2CCQA

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'GSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
molecule tags Glycoprotein
source organism Homo sapiens
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
total genus 32
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ccqA00
2HPLA 2D5UA 4P0BA 4P09A 5LJNA 2HPJA 4OYKA 5LJMA 4P0AA 2CM0A 4JUYA 2CCQA 4OYJA
chains in the Genus database with same CATH superfamily
3P4PA 3AAEB 2ACZA 3PU8A 3RYIE 4DMVA 5CFBA 1J5WA 3T8OA 2DWGA 2PTFA 2J62A 2MBGA 5ABHA 1X9BA 2IUBA 4HWIB 3WAJA 2E9XD 4OX9T 5FMNA 4GK5E 3NVOA 2WWUA 2KMFA 2QA7A 2XQ3A 4LF5T 2BKPA 2QRXA 3RYCE 4IHJE 4JUYA 1OEDE 1N34T 5LHGB 5AQMB 3KINB 4IE7A 2BKOA 5JDMA 3EHZA 3N9OA 3ZC1A 2FUPA 4IDZA 4AQYT 1HNZT 4U7YA 3J7Yq 3M65A 3RC8A 4AQFA 2YOEA 5AQTB 4HFBA 4O2AE 2BS2A 2DCFA 2YK0A 4B6XA 1ZOYA 4ZI7E 2X0YA 5JDHA 1ZKEA 4DV3T 2ES0A 2JQKA 2OLTA 2P9BA 3RIAA 4K0UA 3ZC0A 2IHR1 4GYRA 4WBOA 5FVKA 2A2FX 5L3EB 1QSDA 2VKDA 2XAJB 2RPAA 2XSBA 3HKEE 2ZM6T 2W63A 3HKDE 2HH7A 5DQWA 3SRZA 3V5SA 4HFIA 4HWCA 3ZMTB 4IE0A 4ZOLE 4ZHQE 4YHHT 1MMAA 2FJDA 1YD8G 4YTMA 2OA5A 2E9XA 2PG8A 3ONXA 3RH3A 5EK2A 1UX4A 2WDQA 3LBXA 3P7IA 5AQKB 2CA5A 4OYKA 4TX5A 1Z0PA 4AIUA 1W0AA 4OK0A 2VKJA 2K9AA 3N9QA 3C50A 4HWDA 3LDQB 1KEYA 2H3RA 1ZV4X 2AE9A 4NPPA 4ISSA 4I43B 4U2YA 3LBXB 5JRCA 4HFHA 4LFBT 2JQ9A 1VRBA 3AAAB 5HXEA 4IE4A 4O2BE 3DTOA 5EZYE 3GMIA 4HTEA 5BR8T 2XZEA 2XY8B 3MZKB 1QLBA 3ZKRA 3DP7A 5L2LA 4B3RT 1XDPA 2H7OA 2WDRA 4O4HE 4LFCT 3P50A 3RIUC 3PDYA 4DUZT 2CPTA 2E8IA 2QVAA 3E08A 4F6RC 2BVMA 1LKXA 4J2CA 3T1YT 4TUYE 4H63V 2I59A 4BA9A 1XNRT 1HTJF 1WFDA 2Y48B 4HFEA 4UELA 3RIFA 1XMQT 3OKQA 4C90A 2KSRA 2V8SV 1Y64B 4QX8B 2IW5B 4CI1B 2LHNA 4DV0T 5LNKA 3SOLA 5AQHB 3PUZF 4I4TE 2YEVC 5FXWA 2YDSA 5J2TE 1KFYA 2LHRA 3GWHA 3C98B 1D1AA 1YXRA 3ANWB 3OJAA 3UUMA 3N2KE 2KWIB 2ZLYA 4HWHA 3RPUA 2XAGB 3PUGA 1YW0A 4KP3C 4KHPT 1WYCA 4ZI2C 2WZHA 3FB2A 4DR7T 3FZHB 5AFUL 4IE5A 2CWYA 1XDOA 5L4EA 2KLQA 5HWXA 3KVBA 4Z8XA 5CGMA 4QHOA 3ZEFB 2EHOC 4PK5A 4TWFA 4PK6A 4HFCA 5LMNT 5FY0A 5AQQB 1LRZA 4U74A 5HCJA 5FY1A 2D5UA 2WB5A 3MK7C 4P1NA 2LJLA 2HPJA 1XZYA 4UEMA 4X5TA 3ZYLA 1WYBA 5AQUB 3RQUA 3OBVE 2BS3A 2JIWA 5JRCB 4ZZCA 2MOZA 3FZLB 3RI5A 2W0GA 2JMKA 2CHOA 1M7KA 4YJ2E 5JH7E 3N9LA 3EAMA 5LBMA 1R8IA 5HEJA 3K3NA 4JI2T 3IF8B 2WY2A 2W00A 1VCSA 4JBWF 3JAFA 3UU4A 3ZCIA 2V1DB 2UXNB 4DO0A 4EGWA 3O4XE 3X1DA 3AEGA 2VK9A 4TZ4C 5KX5E 5LJMA 2UXDT 1NENA 3AEEA 2YU2A 3PUWF 5HCMA 4QKNA 5FXZA 1ZHCA 1W09A 3A5XA 2WDVA 1SUMB 2LM2A 3AA0B 3AE2A 4BJNA 5JQGE 4JI8T 4NXMT 2BG9A 2OV9A 2ZMAA 3T1HT 1HS7A 4H9QC 3RC3A 2HPLA 2NW8A 3E0ZA 3NKZA 2DL1A 2LRKA 5DQVA 2VURA 2YKSA 1IZNB 1M62A 2JJ9A 3ZJ2A 4DV2T 1KK7A 2XQ9A 3P4WA 4ZZBA 3CMLA 1IAPA 1WR6A 2VL8A 1GQEA 1MMGA 4HFVA 4QXHB 2HN1A 4UV9B 4MHCA 4X1KE 3U3IA 4A97A 4DV6T 3K3OA 4XZCA 2D0UA 2X9XA 2V7JA 1YKEB 3BQLA 3AE8A 2BDEA 2CCQA 3CQGB 3EVYA 5CB4E 1E1HB 5LGTB 3KVAA 3NZQA 4AKIA 2MAWA 3PJAJ 2KWHA 4X64T 2M6IA 4DV5T 3MACA 5FY7A 5LB7B 5LXTE 2NP9A 2XUEA 4ZS2A 2W2UA 4NUVA 4EV6A 3EUHA 5L47A 3G06A 3HKBE 4Z91A 1MIWA 3NRXA 4ILCA 4U33A 4H9RC 3AA6B 5L3GB 2Q9QD 2UUCT 1Z8UA 3PV0F 4PAGA 5KMGP 2MTQA 4H9OC 4EEDA 3I1AA 3ESLA 3N9NA 2XASB 2NTXA 4L9IA 3S4UA 2UXCT 2ZM0A 2CLYC 2IMLA 3AEAA 2W66A 4UVAB 5CA1E 3AAIA 3BQIA 2X9WA 4H63H 2LE8A 3QOFA 4GKJT 2VB6A 3AE5A 4HGAA 2UU9T 4PJLA 5AQGB 3SWHA 4EAHA 4TWHA 5LG4A 4MBQA 3L3PA 2NOXA 2XQ8A 3AE1A 2WU2A 2WS3A 3C64A 3V5UA 2DI4A 4I0UA 2W61A 4ANJA 2WU5A 5FVLA 3P4SA 3RLFF 3TKLB 1FMVA 4AI6A 3VR9A 3ZT7A 1MMNA 3RYFE 2J4GA 4AQFC 4B3TT 1CUNA 5A1LA 3ZT5A 3KV9A 3OTOT 5AQPB 1I6ZA 1WRDA 2BZBA 2V5DA 4JLEA 4LF9T 3FZFB 5AQIB 2BG9E 2X67A 4UF0A 3HR0A 2V6YA 2PFVA 2ZM2A 3UU3A 5LP6E 3AVSA 4LF6T 3B57A 1W9RA 4U3CA 3KV4A 3UTKA 2WQYA 1FMWA 4UR9A 2I0MA 1U4QA 4AISA 4KX6A 3O1JA 5HXRA 3HL6A 3QB5A 5L3DB 2VQFT 2X68A 2X0HA 4UXNB 4YHJA 5FKYA 3LSVA 4TWDA 3QK6A 3ONJA 1YQ4A 5FNVE 1BR2A 5AQOB 2IC9A 3AE7A 3IA3A 4G2AA 5FL0A 5HEOA 1J5ET 4DR6T 2LKGA 5F5WA 2R6GF 4QWNB 1W0BA 3FBZA 4ZXLA 3RIUA 3I9YA 1SE7A 2XSAA 3HI2A 3TLTA 4A5XA 2C5KT 2NW7A 4BJMA 5LOVE 3UFEA 4MFRA 3PUQA 4WZXA 1ZP0A 3PUXF 3QC9A 4OHFA 3C51A 3DJBA 1XMOT 2XQ5A 1T8BA 3CQCB 1EZ3A 3Q5EA 4UF0B 2VQET 4GOUA 1S94A 1HNXT 3A7MA 4N78D 3SS1A 3CIRA 4YFSA 3O1IA 5H6QB 5JDNA 2LLYA 2Q9QA 2XQ7A 3EDUA 1KNZA 2N9DA 2FBWA 3PUVF 4ILUA 5C2TA 3UULA 2CXFA 2V26A 3B5MA 3F31A 1B7TA 5JDLA 2UXXB 3RF1A 2B1EA 4G63A 4X20E 4LF8T 3JCFA 3ZN0B 3EABA 1NAFA 3OVUA 3VHLA 1N36T 3QNUA 4CXYA 1JNZA 2CXLA 2LM9A 5H6RB 2FJAA 4EXTA 5CJ5A 4DR1T 5HYAA 2XHEB 4X1YE 5HXCA 4YT0A 4O4IE 4MALA 5LMUT 4HEAA 4YLHA 3ZCJA 1XNQT 4JV5T 5LYJE 2LOPA 3TLVA 3Q2MA 2VL0A 3AXJA 3PE0A 2DLRA 4QH4A 4QXCB 4TV9E 4Z90A 4HWFA 4JI4T 1KNRA 3ZT6A 4NUUA 2WM9A 4A56A 4XBFB 2CE7A 4B3ST 1J1JA 2V5CA 3MKDA 3N2GE 2WSSV 2D2SA 4IE6A 1D0XA 5HEUA 5LHIB 3LK2B 5JR9A 2UUAT 3HKCE 3J9X1 5J1GA 3AA7B 4PFPA 5M4YA 5FP3A 1G73A 4QXBB 3JC6D 2KT9A 3CX6B 3OYZA 2VVNA 5AQVB 5L4HA 3RHWA 5C3JA 1MNDA 1HFAA 2Z6EA 4DNDA 4LMKA 4IDPA 4YTNA 5AQJB 2IC6A 5J0ZA 2QGSA 1JNRA 3FHNA 3VKHA 4ZEYA 3PUSA 3I0QA 4HKAA 4HN9A 3FZKB 3P8CD 3SFEA 3K3QC 1S35A 3KBUA 3TLUA 1WCRA 2CLYB 4DIDB 2M67A 4GKKT 2C0SA 2DHRA 1D0ZA 4AKRB 4WBNE 5ABEA 1E7PA 5HXSA 2HHHT 4TN7B 4ILBA 2UUBT 3LK3B 2X51A 2LKHA 3BK9A 2Y6XA 3QB5K 3KFWX 4ASKA 1AJ3A 3N2OA 3PUYF 3FXDB 2BG9C 4PJJA 2E2AA 2ODVA 4ZI3C 3WAKA 3UUNA 3ZLIA 1SHZC 4CXWA 5ADXL 4LF7T 4AKLA 2QYWA 1HF8A 4DR5T 3ETUA 5LG3A 4IT4A 3CKDA 4FJOA 1HCIA 1YQ3A 3L39A 2K5BB 1O3XA 2DWKA 1HX1B 1VOMA 3I9WA 4QH1A 3ZSSA 1V9DA 4ERRA 3LK42 2XPKA 1LVFA 2E5VA 3H37A 1NEKA 3Q5DA 4AQGA 1D1BA 3KBTA 4QX7B 2V6XA 2K3WA 4V1Av 3PJAA 5LHHB 2N2NA 3UU6A 5ABFA 4COFA 5AQLB 2H7VC 4AKHA 3VR8A 1D1CA 2L8KA 4FI5A 1QUUA 4I55E 1US7B 5LCYA 2EHOD 4YTPA 2IIUA 3ZMUB 5L3CB 1OWAA 2X66A 5HEGA 5KDMC 4HE8A 4JI3T 1G8XA 2NWBA 2M6BA 5JREA 5DJQC 2LOSA 4PFOA 3IHRA 5EK3A 5HWYA 4E7ZA 5TAOA 3BQKA 3RRWA 5FYMA 2YN6A 3LFMA 1VCTA 3L8RA 1D0YA 4X65T 3RKOA 1HG2A 3K1SA 2J1DG 4EYYR 4P0BA 5GONE 2V7LA 4H9SE 5ETWA 5IWAT 2H88A 4LFAT 2I6HA 3ETVA 5J2UE 4AKGA 3K8PC 2JMHA 1OEDA 3AEDA 5KXJA 2UXBT 3PURA 1UGOA 2C5JA 3E22E 3Q5WA 4U7IA 2WCAA 3N9MA 3UUXB 2XAQB 4ISTA 4U72A 4EZ4A 4EEBA 1FEWA 3FZMB 3ZYKA 4CN6A 1X79A 4I50E 1T72A 1OXZA 3MJXA 2HN2A 4B3MT 4O8SA 5LGUB 5F3JA 3CVRA 4OYJA 4JI7T 2KINB 3P4QA 4DR2T 2FJEA 1MNEA 4F8HA 4DV7T 2J47A 2IAKA 4CN1A 2BVLA 3CQXC 5LBQB 3QUJA 4EZHA 5ABFB 2K24A 1KNPA 2FJBA 3AB3B 2D0TA 2D9DA 2WBLA 4O4JE 3SFDA 2BS4A 2N1GA 2XQAA 3Q9DA 2VVSA 4PW8A 3UU8A 3ZMVB 3PTRB 4CN4A 5HAXA 3OPCA 1WLXA 2ODUA 2W4XA 2NTYA 4U31A 5IYZE 3EI0A 4ADZA 1H7CA 2WP9A 2PJQA 4JEUB 1L0VA 5LJNA 4DBQA 2XAFB 4JI0T 2L3LA 4A98A 1XWMA 4Q25A 3LG7A 3ONLC 1N33T 4JYAT 3FBLA 4P09A 3R84B 2W62A 2GK9A 2MYSA 3C4ZA 2CXDA 4LMJA 4MLKA 4U2ZA 3ZYMA 4AXPA 3O9XA 4NXNT 4GK0E 4KMCA 3ANWA 3AVRA 4KHZF 5AQRB 4JI5T 4ZI2D 5C8YE 2CMRA 4M1PA 2V7KA 2XAHB 3C4XA 5E0OA 3AE9A 2LSIA 2LSKA 3AEFA 3N9PA 3UQ7A 4EOZB 1FJGT 2K48A 4H9NC 2XM2A 1UCUA 5CA0E 4YJ3E 2ZM8A 3P4RA 3AE3A 3LJCA 3W15B 2LT3A 4K0KT 3CX8B 3O1HA 2E5LT 1MMDA 3ZSTA 2CWOA 4TNWA 4LMLA 2G0UA 1NWMX 1BR4A 2XQ6A 2A9UA 4IGUA 4ZS3A 3ZJ1A 4CI3B 1HNWT 2MPKA 5JR9B 3UUBA 2XM1A 4YY3T 4KBMB 3NBXX 2PBIA 4YSXA 5JR9C 4GYSA 3HA4A 3M3ZB 1BR0A 4E7SA 3PUAA 3ZPOA 4CI2B 4EIWA 4JI1T 3B13A 5ABGA 4TV8E 5IUXA 1IBMT 1T7SA 3RX6A 2WAUA 5DABA 4IREA 3TLSA 4KI0F 2LSJA 2F4VT 3OYXA 4IL9A 1MIVA 2WMNA 2W67A 1HG5A 2E9XB 2RA1A 3L09A 4IDQA 4QH5A 4BAYB 4WNKA 2WZIA 2H89A 2LSYA 3F57A 4CZZB 4OFZA 3N5LA 4TNVA 2A3DA 4IDNA 4ILAA 2X0LB 2EHOB 3RGLA 2JRKA 4X1IE 3UQ4A 4IL4A 3U78A 3ZMSB 3C4WA 3RRCA 5L3BB 1OEDC 4PNIA 2CBJA 2KZ7B 3KV5A 1U5PA 2CHNA 3JAEA 4GIWA 4NIQA 1SA0E 3I0OA 1UK5A 3H3AA 4IDOA 5FL1A 4PJNA 2VKHA 1UUSA 3KDSE 2JQQA 2L9QA 4L5GA 4UVBB 2YDQA 1OEDB 4H9PC 3ZN1B 5L3FB 5JDQA 3AEBA 4WW0A 4DUYT 5JDGA 4DBRA 4LF4T 2LSGA 3AE4A 3D0TA 2KNDA 1Y01A 2C5IT 3R6NA 2AXDS 4L0RA 2VWAA 4X66T 2CBIA 2LEHA 2VASA 2V7MA 2BKNA 4YSYA 3AECA 2A72A 2DNXA 1DU2A 1UX5A 5IHYA 2XQYA 3CWZB 4UVCB 3NZPA 4PK4A 4HFDA 4UIGA 3UT5E 4WYVA 4DR4T 3VRAA 2V6YB 3UU5A 2E9XC 2YU1A 3H3MA 2XTLA 1YKHB 2JPFA 3FXEB 2BG9B 3AA1B 3CX7B 2WMOA 4YXDA 3JC6C 1LVKA 4JEHB 5HEHA 2SPCA 2YINA 4DMWA 4P0AA 2VKOA 2RP4A 3JADA 3AXJB 2NW9A 1KF6A 3EDVA 4IIJE 4DVDA 5JTGA 5LGNB 4DR3T 4EYUA 2JQHA 1E2AA 3UFGA 3VU7H 2CEAA 3F2EA 1HR0T 2WWVA 1BR1A 2ACXA 2YDRA 3CPZA 3GN5B 1T98A 5AQFB 3RKGA 3NRYA 2NR4A 1N32T 1IBLT 2B76A 3IEEA 3PU3A 5EK4A 2KXPB 2X9YA 5F8PA 5JVDE 3RQWA 2IDOB 4KUMB 5JDFA 1UURA 2BBHA 4PJMA 2BBJA 2V7IA 4DV4T 1I94T 4EB6E 4X62T 1MIYA 1CHUA 3WI3A 2X9HA 4DV1T 2XQ4A 2CRBA 2Q9QB 3GN5A 3VRBA 4C91A 5HXHA 3A8YC 3Q5XA 3TLWA 3GA8A 2XJ7A 4UV8B 3NWIA 3IBPA 3ZMZB 2EHOA 2LRLA 4ZI3D 3KV6A 1ZEEA 4CQIA 5FXXA 2Y8DA 3CK6A 4O4LE 4JI6T 2CM0A 4XAXB 3MA9A 1IJ5A 3AE6A 3MXZA 5FXVA 4YSZA 3VKGA 1FIOA 5LA6E 5BMVE 3RYHE 1IJ6A 3ABVA 1HX8A 1IBKT 2Q9QC 5AQNB 1WR0A 4CXXA 5AQSB
chains in the Genus database with same CATH topology
3AAEB 3RYIE 3PU8A 4DMVA 3T8OA 2DWGA 2MBGA 2E9XD 5FMNA 4GK5E 2WWUA 2KMFA 2QA7A 3RYCE 4IHJE 4JUYA 5LHGB 3KINB 4IE7A 5JDMA 3N9OA 4IDZA 3J7Yq 3RC8A 3M65A 4AQFA 4O2AE 2DCFA 2YK0A 4B6XA 5JDHA 4ZI7E 1ZKEA 2ES0A 2P9BA 3ZC0A 4K0UA 4GYRA 4WBOA 5L3EB 2A2FX 1QSDA 2VKDA 2XAJB 3HKEE 2W63A 3HKDE 2HH7A 5DQWA 3SRZA 3V5SA 3ZMTB 4IE0A 4ZOLE 4ZHQE 1MMAA 1YD8G 2OA5A 2E9XA 2PG8A 3ONXA 3RH3A 5EK2A 1UX4A 3LBXA 3P7IA 2CA5A 4OYKA 4TX5A 1Z0PA 4OK0A 2VKJA 2K9AA 3N9QA 3C50A 2H3RA 1ZV4X 4ISSA 4I43B 3LBXB 1VRBA 3AAAB 5HXEA 4IE4A 4O2BE 3DTOA 5EZYE 3GMIA 4HTEA 3MZKB 3DP7A 5L2LA 2H7OA 4O4HE 3PDYA 2E8IA 3E08A 4F6RC 2BVMA 1LKXA 4J2CA 4TUYE 4H63V 2I59A 4BA9A 1HTJF 2Y48B 4UELA 3OKQA 4C90A 1Y64B 4QX8B 2IW5B 4CI1B 2LHNA 5LNKA 3SOLA 4I4TE 5FXWA 2YEVC 5J2TE 2LHRA 3GWHA 3C98B 1D1AA 3ANWB 3OJAA 3UUMA 3N2KE 2KWIB 2ZLYA 3RPUA 2XAGB 3PUGA 1YW0A 4KP3C 1WYCA 4ZI2C 3FB2A 5AFUL 4IE5A 2CWYA 2KLQA 5HWXA 3KVBA 4Z8XA 4QHOA 3ZEFB 2EHOC 4PK5A 4PK6A 5FY0A 1LRZA 4U74A 5FY1A 2D5UA 3MK7C 2LJLA 2HPJA 4UEMA 3ZYLA 1WYBA 3OBVE 5JRCB 2MOZA 2W0GA 2JMKA 5JH7E 4YJ2E 3N9LA 5LBMA 3K3NA 3IF8B 2W00A 3ZCIA 2V1DB 2UXNB 4DO0A 3O4XE 2VK9A 4TZ4C 5KX5E 5LJMA 2YU2A 4QKNA 5FXZA 1ZHCA 3A5XA 3AA0B 4BJNA 5JQGE 2ZMAA 1HS7A 4H9QC 3RC3A 2HPLA 2NW8A 3E0ZA 5DQVA 1IZNB 2JJ9A 3ZJ2A 1KK7A 3CMLA 1IAPA 1WR6A 2VL8A 4QXHB 1MMGA 4HFVA 4UV9B 4X1KE 3U3IA 4MHCA 3K3OA 4XZCA 2D0UA 2X9XA 2V7JA 1YKEB 3BQLA 3CQGB 2BDEA 2CCQA 3EVYA 5CB4E 1E1HB 5LGTB 3KVAA 3NZQA 4AKIA 2KWHA 3MACA 5FY7A 5LXTE 2NP9A 2XUEA 4ZS2A 4NUVA 3EUHA 3HKBE 1MIWA 3NRXA 4H9RC 3AA6B 5L3GB 2Q9QD 5KMGP 4PAGA 2MTQA 4H9OC 3I1AA 3ESLA 3N9NA 2XASB 2NTXA 4L9IA 3S4UA 2ZM0A 2CLYC 4UVAB 3AAIA 3BQIA 2X9WA 4H63H 2LE8A 2VB6A 4HGAA 4PJLA 3SWHA 4EAHA 5LG4A 4MBQA 3L3PA 2NOXA 3C64A 3V5UA 2DI4A 4ANJA 2W61A 3TKLB 1FMVA 4AI6A 1MMNA 3RYFE 4AQFC 1CUNA 5A1LA 3KV9A 1WRDA 2BZBA 4JLEA 2X67A 4UF0A 3HR0A 2ZM2A 2PFVA 5LP6E 3AVSA 3B57A 3KV4A 3UTKA 1FMWA 1U4QA 5HXRA 3O1JA 5L3DB 3HL6A 2X68A 4YHJA 4UXNB 3QK6A 5FNVE 1BR2A 2IC9A 4G2AA 4QWNB 3FBZA 3I9YA 3HI2A 2C5KT 2NW7A 4BJMA 5LOVE 3UFEA 4MFRA 3PUQA 3QC9A 4OHFA 3C51A 3DJBA 3CQCB 4UF0B 1EZ3A 4GOUA 1S94A 4N78D 3SS1A 4YFSA 5H6QB 3O1IA 5JDNA 1KNZA 2Q9QA 3EDUA 2N9DA 4ILUA 3UULA 2CXFA 2V26A 3F31A 1B7TA 5JDLA 2UXXB 2B1EA 4G63A 4X20E 3ZN0B 1NAFA 3VHLA 2CXLA 2LM9A 5H6RB 4EXTA 5HYAA 2XHEB 4X1YE 5HXCA 4O4IE 4MALA 4HEAA 4YLHA 3ZCJA 5LYJE 2LOPA 3Q2MA 4QXCB 4TV9E 3PE0A 2DLRA 4NUUA 2WM9A 4A56A 4XBFB 2CE7A 3N2GE 3MKDA 4IE6A 2WSSV 2D2SA 5LHIB 1D0XA 3LK2B 5JR9A 3HKCE 3J9X1 5J1GA 3AA7B 4PFPA 5M4YA 5FP3A 1G73A 4QXBB 3JC6D 2KT9A 3CX6B 3OYZA 1MNDA 1HFAA 2Z6EA 4DNDA 2IC6A 2QGSA 3VKHA 3FHNA 3PUSA 3I0QA 4HKAA 4HN9A 3P8CD 3K3QC 1S35A 3KBUA 2CLYB 2M67A 2C0SA 2DHRA 1D0ZA 4AKRB 4WBNE 5HXSA 4TN7B 3LK3B 2X51A 3BK9A 2Y6XA 3KFWX 4ASKA 1AJ3A 3N2OA 3FXDB 4PJJA 4ZI3C 2ODVA 3ZLIA 4CXWA 3WAKA 3UUNA 1SHZC 5ADXL 4AKLA 1HF8A 3ETUA 3CKDA 4FJOA 1HCIA 2K5BB 1O3XA 2DWKA 3I9WA 1VOMA 4ERRA 1V9DA 3LK42 1LVFA 3H37A 5CA0E 4AQGA 1D1BA 3KBTA 4QX7B 4V1Av 5LHHB 2N2NA 2H7VC 4AKHA 1D1CA 2L8KA 4FI5A 1QUUA 4I55E 1US7B 5LCYA 2EHOD 5L3CB 3ZMUB 1OWAA 2X66A 5KDMC 4HE8A 1G8XA 2NWBA 5JREA 5DJQC 2LOSA 4PFOA 3IHRA 5EK3A 5HWYA 4E7ZA 5TAOA 3BQKA 5FYMA 3LFMA 1D0YA 3RKOA 1HG2A 2J1DG 4EYYR 4P0BA 5GONE 2V7LA 4H9SE 5ETWA 3ETVA 5J2UE 4AKGA 3K8PC 2JMHA 3PURA 2C5JA 3E22E 3Q5WA 3N9MA 3UUXB 2XAQB 4ISTA 4U72A 4EZ4A 1FEWA 3ZYKA 1X79A 4I50E 3MJXA 1OXZA 4O8SA 5LGUB 5F3JA 3CVRA 4OYJA 2KINB 1MNEA 2IAKA 2BVLA 3CQXC 5LBQB 3QUJA 4EZHA 2K24A 3AB3B 2D0TA 2WBLA 4O4JE 5CA1E 2N1GA 4PW8A 3Q9DA 3ZMVB 3PTRB 5HAXA 1WLXA 2ODUA 2NTYA 4ADZA 5IYZE 1H7CA 4JEUB 2PJQA 5LJNA 4DBQA 2XAFB 2L3LA 3LG7A 3FBLA 4P09A 3R84B 2W62A 2GK9A 2MYSA 3C4ZA 2CXDA 4MLKA 3ZYMA 3O9XA 4AXPA 4GK0E 4KMCA 3ANWA 3AVRA 4ZI2D 5C8YE 2CMRA 4M1PA 2V7KA 2XAHB 3C4XA 5E0OA 2LSIA 2LSKA 3N9PA 2K48A 4H9NC 1UCUA 4YJ3E 2ZM8A 3W15B 3LJCA 2LT3A 3CX8B 3O1HA 1MMDA 3WAJA 2CWOA 4ZS3A 2G0UA 1NWMX 1BR4A 4CXYA 4IGUA 3ZJ1A 4CI3B 5JR9B 4KBMB 3NBXX 2PBIA 5JR9C 4GYSA 3HA4A 1BR0A 4E7SA 3PUAA 3ZPOA 4CI2B 4EIWA 3B13A 4TV8E 3RX6A 2WAUA 5DABA 2LSJA 3OYXA 1MIVA 2WMNA 4BAYB 1HG5A 2E9XB 2RA1A 3L09A 4WNKA 2LSYA 3F57A 4CZZB 4OFZA 3N5LA 2A3DA 2X0LB 2EHOB 3ZMSB 2JRKA 4X1IE 5L3BB 3U78A 3C4WA 3RRCA 4PNIA 2KZ7B 3KV5A 1U5PA 4GIWA 1SA0E 3I0OA 3H3AA 4PJNA 2VKHA 3KDSE 2JQQA 2L9QA 4L5GA 4UVBB 3ZN1B 4H9PC 5L3FB 5JDQA 4WW0A 5JDGA 4DBRA 2LSGA 3D0TA 2KNDA 2C5IT 3R6NA 4L0RA 2VWAA 2LEHA 2VASA 2V7MA 2A72A 2DNXA 1UX5A 5IHYA 2XQYA 3CWZB 4UVCB 3NZPA 4PK4A 4UIGA 3UT5E 3ZC1A 4EOZB 2E9XC 2YU1A 2XTLA 1YKHB 2JPFA 3FXEB 3AA1B 3CX7B 2WMOA 3JC6C 1LVKA 4JEHB 2SPCA 2YINA 4DMWA 4P0AA 2VKOA 2RP4A 2NW9A 5LGNB 3EDVA 4IIJE 4DVDA 4EYUA 3VU7H 2CEAA 3F2EA 1BR1A 2ACXA 3GN5B 3CPZA 1T98A 3NRYA 3PU3A 3IEEA 5EK4A 2KXPB 2X9YA 5F8PA 5JVDE 5JRCA 4KUMB 5JDFA 4PJMA 2V7IA 4EB6E 1MIYA 3WI3A 2X9HA 3GN5A 2Q9QB 5HXHA 4C91A 3Q5XA 3GA8A 4UV8B 3ZMZB 3IBPA 2EHOA 4ZI3D 3KV6A 1ZEEA 4CQIA 5FXXA 2Y8DA 4O4LE 2CM0A 4XAXB 3MA9A 1IJ5A 5FXVA 3MXZA 3VKGA 1FIOA 5LA6E 5BMVE 3RYHE 1IJ6A 1HX8A 2Q9QC 3RRWA 4CXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPL A;  2D5U A;  4P0B A;  4P09 A;  5LJN A;  2HPJ A;  4OYK A;  5LJM A;  4P0A A;  2CM0 A;  4JUY A;  2CCQ A;  4OYJ A; 
#chains in the Genus database with same CATH topology
 3P4P A;  3AAE B;  2ACZ A;  3PU8 A;  3RYI E;  4DMV A;  5CFB A;  1J5W A;  3T8O A;  2DWG A;  2PTF A;  2J62 A;  2MBG A;  5ABH A;  1X9B A;  2IUB A;  4HWI B;  3WAJ A;  2E9X D;  4OX9 T;  5FMN A;  4GK5 E;  3NVO A;  2WWU A;  2KMF A;  2QA7 A;  2XQ3 A;  4LF5 T;  2BKP A;  2QRX A;  3RYC E;  4IHJ E;  4JUY A;  1OED E;  1N34 T;  5LHG B;  5AQM B;  3KIN B;  4IE7 A;  2BKO A;  5JDM A;  3EHZ A;  3N9O A;  3ZC1 A;  2FUP A;  4IDZ A;  4AQY T;  1HNZ T;  4U7Y A;  3J7Y q;  3M65 A;  3RC8 A;  4AQF A;  2YOE A;  5AQT B;  4HFB A;  4O2A E;  2BS2 A;  2DCF A;  2YK0 A;  4B6X A;  1ZOY A;  4ZI7 E;  2X0Y A;  5JDH A;  1ZKE A;  4DV3 T;  2ES0 A;  2JQK A;  2OLT A;  2P9B A;  3RIA A;  4K0U A;  3ZC0 A;  2IHR 1;  4GYR A;  4WBO A;  5FVK A;  2A2F X;  5L3E B;  1QSD A;  2VKD A;  2XAJ B;  2RPA A;  2XSB A;  3HKE E;  2ZM6 T;  2W63 A;  3HKD E;  2HH7 A;  5DQW A;  3SRZ A;  3V5S A;  4HFI A;  4HWC A;  3ZMT B;  4IE0 A;  4ZOL E;  4ZHQ E;  4YHH T;  1MMA A;  2FJD A;  1YD8 G;  4YTM A;  2OA5 A;  2E9X A;  2PG8 A;  3ONX A;  3RH3 A;  5EK2 A;  1UX4 A;  2WDQ A;  3LBX A;  3P7I A;  5AQK B;  2CA5 A;  4OYK A;  4TX5 A;  1Z0P A;  4AIU A;  1W0A A;  4OK0 A;  2VKJ A;  2K9A A;  3N9Q A;  3C50 A;  4HWD A;  3LDQ B;  1KEY A;  2H3R A;  1ZV4 X;  2AE9 A;  4NPP A;  4ISS A;  4I43 B;  4U2Y A;  3LBX B;  5JRC A;  4HFH A;  4LFB T;  2JQ9 A;  1VRB A;  3AAA B;  5HXE A;  4IE4 A;  4O2B E;  3DTO A;  5EZY E;  3GMI A;  4HTE A;  5BR8 T;  2XZE A;  2XY8 B;  3MZK B;  1QLB A;  3ZKR A;  3DP7 A;  5L2L A;  4B3R T;  1XDP A;  2H7O A;  2WDR A;  4O4H E;  4LFC T;  3P50 A;  3RIU C;  3PDY A;  4DUZ T;  2CPT A;  2E8I A;  2QVA A;  3E08 A;  4F6R C;  2BVM A;  1LKX A;  4J2C A;  3T1Y T;  4TUY E;  4H63 V;  2I59 A;  4BA9 A;  1XNR T;  1HTJ F;  1WFD A;  2Y48 B;  4HFE A;  4UEL A;  3RIF A;  1XMQ T;  3OKQ A;  4C90 A;  2KSR A;  2V8S V;  1Y64 B;  4QX8 B;  2IW5 B;  4CI1 B;  2LHN A;  4DV0 T;  5LNK A;  3SOL A;  5AQH B;  3PUZ F;  4I4T E;  2YEV C;  5FXW A;  2YDS A;  5J2T E;  1KFY A;  2LHR A;  3GWH A;  3C98 B;  1D1A A;  1YXR A;  3ANW B;  3OJA A;  3UUM A;  3N2K E;  2KWI B;  2ZLY A;  4HWH A;  3RPU A;  2XAG B;  3PUG A;  1YW0 A;  4KP3 C;  4KHP T;  1WYC A;  4ZI2 C;  2WZH A;  3FB2 A;  4DR7 T;  3FZH B;  5AFU L;  4IE5 A;  2CWY A;  1XDO A;  5L4E A;  2KLQ A;  5HWX A;  3KVB A;  4Z8X A;  5CGM A;  4QHO A;  3ZEF B;  2EHO C;  4PK5 A;  4TWF A;  4PK6 A;  4HFC A;  5LMN T;  5FY0 A;  5AQQ B;  1LRZ A;  4U74 A;  5HCJ A;  5FY1 A;  2D5U A;  2WB5 A;  3MK7 C;  4P1N A;  2LJL A;  2HPJ A;  1XZY A;  4UEM A;  4X5T A;  3ZYL A;  1WYB A;  5AQU B;  3RQU A;  3OBV E;  2BS3 A;  2JIW A;  5JRC B;  4ZZC A;  2MOZ A;  3FZL B;  3RI5 A;  2W0G A;  2JMK A;  2CHO A;  1M7K A;  4YJ2 E;  5JH7 E;  3N9L A;  3EAM A;  5LBM A;  1R8I A;  5HEJ A;  3K3N A;  4JI2 T;  3IF8 B;  2WY2 A;  2W00 A;  1VCS A;  4JBW F;  3JAF A;  3UU4 A;  3ZCI A;  2V1D B;  2UXN B;  4DO0 A;  4EGW A;  3O4X E;  3X1D A;  3AEG A;  2VK9 A;  4TZ4 C;  5KX5 E;  5LJM A;  2UXD T;  1NEN A;  3AEE A;  2YU2 A;  3PUW F;  5HCM A;  4QKN A;  5FXZ A;  1ZHC A;  1W09 A;  3A5X A;  2WDV A;  1SUM B;  2LM2 A;  3AA0 B;  3AE2 A;  4BJN A;  5JQG E;  4JI8 T;  4NXM T;  2BG9 A;  2OV9 A;  2ZMA A;  3T1H T;  1HS7 A;  4H9Q C;  3RC3 A;  2HPL A;  2NW8 A;  3E0Z A;  3NKZ A;  2DL1 A;  2LRK A;  5DQV A;  2VUR A;  2YKS A;  1IZN B;  1M62 A;  2JJ9 A;  3ZJ2 A;  4DV2 T;  1KK7 A;  2XQ9 A;  3P4W A;  4ZZB A;  3CML A;  1IAP A;  1WR6 A;  2VL8 A;  1GQE A;  1MMG A;  4HFV A;  4QXH B;  2HN1 A;  4UV9 B;  4MHC A;  4X1K E;  3U3I A;  4A97 A;  4DV6 T;  3K3O A;  4XZC A;  2D0U A;  2X9X A;  2V7J A;  1YKE B;  3BQL A;  3AE8 A;  2BDE A;  2CCQ A;  3CQG B;  3EVY A;  5CB4 E;  1E1H B;  5LGT B;  3KVA A;  3NZQ A;  4AKI A;  2MAW A;  3PJA J;  2KWH A;  4X64 T;  2M6I A;  4DV5 T;  3MAC A;  5FY7 A;  5LB7 B;  5LXT E;  2NP9 A;  2XUE A;  4ZS2 A;  2W2U A;  4NUV A;  4EV6 A;  3EUH A;  5L47 A;  3G06 A;  3HKB E;  4Z91 A;  1MIW A;  3NRX A;  4ILC A;  4U33 A;  4H9R C;  3AA6 B;  5L3G B;  2Q9Q D;  2UUC T;  1Z8U A;  3PV0 F;  4PAG A;  5KMG P;  2MTQ A;  4H9O C;  4EED A;  3I1A A;  3ESL A;  3N9N A;  2XAS B;  2NTX A;  4L9I A;  3S4U A;  2UXC T;  2ZM0 A;  2CLY C;  2IML A;  3AEA A;  2W66 A;  4UVA B;  5CA1 E;  3AAI A;  3BQI A;  2X9W A;  4H63 H;  2LE8 A;  3QOF A;  4GKJ T;  2VB6 A;  3AE5 A;  4HGA A;  2UU9 T;  4PJL A;  5AQG B;  3SWH A;  4EAH A;  4TWH A;  5LG4 A;  4MBQ A;  3L3P A;  2NOX A;  2XQ8 A;  3AE1 A;  2WU2 A;  2WS3 A;  3C64 A;  3V5U A;  2DI4 A;  4I0U A;  2W61 A;  4ANJ A;  2WU5 A;  5FVL A;  3P4S A;  3RLF F;  3TKL B;  1FMV A;  4AI6 A;  3VR9 A;  3ZT7 A;  1MMN A;  3RYF E;  2J4G A;  4AQF C;  4B3T T;  1CUN A;  5A1L A;  3ZT5 A;  3KV9 A;  3OTO T;  5AQP B;  1I6Z A;  1WRD A;  2BZB A;  2V5D A;  4JLE A;  4LF9 T;  3FZF B;  5AQI B;  2BG9 E;  2X67 A;  4UF0 A;  3HR0 A;  2V6Y A;  2PFV A;  2ZM2 A;  3UU3 A;  5LP6 E;  3AVS A;  4LF6 T;  3B57 A;  1W9R A;  4U3C A;  3KV4 A;  3UTK A;  2WQY A;  1FMW A;  4UR9 A;  2I0M A;  1U4Q A;  4AIS A;  4KX6 A;  3O1J A;  5HXR A;  3HL6 A;  3QB5 A;  5L3D B;  2VQF T;  2X68 A;  2X0H A;  4UXN B;  4YHJ A;  5FKY A;  3LSV A;  4TWD A;  3QK6 A;  3ONJ A;  1YQ4 A;  5FNV E;  1BR2 A;  5AQO B;  2IC9 A;  3AE7 A;  3IA3 A;  4G2A A;  5FL0 A;  5HEO A;  1J5E T;  4DR6 T;  2LKG A;  5F5W A;  2R6G F;  4QWN B;  1W0B A;  3FBZ A;  4ZXL A;  3RIU A;  3I9Y A;  1SE7 A;  2XSA A;  3HI2 A;  3TLT A;  4A5X A;  2C5K T;  2NW7 A;  4BJM A;  5LOV E;  3UFE A;  4MFR A;  3PUQ A;  4WZX A;  1ZP0 A;  3PUX F;  3QC9 A;  4OHF A;  3C51 A;  3DJB A;  1XMO T;  2XQ5 A;  1T8B A;  3CQC B;  1EZ3 A;  3Q5E A;  4UF0 B;  2VQE T;  4GOU A;  1S94 A;  1HNX T;  3A7M A;  4N78 D;  3SS1 A;  3CIR A;  4YFS A;  3O1I A;  5H6Q B;  5JDN A;  2LLY A;  2Q9Q A;  2XQ7 A;  3EDU A;  1KNZ A;  2N9D A;  2FBW A;  3PUV F;  4ILU A;  5C2T A;  3UUL A;  2CXF A;  2V26 A;  3B5M A;  3F31 A;  1B7T A;  5JDL A;  2UXX B;  3RF1 A;  2B1E A;  4G63 A;  4X20 E;  4LF8 T;  3JCF A;  3ZN0 B;  3EAB A;  1NAF A;  3OVU A;  3VHL A;  1N36 T;  3QNU A;  4CXY A;  1JNZ A;  2CXL A;  2LM9 A;  5H6R B;  2FJA A;  4EXT A;  5CJ5 A;  4DR1 T;  5HYA A;  2XHE B;  4X1Y E;  5HXC A;  4YT0 A;  4O4I E;  4MAL A;  5LMU T;  4HEA A;  4YLH A;  3ZCJ A;  1XNQ T;  4JV5 T;  5LYJ E;  2LOP A;  3TLV A;  3Q2M A;  2VL0 A;  3AXJ A;  3PE0 A;  2DLR A;  4QH4 A;  4QXC B;  4TV9 E;  4Z90 A;  4HWF A;  4JI4 T;  1KNR A;  3ZT6 A;  4NUU A;  2WM9 A;  4A56 A;  4XBF B;  2CE7 A;  4B3S T;  1J1J A;  2V5C A;  3MKD A;  3N2G E;  2WSS V;  2D2S A;  4IE6 A;  1D0X A;  5HEU A;  5LHI B;  3LK2 B;  5JR9 A;  2UUA T;  3HKC E;  3J9X 1;  5J1G A;  3AA7 B;  4PFP A;  5M4Y A;  5FP3 A;  1G73 A;  4QXB B;  3JC6 D;  2KT9 A;  3CX6 B;  3OYZ A;  2VVN A;  5AQV B;  5L4H A;  3RHW A;  5C3J A;  1MND A;  1HFA A;  2Z6E A;  4DND A;  4LMK A;  4IDP A;  4YTN A;  5AQJ B;  2IC6 A;  5J0Z A;  2QGS A;  1JNR A;  3FHN A;  3VKH A;  4ZEY A;  3PUS A;  3I0Q A;  4HKA A;  4HN9 A;  3FZK B;  3P8C D;  3SFE A;  3K3Q C;  1S35 A;  3KBU A;  3TLU A;  1WCR A;  2CLY B;  4DID B;  2M67 A;  4GKK T;  2C0S A;  2DHR A;  1D0Z A;  4AKR B;  4WBN E;  5ABE A;  1E7P A;  5HXS A;  2HHH T;  4TN7 B;  4ILB A;  2UUB T;  3LK3 B;  2X51 A;  2LKH A;  3BK9 A;  2Y6X A;  3QB5 K;  3KFW X;  4ASK A;  1AJ3 A;  3N2O A;  3PUY F;  3FXD B;  2BG9 C;  4PJJ A;  2E2A A;  2ODV A;  4ZI3 C;  3WAK A;  3UUN A;  3ZLI A;  1SHZ C;  4CXW A;  5ADX L;  4LF7 T;  4AKL A;  2QYW A;  1HF8 A;  4DR5 T;  3ETU A;  5LG3 A;  4IT4 A;  3CKD A;  4FJO A;  1HCI A;  1YQ3 A;  3L39 A;  2K5B B;  1O3X A;  2DWK A;  1HX1 B;  1VOM A;  3I9W A;  4QH1 A;  3ZSS A;  1V9D A;  4ERR A;  3LK4 2;  2XPK A;  1LVF A;  2E5V A;  3H37 A;  1NEK A;  3Q5D A;  4AQG A;  1D1B A;  3KBT A;  4QX7 B;  2V6X A;  2K3W A;  4V1A v;  3PJA A;  5LHH B;  2N2N A;  3UU6 A;  5ABF A;  4COF A;  5AQL B;  2H7V C;  4AKH A;  3VR8 A;  1D1C A;  2L8K A;  4FI5 A;  1QUU A;  4I55 E;  1US7 B;  5LCY A;  2EHO D;  4YTP A;  2IIU A;  3ZMU B;  5L3C B;  1OWA A;  2X66 A;  5HEG A;  5KDM C;  4HE8 A;  4JI3 T;  1G8X A;  2NWB A;  2M6B A;  5JRE A;  5DJQ C;  2LOS A;  4PFO A;  3IHR A;  5EK3 A;  5HWY A;  4E7Z A;  5TAO A;  3BQK A;  3RRW A;  5FYM A;  2YN6 A;  3LFM A;  1VCT A;  3L8R A;  1D0Y A;  4X65 T;  3RKO A;  1HG2 A;  3K1S A;  2J1D G;  4EYY R;  4P0B A;  5GON E;  2V7L A;  4H9S E;  5ETW A;  5IWA T;  2H88 A;  4LFA T;  2I6H A;  3ETV A;  5J2U E;  4AKG A;  3K8P C;  2JMH A;  1OED A;  3AED A;  5KXJ A;  2UXB T;  3PUR A;  1UGO A;  2C5J A;  3E22 E;  3Q5W A;  4U7I A;  2WCA A;  3N9M A;  3UUX B;  2XAQ B;  4IST A;  4U72 A;  4EZ4 A;  4EEB A;  1FEW A;  3FZM B;  3ZYK A;  4CN6 A;  1X79 A;  4I50 E;  1T72 A;  1OXZ A;  3MJX A;  2HN2 A;  4B3M T;  4O8S A;  5LGU B;  5F3J A;  3CVR A;  4OYJ A;  4JI7 T;  2KIN B;  3P4Q A;  4DR2 T;  2FJE A;  1MNE A;  4F8H A;  4DV7 T;  2J47 A;  2IAK A;  4CN1 A;  2BVL A;  3CQX C;  5LBQ B;  3QUJ A;  4EZH A;  5ABF B;  2K24 A;  1KNP A;  2FJB A;  3AB3 B;  2D0T A;  2D9D A;  2WBL A;  4O4J E;  3SFD A;  2BS4 A;  2N1G A;  2XQA A;  3Q9D A;  2VVS A;  4PW8 A;  3UU8 A;  3ZMV B;  3PTR B;  4CN4 A;  5HAX A;  3OPC A;  1WLX A;  2ODU A;  2W4X A;  2NTY A;  4U31 A;  5IYZ E;  3EI0 A;  4ADZ A;  1H7C A;  2WP9 A;  2PJQ A;  4JEU B;  1L0V A;  5LJN A;  4DBQ A;  2XAF B;  4JI0 T;  2L3L A;  4A98 A;  1XWM A;  4Q25 A;  3LG7 A;  3ONL C;  1N33 T;  4JYA T;  3FBL A;  4P09 A;  3R84 B;  2W62 A;  2GK9 A;  2MYS A;  3C4Z A;  2CXD A;  4LMJ A;  4MLK A;  4U2Z A;  3ZYM A;  4AXP A;  3O9X A;  4NXN T;  4GK0 E;  4KMC A;  3ANW A;  3AVR A;  4KHZ F;  5AQR B;  4JI5 T;  4ZI2 D;  5C8Y E;  2CMR A;  4M1P A;  2V7K A;  2XAH B;  3C4X A;  5E0O A;  3AE9 A;  2LSI A;  2LSK A;  3AEF A;  3N9P A;  3UQ7 A;  4EOZ B;  1FJG T;  2K48 A;  4H9N C;  2XM2 A;  1UCU A;  5CA0 E;  4YJ3 E;  2ZM8 A;  3P4R A;  3AE3 A;  3LJC A;  3W15 B;  2LT3 A;  4K0K T;  3CX8 B;  3O1H A;  2E5L T;  1MMD A;  3ZST A;  2CWO A;  4TNW A;  4LML A;  2G0U A;  1NWM X;  1BR4 A;  2XQ6 A;  2A9U A;  4IGU A;  4ZS3 A;  3ZJ1 A;  4CI3 B;  1HNW T;  2MPK A;  5JR9 B;  3UUB A;  2XM1 A;  4YY3 T;  4KBM B;  3NBX X;  2PBI A;  4YSX A;  5JR9 C;  4GYS A;  3HA4 A;  3M3Z B;  1BR0 A;  4E7S A;  3PUA A;  3ZPO A;  4CI2 B;  4EIW A;  4JI1 T;  3B13 A;  5ABG A;  4TV8 E;  5IUX A;  1IBM T;  1T7S A;  3RX6 A;  2WAU A;  5DAB A;  4IRE A;  3TLS A;  4KI0 F;  2LSJ A;  2F4V T;  3OYX A;  4IL9 A;  1MIV A;  2WMN A;  2W67 A;  1HG5 A;  2E9X B;  2RA1 A;  3L09 A;  4IDQ A;  4QH5 A;  4BAY B;  4WNK A;  2WZI A;  2H89 A;  2LSY A;  3F57 A;  4CZZ B;  4OFZ A;  3N5L A;  4TNV A;  2A3D A;  4IDN A;  4ILA A;  2X0L B;  2EHO B;  3RGL A;  2JRK A;  4X1I E;  3UQ4 A;  4IL4 A;  3U78 A;  3ZMS B;  3C4W A;  3RRC A;  5L3B B;  1OED C;  4PNI A;  2CBJ A;  2KZ7 B;  3KV5 A;  1U5P A;  2CHN A;  3JAE A;  4GIW A;  4NIQ A;  1SA0 E;  3I0O A;  1UK5 A;  3H3A A;  4IDO A;  5FL1 A;  4PJN A;  2VKH A;  1UUS A;  3KDS E;  2JQQ A;  2L9Q A;  4L5G A;  4UVB B;  2YDQ A;  1OED B;  4H9P C;  3ZN1 B;  5L3F B;  5JDQ A;  3AEB A;  4WW0 A;  4DUY T;  5JDG A;  4DBR A;  4LF4 T;  2LSG A;  3AE4 A;  3D0T A;  2KND A;  1Y01 A;  2C5I T;  3R6N A;  2AXD S;  4L0R A;  2VWA A;  4X66 T;  2CBI A;  2LEH A;  2VAS A;  2V7M A;  2BKN A;  4YSY A;  3AEC A;  2A72 A;  2DNX A;  1DU2 A;  1UX5 A;  5IHY A;  2XQY A;  3CWZ B;  4UVC B;  3NZP A;  4PK4 A;  4HFD A;  4UIG A;  3UT5 E;  4WYV A;  4DR4 T;  3VRA A;  2V6Y B;  3UU5 A;  2E9X C;  2YU1 A;  3H3M A;  2XTL A;  1YKH B;  2JPF A;  3FXE B;  2BG9 B;  3AA1 B;  3CX7 B;  2WMO A;  4YXD A;  3JC6 C;  1LVK A;  4JEH B;  5HEH A;  2SPC A;  2YIN A;  4DMW A;  4P0A A;  2VKO A;  2RP4 A;  3JAD A;  3AXJ B;  2NW9 A;  1KF6 A;  3EDV A;  4IIJ E;  4DVD A;  5JTG A;  5LGN B;  4DR3 T;  4EYU A;  2JQH A;  1E2A A;  3UFG A;  3VU7 H;  2CEA A;  3F2E A;  1HR0 T;  2WWV A;  1BR1 A;  2ACX A;  2YDR A;  3CPZ A;  3GN5 B;  1T98 A;  5AQF B;  3RKG A;  3NRY A;  2NR4 A;  1N32 T;  1IBL T;  2B76 A;  3IEE A;  3PU3 A;  5EK4 A;  2KXP B;  2X9Y A;  5F8P A;  5JVD E;  3RQW A;  2IDO B;  4KUM B;  5JDF A;  1UUR A;  2BBH A;  4PJM A;  2BBJ A;  2V7I A;  4DV4 T;  1I94 T;  4EB6 E;  4X62 T;  1MIY A;  1CHU A;  3WI3 A;  2X9H A;  4DV1 T;  2XQ4 A;  2CRB A;  2Q9Q B;  3GN5 A;  3VRB A;  4C91 A;  5HXH A;  3A8Y C;  3Q5X A;  3TLW A;  3GA8 A;  2XJ7 A;  4UV8 B;  3NWI A;  3IBP A;  3ZMZ B;  2EHO A;  2LRL A;  4ZI3 D;  3KV6 A;  1ZEE A;  4CQI A;  5FXX A;  2Y8D A;  3CK6 A;  4O4L E;  4JI6 T;  2CM0 A;  4XAX B;  3MA9 A;  1IJ5 A;  3AE6 A;  3MXZ A;  5FXV A;  4YSZ A;  3VKG A;  1FIO A;  5LA6 E;  5BMV E;  3RYH E;  1IJ6 A;  3ABV A;  1HX8 A;  1IBK T;  2Q9Q C;  5AQN B;  1WR0 A;  4CXX A;  5AQS B; 
#chains in the Genus database with same CATH homology
 3AAE B;  3RYI E;  3PU8 A;  4DMV A;  3T8O A;  2DWG A;  2MBG A;  2E9X D;  5FMN A;  4GK5 E;  2WWU A;  2KMF A;  2QA7 A;  3RYC E;  4IHJ E;  4JUY A;  5LHG B;  3KIN B;  4IE7 A;  5JDM A;  3N9O A;  4IDZ A;  3J7Y q;  3RC8 A;  3M65 A;  4AQF A;  4O2A E;  2DCF A;  2YK0 A;  4B6X A;  5JDH A;  4ZI7 E;  1ZKE A;  2ES0 A;  2P9B A;  3ZC0 A;  4K0U A;  4GYR A;  4WBO A;  5L3E B;  2A2F X;  1QSD A;  2VKD A;  2XAJ B;  3HKE E;  2W63 A;  3HKD E;  2HH7 A;  5DQW A;  3SRZ A;  3V5S A;  3ZMT B;  4IE0 A;  4ZOL E;  4ZHQ E;  1MMA A;  1YD8 G;  2OA5 A;  2E9X A;  2PG8 A;  3ONX A;  3RH3 A;  5EK2 A;  1UX4 A;  3LBX A;  3P7I A;  2CA5 A;  4OYK A;  4TX5 A;  1Z0P A;  4OK0 A;  2VKJ A;  2K9A A;  3N9Q A;  3C50 A;  2H3R A;  1ZV4 X;  4ISS A;  4I43 B;  3LBX B;  1VRB A;  3AAA B;  5HXE A;  4IE4 A;  4O2B E;  3DTO A;  5EZY E;  3GMI A;  4HTE A;  3MZK B;  3DP7 A;  5L2L A;  2H7O A;  4O4H E;  3PDY A;  2E8I A;  3E08 A;  4F6R C;  2BVM A;  1LKX A;  4J2C A;  4TUY E;  4H63 V;  2I59 A;  4BA9 A;  1HTJ F;  2Y48 B;  4UEL A;  3OKQ A;  4C90 A;  1Y64 B;  4QX8 B;  2IW5 B;  4CI1 B;  2LHN A;  5LNK A;  3SOL A;  4I4T E;  5FXW A;  2YEV C;  5J2T E;  2LHR A;  3GWH A;  3C98 B;  1D1A A;  3ANW B;  3OJA A;  3UUM A;  3N2K E;  2KWI B;  2ZLY A;  3RPU A;  2XAG B;  3PUG A;  1YW0 A;  4KP3 C;  1WYC A;  4ZI2 C;  3FB2 A;  5AFU L;  4IE5 A;  2CWY A;  2KLQ A;  5HWX A;  3KVB A;  4Z8X A;  4QHO A;  3ZEF B;  2EHO C;  4PK5 A;  4PK6 A;  5FY0 A;  1LRZ A;  4U74 A;  5FY1 A;  2D5U A;  3MK7 C;  2LJL A;  2HPJ A;  4UEM A;  3ZYL A;  1WYB A;  3OBV E;  5JRC B;  2MOZ A;  2W0G A;  2JMK A;  5JH7 E;  4YJ2 E;  3N9L A;  5LBM A;  3K3N A;  3IF8 B;  2W00 A;  3ZCI A;  2V1D B;  2UXN B;  4DO0 A;  3O4X E;  2VK9 A;  4TZ4 C;  5KX5 E;  5LJM A;  2YU2 A;  4QKN A;  5FXZ A;  1ZHC A;  3A5X A;  3AA0 B;  4BJN A;  5JQG E;  2ZMA A;  1HS7 A;  4H9Q C;  3RC3 A;  2HPL A;  2NW8 A;  3E0Z A;  5DQV A;  1IZN B;  2JJ9 A;  3ZJ2 A;  1KK7 A;  3CML A;  1IAP A;  1WR6 A;  2VL8 A;  4QXH B;  1MMG A;  4HFV A;  4UV9 B;  4X1K E;  3U3I A;  4MHC A;  3K3O A;  4XZC A;  2D0U A;  2X9X A;  2V7J A;  1YKE B;  3BQL A;  3CQG B;  2BDE A;  2CCQ A;  3EVY A;  5CB4 E;  1E1H B;  5LGT B;  3KVA A;  3NZQ A;  4AKI A;  2KWH A;  3MAC A;  5FY7 A;  5LXT E;  2NP9 A;  2XUE A;  4ZS2 A;  4NUV A;  3EUH A;  3HKB E;  1MIW A;  3NRX A;  4H9R C;  3AA6 B;  5L3G B;  2Q9Q D;  5KMG P;  4PAG A;  2MTQ A;  4H9O C;  3I1A A;  3ESL A;  3N9N A;  2XAS B;  2NTX A;  4L9I A;  3S4U A;  2ZM0 A;  2CLY C;  4UVA B;  3AAI A;  3BQI A;  2X9W A;  4H63 H;  2LE8 A;  2VB6 A;  4HGA A;  4PJL A;  3SWH A;  4EAH A;  5LG4 A;  4MBQ A;  3L3P A;  2NOX A;  3C64 A;  3V5U A;  2DI4 A;  4ANJ A;  2W61 A;  3TKL B;  1FMV A;  4AI6 A;  1MMN A;  3RYF E;  4AQF C;  1CUN A;  5A1L A;  3KV9 A;  1WRD A;  2BZB A;  4JLE A;  2X67 A;  4UF0 A;  3HR0 A;  2ZM2 A;  2PFV A;  5LP6 E;  3AVS A;  3B57 A;  3KV4 A;  3UTK A;  1FMW A;  1U4Q A;  5HXR A;  3O1J A;  5L3D B;  3HL6 A;  2X68 A;  4YHJ A;  4UXN B;  3QK6 A;  5FNV E;  1BR2 A;  2IC9 A;  4G2A A;  4QWN B;  3FBZ A;  3I9Y A;  3HI2 A;  2C5K T;  2NW7 A;  4BJM A;  5LOV E;  3UFE A;  4MFR A;  3PUQ A;  3QC9 A;  4OHF A;  3C51 A;  3DJB A;  3CQC B;  4UF0 B;  1EZ3 A;  4GOU A;  1S94 A;  4N78 D;  3SS1 A;  4YFS A;  5H6Q B;  3O1I A;  5JDN A;  1KNZ A;  2Q9Q A;  3EDU A;  2N9D A;  4ILU A;  3UUL A;  2CXF A;  2V26 A;  3F31 A;  1B7T A;  5JDL A;  2UXX B;  2B1E A;  4G63 A;  4X20 E;  3ZN0 B;  1NAF A;  3VHL A;  2CXL A;  2LM9 A;  5H6R B;  4EXT A;  5HYA A;  2XHE B;  4X1Y E;  5HXC A;  4O4I E;  4MAL A;  4HEA A;  4YLH A;  3ZCJ A;  5LYJ E;  2LOP A;  3Q2M A;  4QXC B;  4TV9 E;  3PE0 A;  2DLR A;  4NUU A;  2WM9 A;  4A56 A;  4XBF B;  2CE7 A;  3N2G E;  3MKD A;  4IE6 A;  2WSS V;  2D2S A;  5LHI B;  1D0X A;  3LK2 B;  5JR9 A;  3HKC E;  3J9X 1;  5J1G A;  3AA7 B;  4PFP A;  5M4Y A;  5FP3 A;  1G73 A;  4QXB B;  3JC6 D;  2KT9 A;  3CX6 B;  3OYZ A;  1MND A;  1HFA A;  2Z6E A;  4DND A;  2IC6 A;  2QGS A;  3VKH A;  3FHN A;  3PUS A;  3I0Q A;  4HKA A;  4HN9 A;  3P8C D;  3K3Q C;  1S35 A;  3KBU A;  2CLY B;  2M67 A;  2C0S A;  2DHR A;  1D0Z A;  4AKR B;  4WBN E;  5HXS A;  4TN7 B;  3LK3 B;  2X51 A;  3BK9 A;  2Y6X A;  3KFW X;  4ASK A;  1AJ3 A;  3N2O A;  3FXD B;  4PJJ A;  4ZI3 C;  2ODV A;  3ZLI A;  4CXW A;  3WAK A;  3UUN A;  1SHZ C;  5ADX L;  4AKL A;  1HF8 A;  3ETU A;  3CKD A;  4FJO A;  1HCI A;  2K5B B;  1O3X A;  2DWK A;  3I9W A;  1VOM A;  4ERR A;  1V9D A;  3LK4 2;  1LVF A;  3H37 A;  5CA0 E;  4AQG A;  1D1B A;  3KBT A;  4QX7 B;  4V1A v;  5LHH B;  2N2N A;  2H7V C;  4AKH A;  1D1C A;  2L8K A;  4FI5 A;  1QUU A;  4I55 E;  1US7 B;  5LCY A;  2EHO D;  5L3C B;  3ZMU B;  1OWA A;  2X66 A;  5KDM C;  4HE8 A;  1G8X A;  2NWB A;  5JRE A;  5DJQ C;  2LOS A;  4PFO A;  3IHR A;  5EK3 A;  5HWY A;  4E7Z A;  5TAO A;  3BQK A;  5FYM A;  3LFM A;  1D0Y A;  3RKO A;  1HG2 A;  2J1D G;  4EYY R;  4P0B A;  5GON E;  2V7L A;  4H9S E;  5ETW A;  3ETV A;  5J2U E;  4AKG A;  3K8P C;  2JMH A;  3PUR A;  2C5J A;  3E22 E;  3Q5W A;  3N9M A;  3UUX B;  2XAQ B;  4IST A;  4U72 A;  4EZ4 A;  1FEW A;  3ZYK A;  1X79 A;  4I50 E;  3MJX A;  1OXZ A;  4O8S A;  5LGU B;  5F3J A;  3CVR A;  4OYJ A;  2KIN B;  1MNE A;  2IAK A;  2BVL A;  3CQX C;  5LBQ B;  3QUJ A;  4EZH A;  2K24 A;  3AB3 B;  2D0T A;  2WBL A;  4O4J E;  5CA1 E;  2N1G A;  4PW8 A;  3Q9D A;  3ZMV B;  3PTR B;  5HAX A;  1WLX A;  2ODU A;  2NTY A;  4ADZ A;  5IYZ E;  1H7C A;  4JEU B;  2PJQ A;  5LJN A;  4DBQ A;  2XAF B;  2L3L A;  3LG7 A;  3FBL A;  4P09 A;  3R84 B;  2W62 A;  2GK9 A;  2MYS A;  3C4Z A;  2CXD A;  4MLK A;  3ZYM A;  3O9X A;  4AXP A;  4GK0 E;  4KMC A;  3ANW A;  3AVR A;  4ZI2 D;  5C8Y E;  2CMR A;  4M1P A;  2V7K A;  2XAH B;  3C4X A;  5E0O A;  2LSI A;  2LSK A;  3N9P A;  2K48 A;  4H9N C;  1UCU A;  4YJ3 E;  2ZM8 A;  3W15 B;  3LJC A;  2LT3 A;  3CX8 B;  3O1H A;  1MMD A;  3WAJ A;  2CWO A;  4ZS3 A;  2G0U A;  1NWM X;  1BR4 A;  4CXY A;  4IGU A;  3ZJ1 A;  4CI3 B;  5JR9 B;  4KBM B;  3NBX X;  2PBI A;  5JR9 C;  4GYS A;  3HA4 A;  1BR0 A;  4E7S A;  3PUA A;  3ZPO A;  4CI2 B;  4EIW A;  3B13 A;  4TV8 E;  3RX6 A;  2WAU A;  5DAB A;  2LSJ A;  3OYX A;  1MIV A;  2WMN A;  4BAY B;  1HG5 A;  2E9X B;  2RA1 A;  3L09 A;  4WNK A;  2LSY A;  3F57 A;  4CZZ B;  4OFZ A;  3N5L A;  2A3D A;  2X0L B;  2EHO B;  3ZMS B;  2JRK A;  4X1I E;  5L3B B;  3U78 A;  3C4W A;  3RRC A;  4PNI A;  2KZ7 B;  3KV5 A;  1U5P A;  4GIW A;  1SA0 E;  3I0O A;  3H3A A;  4PJN A;  2VKH A;  3KDS E;  2JQQ A;  2L9Q A;  4L5G A;  4UVB B;  3ZN1 B;  4H9P C;  5L3F B;  5JDQ A;  4WW0 A;  5JDG A;  4DBR A;  2LSG A;  3D0T A;  2KND A;  2C5I T;  3R6N A;  4L0R A;  2VWA A;  2LEH A;  2VAS A;  2V7M A;  2A72 A;  2DNX A;  1UX5 A;  5IHY A;  2XQY A;  3CWZ B;  4UVC B;  3NZP A;  4PK4 A;  4UIG A;  3UT5 E;  3ZC1 A;  4EOZ B;  2E9X C;  2YU1 A;  2XTL A;  1YKH B;  2JPF A;  3FXE B;  3AA1 B;  3CX7 B;  2WMO A;  3JC6 C;  1LVK A;  4JEH B;  2SPC A;  2YIN A;  4DMW A;  4P0A A;  2VKO A;  2RP4 A;  2NW9 A;  5LGN B;  3EDV A;  4IIJ E;  4DVD A;  4EYU A;  3VU7 H;  2CEA A;  3F2E A;  1BR1 A;  2ACX A;  3GN5 B;  3CPZ A;  1T98 A;  3NRY A;  3PU3 A;  3IEE A;  5EK4 A;  2KXP B;  2X9Y A;  5F8P A;  5JVD E;  5JRC A;  4KUM B;  5JDF A;  4PJM A;  2V7I A;  4EB6 E;  1MIY A;  3WI3 A;  2X9H A;  3GN5 A;  2Q9Q B;  5HXH A;  4C91 A;  3Q5X A;  3GA8 A;  4UV8 B;  3ZMZ B;  3IBP A;  2EHO A;  4ZI3 D;  3KV6 A;  1ZEE A;  4CQI A;  5FXX A;  2Y8D A;  4O4L E;  2CM0 A;  4XAX B;  3MA9 A;  1IJ5 A;  5FXV A;  3MXZ A;  3VKG A;  1FIO A;  5LA6 E;  5BMV E;  3RYH E;  1IJ6 A;  1HX8 A;  2Q9Q C;  3RRW A;  4CXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...