA 1Z6AA 1VG9B 2ZR9A 2ZRHA 3A1WA 5EUMA 3NDPA 2IYLD 3L0IB 2GVDC 1G6OA 4BASA 2YOGA 4NBSA 4Q4LA 4DKXA 2HXYA 2ZE5A 1GL9B 1ZMXA 4B33A 1HE1C 2QE7D 1DTSA 1G18A 1XFAA 4LJ8A 4QHYA 1QHGA 2JA1A 4R71A 1RKBA 4OK3A 4DCNA 2EU8A 4KBGA 1UDXA 3D6TB 2RGGA 4QKQA 2J7PD 4B3DA 4BLQA 3CX8A 2G0TA 3GLGA 2QT1A 3TRFA 4A6PA 1XMIA 1KDRA 5JJIA 2X1VA 5TY0A 3FPAA 3LX8A 4O2LA 3CRRA 2NGRA 3LQQA 4LYAA 4EQ6A 1SGWA 2ODWA 1CU1A 1E9DA 2GHIA 4UJ3A 1W0KA 2OHFA 3UKDA 4DDWA 3OIUA 1YRAA 1CLUA 2Z6VA 5CB8A 4BZQA 1UBEA 1SVKA 1IN6A 1RPZA 2NO6A 2R6FA 3CWZA 1GP2A 3H4MA 4DLVA 5CK5A 2IS6A 1IN4A 4PXAA 4Z51A 3EIQA 1VYVA 2JLRA 2IA5A 4B3XA 1ZINA 2ZRPA 2BIFA 2GILA 2J41A 4URUR 1V43A 1NVXQ 3F3YA 3HPRA 3PUWA 5EZ5A 3S1AA 4KYUA 2QSZA 2NO0A 3MG9A 3P4YA 3ZDQA 2LKCA 1OFUX 1N2CE 1DAGA 2GK6A 1NN3A 1VG0B 2QG6A 3K0CA 4RD3A 2DCUA 2GESA 4PPQA 4YXWA 3LFUA 1H8HD 5GVRA 2H18A 1K5DA 1E9BA 2CCGA 4PQRA 3HU3A 1IY1A 4MRVA 1ESNA 2XX3A 4UNRA 1PJRA 1DAKA 4D6PA 1X3SA 1KDPA 1T0HB 3QKSA 2HDNB 4C4PA 4ASUD 2NTYC 4M1OA 3CF0A 4I4LA 4TT3A 4PSVA 3VU9B 1IXRC 2FNAA 4P3YA 3VX3A 1DOAA 2IK8A 2J5XA 4LK2A 5FOSA 5AUOB 1XBTA 4NMMA 4A0RA 2HCBA 4B3CA 2WTUA 1KMQA 2ZJOA 1QHYA 3KUCA 2PLRA 5AJZA 1W1WA 2P5TB 3ZIAD 2ZSDA 4KBFA 6Q21A 5H1YA 2W2XA 4DSUA 4MKHA 3AVPA 1Z47A 2XZLA 3BGWA 2GF0A 3SYKA 2VEDA 2I3BA 1BS1A 3GLFA 1II0A 3D3QA 5LB4A 2A5GA 3I8XA 1YR6A 2XJ9A 4LRWA 4PC3A 1BMFA 1JEEA 5KDLA 4M22A 1AA9A 1CR2A 2ZITA 4IVRA 5D3QA 1NLFA 4QBHA 1A2KC 4OI4A 2WHXA 5B57C 4LJ7A 3O8CA 3AVXA 2QSYA 5AJWA 4LCBA 3MMPA 2VF8A 4IXNA 1CJMA 1NBMA 4UXIA 4ZDKA 4B3GA 3BB3A 1MO3A 1AKEA 2CHGA 2E9SA 2MMCA 2ZJBA 3N5CA 3K9NA 1TNDA 3BK7A 1UJ2A 3IQWA 4HUTA 2OSBA 4X8MA 2YWEA 3O8BA 2ODBA 1NMZA 1T91A 2WWGA 1TADA 4ZKDA 1Q1ZA 1FMJA 1JPJA 4TMXA 5BYKA 1E2KA 5DNYB 2JDID 1IN5A 4GP6A 3H86A 4M4SA 5DN6D 1GL7A 3OAAD 5KUTA 4JLKA 3QEJA 3OESA 4AG6A 1XMSA 5E3HA 3MLEA 5IF9A 1QHNA 3EW9A 4AURA 1MV5A 3P4XA 3AVWA 2IYVA 4Q02A 3EZFA 4Q47A 3IDQA 4HAWA 2QTVB 4YONB 1JI0A 1GZSA 4ZI3A 3JVVA 4R9UC 2IXFA 2EYUA 5K8TA 1K8RA 4F4JA 1Z0FA 1G3UA 4TLEA 1E0JA 4CVNA 3CPHA 1YR9A 5FUVA 4N3NA 1TU3A 4RFSB 3PEYA 4QHSA 3VHXA 4JL8A 3NKVA 3I1FA 3SFVA 3AKYA 2A2ZA 5IRCD 1F6BA 3CX6A 5EE9A 1R5BA 3H84A 3GQBA 4HLUA 4BGDA 4LHXA 1IY2A 2ONJA 1JR6A 4HAYA 3CW2A 4QRHA 4UXJA 3IQXA 4WA7A 1US8B 3KFXA 3QG5A 4LPKA 4DT1A 1NY6A 4HYYA 2DWOA 4A8JA 1E79A 1W49A 4NTZA 2GAOA 2BWJA 1J70A 1G5TA 2KI5A 1RYFA 2PCJA 2EQBA 4IDNA 3G5UA 2QNRA 4EIWA 1FL9A 4HSEA 3UWKA 2J9RA 1OXXK 2ODEA 4PC2A 4US0R 2ZRDA 2Q3HA 1RIFA 1KDTA 2BMJA 3NEJA 3ZZUA 2QAGB 1VDZA 3T34A 1YZUA 3GJ7A 2ZI6A 1NVVQ 4ESVA 2JLVA 5IDVA 1W0JA 1GNRA 1YZNA 1HV8A 1XWIA 2QQ0A 4GNKA 5FFMA 3B1VA 3RC3A 1CRQA 1NVVR 1OKKD 4N1AA 4I1SA 4DSTA 2XNDA 3A58B 5JSZA 2FSGA 1GL6A 4KSBA 1OF1A 2UZIR 2RMKA 4HLQB 3HDTA 5HZHA 1KSFX 5EXPA 2ZE8A 4CEHA 3G0HA 2D3WA 2G6BA 4Q4JB 1JXMA 2BBWA 1E2NA 5L3SA 4H9GA 5JHHB 1JR3A 1KO7A 2WOOA 3DOEA 3ZYCA 1N5LA 3CPJB 2FWRA 3AEZA 2X8AA 1HEIA 2WV9A 1NKTA 2W6ID 4MGYR 1V5WA 2FPKA 1GRQA 1CXZA 2DPXA 2QN6A 1EGAA 2IYWA 3OE7A 2WAYA 2VP0A 4LJ5A 3P20A 1B0UA 5DI3A 3SI7A 4A0HA 3EASA 2OBMA 1XJCA 2ZAMA 4KFTA 4V0LA 2ASEA 4B48A 2WAXA 4V02A 2WJJA 3PCRB 3CR7A 5E95A 1EFTA 5F98A 2WPDD 2OFXA 2A5YB 4Q7KA 1N6IA 3OIWA 4F38A 3HR8A 1XTRA 2RGAA 1YR7A 1OHHA 2P3SA 2VSXA 4Q4HB 1D6JA 5TB5A 5FOVA 3VQTA 3WP0A 3VR6A 3WNCA 1OB2A 2MSDB 5KNCA 1RVDA 1ZJ6A 1E2FA 2AXNA 3AF4A 1Q22A 4OQMA 1N6PA 5FTJA 4TMTA 2O5VA 2IS1A 2HV8A 2K5UA 3W3AA 3TE6A 1QHXA 3BWDD 1N6NA 3FMOB 2YWHA 3CRQA 3X1XA 4L16A 2WWYA 1NY5A 4Q7LA 1BO6A 2JGNA 4AK9A 3L8ZA 2C78A 2O0HA 5DHAA 3KKPA 3T35A 3CLVA 3GJ3A 4YLGA 2QTFA 2GXSA 1COWA 2R44A 3IPYA 2W00A 4EPWA 2Y8EA 3W8NA 2ZS8A 4Q1CA 4DUGA 3QF4B 1U0HC 1A82A 2QAGC 4CIDA 3RRZA 2IYZA 4LSGA 1NKSA 1B23P 1JALA 5FBVB 1G4AE 4DSOA 2KSQA 3THWA 5A5GA 3UG6A 3TSZA 4RFVA 4LX0A 3KJIA 2F3TA 2JJ8A 1TUIA 2CDNA 2C2HA 4S2EA 3UATA 3W6OA 3WNBA 1PLJA 4P33A 5FTNA 2Z4SA 2ONKA 1P73A 2WWWA 5ELXA 2ZETA 1HQYE 3BS4A 4A2PA 1OKKA 2EFGA 2HYDA 3CNNA 4BUJA 1XD8A 2FU5C 2PEZA 4QL3A 4PZZA 1TQDA 3A1VA 1YQTA 2RGCA 2GCOA 2JEOA 5HPYB 1UEIA 4TZ0A 1PLKA 5FPYA 3DPUA 4XD7D 3ZQJA 3B6EA 3WNDA 1KAGA 3A4NA 1SXJA 1Z8FA 1W5TA 2QRZA 4M8NE 4BZPA 3UK6A 2Q0HA 3DEFA 4L9SA 1DADA 1E2EA 4OK5A 4WXRA 3ZVNA 2FZLA 3QKTA 4EJSC 1K5GA 4ZDJA 2GETA 1AS2A 3NHAA 4JS0A 3BIFA 3CZQA 1K6MA 4TQAA 3B5JA 2ZUDA 4ZPXA 2IYXA 4UNSA 2ZRLA 3OHMA 3AM1A 2VHQA 1QG4A 4OQLA 1D2EA 1EFRD 1Z06A 1LVGA 4FCVA 2EWWA 3SJZA 2N1BA 3AP1A 4A82A 3QXHA 2AFIE 3EXAA 3W9YA 1W2GA 2QL6A 3QVUA 4E5UA 2ZYWX 3PEUA 2QT0A 1W4BA 3RAPR 4D0NA 1RRGA 4M2LA 4ZCMA 1A4RA 3LWNA 4D0GA 2YOFA 3BORA 1RE0A 2XZPA 4B2LA 2IL1A 1NVUQ 1R10A 4DB4A 1YZTA 2YYZA 4S35A 3KX2A 1Z83A 1ZM4A 2IWHA 4C0LA 2RGXA 2P65A 1KI7A 2FMXA 3I3SR 4Z8YA 4RKEA 3CNLA 3LQRA 1QVRA 2JIZD 3P32A 4BQSA 2QEQA 1GOTA 2JLZA 2NZJA 1GKYA 1U8ZA 2ZTSA 4GSYA 1S9DA 2XB4A 5E7MA 2ZXUA 1KI3A 4D82A 1SKQA 1C1YA 1OIXA 1IJEA 1H8EA 1OFTA 2VSFA 1U94A 1X8KA 3CF2A 5JCZA 4ACBA 3C8UA 2ZJZA 4NCIA 1AN0A 3TNFA 1P3JA 2FFBA 1E3MA 1DAFA 1SXJB 5LDDC 3NTUA 2ERXA 2OLKA 3GLIE 1EFUA 1OE0A 1O87A 4CT5A 3EZ7A 1P61B 5DYGA 3FMFA 1R6BX 3MAAC 4CEIA 4BE7B 3QY0A 2ZRAA 1QDEA 2BCGY 3DHWC 1WCV1 3ZVRA 2VTKA 3N2EA 4JT2A 3MD0A 5A0FA 4RZXA 3E5HA 1OFIA 2D62A 2KB0A 1VCIA 1N6LA 2AN9A 4KV9A 1RYHA 2QP9X 4MKFA 4EJSB 5CDFE 1UF9A 1FUKA 3BERA 2VPPA 1DG3A 3R7WB 4E22A 3VKHA 4TLCA 3ASZA 1G17A 2BMDA 3RS4A 1ZC3A 1UKVY 1P4SA 4LYJA 2ZI4A 4YDSA 5JI3E 2GJ9A 2W2TA 4TSFA 1E2PA 1E0AA 1SVLA 2Q9CA 3SS8A 3U3RA 1XX6A 4DBLC 4YMTA 3ZVMA 2QI9C 2P0EA 4YDHB 4XD7A 4D25A 4LV6A 4LOAA 2ZYVX 3BFXA 4KITB 4NZYA 1OXSC 3VHLB 2O8CA 2A5DA 5C46F 2QY9A 2GBLA 2FSFA 3CBQA 2G0NA 4WZBE 5AJXA 1SVOA 2OXRA 3QVVA 3PUXA 4N0DA 5HE8A 3RS2A 1FNNA 2MSEB 2V9PA 3TR5A 1KI8A 1AIPA 3CM0A 3QOFA 4IOJA 1WF3A 2FF7A 3L82B 1G8GA 1FTSA 1TQ4A 3E1SA 2MMGA 3NBYC 1S3SA 2ZVQX 3OFND 3ZD7A 1TEXA 1L2TA 3K0EA 4FXPA 1JAIA 2VIIA 4AYTA 4JLMA 2DFTA 3BH7A 2IS2A 1RZ3A 3LW8A 2VP5A 5EE0A 1BYUA 2IEZA 4FW9A 4P0TA 4A4DA 2OEPA 4CT4B 1YVDA 3K9HA 5G41A 1KO5A 2CEAA 1P2VA 2ORVA 2YV5A 1VPLA 2O0JA 4URYR 1G4UR 1YRBA 3HYTA 2ORIA 4PQFA 5JWHA 5EE5B 1AQYA 3OF5A 4Q1BA 2VHJA 2FG5A 4L5BA 2HYIC 2GVZC 1JR3E 1IN8A 2BDTA 4OI1A 4DLRA 3JZAA 2D4HA 3SQWA 5JECA 1GNQA 2PBRA 1SXJC 3SFZA 1NN1A 1AZTA 4C7OA 4HAUA 1KZGB 1VKJA 2ZRKA 3V00A 2NPIA 5L3RA 3NC0C 4HUQB 4Q19A 1J99A 1UBFA 1W4RA 2FPLA 5IT5A 5JJLA 4DLTA 1BH2A 1E2GA 3K0FA 4V0KA 2H92A 3FKQA 3BAFA 5F9FA 1XB2A 4NYMQ 3ZZTA 3THWB 2B6HA 2UKDA 1G16A 1W44A 4OHVA 3FKSD 2FGKA 4DEYA 1H65A 2IC5A 2H57A 2V54A 1OHHD 5AJVB 1QZXA 1Z07A 5LPNA 3IHWA 2V7QD 4M53A 4R2IA 3U3MA 4RZ3A 2ZUBA 3L2OB 4W5WA 3TW4A 3NBFA 2PT5A 821PA 1TU4A 3FMPB 4Q00A 3IIKA 5JZVA 2QAGA 3SE0A 4JYCA 4BLOA 5CYOA 1I2MA 4D26A 2C9YA 3B8HA 1OB5A 5CIQA 4DB2A 5L8VA 1G1MA 1HY3A 4UQOA 4O25A 1N6RA 1E9SA 3KTAA 5FOWA 1R2QA 1JR3D 2CVHA 4LY6A 3FGNA 2YJTD 3PUVA 4FN5A 4RVCA 1OT3A 3MJHA 1KI1A 3OIVA 1XXHB 2J3EA 4MRNA 1E4YA 2YC2C 3FDIA 4WBSA 2XNDD 4JMPA 3TMKA 2BHRA 3CRVA 2AL7A 1R4AA 4RD6A 3I73A 2NQ2C 5G53C 4IOLA 1RFLA 3BB4A 3DKVA 5D3MA 3VMFA 3E70C 4FWTA 4OQNA 5SZJA 3ADKA 3X1WA 4PC6A 2IYSA 3VNVA 1G3MA 2QGZA 4IKEA 2VH5R 2ZJ5A 4IXMA 5C1BA 3GLGE 1KJYA 2BMEA 1HYQA 3KJHA 2O8FA 2NIPA 1UKYA 2G9NA 2H8KA 4NYIQ 4IDHA 2OO7A 1ZM9A 2R62A 3RRMA 4WXPA 1IXSB 3VTKA 5HKKA 5JWRA 4RSGA 2QGNA 1G8YA 5BWMA 3I62A 3RABA 1W2HA 3LY5A 2WJVA 2F1RA 4QBFA 2CMKA 5LD2B 3F0TA 3OAAA 4NCHA 4B34A 4G5QA 3Q7PA 1E94E 2A5JA 2MSCB 2H5EA 4KSCA 5EXSA 3LXXA 3U2QA 1WE2A 4V0ME 4C0JA 2P5SA 2QROA 3MWJA 5JHGB 1U8AA 4GP7A 2IUTA 4EFMA 1G41A 721PA 2X2FA 2ZRJA 3AH8A 1KKLA 3EZ2A 2DFKB 3Q3JB 3QKRA 1R8SA 4RCYA 1CRPA 4Q21A 3F8TA 2PEYA 1W0JD 1MABA 1DO2A 2CNWD 1SVIA 1MKYA 3LXRA 1CF4A 2IUUA 3Q85A 4EDHA 1SXJE 2ZJ2A 4MGKR 1U2RA 3LLMA 1GITA 1OYYA 4HATA 4DLZA 1M34E 3QF4A 1XCPA 3KQNA 1XPRA 5JJKA 1EX6A 4ZDIA 3ICQB 1OH8A 4DHEA 4M0LA 3L0OA 2VBCA 1CJTC 4FI3C 2V1XA 1E79D 2ZSBA 4AKGA 4JT4A 5L3QA 1SKYB 2QU8A 4L4UA 5DGXA 3NWJA 1QHIA 2CHVA 1QBKC 4JVLA 4W5HA 2YVUA 2NOAA 4WVFA 3GLFE 1KDOA 2QBYB 3PENA 1Q57A 3OFNA 1ZIOA 3LX5A 4AC9A 2I1VB 1A1VA 1OYWA 4JKYA 5AWFC 4FMCB 1P9RA 3BE4A 1UDWA 4LWZA 1M74A 2ZI3A 1Z6YA 2F1IA 2B7CA 2XTNA 2ZE7A 3ZGXA 4Q9KA 1XD2A 5GJBA 2D7DA 3WYFA 5TDHA 1OFHA 1KMHB 4Q66C 5FPKA 4HDOB 4UKDA 4NYJR 5C2JB 3U6KA 1UAAA 1VTKA 2CJWB 4CW7A 2ZRMA 1RW4A 1Z6GA 1NG1A 1JEDA 5LD2C 3GEEA 1VCNA 3BFKA 4DLSA 1T8TA 2GXQA 1QF9A 1S0UA 4FIDA 5HCIA 3SN6A 3A36A 4FMBB 4A0GA 4WAUA 3KTAB 4PC1A 4CZ2A 3TAHA 2WICA 2ZS9A 2ZAOA 4URWR 4PAMA 2GF9A 4A0FA 3B1XA 1BKDR 1CR1A 1G291 2QM7A 4IOKA 4D81A 1ZP6A 3B2EA 5IK2D 3TQFA 5J47A 1ZBDA 1LV7A 2DWQA 5C4GB 2CE2X 1HQCA 1J8YF 3HP1A 3CX7A 2J0VA 2V4ZA 2WMOB 5KSYA 5JEEA 1O3YA 2ZIAA 2ZPTX 4PO9A 5H70A 1AKYA 1U99A 1OSNA 2HEIA 2WWHA 2ZJAA 4HUQA 4R98A 4C0AC 3TK1A 3AVOA 3WRXC 1W7AA 2GEDA 1F2UA 2ZRBA 3RDPA 4JJZA 4Q9JA 4IVQA 1SHZA 1ZNZA 1Q1BA 2F9LA 2OCYC 1N5JA 2Q9AA 2ZYTX 4KLZA 4A9AA 4B73A 4UNNA 4DXAA 1YZKA 4PSKA 4BRWA 3J81k 1Z08A 4NL4H 3L43A 2DWPA 4JZKA 2H7VA 4LGMA 2P6RA 2O8BB 3BXZA 2IXEA 1E2LA 1OIVA 1HT2E 4Y0AA 3KKQA 1I4TD 2NO1A 2XTZA 1ZD9A 2H16A 2ODNA 4Q4AB 4BLPA 1KNQA 1M1YE 3ASYA 1HUQA 5EQTA 2AK3A 3WMFA 4PHFA 4LC1A 5JS7A 4HZUA 2VYFA 4JLBA 4KLNA 1G7CA 2AKAB 4MYTA 5IHPA 1AJEA 4ERNA 4QGGA 3UXMA 1X1SA 4L9WA 3VNUA 4BLSA 2W0MA 3RRYA 1R5OA 5AUNB 3C16C 5FH9A 3PR1A 4EPVA 3CRMA 1NL3A 1JBKA 4DIEA 4DCSA 4OL0A 4DLWA 3SBDA 5DO9A 1E2JA 2QA5A 4OJQA 3TSOA 4TZ6A 4Q4AA 3GJ4A 1OH6A 4GPTA 1ODFA 4A1FA 3GJ5A 2OT3B 3B85A 4NONA 2HXSA 1OPXA 3MFYA 3EIHA 1T5LA 1ZVQA 3U44A 1WXQA 1N0VC 1JQLB 2VP2A 1S1CA 1T3HA 2D2FA 3AQ4A 2Z4RA 4JLVA 2EFDB 4F4CA 5CLQA 1NJFA 3RLFA 1P60A 3TUZC 3ZQ6A 2NO9A 4U5XA 1PV4A 1XXHE 3RRNA 3O47A 4JBXA 2PT7A 3U3JA 2XEXA 2XJ4A 2QPOA 3CONA 1OH5A 1QHHA 4LZZA 4WZAE 4A6XA 3EARA 1XF9A 3SZRA 3PIRA 2OM2A 1AK2A 2GZDA 2A30A 3LVQE 4QNMA 1XNJA 4BFUA 5CJ2A 1LF5A 2B8TA 5BW8A 5AJYA 2BBTA 3Q5DA 3NC1C 2XNSA 3T5DA 2W6JD 2R2AA 4W7SA 5BN3A 1XMVA 3KJEA 4TLAA 5JSZB 3QBVA 3BBPA 3U7HB 3MGCA 1DAIA 3FHOA 1P9WA 1JECA 1J7KA 2HLDD 5BN4A 1FX0A 1T8UA 2W83A 2J7PA 1MRNA 2ZSEA 3BH0A 3H2YA 4O0MA 4Q1FA 1KO8A 1Z2AA 1GIAA 3EX7C 1D2MA 4MYCA 3ETLA 4LV8B 4RZUA 1M8PA 4Z8XA 2RB4A 4DCTA 1XD9A 2RAPA 2WJGA 4OHXA 3GJ0A 1BOFA 2ERYA 221PA 1C9KA 1JQJC 2F9MA 3BFVA 4MH0R 3FKSA 3WBKA 3W5JA 3DKPA 1YZQA 1D5CA 1F2TB 2CE7A 4GOXA 3UANA 3FHTA 3K1JA 1KI4A 1NBME 1NIPA 1RRPA 4DCUA 2GCPA 3CH5A 3F5FA 1U98A 4CDGA 4YMWA 1CTQA 4TL8A 3SNHA 1CJKC 2R6AA 3U7GA 1NLZA 4DT1B 3SJCA 1ZCBA 1P2SA 1I4LD 4QBGB 2EFCB 2BJWA 4JSTA 5FTLA 1KK1A 2QMEA 1IONA 1NG9A 1U8YA 1XPOA 1ZRHA 4F91B 1GRRA 3UIEA 3QKSB 1EXMA 3QENA 1NF3A 2CVFA 5FL7A 2PL3A 1YKSA 2OG2A 4YQFA 4PZYA 4CEHB 1P2UA 4TWZA 5AK0A 3EC1A 3AKDA 3PFIA 3ECCA 4OQFA 1IAQA 4XSGA 1A5TA 4G01B 2F43B 2GZAA 2RGBA 1A7JA 2QM8A 4H1VA 4DJTA 2HJGA 1G19A 2VRWA 2ZJYA 1NIJA 2AHOA 1X8JA 2IYYA 4E07A 1HURA 4FMDB 1BYIA 5CLLA 1SQ5A 5TVKA 4BRUA 1XCGB 1QHHB 3IPXA 5K8UA 1EFRA 2BEKA 3OIYA 4OI2A 4ZIRA 3WBJA 3EPKA 2IUSA 4TMWA 3BD9A 3A4LA 2DBYA 3GEIA 1G21E 2ZYUX 4M9ZA 5KSOA 4C0QC 4ZCIA 2AK2A 1G7RA 2IF2A 2FX3A 3QXXA 1CJUC 4F7WA 1KY2A 2WBLC 4O3MA 2XXAA 4PPGA 1VYUA 2G3YA 3OZXA 4YMVA 5FL7D 8OHMA 3GLHB 2VHUA 3IIJA 3VR5A 4Q1EA 3BH6A 2QRNA 3TW8B 3TIFA 3T1TA 1XEWX 3D8BA 3MRSA 1I4DD 1CKEA 1VMAA 2P6NA 1F5NA 1CR4A 2HF9A 2PH1A 3N2IA 4AY2A 3SJBA 4EPTA 4LBWA 1E1QD 3W90A 1Z3IX 5JBQA 1GAJA 2ZU0C 4KJZA 621PA 4GDFA 1II8B 5GJVC 2FEMA 4L8GA 1E1RA 1FFHA 5DH9A 2VHTA 4NKRA 3CH4B 4YMSA 1SHKA 3K0AA 1QVAA 3O8RA 3X1DA 4TMKA 3NHBA 2VF7A 3WHKA 4B2IA 1HTWA 2JLQA 3U7EB 3IEVA 4AKEA 5J4KA 4BLTA 1XEXA 4IDQA 1MR3F 1XTJA 2V55B 1PUJA 3PJRA 4BLRA 1JAHA 1KTVA 2QAJA 2IX3A 1T4GA 4RD0A 4HAZA 4JBWA 1MO5A 3TQCA 1DS6A 3KL4A 4C0SA 4P4UA 2GCOB 3QPWA 2Q21A 4Q18A 2ZR7A 1G5PA 1EFHA 1G7TA 1SXJD 4Q1AA 1F60A 2C9OA 3WHLA 1E0KA 2YKGA 1OW3B 2CLDX 1E4VA 1Q3HA
chains in the Genus database with same CATH superfamily
4MKIA 1TAHA 4I9FA 4ZO7A 3H87A 3L8YA 3U0BA 5KPJA 1OIWA 3FX2A 2I6GA 4D9JA 2FQXA 1SXIA 4E7OA 4O33A 5G0TA 3H13A 3K2BA 3LOQA 2WQZA 2XQVA 4HT3B 2W2QA 1IZZA 1TTTA 3V4FA 5A6VA 1AMUA 1H6AA 1PL0A 1E2HA 1C0KA 5D7NA 1DUVG 3AFGA 3H65A 1A04A 3OOWA 5IJZA 3LUGA 4JC4A 4IEEA 4FE4A 4TLLB 1KPGA 2HLPA 1IHDA 5JNSA 1T24A 4DZTA 1KSHA 3UB3A 3V7FA 4RESA 1EI9A 1G8PA 4AL4A 3CZCA 3G89A 1SHTX 3BWEA 1BS2A 3CO0S 4G81A 3O90A 4KXNA 1CQIB 1E2DA 3AY6A 3RRJA 1V1JA 3A1UA 2R11A 1JLKA 4IQGA 2OHXA 4BNFA 5CA1A 1FE8A 5EHNA 3B6KA 4ACAA 4LJAA 2ZROA 1XTQA 1Z8NA 4II2A 1OH7A 1H6DA 1B43A 1WM1A 1ZK0A 2CN1A 3PG5A 5C0OE 3PNLA 2XAAA 1V3TA 1YIDA 3L1VA 4HOYA 2Q9UA 5EJ7A 1OZFA 1J8DA 3WMGA 3KQHA 1KBZA 2AI2A 1PHRA 1POXA 1B1AA 4JODA 1X7XA 1MORA 2J0SA 3FTCA 4AS1A 2I55A 3A6JA 3E5NA 3QPBA 1I7LA 2B4RO 3LCCA 3E9MA 4MI3A 4ZOLF 5TJ9A 1OLOA 3GRFA 4NDZA 3HFRA 2VPWA 2VF5X 3G68A 3SEQA 4FK8A 3QGMA 4RH1A 5SZIA 2YYAA 3UUFA 4B74A 4XX0A 4MSUA 3VXKA 5B30A 4X44A 1RPAA 3DOIA 1GG2A 2GD2A 4KN8A 1H8HA 3GDFA 3LF2A 5FUWA 4K1LA 3ROPA 1TIKA 3D3WA 4F5WA 1ZGJA 3DF7A 4QZVA 4P92A 3CG0A 2MSLA 3GLHE 1WDTA 1Z6XA 4TUYF 4E5KA 4YHHB 2EIXA 1W76A 5DXJA 3RT7A 4Y1RA 2WKRA 4IIHA 1IPEA 4RPGA 5IM4F 3QPCA 2EEZA 4B8ZA 1R4NA 4B85A 1OILA 4NBVA 1OBCA 3Q98A 2FR8A 3DE7X 4M46A 1G2PA 2NUPA 5KCMA 4JL6A 2IDZA 3MMNA 3WK9A 4F71A 1C9EA 3T7AA 2PR7A 1JS1X 3W2EA 4B4UA 2XUPA 4XJVA 4OP1A 5HK8A 3BJIC 3OEHA 3V55A 4ZQHA 1LDEA 1GJRA 1VYHA 4K6HA 2XRFA 1B42A 3FNGA 2G5GX 4RMHA 2NPFA 3TG2A 2ZYRA 3PQ7A 4EPXA 4F5YA 2HFJA 2ZCJA 1E20A 1MNQA 3NHYA 3SZOA 5DMXA 5JAZA 5ABPA 1CC1S 4Q4HA 3CY6A 2E48A 4K9MA 5K3FA 4HNRA 3EPHA 2PUDA 1Z3CA 1IXKA 3EVZA 4FBLA 3HXLA 1SU4A 4CKYA 3OUTA 2P6UA 1E1NA 1GFIA 5ALIA 4MULA 3T9DA 3VMMA 4J0FA 1IHYA 1A9PA 5DNDA 5K0BA 4FHZA 4R2LA 1W4CA 3L0PA 4I1OA 3ZK8A 2B9VA 3AEXA 5IN4A 2VP9A 3ZHSA 2HB6A 1EJBA 1JBQA 1MF7A 1RAFA 1ZUNB 5FBQB 5TT0A 1KWGA 4PR0A 3UH0A 3U4DA 2IY8A 1W5BA 4Z86A 4ZXFA 3UN1A 4FYHA 5BYBA 1NQOA 1B6SA 2XF8A 3IT3A 5FJJA 3JARB 2Q7OE 4P82A 2C0QA 1FFCA 3DE1X 4C5BA 1B15A 4EA7A 2X5XA 4K9QA 1PTJA 2BM1A 5LMNB 1EUCB 1AM4D 1BHSA 5BV7A 4KDRA 3HY6A 1P5FA 3ROGA 2PA0A 3CUYA 2QRKA 4QLAA 1RJFA 1JSXA 2BTOA 1ZI9A 4JJ7A 2EKLA 2PYZA 3HY3A 5DLDA 1WG8A 2Y1OA 3WGIA 3W5BA 3OZCA 9LDBA 1E3JA 1EQUA 4ER5A 1A8UA 2WTBA 3BFPA 1K8ZB 3F96A 3S6JA 4KWIA 2QVGA 3LKBA 1K75A 1M2WA 2Q7DA 4TLDA 4CMHA 5GADl 3DVAA 3GR6A 5CK4A 1NULA 3L8MA 2WWFA 2HTFA 3OQPA 4GECA 4M1TA 2FFHA 2JFHA 4K9SA 4F2HA 3DDCA 2QPAA 1FUUA 2R97A 5CT5A 3X1ZA 2WJIA 1MHPA 1PD0A 4AMYA 1X7ZB 1XZ8A 2JEYA 3BK2A 1O9HA 3KFVA 4IUBS 4YP9A 4MW2A 4O4LA 3L0BA 2D2VA 4BLVA 1JP7A 1J0DA 2XYHA 4P36A 4BLUA 3ZEIA 3R5FA 2WSLA 4GI2A 2OBFA 1XHLA 1LEHA 4DA0A 3LVFO 2SKCA 3G1TA 2ODQA 3IP7A 4DSNA 4ALNA 4QECA 5CLFA 2J09A 5BSHA 4HFRA 1TQ2A 4I4TB 3ASUA 1E7QA 4P22A 3RHSA 4BX8A 1VECA 3EOBI 3VBCA 4PANA 1MT0A 3BOSA 3H2GA 3A1EA 1A4IA 1CRLA 3KB2A 5P21A 1UXKA 5I7OA 4F6CA 1VJ1A 1ENOA 2A9QA 4W8GA 3GLSA 4JC0A 1XRJA 1K2WA 4HEQA 2AHRA 1UT6A 2H4WA 3F9CA 1EHCA 2PZFA 2X8JB 4JB0A 4RTKA 1C8VB 1J90A 1ZN8A 1XCMA 1FDSA 4S0ZA 3NM5A 4C1BA 2H1LA 1XTIA 4RDXA 5L95A 1RZVA 4R8VA 4Z7NB 4C89A 4BEJA 3DB1A 1KEKA 4TOIA 1J56A 5D5HA 1AF4A 3RHFA 4PPYA 1FMFA 3Q3HA 4M1SA 1VLJA 1UQRA 2XE8A 3L7NA 2APJA 4ZARA 2N9UA 3Q8XB 2AN1A 2AKYA 2ZYDA 3BHJA 2GSDA 3LIPA 4WL0A 4X8LA 3WRXA 3RU7A 4DLBA 1BW9B 4MR7B 3DGEC 5EIBD 4F4UA 2NUBA 4MRPA 3CH6A 5TT1A 1A77A 2GZMA 2H5LA 2HPHA 2WW8A 4GXRA 5G0UA 1E1DA 2WPNA 5CVUA 1E1RD 2WYWA 3LV8A 4GPEA 4G9EA 3GHHA 4FGZA 1NVTA 5C8YB 3THYB 5CCDA 2YUIA 4JITA 2D7CA 4L27A 4MP8A 1GWNA 3THXB 5A2GA 5AHXA 2EFHB 1MTZA 3RFXA 3H6HA 4IHJB 2X2PA 4WMLA 1WB9A 3ZHXA 3TZBA 2ZJ4A 1X7WA 3H5VA 1EFKA 3OWXA 4BO2A 5ICCA 1RWPA 4LVOA 3LH5A 5DW3A 2R8RA 5B1DA 4DLUA 4FHGA 4HAVA 4X71A 2PS9A 1ZR2A 2QYOA 3B70A 1ZYUA 3GZNB 3BFJA 2DMRA 2R4TA 3LKVA 1GUAA 3L7JA 5J5CA 1A0OA 1O1YA 1VI2A 3K6SA 1T8RA 4KZKA 4EO4A 3P9KA 5JAUA 2CLIB 3C6MA 1VOTA 2QV0A 2XADA 3N75A 3ADDA 4FYJA 2F3RA 1JQ3A 1Q1AA 1US8A 4ZO4A 3O03A 3KQNA 3BC1A 3E48A 3K9LA 1CIPA 1QIJA 1Q91A 2BKUA 1JIVA 4BFZA 2F3SA 4XRGA 3AVUA 2BEUA 3KTOA 3T99A 4V0MA 1JPNA 4CJXA 3E3LA 2L19A 3VC2A 1Z8HA 4ARZB 3FI0A 4CRWB 3EPJA 1Y8ZA 1XIVA 1CVIA 4TMYA 4HGPA 4HN9A 3FPEA 5INTA 5AUPB 5IVPA 4NEGA 3EC2A 2C82A 1E4EB 2FCAA 2JKZA 3OKAA 4X7RA 1U2DA 1Y5IA 3I5XA 1MIOA 5CLIA 3PXXA 1WCIB 1Y7LA 3GJ8A 4Z4HA 3Q0TA 3BSSA 4ES6A 4MV6A 4YT2A 3B9BA 3DMDA 1KZ6A 3FH0A 4DQ0A 4F6LA 3U62A 1KK0A 4A03A 2Y1DA 4TSRA 4QEKA 5E9JA 1KI6B 3AR8A 3ZQ4A 1Q7GA 1SBIA 4OKSA 5ER6A 3QXSA 4QQKA 3IEMA 5DWDA 1J0AA 1XEWY 3MB5A 5T6MA 1PUIA 2XMCA 2DEUA 2BR5A 2V98A 3KWMA 4RAOA 4J0JA 1JE1A 1J39A 1ZK1A 3RV4A 2Q0QA 2QF7A 4PAGA 2FPSA 1SIOA 3IBTA 4S24A 3PICA 4DV6B 3FCXA 3FF1A 3D1JA 3LU1A 1NUAA 4L5IA 4KFUA 2HBZA 5JRJA 3F49S 5KYKA 6ABPA 2JLUA 3DBVO 4QGBA 1C9NA 4LECA 5ENVA 5L3SB 1D6SA 3FOEC 3FVTA 3VYTB 1RXIA 1E1LA 4BTLA 2VJDA 4BE4A 1WHSA 2OZKA 3AGPA 4LVCA 2FRXA 2VG8A 1UXOA 3PLNA 3G9XA 4ENPA 2O14A 1CEYA 1IHUA 2A78A 1CE8A 1EVJA 1ZU5A 3L0YA 2ZULA 2R8XA 2CK3A 4D8UA 1W75A 3AL2A 3LUFA 4UFOA 1WB5A 3CJRA 2OMKA 3I01A 2EJVA 4HPWA 4F60A 2E6UX 2IEAA 1HO3A 4FMDF 4HAIA 3ZWOA 5EMMA 1M8GA 3RGWS 5KOJA 5F9MA 4EITA 2H3HA 4LG1A 5BXYA 1JIJA 3DHYA 1AKQA 3KCNA 1D8TA 1ZK2A 3R0ZA 4QG7A 3HCOA 1DPFA 4KRYA 1PX0A 3ZU3A 3JQ7B 4B0OA 5B64A 1OLSB 2HRBA 2XAUA 6AT1A 1IATA 2GUWA 1J7JA 4HX9A 4J43A 4CMEA 3CW8X 2BZGA 3A6HA 2OD2A 3THSA 1CEEA 2WM8A 3L7AA 3CNEA 1EM6A 3M9LA 3O4IA 1KMHA 4XCVA 4E12A 2DY1A 2JJ2A 3AHCA 4ZO8A 5JY6A 2BFBB 4YXWD 1JIIA 4LBZA 1C80A 4QXPA 4U9HS 5FHRA 1K97A 4WNIA 4XGRA 2NO7A 3VVBA 4EKGA 3OTWA 3GJ6A 5EZYB 3WP1B 2AVNA 1F1JA 4HNUA 4TYYA 1ESMA 5TMPA 4TS4A 1N2CA 4GGOA 1RPTA 3FLMA 4NQZA 1E9RA 1PZNA 1WU8A 2Q6VA 3P0JA 1QNFA 1CS4C 2XLCA 3I6IA 3MCWA 2UVDA 3LD9A 5JAIA 1VB5A 2XBLA 1E6KA 1PVVA 4KK3A 4TN5A 5EXTA 5M04A 1GARA 4WTOA 5DNAA 4KWTA 4Q4JA 4ZZ0A 5BSEA 1KFEB 4D8YA 1ZGHA 1X1EA 3LP5A 5T41A 3ZJYA 5BV8A 2LNDA 1YZGA 1KXJA 3AEQA 4L5AA 4AB1A 4LMBA 1EUZA 2PV0A 1G38A 4KXMA 1E3DA 4UTNA 1Y6GA 5LA6B 1L5LA 3QTTA 3WB9A 1KOFA 4EABA 2GD1O 1TA0A 2M6SA 1RQXA 1H2WA 3CLSC 5T57A 4XEUA 1K7FB 2J3HA 2P4QA 1LLFA 2GZRA 2Y0PA 5E6RA 4A26A 1YI0A 5BYJA 2GEFA 3C1AA 1WBJB 1B0PA 4LJ9A 5KU1A 5CNIA 3RBZA 3EFHA 2IKSA 2NZWA 2OCPA 4MB0A 4NS4A 4K2AA 3JTEA 1VE6A 4LX8A 5DHFA 1TE2A 5KINB 2O8DA 1SCNE 5HFJA 4QREA 3LPLA 1NV8A 1TKBA 2VATA 2GJSA 3NG1A 4NU5A 5KNCH 2LR0A 4RCZA 2CV1A 5EI5A 3KB8A 4A8TA 1OWPA 1D0IA 3K6JA 3RASA 4IJVA 1G21B 3V1KA 3TFQA 5LOVA 3KR2A 4GOOD 4C9BA 2OGSA 3K1AB 1GPWB 2AMLA 1QHSA 2G1KA 2IOQA 3LLUA 2AC2A 2BT4A 1MJNA 4H6XA 2C2YA 1T9HA 1CD5A 2GD0A 1RWVA 1ID1A 2O2IA 5FI3A 3KQLA 2OBNA 2E87A 3PE6A 5FFNA 3D6JA 3TPFA 3EZNA 3KUDA 3UJDA 2XECA 3L4EA 3ZXXA 4I6JA 2YWRA 3KR1A 1SKBA 2WOJA 3DE5X 4DPMA 3GVHA 4XJTA 5AIAA 5JD4A 4JUCA 5IHXA 4QM7A 1LSSA 1C3XA 4GUAA 4UCXA 4YUYA 1P62B 1T8WA 1WB6A 2J7KA 2Y77A 4HNAA 3WGHA 3GT0A 5L4SA 3P2KA 5HF9A 4V03A 3IT1A 2BGRA 4I66A 4YQZA 2YZKA 1CR6A 3PQDA 5I9BA 3BXGA 2VCHA 3W06A 3SHQA 4TV9B 4MVJF 3OQNA 4EI7A 4G5YA 3QPVA 4R0VA 5B1HA 3N86A 5BSRA 2VCEA 5EY5B 4NX2A 1NVBA 2L17A 2Z2KA 3GT3A 1TIPA 2VBIA 2ZSJA 2ZUCA 3D2BA 3U4AA 4ML3A 2R48A 2DHEA 3A8TA 4E09A 2O8BA 1YJAA 3ZY5A 5I7HA 3EVTA 1G98A 3R3WA 4ZICA 2W37A 2IOYA 2P9BA 5I01A 4P38A 4QX6A 2IPNA 5BWLA 3FHJA 1ZRSA 1IOZA 3LPNA 2PRSA 1O0SA 4IUCS 1A69A 1N77A 4X1OA 5IX8A 2RC6A 3UY4A 4IFBA 1E2MA 1VKRA 4MCIA 3SJAA 1E60A 2ZU6A 4PLFA 5GTDA 5J4LA 1EBFA 3IEXA 4D9BA 1CY6A 1FF9A 1SCQA 3F9IA 3FYUB 1YDEA 5DBGA 1I10A 4PNEA 3A0RB 2X5JO 4CLRA 4I8XA 1VSVA 2ZSKA 1VE5A 2G5TA 1DIOB 4ZC8A 3GRYA 1KMMA 3IO3A 4HLCA 4RY0A 2XXBA 5KOYA 4MR7A 3IUPA 3IDFA 2V03A 2MYUA 3F2IA 1D2GA 2GPTA 2E82A 1XWWA 1AGPA 3HHPA 3SOPA 3INYA 1QIEA 3PGXA 3QSGA 3FUCA 5E3JA 2HSJA 5LZ2A 3X2EA 4IDAA 3AFHA 4OXQA 3IB3A 1VBKA 4HVTA 3EB9A 5LVAA 2JLXA 1P91A 1PK9A 2CUKA 1UJBA 1QMGA 4HB2A 5CB0A 4QU5A 3JXEA 1AHIA 3G9UA 2LWIA 3I2YX 4X24A 3IAM1 1NLUA 1S8OA 3CQ9A 4IV8A 5C3MA 3GNLA 4JC8A 4DRXB 3T4EA 4UDOA 3K1TA 3RTDA 4P7BA 3CLUC 1MJHA 1D2AA 3BRWD 3ZLBA 4IIFA 4MDFA 4MB6A 3VPSA 3Q11A 3TW6A 2OESA 3DO8A 4P4LA 5KVQA 3HVJA 2A1UA 3DTYA 2LUOA 3KHSA 3U4MA 5H83A 2IDMA 4KXFB 1FW6A 4GBJA 4GZLA 3TZEA 1C1HA 4G4GA 3W3ZB 5IUJC 1I5EA 1KKMA 5JMTA 1DINA 1SKYE 2K2WA 1RHMA 3I2FA 3ZE7A 2R4QA 1C7JA 1D0SA 3WL7A 4NNOA 2V0NA 3MIIA 4KI0A 4BX3A 2I3AA 1SU8A 1KY3A 2CXSA 1WVIA 5JSKA 4P7GA 1QO9A 2NZ2A 2J3IA 2XGOA 3ELBA 3HLKA 4G0VA 1KHTA 1XU4A 2PKXA 1L9KA 2F7SA 4RVCA 4BNWA 4GBGA 1HM5A 1ZGGA 2VR1A 5EZQA 3K09A 1GDHA 4KO4S 5JYDA 4KAFA 3PA8A 1TX4B 3UWMA 4CG1A 2GEJA 1EP9A 3R41A 1MQSA 3GLGB 4U7DA 1N5MA 3RTBA 1ZISA 3MCAA 1SUEA 3H8VA 3WQSB 4R9SA 5FFFA 4YWHA 3UJBA 2JIZA 3HDJA 3QFRA 3NYIA 4WJZA 1KWKA 4J07A 5DBOA 2GN2A 1FSFA 4ZQFA 2UUCB 1Z2DA 4Z9XA 3TR0A 2CC2A 3ZV4A 2WA1A 3MAGA 1HE4A 4RJ2A 5FOTA 3VHRA 3A9WA 1VZ3A 4P4SA 4UU0A 1UAGA 1P0MA 4ZYYA 2V5VA 2VJYA 5AP9A 3ZWBA 4IWXA 2JVJA 4P9NA 3E7WA 1HZZC 1QO7A 5BNIA 1HYBA 2XB9A 1JIQA 1FS6A 5FWXB 1PF7E 1FSZA 2E85A 2IQIA 4R2MA 2BUBA 3ND8A 2RHHA 4G63A 4L4YA 1MABB 1N5IA 1QFXA 4TROA 2AQKA 4K6KA 2JHGA 3PR2B 4EYSA 2YN4A 4AECA 5AI5A 1KI6A 2DKFA 3DMRA 4ROTA 3QI2A 3FFAA 3PDJA 2C04A 3AG5A 1YDHA 4DV1B 2ZQ5A 4D3ZA 2ECPA 1KC3A 3IP3A 4MYUA 3FJOA 1GZVA 4RH0A 4GQBA 1Y7PA 4IJQA 4AP9A 4CIYA 4DUZB 1SG9A 4BB9A 3OPXA 3D6NB 5IP5A 4W9MC 2KBFA 2D54A 3WRYC 4WKGA 4EHAA 4O2BF 1KPIA 5JCPA 4XCXA 4F06A 1ZDMA 3ACBA 3GFFA 2CLCX 5GZ6A 2ZS7A 3G82C 1C3OA 4NK5A 4CE6A 4RHCA 3FB1A 3AVTA 4GS5A 2H1SA 3WYAA 2R6R1 4I1UA 1VPTA 5E8JA 1RMQA 4A2WA 4ARZA 2YY6A 1FB5A 1RJ9A 2BUAA 3FHLA 3FFBA 2O59A 2AG5A 2BGUA 1XKXA 3FRHA 1Z0KA 4F4FA 5K0TA 2QZSA 7MHTA 4ZVMA 3GD5A 3DO6A 5GONA 3W04A 1Z4IA 1P7ZA 2ODAA 3BIWA 4TMZA 1A50B 4CF6A 2O3QA 1X1RA 1IM2A 2GFQA 4PLYA 2HLNA 3IMKA 1HZJA 3IEKA 4FX2A 2ZM5A 3L8CA 2WSSA 2BMAA 2X3UA 3LP8A 2F6RA 4GZMA 3ZV7A 1TM1E 1S9HA 4LZOA 3PRJA 1HRKA 1KNXA 4HTFA 1V48A 4Q03A 1D7AA 1YT5A 2HIHA 3GZNA 3LUBA 3FFXA 2YW2A 4NP6A 3T3GA 3ZIDA 1ECBA 3WK6A 3QPUA 5AJUA 4GKJB 4FZJA 3B89A 3PCTA 1XZNA 2NV0A 2DFNA 4HZIA 1JHDA 3DDOA 2ODPA 3HYNA 1RC0A 1VGVA 5HGJA 1VBFA 1GNSA 4CMCA 1X92A 3BCSA 2PGOA 1UWKA 1IZ0A 3ME5A 4XIIA 2GYWA 4L8FA 1Q19A 4ZAZA 3RFFA 2ZK7A 2QZ4A 4ESHA 3ZWVA 3H2SA 3SQXA 3CG4A 1F3OA 2ZJ3A 4DWJA 2VJBA 1MFZA 4KBYA 3ZJ5A 3OEHD 1K5HA 5KC8A 5F35A 2J48A 3DFZA 1Q3TA 4XI9A 4YJ2A 4GSLA 1ECPA 4LMPA 1KI9A 4NS1A 1L7RA 4QDTA 3VH1A 3IJPA 3ECSA 1TTPB 1IEWA 1BX0A 3W9UA 4FSHA 1TUBB 3AIIA 3UOAB 4HPJB 3I8SA 3OCXA 4O63O 3LA6A 5JLAA 3SEZA 3H97A 3Q7QA 3P5BA 4UCWA 3ZD6A 4N5LA 4PBSA 3COVA 1E0SA 5F3WB 3A9SA 4NG4A 4YCBA 4YV0A 4YAEA 4JYPA 1JLHA 3MILA 1O95C 2GPAA 4YECA 1JQBA 1H1DA 2HZ7A 4RHYA 3G5AA 4CYMA 4HX5A 1PJ2A 2OWDA 3IXLA 4IGIA 3Q5EA 3RUCA 4V1CA 3RB8A 1DAMA 5GY7A 5HJ5A 3UV7A 2PJRA 5CU7A 5ADVA 2HWXA 2B8WA 4Y2SA 3IEPA 2HT1A 2HGSA 2LKDA 1W36D 1T0UA 3IGFA 4BMCA 1U81A 4TV8A 5D00A 4C7KA 4DCVA 3HUUA 4ZODA 3NU1A 4LNUB 3C74A 3G8YA 1UFQA 3RTGA 1AQNA 2Q3FA 1EJ0A 3LTEA 2AH5A 1SKMA 1CP2A 3DOOA 5CBKA 4MR9A 5CFLA 2QP3A 3NT2A 3DA8A 3ESDA 5LCXA 2R6DA 4PRKA 4TTPA 4DLYA 4TWJA 4AICA 2GM5A 1TGYA 2CK3D 3B9QA 2NACA 3EOZA 4WOJA 4ED9A 1G8FA 1SOAA 1I4OA 1OC2A 2RBEA 5E1BA 5SZKB 3U1TA 1EA7A 1FQKA 3OUZA 3BIJA 5ARBA 5HIMA 5BV1A 3EG5A 5IZCC 2GBLC 3DEYX 5L4LA 4W5RA 3W8FA 4Y1GA 4FQ7A 5AUQA 2HSZA 1NI4A 1G3QA 3AESB 4OLFA 1DCFA 4YJKA 2E6KA 2NXEA 1LX6A 1TAGA 2FP4B 3CE6A 3HO6A 4DMRA 1YONA 3Q72A 3KWFA 3GQVA 3O3NB 1Z39A 2PAAA 1QYIA 3QX8A 3RYHA 4DHWA 4EJ6A 1AQJA 2M98A 4JBHA 2QSUA 4Z0NA 3EBOA 2ZUVA 4BPRA 3KJGA 4KE9A 1XCLA 4KR7A 5JADA 1CUJA 2HK9A 3JAKA 3V5NA 3H2ZA 4NCJA 2EQAA 3R9IA 5BMOA 1WBBA 2OK8A 5K0ZA 5AQ1A 1VGRA 2FPPB 1J9ZA 1JSZA 3JPWA 4XJXA 1KETA 2LTAA 3DDNA 1U0GA 1NM5C 3RHZA 2LV8A 3CVWA 4L0MA 2CHFA 2PMDA 2BI7A 4OBXA 4XW2A 4YJGA 2WHPB 2YXBA 1CJCA 1W9MA 1K0FA 4OHWA 3AP2A 2W8BB 4MW4A 2PKCA 1D5WA 5DXAA 2OYCA 3RF7A 2J9GA 2BL4A 3GZ4A 3IVMA 5J1SB 1M1NB 1EEXB 2GERA 3JSXA 3I9OA 1Z8DA 1YR3A 4N0QA 4RGBA 3ZWWA 4RFLA 3UCEA 4DBLE 3HACA 5CLGA 2D0IA 2HJVA 1GXSA 4G85A 3HWSA 3T9AA 3GLIB 1GGKA 4XVQA 2PGLA 1ZOPA 2OFWA 4ZZIA 3P52A 1NFFA 4JLDA 2M1XA 4KXQA 4UVHA 3DZDA 1P7CA 3OPNA 1TOAA 4FR0A 2W6JA 3IAHA 1ZNXA 2VSYA 4OATA 3VU0A 4QD3A 2Q6TA 5ERXA 4D4IA 1WZCA 2EHDA 4Y98A 2XITA 2CNBA 3BHMA 1XYVA 3CKKA 2YFYA 5K7SA 3P1JA 3SFTA 4B4KA 1Z25A 4JQCA 4YVFA 3THOA 4RJLA 4D79A 1LS1A 1SHUX 1YWGO 3VPBA 5C5CA 1KAEA 1SMKA 5E0KB 1P29A 3STYA 3ZX4A 9LDTA 4RETA 2F43A 3DTVB 1YOVB 3MC1A 3P9RA 4KNYA 1EDZA 3AEKB 1NASA 4PAQA 2VK4A 1NP3A 1W35A 3FE2A 3NRJA 4D98A 3G8AA 2WIAA 5JARA 4KYVA 1FU4A 3VSBA 1PJ4A 4C3ZA 1KI2A 1Z82A 2JF0A 2FPIA 3VRHA 4Y18A 4ZVOA 2B69A 1DU4A 1Q7TA 1YMQA 1Z2CA 4PZLA 5ALOA 3VZPA 3AIOA 4A7PA 2WWTA 1VHJA 4D8XA 1K4KA 1O9GA 1KGDA 2BEVB 2BKAA 3VO8A 1GKKA 2H07A 4GXQA 3FROA 1OFVA 2EZ8A 3TFOA 1O6CA 1NMXA 2E18A 3HH8A 3HO1A 3DT6A 1QP0A 4ZT3A 5IAJA 2HU8A 3I2GA 2GTPA 2AG6A 1RWQA 3E61A 4JEHA 3PNYA 1U0TA 3Q6NA 1ISMA 1IZYA 1XDBA 4FFVA 2IQ5A 4BO3A 2AGVA 1B8UA 3FNBA 4H7DA 4UNPA 3GLHA 1ETHA 3KB6A 4JGGA 5LC1A 1U1CA 4U3JB 5I7VA 2JAHA 1O9BA 4V2IA 3TLGA 4UMDA 4CTKA 4UW9A 3CHYA 1NBWB 1PEDA 4NK4A 1LBHA 1Z4PX 1BWPA 2G5CA 1CUIA 2HPZA 2YWXA 2QVYX 3E6AA 5HFAA 3RVQA 1FC0A 1JSRA 4Q3AA 4EEKA 1X1AA 3MWLA 3SS7X 3PWKA 5GONF 3DDWA 3T1VA 2FZ4A 5CIWA 2ARKA 4CCSA 3SX0A 2V6GA 3DUFA 2DTXA 4GVLA 4JQZA 4PTYA 4MS3B 4RD4A 4U7PB 2WRZA 1D2CA 3SE7A 4V38A 3OE1A 1JHPA 2OORC 3VKGA 2E3JA 4CM6A 3PBKA 2B7BA 4H3HB 3OJOA 4I3GA 1ZIXA 4WOCA 2ZIFA 1L1QA 2CYCA 1V8PA 1CERA 2CNWA 3AJAA 3INRA 1LJLA 3LRPA 3K9GA 1CZNA 1T3LA 1UP6A 1V1MA 2XMDA 3Q3IA 4GOKA 4N7JA 2AB0A 4U6QA 4ESEA 2CMFA 5LLSA 3WA6A 4CV2A 5JSFA 1O94D 4R2HA 3DNFA 3AK4A 3LYUA 4P93A 1G8HA 2YMPA 5AM3A 5DN6A 1U04A 2Q5FA 1RXCA 1X19A 1B00A 1GTG1 4J94A 1MNAA 2O7RA 1KH3A 4IILA 2HCJB 4UU7A 3MBKA 3K0FB 4MQBA 3WYBA 1RNLA 4BEBA 3IILA 4JXJA 2VSOA 1YUNA 3L7CA 1WUHS 5CCBA 5LKRA 4TT3D 1EZ4A 2FMIA 4UBKA 3I3OA 4OJNA 2XT0A 4BNUA 1A5BB 2XB8A 5IKXA 4MDEA 5H5JA 1YMVA 2H2GA 3MJ4A 4M49A 5JEDA 2CYBA 1NJGA 4FSDA 4UUOA 2LPMA 2WM2A 1YRHA 2OFOA 3QVTA 4KVFA 2EVWX 1ZLXA 3ZI0A 4ZHQA 3FRJA 1T5DX 2Q2OA 1P2BA 4MAAA 1C30A 1ZOLA 3EIEA 1QTNA 3EZ9A 4JBYA 2HTEA 3QBTA 5K51A 3AUYA 2TMYA 4AJPA 2OLJA 2WU1A 5B36A 3UJNA 1W4AA 2JAUA 5GJCA 3UFBA 4PZPA 3W5IA 1ZHFA 3HU1A 3II6X 2CKDA 3PC8C 1KIMA 4IL5A 4XLZA 5LLDA 1WCYA 3UF0A 1B73A 2IKQA 3JQBC 4UJ5A 4BAGA 2H17A 3BXFA 4G0OA 5E6UB 2C5SA 3SS9X 5JTUA 1GTVA 1YJ5A 2P8SA 1YRYE 3DM5A 4PZUA 5JAMA 1Z6AA 3DEHA 4LSZA 5JCOA 3WYCA 1VG9B 1ECFA 2ZRHA 3JASA 4Q3EA 4U6SA 3WWDA 2IYLD 3OX2A 2GVDC 4BASA 1AUVA 3CB2A 3QFFA 4G24A 3IR7A 3O73A 3H1EA 3RUEA 3ESAA 2HXYA 5JZBA 3KQOA 3P2YA 2O6LA 1HE1C 2V7PA 3C7AA 1DTSA 3VNAA 1G18A 4B33A 2PD3A 3ODGA 4QHYA 3PX2A 4HN2A 5T5QA 5CB4F 3AHGA 1S5PA 4RTMA 4DA4A 4GPIB 4O4HB 1DBQA 1OPRA 3ZDRA 5EXEA 2GN0A 2I7VA 2G0TA 3GLGA 3TRFA 1YQDA 1YAHA 4UQLA 3OJFA 4G8BA 5K8VA 1ODCA 3HKCA 3TMAA 3L07A 4FE3A 2JCXA 1VJGA 3MSCA 3OA2A 3MPOA 3NGLA 1AY0A 1EMDA 1R4MB 3CRRA 3LQQA 2OCGA 2IYPA 2QS9A 3C3AA 2XUJA 3F78A 3GJZA 2GHIA 1OI3A 3P97A 1UQUA 3GAZA 5TE9A 3MLBA 5G4LA 1JFFB 2B1JA 4PSDA 4AZ0B 3BGDA 3UBTA 1CLUA 2FUG6 3EFBA 2Z5LA 5CB8A 1VLLA 2GKGA 1DTWA 4IYRA 1MENA 1IN6A 4DJFC 1D1TA 4UATA 5AW3A 2R6FA 4ESOA 3ZHUA 3O2SB 4UBMA 4EY4A 2V3WA 3QOYA 2X9QA 4OD0A 2QRGA 2YX1A 1L4MA 1B0ZA 3NYQA 4CU5A 3H2KA 4URUR 1SR8A 5KYWB 2NO4A 5EZ5A 3NT5A 5CDSA 5BWCA 4MCAA 2QSZA 2C4TA 4KPFC 4KQWA 2FW1A 1O6BA 2WU4A 1L7PA 1ODSA 3KEOA 3MG9A 1Z2PX 3P4YA 4J4BA 1Z88A 3P2OA 3RE1A 2GK6A 3DLAA 2BR3A 2H2FA 1X1DA 3C6XA 4W5TA 4CGYA 4A0QA 1FSSA 2J0EA 2GARA 1X7DA 2GLTA 5K0CA 1H8HD 1QIIA 1QANA 3BGVA 1OZ0A 3IP5A 3RCBA 4DUPA 1NNLA 1ZONA 5KCZA 3NBKA 5K4AA 1L3CA 1HKUA 1NW3A 2P9TA 3ED5A 4U63A 1DXYA 1DAKA 4D6PA 3DHNA 3L02A 3LBAA 3MTQA 4EEZA 1DRJA 5IU6A 1JHAA 1UMBB 1DXQA 4ASUD 2NTYC 1RTKA 1XLVA 3FGPA 1G2QA 5TJHA 1HK7A 3IV7A 2FNAA 4OU4A 5EKXA 1FFGA 1QYWA 3PI7A 4LK2A 2J5RA 5AUOB 3VZQA 3FVRA 4QICA 1DKMA 4NMMA 4A0RA 4EY5A 4B3CA 3OM1A 1N9GA 5E4TA 2FX2A 3EH1A 3KUCA 3RIMA 2BKXA 1TA9A 2V0CA 3BMQA 4KBFA 5T8KC 1OWOA 3L7OA 3EQ7A 5C7OO 6Q21A 4NWIA 3UMMA 1C8KA 4MKHA 3AVPA 1Z47A 1B26A 1TVCA 3LUDA 4JEIA 3BGWA 2GUGA 3SYKA 3UZUA 2G9VA 4F5ZA 3GLFA 1FIUA 5EIAA 1II0A 3HSYA 3LCUA 3SC4A 3MOIA 1YR6A 1G8MA 4LRWA 4PC3A 2Q50A 2AOUA 3H5IA 3HC7A 4M22A 4O5AA 5EEGA 5HYVA 1AA9A 2ZITA 3HA7A 5I7SA 3BA6A 4OI4A 3WWCA 4GKBA 4R8LA 2ZWIA 3UMBA 2DJIA 4LJ7A 5B57C 3GUUA 2PZKA 2YWBA 4NMXB 2H51A 1Z9BA 1QUEA 3H7AA 3HB7A 1PJ8A 3D8SA 3KPJA 3TTXA 2Z04A 4CG3A 3GT4A 3OF2A 4ZEVA 4AQ7A 1QOQB 1EXDA 3NTRA 1JDBC 4XB6B 3NGMA 2QNBA 3I39X 3GEPA 5KYTA 1AKEA 2E9SA 1T3GA 4CMBA 5AH0A 5LOVF 4IJUA 1GR1A 4CMEC 2B78A 2EX1A 3WRYA 1T4BA 2JGDA 2FPGB 4R2KA 3DNMA 3KCQA 3LZDA 5CVVA 3JYLA 4OL9A 3ILHA 3V1MA 1W96A 3DEZA 3NHLA 1IWOA 1JPJA 1CPYA 2A0XA 2ETVA 3JAWA 5MN4A 2XNKA 2YN0A 3KJFA 4E88A 1XN4A 3WLTA 1DB3A 1FRNA 4M8SA 1FLDA 2BF4A 2NV6A 4X1IB 3LTNC 4M4SA 4XQ9A 5DN6D 2XWSA 3CX3A 2Z09A 3PUKA 1CQPA 1KQ3A 1XZHA 4BO7A 4D3YA 4K9OA 4JLKA 4DIBA 3NM4A 3OESA 3AY7A 3QEJA 4E5MA 1I8TA 2HW8A 1J8VA 5KAMA 3DKKA 3MLEA 4Q9LA 3O92A 3TINA 3WGKA 1CZUA 5IF9A 2FI1A 4AURA 4FOSA 2IYVA 2VYCA 4Q02A 3T3OA 4DSZA 2E4XA 2X8LA 1YJXA 1YV9A 3EZFA 4ZI3A 5ICMA 3DQQA 1FYDA 1GSOA 2FR8C 3HA2A 4GZ6A 4N6OA 1NF9A 1UDBA 3TYXA 4F4JA 5K8TA 3A1DA 1T4CA 1DQYA 1G3UA 5GINE 4CVNA 4E3WA 1C50A 5A0VA 2E4WA 3ZWNA 1YR9A 1BCSA 1XTZA 1NF8A 1OA1A 4RVDA 3VHXA 1QP8A 4K40A 1ZD5A 4NG5A 3LY9A 3JZIA 3RVMA 3GQBA 1JDUA 3NM6B 4HLUA 3X1JA 2QJOA 4LHXA 1IY2A 2HK8A 4MPRA 1CUWA 4NIMA 1U7ZA 1JR6A 2KW5A 3QFCA 1I0LA 4TM8A 1P1JA 4EJ2A 4WKCA 4BCBA 4QRHA 4KWEA 3HBJA 3AERA 4ZU6X 1I51A 1RBZA 1ZOSA 3GGPA 4KFCA 4DT1A 3DE2X 4QYWA 1RXUA 1DC4A 1P19A 3OECA 3WL4A 4H1WA 1GGEA 5DM70 4NF2A 5CHEA 1I1NA 1W49A 3DKIA 4NTZA 4B6GA 1VI6A 2BWJA 4ND1A 4X7BA 3WNVA 3N8HA 2GF2A 1ZEJA 2KI5A 3AZPA 1JDBB 3KQMA 4NENB 5FBZA 1FFWA 3AR2A 3WFZA 2VJLA 3NDIA 1QQ7A 3BUSA 3G5UA 2E4YA 5E4JA 1WXHA 4EIWA 3NATA 1QGYA 1YS2X 4QATA 1KZ4A 3A7EA 4QSHA 4D4GA 2X42A 1ORWA 2V5UA 1RXWA 3KPVA 1P0FA 2XCOA 2PWPA 1OXXK 2ODEA 4PC2A 2A0FA 5AKJA 5DPMA 4E2FA 4WRRA 3L5OA 4B1FA 2Q3HA 3P0HA 4C07A 2XODA 3BWXA 2EF1A 1GA4A 4UNRA 3EMDA 4QTUB 3FFWA 3O38A 1VDZA 2BEWA 3GJ7A