2CCIB

Crystal structure of phospho-cdk2 cyclin a in complex with a peptide containing both the substrate and recruitment sites of cdc6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title The role of the phospho-CDK2/cyclin A recruitment site in substrate recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cciB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cciB02
4CXAB 1XO2A 4BCPB 2IW6B 2R7GA 1JSUB 1OIYB 2C5OB 2I53A 3BHVB 5ACBA 1UNGD 2CCHB 2W96A 1OKWB 1GUXA 1H1SB 5HNBB 1H4LD 3RGFB 4RODA 1OKVB 1W98B 4YOOA 1UNLD 4BCQB 2C5VB 4F6WB 5ICPB 4EC9B 5IF1B 3BLHB 2UZDB 4ELJA 3MY1B 5HQ0B 1GUXB 5LQFB 2I40B 2W99A 3EOCB 4II5B 4FX3B 4F7LB 4YOSA 2WIHB 4F7JB 1BU2A 4KRCB 4KRDB 2CCIB 5EFQB 2WIPB 5FGKB 4BCKB 4EOIB 1GY3B 5IDNB 4CFVB 3TNHB 4F7SB 1OI9B 5HBEB 4ELLA 4EOOB 1F5QB 1UNHD 2PK9B 4EOJB 2G9XB 5BNJB 5HBHB 3DOGB 3EIDB 4YC3B 1TFBA 4BCQD 3TN8B 2V22B 2WMBB 3BLRB 5CEIB 4BCFB 4BCGB 1H1QB 2F2CA 3EJ1B 1QMZB 3O0GD 4BCND 2JGZB 1FVVB 2UZLB 2EUFA 2BPMB 4EOKB 1KXUA 2WFYB 2PMIB 5L2WB 2C5XB 4CFWB 1FINB 4ROEA 1VOLA 2WPAB 2UZEB 4CFUB 1VYWB 3BHUB 2WMAB 3TNWB 2B9RA 3DDQB 1AISB 3MIAB 4F7NB 4EORB 1OIUB 2IVXA 2X1NB 3QHWB 1OL2B 4EOPB 4UN0A 3DDPB 3K7AM 4TTHA 1OGUB 5LMKB 3MY5B 2WEVB 3H4CA 1H1PB 1OL1B 2UZBB 1URCB 4EOSB 2W9ZA 2PK2A 3G33B 2IW8B 4BCMB 4F6SB 4G6LB 3QHRB 4CFXB 1H28B 1H26B 1ZP2A 3MI9B 4NSTB 4BCIB 4CRLB 1H1RB 1JKWA 4EOMB 5I5ZB 1E9HB 1G3NC 2C5NB 3BHTB 1H27B 1AD6A 3BLQB 4I3ZB 4EONB 2W2HA 5HBJB 2QDJA 4CFMB 1JSTB 2C4GB 2WHBB 1D3UB 3POMA 1H25B 4ROCA 2W9FA 1C9BA 3M03A 4OR5B 1GH6B 4BCOB 4BCHB 4BCMD 4F6UB 1PKDB 1P5EB 3F5XB 4EOQB 1O9KA 1H24B 2IW9B 4YOZA 3LQ5B 4IMYB 4OGRB 4BCNB 1VINA 2CJMB 1JOWA 4Y72B 4CFUD 2BKZB 4EOLB 1O9KB 4F70B 3TNIB 5IDPB 2UUEB 2WXVB 5HVYB 2PHGA 4BCJB 4EC8B 4CFNB 5CYIB 1N4MA 2C6TB
chains in the Genus database with same CATH superfamily
2C5OB 1OKWB 5HNBB 1H4LD 4BY1X 5ICPB 2C5VB 4F6WB 5IF1B 5LQFB 2G77A 2ZPHB 3EOCB 4II5B 4F7JB 1BU2A 3QZ9B 4F7SB 5HBEB 4ELLA 1F5QB 4JX5A 2WMBB 3BLRB 4BCFB 3EJ1B 1QMZB 1FVVB 1KXUA 3VYHB 4CFWB 4CFUB 1AISB 1UGRB 3MIAB 1E7PA 4UN0A 3K7AM 4MFDA 4OB0B 4G6LB 3QHRB 1ZP2A 4NSTB 2D0QB 1H1RB 4MIMA 4FM4B 3DTOA 2CZ1B 3KHIA 2CZ0B 3GTMS 3X26B 2QQ8A 3BLQB 4EONB 5HBJB 2WHBB 2C4GB 4HNUA 1H25B 4ZGDB 2W9FA 3M03A 4OR5B 1UGQB 4BCNB 3VKHA 2BS2A 4Y72B 3X25B 4F70B 2PHGA 5IHYA 2ZCFB 1JSUB 1UNGD 3RGFB 1GUXA 4RODA 4BCQB 3BLHB 3A8MB 2UZDB 4ELJA 5HQ0B 3VKGA 2W99A 4FX3B 1UGPB 2CCIB 5EFQB 2DD4B 2BS4A 1GY3B 5IDNB 4EOIB 3X28B 1OI9B 3DL1A 4BBSM 1UNHD 4EOJB 5BNJB 2KR6A 5HBHB 4BCQD 2QFZA 2F2CA 2JGZB 2ZPIB 3QYHB 5L2WB 2C5XB 1UGSB 1FINB 1VOLA 2WPAB 2UZEB 3BHUB 3TW7A 2B9RA 4MFEA 4F7NB 4EORB 1AHJB 2CYZB 2IVXA 2X1NB 3HBLA 3QHWB 4EOPB 4JX4A 3DDPB 2UZBB 1URCB 4CFXB 2PK2A 3DJBA 3MI9B 4BCIB 2ZPBB 3BG9A 4EOMB 5I5ZB 1H27B 3B57A 3POMA 2KMGA 4BCHB 1IREB 1O9KA 4YOZA 3LQ5B 1VINA 2CJMB 2ZZDB 4CFUD 2CZ6B 3TNIB 2UUEB 2WXVB 4BCJB 4EC8B 4CFNB 5CYIB 4BBRM 2C6TB 4CXAB 1XO2A 2IW6B 4BXXX 3QYBA 4ZGEB 1OIYB 2I53A 3X24B 2CCHB 1H1SB 4BY7X 1OKVB 1W98B 3A8OB 4YOOA 4EC9B 4HNTA 3MY1B 2BS3A 4OB1B 4YOSA 4KRDB 2WIPB 5FGKB 4BCKB 4EOOB 2PK9B 3EIDB 4YC3B 1TFBA 5CEIB 4BCGB 4AKHA 3O0GD 4BCND 2BPMB 1QLBA 2PMIB 1FKMA 4ROEA 2WMAB 3NDQA 4AKGA 1OIUB 5DQWA 3QYGB 4LOCA 4Z6YA 1OGUB 4AKIA 3MY5B 3G33B 3X20B 1H28B 2IN3A 1H26B 4CRLB 3PO3S 4OB3B 1JKWA 4HLQA 1G3NC 2DMEA 2C5NB 2CZ7B 4I3ZB 2QDJA 4CFMB 3QWLA 1JSTB 1D3UB 1C9BA 4BCOB 1P5EB 2QDYB 3VYGB 3BG5A 2DD5B 4IMYB 2AHJB 4OGRB 3HO8A 5EJCA 3WVDB 4EOLB 5HVYB 2LW4A 3BG3A 2WJ9A 3DOGB 4BCPB 2DXCB 2R7GA 5ACBA 3BHVB 2W96A 2ZPGB 4OB2B 1UNLD 3QYEA 1GUXB 2I40B 4F7LB 2WIHB 4ZGJB 4KRCB 3QZ5B 4CFVB 3TNHB 2DPPB 2G9XB 4HL4A 4AI6A 3TN8B 2V22B 1H1QB 2UZLB 2EUFA 4EOKB 2WFYB 4JX6A 2QF7A 1VYWB 2DXBB 3A8GB 3TNWB 3DDQB 1V29B 3WVEB 3A8LB 1OL2B 4QSHA 3A8HB 4TTHA 5LMKB 2WEVB 3H4CA 1H1PB 1OL1B 3TW6A 4EOSB 2W9ZA 4BCMB 2ZPEB 2IW8B 4F6SB 4NC6A 3HHTB 1E9HB 3BHTB 1AD6A 2PJQA 3HZJA 2W2HA 1ENWA 2ZPFB 4ROCA 3HB9A 4M6VA 1GH6B 5DQVA 4BCMD 4F6UB 1PKDB 3F5XB 4EOQB 1H24B 2IW9B 1JOWA 4HNVA 2BKZB 1O9KB 5IDPB 2QGSA 1TD6A 3QXEB 1N4MA
chains in the Genus database with same CATH topology
4CXAB 1XO2A 4BCPB 2IW6B 2R7GA 1JSUB 1OIYB 2C5OB 2I53A 3BHVB 5ACBA 1UNGD 2CCHB 2W96A 1OKWB 1GUXA 1H1SB 5HNBB 1H4LD 3RGFB 4RODA 1OKVB 1W98B 4YOOA 1UNLD 4BCQB 2C5VB 4F6WB 5ICPB 4EC9B 5IF1B 3BLHB 2UZDB 4ELJA 3MY1B 5HQ0B 1GUXB 5LQFB 2I40B 2W99A 3EOCB 4II5B 4FX3B 4F7LB 4YOSA 2WIHB 4F7JB 1BU2A 4KRCB 4KRDB 2CCIB 5EFQB 2WIPB 5FGKB 4BCKB 4EOIB 1GY3B 5IDNB 4CFVB 3TNHB 4F7SB 1OI9B 5HBEB 4ELLA 4EOOB 1F5QB 1UNHD 2PK9B 4EOJB 2G9XB 5BNJB 5HBHB 3DOGB 3EIDB 4YC3B 1TFBA 4BCQD 3TN8B 2V22B 2WMBB 3BLRB 5CEIB 4BCFB 4BCGB 1H1QB 2F2CA 3EJ1B 1QMZB 3O0GD 4BCND 2JGZB 1FVVB 2UZLB 2EUFA 2BPMB 4EOKB 1KXUA 2WFYB 2PMIB 5L2WB 2C5XB 4CFWB 1FINB 4ROEA 1VOLA 2WPAB 2UZEB 4CFUB 1VYWB 3BHUB 2WMAB 3TNWB 2B9RA 3DDQB 1AISB 3MIAB 4F7NB 4EORB 1OIUB 2IVXA 2X1NB 3QHWB 1OL2B 4EOPB 4UN0A 3DDPB 3K7AM 4TTHA 1OGUB 5LMKB 3MY5B 2WEVB 3H4CA 1H1PB 1OL1B 2UZBB 1URCB 4EOSB 2W9ZA 2PK2A 3G33B 2IW8B 4BCMB 4F6SB 4G6LB 3QHRB 4CFXB 1H28B 1H26B 1ZP2A 3MI9B 4NSTB 4BCIB 4CRLB 1H1RB 1JKWA 4EOMB 5I5ZB 1E9HB 1G3NC 2C5NB 3BHTB 1H27B 1AD6A 3BLQB 4I3ZB 4EONB 2W2HA 5HBJB 2QDJA 4CFMB 1JSTB 2C4GB 2WHBB 1D3UB 3POMA 1H25B 4ROCA 2W9FA 1C9BA 3M03A 4OR5B 1GH6B 4BCOB 4BCHB 4BCMD 4F6UB 1PKDB 1P5EB 3F5XB 4EOQB 1O9KA 1H24B 2IW9B 4YOZA 3LQ5B 4IMYB 4OGRB 4BCNB 1VINA 2CJMB 1JOWA 4Y72B 4CFUD 2BKZB 4EOLB 1O9KB 4F70B 3TNIB 5IDPB 2UUEB 2WXVB 5HVYB 2PHGA 4BCJB 4EC8B 4CFNB 5CYIB 1N4MA 2C6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXA B;  1XO2 A;  4BCP B;  2IW6 B;  2R7G A;  1JSU B;  1OIY B;  2C5O B;  2I53 A;  3BHV B;  5ACB A;  1UNG D;  2CCH B;  2W96 A;  1OKW B;  1GUX A;  1H1S B;  5HNB B;  1H4L D;  3RGF B;  4ROD A;  1OKV B;  1W98 B;  4YOO A;  1UNL D;  4BCQ B;  2C5V B;  4F6W B;  5ICP B;  4EC9 B;  5IF1 B;  3BLH B;  2UZD B;  4ELJ A;  3MY1 B;  5HQ0 B;  1GUX B;  5LQF B;  2I40 B;  2W99 A;  3EOC B;  4II5 B;  4FX3 B;  4F7L B;  4YOS A;  2WIH B;  4F7J B;  1BU2 A;  4KRC B;  4KRD B;  2CCI B;  5EFQ B;  2WIP B;  5FGK B;  4BCK B;  4EOI B;  1GY3 B;  5IDN B;  4CFV B;  3TNH B;  4F7S B;  1OI9 B;  5HBE B;  4ELL A;  4EOO B;  1F5Q B;  1UNH D;  2PK9 B;  4EOJ B;  2G9X B;  5BNJ B;  5HBH B;  3DOG B;  3EID B;  4YC3 B;  1TFB A;  4BCQ D;  3TN8 B;  2V22 B;  2WMB B;  3BLR B;  5CEI B;  4BCF B;  4BCG B;  1H1Q B;  2F2C A;  3EJ1 B;  1QMZ B;  3O0G D;  4BCN D;  2JGZ B;  1FVV B;  2UZL B;  2EUF A;  2BPM B;  4EOK B;  1KXU A;  2WFY B;  2PMI B;  5L2W B;  2C5X B;  4CFW B;  1FIN B;  4ROE A;  1VOL A;  2WPA B;  2UZE B;  4CFU B;  1VYW B;  3BHU B;  2WMA B;  3TNW B;  2B9R A;  3DDQ B;  1AIS B;  3MIA B;  4F7N B;  4EOR B;  1OIU B;  2IVX A;  2X1N B;  3QHW B;  1OL2 B;  4EOP B;  4UN0 A;  3DDP B;  3K7A M;  4TTH A;  1OGU B;  5LMK B;  3MY5 B;  2WEV B;  3H4C A;  1H1P B;  1OL1 B;  2UZB B;  1URC B;  4EOS B;  2W9Z A;  2PK2 A;  3G33 B;  2IW8 B;  4BCM B;  4F6S B;  4G6L B;  3QHR B;  4CFX B;  1H28 B;  1H26 B;  1ZP2 A;  3MI9 B;  4NST B;  4BCI B;  4CRL B;  1H1R B;  1JKW A;  4EOM B;  5I5Z B;  1E9H B;  1G3N C;  2C5N B;  3BHT B;  1H27 B;  1AD6 A;  3BLQ B;  4I3Z B;  4EON B;  2W2H A;  5HBJ B;  2QDJ A;  4CFM B;  1JST B;  2C4G B;  2WHB B;  1D3U B;  3POM A;  1H25 B;  4ROC A;  2W9F A;  1C9B A;  3M03 A;  4OR5 B;  1GH6 B;  4BCO B;  4BCH B;  4BCM D;  4F6U B;  1PKD B;  1P5E B;  3F5X B;  4EOQ B;  1O9K A;  1H24 B;  2IW9 B;  4YOZ A;  3LQ5 B;  4IMY B;  4OGR B;  4BCN B;  1VIN A;  2CJM B;  1JOW A;  4Y72 B;  4CFU D;  2BKZ B;  4EOL B;  1O9K B;  4F70 B;  3TNI B;  5IDP B;  2UUE B;  2WXV B;  5HVY B;  2PHG A;  4BCJ B;  4EC8 B;  4CFN B;  5CYI B;  1N4M A;  2C6T B; 
#chains in the Genus database with same CATH topology
 2C5O B;  1OKW B;  5HNB B;  1H4L D;  4BY1 X;  5ICP B;  2C5V B;  4F6W B;  5IF1 B;  5LQF B;  2G77 A;  2ZPH B;  3EOC B;  4II5 B;  4F7J B;  1BU2 A;  3QZ9 B;  4F7S B;  5HBE B;  4ELL A;  1F5Q B;  4JX5 A;  2WMB B;  3BLR B;  4BCF B;  3EJ1 B;  1QMZ B;  1FVV B;  1KXU A;  3VYH B;  4CFW B;  4CFU B;  1AIS B;  1UGR B;  3MIA B;  1E7P A;  4UN0 A;  3K7A M;  4MFD A;  4OB0 B;  4G6L B;  3QHR B;  1ZP2 A;  4NST B;  2D0Q B;  1H1R B;  4MIM A;  4FM4 B;  3DTO A;  2CZ1 B;  3KHI A;  2CZ0 B;  3GTM S;  3X26 B;  2QQ8 A;  3BLQ B;  4EON B;  5HBJ B;  2WHB B;  2C4G B;  4HNU A;  1H25 B;  4ZGD B;  2W9F A;  3M03 A;  4OR5 B;  1UGQ B;  4BCN B;  3VKH A;  2BS2 A;  4Y72 B;  3X25 B;  4F70 B;  2PHG A;  5IHY A;  2ZCF B;  1JSU B;  1UNG D;  3RGF B;  1GUX A;  4ROD A;  4BCQ B;  3BLH B;  3A8M B;  2UZD B;  4ELJ A;  5HQ0 B;  3VKG A;  2W99 A;  4FX3 B;  1UGP B;  2CCI B;  5EFQ B;  2DD4 B;  2BS4 A;  1GY3 B;  5IDN B;  4EOI B;  3X28 B;  1OI9 B;  3DL1 A;  4BBS M;  1UNH D;  4EOJ B;  5BNJ B;  2KR6 A;  5HBH B;  4BCQ D;  2QFZ A;  2F2C A;  2JGZ B;  2ZPI B;  3QYH B;  5L2W B;  2C5X B;  1UGS B;  1FIN B;  1VOL A;  2WPA B;  2UZE B;  3BHU B;  3TW7 A;  2B9R A;  4MFE A;  4F7N B;  4EOR B;  1AHJ B;  2CYZ B;  2IVX A;  2X1N B;  3HBL A;  3QHW B;  4EOP B;  4JX4 A;  3DDP B;  2UZB B;  1URC B;  4CFX B;  2PK2 A;  3DJB A;  3MI9 B;  4BCI B;  2ZPB B;  3BG9 A;  4EOM B;  5I5Z B;  1H27 B;  3B57 A;  3POM A;  2KMG A;  4BCH B;  1IRE B;  1O9K A;  4YOZ A;  3LQ5 B;  1VIN A;  2CJM B;  2ZZD B;  4CFU D;  2CZ6 B;  3TNI B;  2UUE B;  2WXV B;  4BCJ B;  4EC8 B;  4CFN B;  5CYI B;  4BBR M;  2C6T B;  4CXA B;  1XO2 A;  2IW6 B;  4BXX X;  3QYB A;  4ZGE B;  1OIY B;  2I53 A;  3X24 B;  2CCH B;  1H1S B;  4BY7 X;  1OKV B;  1W98 B;  3A8O B;  4YOO A;  4EC9 B;  4HNT A;  3MY1 B;  2BS3 A;  4OB1 B;  4YOS A;  4KRD B;  2WIP B;  5FGK B;  4BCK B;  4EOO B;  2PK9 B;  3EID B;  4YC3 B;  1TFB A;  5CEI B;  4BCG B;  4AKH A;  3O0G D;  4BCN D;  2BPM B;  1QLB A;  2PMI B;  1FKM A;  4ROE A;  2WMA B;  3NDQ A;  4AKG A;  1OIU B;  5DQW A;  3QYG B;  4LOC A;  4Z6Y A;  1OGU B;  4AKI A;  3MY5 B;  3G33 B;  3X20 B;  1H28 B;  2IN3 A;  1H26 B;  4CRL B;  3PO3 S;  4OB3 B;  1JKW A;  4HLQ A;  1G3N C;  2DME A;  2C5N B;  2CZ7 B;  4I3Z B;  2QDJ A;  4CFM B;  3QWL A;  1JST B;  1D3U B;  1C9B A;  4BCO B;  1P5E B;  2QDY B;  3VYG B;  3BG5 A;  2DD5 B;  4IMY B;  2AHJ B;  4OGR B;  3HO8 A;  5EJC A;  3WVD B;  4EOL B;  5HVY B;  2LW4 A;  3BG3 A;  2WJ9 A;  3DOG B;  4BCP B;  2DXC B;  2R7G A;  5ACB A;  3BHV B;  2W96 A;  2ZPG B;  4OB2 B;  1UNL D;  3QYE A;  1GUX B;  2I40 B;  4F7L B;  2WIH B;  4ZGJ B;  4KRC B;  3QZ5 B;  4CFV B;  3TNH B;  2DPP B;  2G9X B;  4HL4 A;  4AI6 A;  3TN8 B;  2V22 B;  1H1Q B;  2UZL B;  2EUF A;  4EOK B;  2WFY B;  4JX6 A;  2QF7 A;  1VYW B;  2DXB B;  3A8G B;  3TNW B;  3DDQ B;  1V29 B;  3WVE B;  3A8L B;  1OL2 B;  4QSH A;  3A8H B;  4TTH A;  5LMK B;  2WEV B;  3H4C A;  1H1P B;  1OL1 B;  3TW6 A;  4EOS B;  2W9Z A;  4BCM B;  2ZPE B;  2IW8 B;  4F6S B;  4NC6 A;  3HHT B;  1E9H B;  3BHT B;  1AD6 A;  2PJQ A;  3HZJ A;  2W2H A;  1ENW A;  2ZPF B;  4ROC A;  3HB9 A;  4M6V A;  1GH6 B;  5DQV A;  4BCM D;  4F6U B;  1PKD B;  3F5X B;  4EOQ B;  1H24 B;  2IW9 B;  1JOW A;  4HNV A;  2BKZ B;  1O9K B;  5IDP B;  2QGS A;  1TD6 A;  3QXE B;  1N4M A; 
#chains in the Genus database with same CATH homology
 4CXA B;  1XO2 A;  4BCP B;  2IW6 B;  2R7G A;  1JSU B;  1OIY B;  2C5O B;  2I53 A;  3BHV B;  5ACB A;  1UNG D;  2CCH B;  2W96 A;  1OKW B;  1GUX A;  1H1S B;  5HNB B;  1H4L D;  3RGF B;  4ROD A;  1OKV B;  1W98 B;  4YOO A;  1UNL D;  4BCQ B;  2C5V B;  4F6W B;  5ICP B;  4EC9 B;  5IF1 B;  3BLH B;  2UZD B;  4ELJ A;  3MY1 B;  5HQ0 B;  1GUX B;  5LQF B;  2I40 B;  2W99 A;  3EOC B;  4II5 B;  4FX3 B;  4F7L B;  4YOS A;  2WIH B;  4F7J B;  1BU2 A;  4KRC B;  4KRD B;  2CCI B;  5EFQ B;  2WIP B;  5FGK B;  4BCK B;  4EOI B;  1GY3 B;  5IDN B;  4CFV B;  3TNH B;  4F7S B;  1OI9 B;  5HBE B;  4ELL A;  4EOO B;  1F5Q B;  1UNH D;  2PK9 B;  4EOJ B;  2G9X B;  5BNJ B;  5HBH B;  3DOG B;  3EID B;  4YC3 B;  1TFB A;  4BCQ D;  3TN8 B;  2V22 B;  2WMB B;  3BLR B;  5CEI B;  4BCF B;  4BCG B;  1H1Q B;  2F2C A;  3EJ1 B;  1QMZ B;  3O0G D;  4BCN D;  2JGZ B;  1FVV B;  2UZL B;  2EUF A;  2BPM B;  4EOK B;  1KXU A;  2WFY B;  2PMI B;  5L2W B;  2C5X B;  4CFW B;  1FIN B;  4ROE A;  1VOL A;  2WPA B;  2UZE B;  4CFU B;  1VYW B;  3BHU B;  2WMA B;  3TNW B;  2B9R A;  3DDQ B;  1AIS B;  3MIA B;  4F7N B;  4EOR B;  1OIU B;  2IVX A;  2X1N B;  3QHW B;  1OL2 B;  4EOP B;  4UN0 A;  3DDP B;  3K7A M;  4TTH A;  1OGU B;  5LMK B;  3MY5 B;  2WEV B;  3H4C A;  1H1P B;  1OL1 B;  2UZB B;  1URC B;  4EOS B;  2W9Z A;  2PK2 A;  3G33 B;  2IW8 B;  4BCM B;  4F6S B;  4G6L B;  3QHR B;  4CFX B;  1H28 B;  1H26 B;  1ZP2 A;  3MI9 B;  4NST B;  4BCI B;  4CRL B;  1H1R B;  1JKW A;  4EOM B;  5I5Z B;  1E9H B;  1G3N C;  2C5N B;  3BHT B;  1H27 B;  1AD6 A;  3BLQ B;  4I3Z B;  4EON B;  2W2H A;  5HBJ B;  2QDJ A;  4CFM B;  1JST B;  2C4G B;  2WHB B;  1D3U B;  3POM A;  1H25 B;  4ROC A;  2W9F A;  1C9B A;  3M03 A;  4OR5 B;  1GH6 B;  4BCO B;  4BCH B;  4BCM D;  4F6U B;  1PKD B;  1P5E B;  3F5X B;  4EOQ B;  1O9K A;  1H24 B;  2IW9 B;  4YOZ A;  3LQ5 B;  4IMY B;  4OGR B;  4BCN B;  1VIN A;  2CJM B;  1JOW A;  4Y72 B;  4CFU D;  2BKZ B;  4EOL B;  1O9K B;  4F70 B;  3TNI B;  5IDP B;  2UUE B;  2WXV B;  5HVY B;  2PHG A;  4BCJ B;  4EC8 B;  4CFN B;  5CYI B;  1N4M A;  2C6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...