2CCQA

The pub domain functions as a p97 binding module in human peptide n-glycanase.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'GSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE N-GLYCANASE HOMOLOG
publication title The Pub Domain Functions as a P97 Binding Module in Human Peptide N-Glycanase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycoprotein
total genus 32
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ccqA00
4OYJA 2CCQA 4P0AA 2HPLA 4JUYA 4P09A 4P0BA 5LJMA 4OYKA 2HPJA 2CM0A 2D5UA 5LJNA
chains in the Genus database with same CATH superfamily
4GKJT 3CMLA 3DTOA 4U31A 3HI2A 4IDZA 3AB3B 3FB2A 3OTOT 2D0TA 2CXFA 4G63A 4OFZA 4DBQA 4QH4A 4FI5A 2NTYA 1LRZA 2X51A 1VCSA 4EV6A 1XDOA 4IREA 5AQJB 4DUYT 1UK5A 3RGLA 2X0HA 1ZOYA 4HTEA 4A98A 4UVAB 2K3WA 5F3JA 3MZKB 1W0BA 3AVSA 3Q2MA 3P4SA 4YT0A 4PFPA 2E9XC 2V8SV 3VU7H 3ZT5A 5H6QB 3UFGA 5C8YE 5L47A 3ZCJA 2LOSA 2XQYA 5AQLB 3OVUA 4HFDA 5L3BB 4DV5T 2RA1A 1MMDA 3N2KE 3GMIA 1M7KA 3AAIA 2BBHA 2CBIA 3LJCA 2LSYA 4C91A 4DV0T 2A9UA 1OEDE 3MJXA 3JCFA 1J1JA 2VWAA 2FUPA 4DV3T 1QSDA 2V7KA 1XDPA 4NXMT 2LSIA 3FZKB 3FZFB 4LF4T 4ANJA 2DWGA 2FJBA 4QH1A 3P50A 4DBRA 2V7IA 2ACXA 4AKRB 4JBWF 2CXDA 4PNIA 1BR4A 3KV9A 5JDQA 4EAHA 1IJ5A 4HWIB 5L3CB 2ES0A 4ILUA 1ZKEA 3LK2B 3L09A 3PUXF 2XM2A 3PUWF 1T7SA 2YU2A 2ZM8A 3OYXA 2IAKA 2UUCT 3F31A 3ZSSA 5IHYA 2M6IA 5J2TE 4DR1T 3AEBA 2W67A 2JPFA 3O9XA 3IF8B 2V7MA 3O1JA 2XAGB 4P0AA 3OPCA 3SRZA 2LEHA 1Z0PA 2K24A 3I0OA 5AQSB 3UQ4A 2MYSA 3AXJB 3P4PA 3TLUA 4AKLA 5L3GB 2DL1A 4DVDA 1QUUA 3V5SA 4ZI3D 4ZS2A 3IA3A 5C2TA 2EHOB 2QYWA 2XY8B 3CWZB 3A5XA 2QRXA 3A8YC 3UFEA 5JDLA 2E9XD 3JADA 3EHZA 2KSRA 4H63V 2LSGA 1M62A 3RYFE 5HWXA 1ZV4X 3O1HA 3RRWA 4Z8XA 1ZHCA 1X79A 3RYHE 4U2ZA 4YHJA 2EHOD 2MAWA 2XAQB 3NRXA 1HF8A 3M65A 4TX5A 3AEFA 4Z91A 5KXJA 5LMUT 2LRKA 4DV2T 1LKXA 4DMVA 3ONLC 1Y64B 4O4HE 3L3PA 3JC6D 3CK6A 3IHRA 3ZN1B 5DQVA 3RKOA 3K1SA 5J0ZA 2JQQA 4DV7T 4K0UA 2YDSA 4ILBA 4P0BA 4HWDA 1IZNB 1YKHB 3RIUC 1S94A 4ASKA 2DI4A 5FXXA 2CXLA 3BQLA 3CX6B 2XAHB 2NP9A 3AE3A 4XZCA 4IT4A 3AXJA 3KVBA 5FVKA 4JLEA 2MTQA 4IE6A 1WR6A 4DIDB 1MNDA 5BMVE 4NXNT 1T98A 4MBQA 2LM9A 2LJLA 1VRBA 2BBJA 3JAEA 2G0UA 2WU5A 5ABFA 3UU6A 1WRDA 4DR4T 1E2AA 3KDSE 4KHZF 2E2AA 2C5KT 1KNPA 3QB5A 4YFSA 2J62A 5HEOA 4X65T 2H88A 4EEDA 4PAGA 1YQ3A 3VR9A 4HKAA 2VURA 1N34T 2XM1A 3P7IA 4OX9T 4Z90A 1WFDA 3IEEA 4GYRA 3LG7A 4MLKA 3AEGA 4JUYA 5L3EB 3RC3A 5HXEA 3PU3A 3AA1B 3EI0A 5GONE 4QX7B 4YY3T 1D0ZA 1XWMA 3RH3A 4JI0T 3I9WA 2JIWA 4HWHA 5JVDE 2I6HA 2X67A 3O4XE 2KT9A 4JEUB 3ZMZB 5AQTB 4DV1T 4DV4T 2GK9A 3RPUA 2VK9A 4U72A 2BG9B 3PUQA 1B7TA 4UELA 4OK0A 3Q5DA 2BZBA 5HXHA 2FJDA 1SHZC 4DR5T 3T1HT 2FJAA 3LBXB 5JDMA 3N9PA 3UTKA 4UXNB 5IWAT 4QXBB 2QA7A 5AQVB 2WSSV 4CN1A 2XQAA 5LHIB 2XAJB 4TZ4C 3S4UA 2JQHA 3PTRB 2WMNA 3ZN0B 1D0XA 2IUBA 1D1BA 2XQ9A 4TWFA 4CI2B 4CXXA 5JDFA 4LMJA 3TLSA 4MHCA 4IGUA 4EIWA 4HFCA 2XJ7A 1X9BA 1XNQT 4DV6T 4P09A 1IBLT 1OEDC 1XNRT 1N33T 5LXTE 4F6RC 4GIWA 2JQKA 3AA0B 5LBQB 1WLXA 1US7B 2WU2A 4TV9E 4YTPA 2CLYB 3AAEB 2VKDA 2V1DB 2E8IA 5E0OA 1U5PA 3ONJA 4HEAA 3AEAA 4A97A 3UU4A 3N9NA 1LVFA 2VKOA 3QB5K 4JI2T 4EB6E 5HEGA 3CX7B 2ODVA 4JI3T 3VKGA 3KFWX 2CHOA 2UU9T 3RF1A 3HKCE 3KVAA 3WI3A 4I50E 1N32T 4J2CA 2E5VA 1CUNA 3QUJA 2Y6XA 2JMKA 4B3RT 1N36T 4X1YE 3RIFA 4PW8A 1IJ6A 4I0UA 2BG9A 4IDPA 4YLHA 5AQRB 5LMNT 2E5LT 3RC8A 2CRBA 2V5CA 1MIVA 2ZLYA 3LBXA 5H6RB 2NW7A 4O4IE 2J47A 2UUAT 2OLTA 2W00A 1E7PA 2YKSA 1FIOA 2NWBA 3OBVE 2UXCT 3T8OA 2KMFA 4LF8T 3E0ZA 2YDRA 2Y48B 4OYJA 4MFRA 4EZ4A 1KEYA 3V5UA 3AE7A 3N9OA 4WZXA 1ZEEA 2Q9QC 5EK4A 4GKKT 2W4XA 3BK9A 5F5WA 4ZI7E 3R84B 3UT5E 2PTFA 3MK7C 2YOEA 2KZ7B 2OV9A 4AQYT 4CZZB 2H7OA 2I59A 3VKHA 2VL0A 2BS2A 2W61A 1UX5A 5AQFB 1ZP0A 4TNVA 3QC9A 2JQ9A 3SOLA 3KBUA 3OYZA 1Y01A 4BJMA 3HKDE 2CWYA 5LHHB 3RRCA 4EGWA 3ZMUB 2KWIB 2BVLA 5LGNB 3N2OA 3PU8A 4A56A 1GQEA 3AE4A 2WB5A 2WZIA 3F57A 5J1GA 2D9DA 2V26A 4YHHT 2XSAA 5HCJA 4AQFA 4HWCA 3PUZF 1R8IA 3G06A 5HXRA 3JAFA 3MA9A 2UUBT 2IW5B 1HS7A 4DR2T 2J1DG 2WWUA 5HXCA 5AQGB 1NWMX 3MACA 4PK5A 5FNVE 4L9IA 3Q9DA 2FBWA 3NKZA 5JDGA 1D1CA 3ZPOA 2YN6A 3AE6A 3AAAB 2P9BA 4WBNE 5ADXL 5FYMA 2DLRA 2CBJA 2X0YA 3ONXA 3ZLIA 3CKDA 1U4QA 5AQMB 2IMLA 2MOZA 2KWHA 3I0QA 5JRCB 3FZHB 2VKJA 3LK42 5LJMA 2W0GA 4UVBB 2E9XB 4UVCB 4TV8E 5LGUB 2WMOA 3O1IA 1HNZT 2L9QA 2LOPA 4HFIA 1KNZA 2A3DA 1HNWT 3E08A 2JJ9A 1KNRA 4H9SE 4AKIA 2ZM2A 4ZI2C 2LM2A 5JR9C 1UURA 3TLTA 5FKYA 3PUVF 3PURA 1MMGA 1L0VA 5KX5E 1KFYA 2M67A 5JTGA 2WP9A 1JNZA 2B76A 4HFHA 1SUMB 2HN2A 5BR8T 4A5XA 2X9YA 4X66T 4ZS3A 4TNWA 2N9DA 4LF9T 2XQ8A 2VQET 4EXTA 3HKEE 3NZQA 4DR7T 4HFVA 1I94T 1W0AA 3HA4A 2ZM6T 4HFBA 4B3TT 3AE8A 4DUZT 1SE7A 3I9YA 5FY1A 3N9LA 3W15B 2L8KA 5FVLA 4XAXB 3CVRA 4HFEA 2LRLA 2NOXA 3LSVA 2IIUA 5LJNA 2XSBA 2IC6A 2M6BA 5EK2A 5L3DB 5ABGA 2VQFT 2A72A 3NWIA 2E9XA 4PJMA 5FXZA 4AISA 1XMOT 1WYBA 5L4EA 2H89A 4PK6A 5CA0E 3RQWA 2EHOA 2LHRA 2JRKA 4ZHQE 3TKLB 3ESLA 2XASB 2LE8A 2AXDS 1KF6A 3B57A 3AEEA 4C90A 4PJLA 4WW0A 3PE0A 3HR0A 3CQXC 1IBMT 5JQGE 2XQ5A 1D1AA 3KBTA 4ZZBA 3ZYKA 2KXPB 2CWOA 5M4YA 2VVNA 1MIWA 4JV5T 3SS1A 4L0RA 1V9DA 4TN7B 2LLYA 2HH7A 3P4QA 2LSKA 3MXZA 3UULA 2BKOA 5AQQB 1D0YA 3Q5WA 4U7YA 5HEHA 3AE1A 1IAPA 4EEBA 2HPJA 2H7VC 4KMCA 3R6NA 2BKPA 3SWHA 2YDQA 2BS4A 1BR0A 2BG9E 4L5GA 3H3MA 1W9RA 3PJAA 1HCIA 4ILCA 5HYAA 3TLWA 3AEDA 3Q5EA 4IE5A 3ZT7A 4U3CA 2XZEA 2CEAA 3FZLB 2WS3A 4DMWA 4GK0E 5LP6E 3EDVA 5LHGB 4I55E 5FP3A 2SPCA 4YTNA 4I4TE 3ZMTB 4P1NA 1MIYA 5FMNA 4ZXLA 2BKNA 4CXYA 3UU5A 4ADZA 2KLQA 2N2NA 4YJ2E 4KHPT 3UU3A 4H9NC 3F2EA 3AA7B 3J9X1 3ZMVB 4CI3B 2XQ4A 3RYCE 2RPAA 2W62A 4KX6A 1HR0T 2XQ7A 4YSYA 5L2LA 4ISSA 4NPPA 3ZJ2A 4AKHA 2YK0A 3FBLA 4U2YA 1MMNA 4JYAT 3ZYLA 1FMWA 4WBOA 2LKGA 3EUHA 3PUGA 2HPLA 1HNXT 4OHFA 2PBIA 3E22E 3DJBA 1Z8UA 3KV6A 3ZC1A 4XBFB 2BS3A 4AIUA 5FL1A 5LOVE 2CHNA 3PJAJ 1YD8G 2Y8DA 4YJ3E 3RIAA 2C5JA 4EOZB 4H63H 3P4WA 4MALA 4AI6A 1YW0A 4X20E 4LMKA 3T1YT 2K48A 2UXNB 5HEJA 3L39A 3N9QA 3UUNA 2L3LA 4LFCT 2DCFA 4ZEYA 1UUSA 2RP4A 3QOFA 3PUAA 5FL0A 5DQWA 3C98B 3P4RA 2YEVC 5HAXA 3GN5B 5AQPB 2XQ3A 5CA1E 4UF0B 4AKGA 3K3OA 4O4JE 2WWVA 4ZI3C 2I0MA 2WCAA 3UUMA 3RIUA 4B6XA 4IDNA 2X9XA 2HN1A 1KK7A 2V6XA 3KINB 4B3ST 2X9HA 3LK3B 5HWYA 4H9PC 2D2SA 4ZZCA 3RQUA 4B3MT 4YSXA 2VB6A 3SFEA 4LMLA 4H9OC 3OJAA 4BJNA 3AE9A 3FZMB 3GA8A 2V6YB 2EHOC 3I1AA 4X1IE 3K8PC 1HTJF 2MPKA 2PG8A 1OEDB 2FJEA 1WCRA 4CN6A 1XZYA 1E1HB 3TLVA 3ANWB 3RYIE 5LGTB 3NRYA 5ABEA 3FBZA 4QXHB 2NW9A 2B1EA 5J2UE 2NTXA 3CPZA 2WBLA 1LVKA 3AECA 3P8CD 1YQ4A 4EYUA 2V5DA 4UIGA 1I6ZA 3JC6C 1G8XA 1MNEA 3CIRA 3B13A 3RHWA 3B5MA 5EK3A 4E7SA 3WAKA 4YTMA 2DHRA 4K0KT 5LCYA 5JDNA 4U7IA 5AQIB 2IHR1 2CCQA 2WDQA 4N78D 1UX4A 4I43B 2XQ6A 1YKEB 3L8RA 5LB7B 3ZC0A 1HFAA 4O2BE 5FY0A 3ZT6A 2NR4A 1UGOA 4CN4A 5KMGP 2XTLA 3AE5A 3EAMA 3WAJA 4O2AE 4HGAA 4QHOA 3GN5A 2KINB 4UF0A 3DP7A 2H3RA 3LDQB 1H7CA 1JNRA 2YINA 1NEKA 2BVMA 1O3XA 2K5BB 4YXDA 4LF6T 3C64A 3KV4A 3PDYA 4PFOA 3N2GE 4KBMB 4PK4A 5IYZE 2V7JA 4ZOLE 5AQNB 1G73A 2CMRA 4QKNA 1J5ET 2W63A 2ZMAA 4UV8B 2XUEA 4DR3T 3AA6B 2X9WA 2CPTA 4LFAT 4QXCB 3RX6A 1WYCA 4PJJA 5L4HA 2Q9QB 3ZCIA 2XAFB 4ILAA 1OXZA 1W09A 2V6YA 1NAFA 5JREA 3PUYF 4DO0A 2IC9A 1OEDA 4LF5T 3BQIA 2PFVA 4JI7T 4TUYE 3ANWA 4JEHB 5LBMA 4WYVA 3CX8B 5JDHA 1QLBA 5IUXA 2Q9QD 3SFDA 3ZYMA 4X64T 2VVSA 4V1Av 2XHEB 4O8SA 4BA9A 3RLFF 3LFMA 5ETWA 3RI5A 5CFBA 2WQYA 3H3AA 4COFA 5ABFB 3ABVA 5LYJE 3ETVA 4DNDA 2VL8A 2LKHA 4U74A 2JMHA 4JI6T 3PV0F 5HCMA 4IL4A 4BAYB 3QK6A 3C51A 4AXPA 2WM9A 3EABA 3C4ZA 4GK5E 4YSZA 5EZYE 2NW8A 4M1PA 2UXDT 2BG9C 5HXSA 3ETUA 2VKHA 1HG5A 2C0SA 5LNKA 1HX8A 4KI0F 4QWNB 4CXWA 1DU2A 4PJNA 4JI5T 1J5WA 3FXDB 2X68A 1BR2A 2F4VT 3KV5A 2UXXB 3ZMSB 2W66A 4X62T 4EZHA 4OYKA 3UUBA 2N1GA 3VHLA 5AFUL 5AQOB 1FMVA 4CQIA 4AQGA 1BR1A 5JRCA 3CQGB 4GOUA 1FJGT 2D5UA 4TWHA 3NBXX 3FXEB 3K3NA 3HKBE 4E7ZA 2CE7A 1WR0A 2A2FX 4CI1B 4TWDA 2Q9QA 1XMQT 2VASA 2Z6EA 3Q5XA 2V7LA 3U3IA 4FJOA 2LHNA 2OA5A 3OKQA 4GYSA 5DABA 2ZM0A 4JI1T 2CLYC 3K3QC 4X1KE 5AQKB 5L3FB 5CJ5A 4IDQA 1EZ3A 5LG3A 2WY2A 4H9QC 5CGMA 1IBKT 3GWHA 4IDOA 1YXRA 3UQ7A 3VR8A 2QGSA 2UXBT 3IBPA 1SA0E 1MMAA 3VRBA 3D0TA 4HE8A 1UCUA 4JI8T 4UEMA 2LSJA 5JR9B 4NUVA 2W2UA 4O4LE 2HHHT 3QNUA 2QVAA 4LF7T 4IHJE 2WDRA 4HWFA 1S35A 3C4WA 4IIJE 2MBGA 1T72A 2AE9A 4WNKA 3A7MA 5DJQC 2DWKA 4ZI2D 4F8HA 4ISTA 3N5LA 4AQFC 3RKGA 3HL6A 1T8BA 4ERRA 4EYYR 3BQKA 3ZKRA 2R6GF 4X5TA 4LFBT 3M3ZB 3MKDA 1FEWA 5ABHA 1HX1B 5LA6E 4IE4A 1VOMA 3N9MA 5AQUB 3AVRA 4DR6T 2WZHA 4UR9A 2X0LB 3VRAA 3X1DA 4QH5A 2PJQA 3C50A 5KDMC 5CB4E 2K9AA 1NENA 2CM0A 2J4GA 3UU8A 1AJ3A 3NZPA 4U33A 4JI4T 2X66A 5AQHB 4QX8B 5TAOA 5FY7A 4KP3C 3AE2A 4IE0A 2CA5A 1VCTA 4H9RC 3UUXB 2LT3A 2XPKA 2C5IT 3J7Yq 4Q25A 3U78A 5F8PA 4NUUA 5JR9A 4UV9B 5C3JA 2WDVA 2YU1A 4HN9A 1CHUA 2WAUA 4G2AA 2IDOB 3ZSTA 3EDUA 3PUSA 4KUMB 3NVOA 3C4XA 3CQCB 5JH7E 1OWAA 2DNXA 2KNDA 3H37A 4IL9A 3ZJ1A 5FXWA 2D0UA 5HEUA 2ACZA 3ZEFB 5A1LA 4IE7A 1HG2A 2BDEA 4NIQA 2ODUA 5LG4A 5FXVA 3FHNA 3EVYA
chains in the Genus database with same CATH topology
5JVDE 2X67A 3NZQA 3CMLA 3O4XE 2KT9A 3ZC0A 1HFAA 3DTOA 4JEUB 4O2BE 3HI2A 4HFVA 3ZMZB 4IDZA 3AB3B 3FB2A 2GK9A 3HA4A 3RPUA 2VK9A 4U72A 5FY0A 2D0TA 3PUQA 1B7TA 4UELA 4OK0A 2BZBA 5HXHA 1SHZC 5KMGP 2CXFA 2XTLA 4G63A 3WAJA 4OFZA 4O2AE 4DBQA 4HGAA 4QHOA 3GN5A 4FI5A 2NTYA 1LRZA 2KINB 2X51A 4UF0A 3DP7A 3I9YA 5FY1A 3LBXB 3N9LA 3W15B 5JDMA 2H3RA 2L8KA 3N9PA 3UTKA 4UXNB 1H7CA 2YINA 4XAXB 2BVMA 1O3XA 2K5BB 4QXBB 2QA7A 3CVRA 2WSSV 3C64A 3KV4A 5LHIB 3PDYA 2NOXA 2XAJB 4TZ4C 3S4UA 4PFOA 5LJNA 3N2GE 4KBMB 3PTRB 4PK4A 2IC6A 5IYZE 4HTEA 2V7JA 4UVAB 4ZOLE 1G73A 5F3JA 3MZKB 5EK2A 5L3DB 2CMRA 3AVSA 2WMNA 3Q2MA 3ZN0B 4QKNA 2W63A 1D0XA 2A72A 1D1BA 2ZMAA 4UV8B 4PFPA 2E9XC 2XUEA 2E9XA 3AA6B 4CI2B 4PJMA 5FXZA 4CXXA 2X9WA 5JDFA 3VU7H 4QXCB 3RX6A 1WYCA 1WYBA 4PJJA 4MHCA 4IGUA 5H6QB 4EIWA 2Q9QB 3ZCIA 2XAFB 1OXZA 1NAFA 4PK6A 5JREA 5C8YE 5CA0E 4DO0A 2EHOA 2IC9A 2LHRA 4P09A 3ZCJA 2JRKA 2LOSA 2XQYA 4ZHQE 3TKLB 5L3BB 3ESLA 5LXTE 3BQIA 4F6RC 2PFVA 4GIWA 4TUYE 3ANWA 2XASB 3AA0B 2LE8A 2RA1A 4JEHB 5LBMA 1MMDA 1WLXA 1US7B 3B57A 3N2KE 5LBQB 4C90A 3CX8B 5JDHA 3GMIA 4TV9E 2CLYB 4PJLA 3AAEB 2Q9QD 2VKDA 3AAIA 2V1DB 3PE0A 4WW0A 3HR0A 3ZYMA 2E8IA 5E0OA 3LJCA 4V1Av 1U5PA 2XHEB 4O8SA 4BA9A 3LFMA 2LSYA 4HEAA 4C91A 5ETWA 3CQXC 3MJXA 3N9NA 1LVFA 2VKOA 5JQGE 2VWAA 3H3AA 1D1AA 4EB6E 3CX7B 1QSDA 3KBTA 2ODVA 5LYJE 3ETVA 2V7KA 3KFWX 3VKGA 4DNDA 2VL8A 4U74A 2LSIA 2JMHA 4ANJA 3ZYKA 2KXPB 3HKCE 2CWOA 3KVAA 3WI3A 2DWGA 5M4YA 1MIWA 4I50E 4J2CA 4BAYB 4DBRA 3QK6A 3C51A 1CUNA 2WM9A 2V7IA 4L0RA 3QUJA 3SS1A 4AXPA 1V9DA 2Y6XA 3C4ZA 2JMKA 3HKEE 4TN7B 4GK5E 2ACXA 2HH7A 4AKRB 5EZYE 2NW8A 4M1PA 4X1YE 2LSKA 3MXZA 3UULA 2CXDA 4PNIA 1IJ6A 4PW8A 1BR4A 5HXSA 3ETUA 3KV9A 5JDQA 4EAHA 1IJ5A 1HG5A 2VKHA 1D0YA 3Q5WA 5L3CB 2C0SA 5LNKA 1HX8A 4YLHA 2ES0A 4ILUA 1IAPA 1ZKEA 2HPJA 3LK2B 3RC8A 2H7VC 4KMCA 4QWNB 3R6NA 4CXWA 3SWHA 1MIVA 2ZLYA 3L09A 3LBXA 5H6RB 2NW7A 4PJNA 4O4IE 1BR0A 2YU2A 2ZM8A 3OYXA 2IAKA 4L5GA 3F31A 3FXDB 2X68A 1BR2A 2W00A 3KV5A 2UXXB 3ZMSB 1FIOA 5IHYA 1HCIA 2NWBA 5HYAA 5J2TE 4EZHA 3OBVE 4OYKA 3T8OA 2N1GA 3VHLA 2KMFA 5AFUL 4IE5A 3E0ZA 1FMVA 4CQIA 2Y48B 4AQGA 4OYJA 1BR1A 4MFRA 2CEAA 4EZ4A 2JPFA 3O9XA 5JRCA 3CQGB 3IF8B 4GOUA 3V5UA 4DMWA 2D5UA 2V7MA 4GK0E 3NBXX 3N9OA 3O1JA 3FXEB 3K3NA 3HKBE 5LP6E 3EDVA 5LHGB 2XAGB 1ZEEA 4I55E 5FP3A 4E7ZA 4P0AA 2SPCA 2CE7A 2Q9QC 5EK4A 2A2FX 4CI1B 2Q9QA 3SRZA 4I4TE 3ZMTB 2LEHA 1Z0PA 2VASA 1MIYA 2Z6EA 3Q5XA 5FMNA 2V7LA 3U3IA 2K24A 4CXYA 3I0OA 4FJOA 2LHNA 2OA5A 3BK9A 2MYSA 3OKQA 4ADZA 4GYSA 2KLQA 4ZI7E 2N2NA 4YJ2E 5DABA 4H9NC 3R84B 4AKLA 3F2EA 3UT5E 2ZM0A 3AA7B 3MK7C 2KZ7B 5L3GB 3J9X1 3ZMVB 4CI3B 2CLYC 3RYCE 4DVDA 2W62A 3K3QC 4X1KE 1QUUA 3V5SA 5L3FB 4ZI3D 4ZS2A 5L2LA 1EZ3A 4CZZB 4H9QC 4ISSA 2H7OA 2I59A 3ZJ2A 3VKHA 3GWHA 2YK0A 4AKHA 3FBLA 2EHOB 1MMNA 2W61A 2QGSA 1UX5A 3CWZB 3IBPA 3A5XA 3QC9A 1SA0E 3UFEA 3ZYLA 1FMWA 1MMAA 3SOLA 4WBOA 5JDLA 3EUHA 3D0TA 3KBUA 3OYZA 2E9XD 4HE8A 4BJMA 3PUGA 2HPLA 3HKDE 1UCUA 2CWYA 4H63V 4UEMA 2LSJA 2LSGA 5JR9B 4NUVA 2PBIA 4OHFA 3E22E 5LHHB 4O4LE 3RRCA 3DJBA 3RYFE 5HWXA 1ZV4X 4IHJE 3KV6A 3O1HA 3RRWA 3ZC1A 3ZMUB 2KWIB 4Z8XA 4XBFB 1ZHCA 1X79A 2BVLA 3RYHE 1S35A 3C4WA 4IIJE 5LGNB 4YHJA 2MBGA 2EHOD 3N2OA 3PU8A 5LOVE 2XAQB 4A56A 4WNKA 5DJQC 2DWKA 3NRXA 1HF8A 1YD8G 2Y8DA 3F57A 4YJ3E 2C5JA 4EOZB 4ZI2D 5J1GA 3M65A 4ISTA 4H63H 2V26A 4TX5A 3N5LA 4AQFC 3HL6A 4AQFA 4MALA 4ERRA 4EYYR 4AI6A 3BQKA 1YW0A 4X20E 1LKXA 5HXRA 4DMVA 3MA9A 2K48A 2IW5B 1Y64B 4O4HE 1HS7A 2UXNB 3N9QA 3MKDA 3UUNA 2J1DG 2WWUA 3L3PA 5HXCA 1NWMX 2L3LA 2DCFA 3JC6D 3MACA 4PK5A 5FNVE 2RP4A 4L9IA 3Q9DA 1FEWA 3IHRA 3PUAA 3ZN1B 5DQVA 5DQWA 3C98B 5JDGA 3RKOA 1D1CA 2YEVC 4IE4A 5LA6E 5HAXA 3ZPOA 3GN5B 5CA1E 3AAAB 4UF0B 4AKGA 2JQQA 2P9BA 3K3OA 4K0UA 1VOMA 4WBNE 3N9MA 4P0BA 4O4JE 5ADXL 5FYMA 1IZNB 3AVRA 1YKHB 2DLRA 4ZI3C 1S94A 4ASKA 3UUMA 2DI4A 4B6XA 5FXXA 2CXLA 2X9XA 3ONXA 2X0LB 1KK7A 3BQLA 3ZLIA 3CKDA 3CX6B 2PJQA 1U4QA 2XAHB 2NP9A 2MOZA 2KWHA 3C50A 5KDMC 5CB4E 2K9AA 3I0QA 5JRCB 4XZCA 3KINB 2CM0A 2X9HA 3LK3B 5HWYA 4H9PC 2D2SA 3KVBA 1AJ3A 2VKJA 3LK42 5LJMA 4JLEA 2W0GA 4UVBB 2MTQA 4IE6A 2E9XB 1WR6A 4UVCB 4TV8E 5LGUB 3NZPA 1MNDA 2WMOA 5BMVE 2X66A 5TAOA 3O1IA 4QX8B 2VB6A 5FY7A 1T98A 2L9QA 2LOPA 4H9OC 4KP3C 3OJAA 4MBQA 4IE0A 4BJNA 1KNZA 2LM9A 2A3DA 2CA5A 2LJLA 3GA8A 2EHOC 4H9RC 1VRBA 3I1AA 3E08A 4X1IE 3K8PC 2JJ9A 3UUXB 4H9SE 2LT3A 2G0UA 4AKIA 2C5IT 1HTJF 3J7Yq 2ZM2A 2PG8A 1WRDA 4ZI2C 3KDSE 3U78A 5F8PA 1E1HB 2C5KT 4NUUA 5JR9C 4YFSA 3ANWB 5JR9A 3RYIE 5LGTB 3NRYA 3FBZA 4UV9B 4QXHB 2NW9A 4PAGA 2YU1A 4HN9A 2B1EA 5J2UE 2NTXA 2WAUA 3CPZA 3PURA 4G2AA 3EDUA 1MMGA 4HKAA 3PUSA 2WBLA 1LVKA 3C4XA 4KUMB 3CQCB 5JH7E 1OWAA 5KX5E 3P7IA 2DNXA 3P8CD 2M67A 2KNDA 4EYUA 3H37A 3IEEA 4GYRA 4UIGA 3LG7A 4MLKA 3JC6C 4JUYA 5L3EB 1G8XA 1MNEA 3ZJ1A 3RC3A 5HXEA 5FXWA 3PU3A 2D0UA 4I43B 2X9YA 3B13A 3ZEFB 3AA1B 4ZS3A 5GONE 4QX7B 5EK3A 5A1LA 4E7SA 4IE7A 1HG2A 2BDEA 3WAKA 1D0ZA 2DHRA 2ODUA 5LCYA 5LG4A 2N9DA 5JDNA 2CCQA 5FXVA 4N78D 3FHNA 3RH3A 1UX4A 4EXTA 3I9WA 3EVYA 1YKEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYJ A;  2CCQ A;  4P0A A;  2HPL A;  4JUY A;  4P09 A;  4P0B A;  5LJM A;  4OYK A;  2HPJ A;  2CM0 A;  2D5U A;  5LJN A; 
#chains in the Genus database with same CATH topology
 4GKJ T;  3CML A;  3DTO A;  4U31 A;  3HI2 A;  4IDZ A;  3AB3 B;  3FB2 A;  3OTO T;  2D0T A;  2CXF A;  4G63 A;  4OFZ A;  4DBQ A;  4QH4 A;  4FI5 A;  2NTY A;  1LRZ A;  2X51 A;  1VCS A;  4EV6 A;  1XDO A;  4IRE A;  5AQJ B;  4DUY T;  1UK5 A;  3RGL A;  2X0H A;  1ZOY A;  4HTE A;  4A98 A;  4UVA B;  2K3W A;  5F3J A;  3MZK B;  1W0B A;  3AVS A;  3Q2M A;  3P4S A;  4YT0 A;  4PFP A;  2E9X C;  2V8S V;  3VU7 H;  3ZT5 A;  5H6Q B;  3UFG A;  5C8Y E;  5L47 A;  3ZCJ A;  2LOS A;  2XQY A;  5AQL B;  3OVU A;  4HFD A;  5L3B B;  4DV5 T;  2RA1 A;  1MMD A;  3N2K E;  3GMI A;  1M7K A;  3AAI A;  2BBH A;  2CBI A;  3LJC A;  2LSY A;  4C91 A;  4DV0 T;  2A9U A;  1OED E;  3MJX A;  3JCF A;  1J1J A;  2VWA A;  2FUP A;  4DV3 T;  1QSD A;  2V7K A;  1XDP A;  4NXM T;  2LSI A;  3FZK B;  3FZF B;  4LF4 T;  4ANJ A;  2DWG A;  2FJB A;  4QH1 A;  3P50 A;  4DBR A;  2V7I A;  2ACX A;  4AKR B;  4JBW F;  2CXD A;  4PNI A;  1BR4 A;  3KV9 A;  5JDQ A;  4EAH A;  1IJ5 A;  4HWI B;  5L3C B;  2ES0 A;  4ILU A;  1ZKE A;  3LK2 B;  3L09 A;  3PUX F;  2XM2 A;  3PUW F;  1T7S A;  2YU2 A;  2ZM8 A;  3OYX A;  2IAK A;  2UUC T;  3F31 A;  3ZSS A;  5IHY A;  2M6I A;  5J2T E;  4DR1 T;  3AEB A;  2W67 A;  2JPF A;  3O9X A;  3IF8 B;  2V7M A;  3O1J A;  2XAG B;  4P0A A;  3OPC A;  3SRZ A;  2LEH A;  1Z0P A;  2K24 A;  3I0O A;  5AQS B;  3UQ4 A;  2MYS A;  3AXJ B;  3P4P A;  3TLU A;  4AKL A;  5L3G B;  2DL1 A;  4DVD A;  1QUU A;  3V5S A;  4ZI3 D;  4ZS2 A;  3IA3 A;  5C2T A;  2EHO B;  2QYW A;  2XY8 B;  3CWZ B;  3A5X A;  2QRX A;  3A8Y C;  3UFE A;  5JDL A;  2E9X D;  3JAD A;  3EHZ A;  2KSR A;  4H63 V;  2LSG A;  1M62 A;  3RYF E;  5HWX A;  1ZV4 X;  3O1H A;  3RRW A;  4Z8X A;  1ZHC A;  1X79 A;  3RYH E;  4U2Z A;  4YHJ A;  2EHO D;  2MAW A;  2XAQ B;  3NRX A;  1HF8 A;  3M65 A;  4TX5 A;  3AEF A;  4Z91 A;  5KXJ A;  5LMU T;  2LRK A;  4DV2 T;  1LKX A;  4DMV A;  3ONL C;  1Y64 B;  4O4H E;  3L3P A;  3JC6 D;  3CK6 A;  3IHR A;  3ZN1 B;  5DQV A;  3RKO A;  3K1S A;  5J0Z A;  2JQQ A;  4DV7 T;  4K0U A;  2YDS A;  4ILB A;  4P0B A;  4HWD A;  1IZN B;  1YKH B;  3RIU C;  1S94 A;  4ASK A;  2DI4 A;  5FXX A;  2CXL A;  3BQL A;  3CX6 B;  2XAH B;  2NP9 A;  3AE3 A;  4XZC A;  4IT4 A;  3AXJ A;  3KVB A;  5FVK A;  4JLE A;  2MTQ A;  4IE6 A;  1WR6 A;  4DID B;  1MND A;  5BMV E;  4NXN T;  1T98 A;  4MBQ A;  2LM9 A;  2LJL A;  1VRB A;  2BBJ A;  3JAE A;  2G0U A;  2WU5 A;  5ABF A;  3UU6 A;  1WRD A;  4DR4 T;  1E2A A;  3KDS E;  4KHZ F;  2E2A A;  2C5K T;  1KNP A;  3QB5 A;  4YFS A;  2J62 A;  5HEO A;  4X65 T;  2H88 A;  4EED A;  4PAG A;  1YQ3 A;  3VR9 A;  4HKA A;  2VUR A;  1N34 T;  2XM1 A;  3P7I A;  4OX9 T;  4Z90 A;  1WFD A;  3IEE A;  4GYR A;  3LG7 A;  4MLK A;  3AEG A;  4JUY A;  5L3E B;  3RC3 A;  5HXE A;  3PU3 A;  3AA1 B;  3EI0 A;  5GON E;  4QX7 B;  4YY3 T;  1D0Z A;  1XWM A;  3RH3 A;  4JI0 T;  3I9W A;  2JIW A;  4HWH A;  5JVD E;  2I6H A;  2X67 A;  3O4X E;  2KT9 A;  4JEU B;  3ZMZ B;  5AQT B;  4DV1 T;  4DV4 T;  2GK9 A;  3RPU A;  2VK9 A;  4U72 A;  2BG9 B;  3PUQ A;  1B7T A;  4UEL A;  4OK0 A;  3Q5D A;  2BZB A;  5HXH A;  2FJD A;  1SHZ C;  4DR5 T;  3T1H T;  2FJA A;  3LBX B;  5JDM A;  3N9P A;  3UTK A;  4UXN B;  5IWA T;  4QXB B;  2QA7 A;  5AQV B;  2WSS V;  4CN1 A;  2XQA A;  5LHI B;  2XAJ B;  4TZ4 C;  3S4U A;  2JQH A;  3PTR B;  2WMN A;  3ZN0 B;  1D0X A;  2IUB A;  1D1B A;  2XQ9 A;  4TWF A;  4CI2 B;  4CXX A;  5JDF A;  4LMJ A;  3TLS A;  4MHC A;  4IGU A;  4EIW A;  4HFC A;  2XJ7 A;  1X9B A;  1XNQ T;  4DV6 T;  4P09 A;  1IBL T;  1OED C;  1XNR T;  1N33 T;  5LXT E;  4F6R C;  4GIW A;  2JQK A;  3AA0 B;  5LBQ B;  1WLX A;  1US7 B;  2WU2 A;  4TV9 E;  4YTP A;  2CLY B;  3AAE B;  2VKD A;  2V1D B;  2E8I A;  5E0O A;  1U5P A;  3ONJ A;  4HEA A;  3AEA A;  4A97 A;  3UU4 A;  3N9N A;  1LVF A;  2VKO A;  3QB5 K;  4JI2 T;  4EB6 E;  5HEG A;  3CX7 B;  2ODV A;  4JI3 T;  3VKG A;  3KFW X;  2CHO A;  2UU9 T;  3RF1 A;  3HKC E;  3KVA A;  3WI3 A;  4I50 E;  1N32 T;  4J2C A;  2E5V A;  1CUN A;  3QUJ A;  2Y6X A;  2JMK A;  4B3R T;  1N36 T;  4X1Y E;  3RIF A;  4PW8 A;  1IJ6 A;  4I0U A;  2BG9 A;  4IDP A;  4YLH A;  5AQR B;  5LMN T;  2E5L T;  3RC8 A;  2CRB A;  2V5C A;  1MIV A;  2ZLY A;  3LBX A;  5H6R B;  2NW7 A;  4O4I E;  2J47 A;  2UUA T;  2OLT A;  2W00 A;  1E7P A;  2YKS A;  1FIO A;  2NWB A;  3OBV E;  2UXC T;  3T8O A;  2KMF A;  4LF8 T;  3E0Z A;  2YDR A;  2Y48 B;  4OYJ A;  4MFR A;  4EZ4 A;  1KEY A;  3V5U A;  3AE7 A;  3N9O A;  4WZX A;  1ZEE A;  2Q9Q C;  5EK4 A;  4GKK T;  2W4X A;  3BK9 A;  5F5W A;  4ZI7 E;  3R84 B;  3UT5 E;  2PTF A;  3MK7 C;  2YOE A;  2KZ7 B;  2OV9 A;  4AQY T;  4CZZ B;  2H7O A;  2I59 A;  3VKH A;  2VL0 A;  2BS2 A;  2W61 A;  1UX5 A;  5AQF B;  1ZP0 A;  4TNV A;  3QC9 A;  2JQ9 A;  3SOL A;  3KBU A;  3OYZ A;  1Y01 A;  4BJM A;  3HKD E;  2CWY A;  5LHH B;  3RRC A;  4EGW A;  3ZMU B;  2KWI B;  2BVL A;  5LGN B;  3N2O A;  3PU8 A;  4A56 A;  1GQE A;  3AE4 A;  2WB5 A;  2WZI A;  3F57 A;  5J1G A;  2D9D A;  2V26 A;  4YHH T;  2XSA A;  5HCJ A;  4AQF A;  4HWC A;  3PUZ F;  1R8I A;  3G06 A;  5HXR A;  3JAF A;  3MA9 A;  2UUB T;  2IW5 B;  1HS7 A;  4DR2 T;  2J1D G;  2WWU A;  5HXC A;  5AQG B;  1NWM X;  3MAC A;  4PK5 A;  5FNV E;  4L9I A;  3Q9D A;  2FBW A;  3NKZ A;  5JDG A;  1D1C A;  3ZPO A;  2YN6 A;  3AE6 A;  3AAA B;  2P9B A;  4WBN E;  5ADX L;  5FYM A;  2DLR A;  2CBJ A;  2X0Y A;  3ONX A;  3ZLI A;  3CKD A;  1U4Q A;  5AQM B;  2IML A;  2MOZ A;  2KWH A;  3I0Q A;  5JRC B;  3FZH B;  2VKJ A;  3LK4 2;  5LJM A;  2W0G A;  4UVB B;  2E9X B;  4UVC B;  4TV8 E;  5LGU B;  2WMO A;  3O1I A;  1HNZ T;  2L9Q A;  2LOP A;  4HFI A;  1KNZ A;  2A3D A;  1HNW T;  3E08 A;  2JJ9 A;  1KNR A;  4H9S E;  4AKI A;  2ZM2 A;  4ZI2 C;  2LM2 A;  5JR9 C;  1UUR A;  3TLT A;  5FKY A;  3PUV F;  3PUR A;  1MMG A;  1L0V A;  5KX5 E;  1KFY A;  2M67 A;  5JTG A;  2WP9 A;  1JNZ A;  2B76 A;  4HFH A;  1SUM B;  2HN2 A;  5BR8 T;  4A5X A;  2X9Y A;  4X66 T;  4ZS3 A;  4TNW A;  2N9D A;  4LF9 T;  2XQ8 A;  2VQE T;  4EXT A;  3HKE E;  3NZQ A;  4DR7 T;  4HFV A;  1I94 T;  1W0A A;  3HA4 A;  2ZM6 T;  4HFB A;  4B3T T;  3AE8 A;  4DUZ T;  1SE7 A;  3I9Y A;  5FY1 A;  3N9L A;  3W15 B;  2L8K A;  5FVL A;  4XAX B;  3CVR A;  4HFE A;  2LRL A;  2NOX A;  3LSV A;  2IIU A;  5LJN A;  2XSB A;  2IC6 A;  2M6B A;  5EK2 A;  5L3D B;  5ABG A;  2VQF T;  2A72 A;  3NWI A;  2E9X A;  4PJM A;  5FXZ A;  4AIS A;  1XMO T;  1WYB A;  5L4E A;  2H89 A;  4PK6 A;  5CA0 E;  3RQW A;  2EHO A;  2LHR A;  2JRK A;  4ZHQ E;  3TKL B;  3ESL A;  2XAS B;  2LE8 A;  2AXD S;  1KF6 A;  3B57 A;  3AEE A;  4C90 A;  4PJL A;  4WW0 A;  3PE0 A;  3HR0 A;  3CQX C;  1IBM T;  5JQG E;  2XQ5 A;  1D1A A;  3KBT A;  4ZZB A;  3ZYK A;  2KXP B;  2CWO A;  5M4Y A;  2VVN A;  1MIW A;  4JV5 T;  3SS1 A;  4L0R A;  1V9D A;  4TN7 B;  2LLY A;  2HH7 A;  3P4Q A;  2LSK A;  3MXZ A;  3UUL A;  2BKO A;  5AQQ B;  1D0Y A;  3Q5W A;  4U7Y A;  5HEH A;  3AE1 A;  1IAP A;  4EEB A;  2HPJ A;  2H7V C;  4KMC A;  3R6N A;  2BKP A;  3SWH A;  2YDQ A;  2BS4 A;  1BR0 A;  2BG9 E;  4L5G A;  3H3M A;  1W9R A;  3PJA A;  1HCI A;  4ILC A;  5HYA A;  3TLW A;  3AED A;  3Q5E A;  4IE5 A;  3ZT7 A;  4U3C A;  2XZE A;  2CEA A;  3FZL B;  2WS3 A;  4DMW A;  4GK0 E;  5LP6 E;  3EDV A;  5LHG B;  4I55 E;  5FP3 A;  2SPC A;  4YTN A;  4I4T E;  3ZMT B;  4P1N A;  1MIY A;  5FMN A;  4ZXL A;  2BKN A;  4CXY A;  3UU5 A;  4ADZ A;  2KLQ A;  2N2N A;  4YJ2 E;  4KHP T;  3UU3 A;  4H9N C;  3F2E A;  3AA7 B;  3J9X 1;  3ZMV B;  4CI3 B;  2XQ4 A;  3RYC E;  2RPA A;  2W62 A;  4KX6 A;  1HR0 T;  2XQ7 A;  4YSY A;  5L2L A;  4ISS A;  4NPP A;  3ZJ2 A;  4AKH A;  2YK0 A;  3FBL A;  4U2Y A;  1MMN A;  4JYA T;  3ZYL A;  1FMW A;  4WBO A;  2LKG A;  3EUH A;  3PUG A;  2HPL A;  1HNX T;  4OHF A;  2PBI A;  3E22 E;  3DJB A;  1Z8U A;  3KV6 A;  3ZC1 A;  4XBF B;  2BS3 A;  4AIU A;  5FL1 A;  5LOV E;  2CHN A;  3PJA J;  1YD8 G;  2Y8D A;  4YJ3 E;  3RIA A;  2C5J A;  4EOZ B;  4H63 H;  3P4W A;  4MAL A;  4AI6 A;  1YW0 A;  4X20 E;  4LMK A;  3T1Y T;  2K48 A;  2UXN B;  5HEJ A;  3L39 A;  3N9Q A;  3UUN A;  2L3L A;  4LFC T;  2DCF A;  4ZEY A;  1UUS A;  2RP4 A;  3QOF A;  3PUA A;  5FL0 A;  5DQW A;  3C98 B;  3P4R A;  2YEV C;  5HAX A;  3GN5 B;  5AQP B;  2XQ3 A;  5CA1 E;  4UF0 B;  4AKG A;  3K3O A;  4O4J E;  2WWV A;  4ZI3 C;  2I0M A;  2WCA A;  3UUM A;  3RIU A;  4B6X A;  4IDN A;  2X9X A;  2HN1 A;  1KK7 A;  2V6X A;  3KIN B;  4B3S T;  2X9H A;  3LK3 B;  5HWY A;  4H9P C;  2D2S A;  4ZZC A;  3RQU A;  4B3M T;  4YSX A;  2VB6 A;  3SFE A;  4LML A;  4H9O C;  3OJA A;  4BJN A;  3AE9 A;  3FZM B;  3GA8 A;  2V6Y B;  2EHO C;  3I1A A;  4X1I E;  3K8P C;  1HTJ F;  2MPK A;  2PG8 A;  1OED B;  2FJE A;  1WCR A;  4CN6 A;  1XZY A;  1E1H B;  3TLV A;  3ANW B;  3RYI E;  5LGT B;  3NRY A;  5ABE A;  3FBZ A;  4QXH B;  2NW9 A;  2B1E A;  5J2U E;  2NTX A;  3CPZ A;  2WBL A;  1LVK A;  3AEC A;  3P8C D;  1YQ4 A;  4EYU A;  2V5D A;  4UIG A;  1I6Z A;  3JC6 C;  1G8X A;  1MNE A;  3CIR A;  3B13 A;  3RHW A;  3B5M A;  5EK3 A;  4E7S A;  3WAK A;  4YTM A;  2DHR A;  4K0K T;  5LCY A;  5JDN A;  4U7I A;  5AQI B;  2IHR 1;  2CCQ A;  2WDQ A;  4N78 D;  1UX4 A;  4I43 B;  2XQ6 A;  1YKE B;  3L8R A;  5LB7 B;  3ZC0 A;  1HFA A;  4O2B E;  5FY0 A;  3ZT6 A;  2NR4 A;  1UGO A;  4CN4 A;  5KMG P;  2XTL A;  3AE5 A;  3EAM A;  3WAJ A;  4O2A E;  4HGA A;  4QHO A;  3GN5 A;  2KIN B;  4UF0 A;  3DP7 A;  2H3R A;  3LDQ B;  1H7C A;  1JNR A;  2YIN A;  1NEK A;  2BVM A;  1O3X A;  2K5B B;  4YXD A;  4LF6 T;  3C64 A;  3KV4 A;  3PDY A;  4PFO A;  3N2G E;  4KBM B;  4PK4 A;  5IYZ E;  2V7J A;  4ZOL E;  5AQN B;  1G73 A;  2CMR A;  4QKN A;  1J5E T;  2W63 A;  2ZMA A;  4UV8 B;  2XUE A;  4DR3 T;  3AA6 B;  2X9W A;  2CPT A;  4LFA T;  4QXC B;  3RX6 A;  1WYC A;  4PJJ A;  5L4H A;  2Q9Q B;  3ZCI A;  2XAF B;  4ILA A;  1OXZ A;  1W09 A;  2V6Y A;  1NAF A;  5JRE A;  3PUY F;  4DO0 A;  2IC9 A;  1OED A;  4LF5 T;  3BQI A;  2PFV A;  4JI7 T;  4TUY E;  3ANW A;  4JEH B;  5LBM A;  4WYV A;  3CX8 B;  5JDH A;  1QLB A;  5IUX A;  2Q9Q D;  3SFD A;  3ZYM A;  4X64 T;  2VVS A;  4V1A v;  2XHE B;  4O8S A;  4BA9 A;  3RLF F;  3LFM A;  5ETW A;  3RI5 A;  5CFB A;  2WQY A;  3H3A A;  4COF A;  5ABF B;  3ABV A;  5LYJ E;  3ETV A;  4DND A;  2VL8 A;  2LKH A;  4U74 A;  2JMH A;  4JI6 T;  3PV0 F;  5HCM A;  4IL4 A;  4BAY B;  3QK6 A;  3C51 A;  4AXP A;  2WM9 A;  3EAB A;  3C4Z A;  4GK5 E;  4YSZ A;  5EZY E;  2NW8 A;  4M1P A;  2UXD T;  2BG9 C;  5HXS A;  3ETU A;  2VKH A;  1HG5 A;  2C0S A;  5LNK A;  1HX8 A;  4KI0 F;  4QWN B;  4CXW A;  1DU2 A;  4PJN A;  4JI5 T;  1J5W A;  3FXD B;  2X68 A;  1BR2 A;  2F4V T;  3KV5 A;  2UXX B;  3ZMS B;  2W66 A;  4X62 T;  4EZH A;  4OYK A;  3UUB A;  2N1G A;  3VHL A;  5AFU L;  5AQO B;  1FMV A;  4CQI A;  4AQG A;  1BR1 A;  5JRC A;  3CQG B;  4GOU A;  1FJG T;  2D5U A;  4TWH A;  3NBX X;  3FXE B;  3K3N A;  3HKB E;  4E7Z A;  2CE7 A;  1WR0 A;  2A2F X;  4CI1 B;  4TWD A;  2Q9Q A;  1XMQ T;  2VAS A;  2Z6E A;  3Q5X A;  2V7L A;  3U3I A;  4FJO A;  2LHN A;  2OA5 A;  3OKQ A;  4GYS A;  5DAB A;  2ZM0 A;  4JI1 T;  2CLY C;  3K3Q C;  4X1K E;  5AQK B;  5L3F B;  5CJ5 A;  4IDQ A;  1EZ3 A;  5LG3 A;  2WY2 A;  4H9Q C;  5CGM A;  1IBK T;  3GWH A;  4IDO A;  1YXR A;  3UQ7 A;  3VR8 A;  2QGS A;  2UXB T;  3IBP A;  1SA0 E;  1MMA A;  3VRB A;  3D0T A;  4HE8 A;  1UCU A;  4JI8 T;  4UEM A;  2LSJ A;  5JR9 B;  4NUV A;  2W2U A;  4O4L E;  2HHH T;  3QNU A;  2QVA A;  4LF7 T;  4IHJ E;  2WDR A;  4HWF A;  1S35 A;  3C4W A;  4IIJ E;  2MBG A;  1T72 A;  2AE9 A;  4WNK A;  3A7M A;  5DJQ C;  2DWK A;  4ZI2 D;  4F8H A;  4IST A;  3N5L A;  4AQF C;  3RKG A;  3HL6 A;  1T8B A;  4ERR A;  4EYY R;  3BQK A;  3ZKR A;  2R6G F;  4X5T A;  4LFB T;  3M3Z B;  3MKD A;  1FEW A;  5ABH A;  1HX1 B;  5LA6 E;  4IE4 A;  1VOM A;  3N9M A;  5AQU B;  3AVR A;  4DR6 T;  2WZH A;  4UR9 A;  2X0L B;  3VRA A;  3X1D A;  4QH5 A;  2PJQ A;  3C50 A;  5KDM C;  5CB4 E;  2K9A A;  1NEN A;  2CM0 A;  2J4G A;  3UU8 A;  1AJ3 A;  3NZP A;  4U33 A;  4JI4 T;  2X66 A;  5AQH B;  4QX8 B;  5TAO A;  5FY7 A;  4KP3 C;  3AE2 A;  4IE0 A;  2CA5 A;  1VCT A;  4H9R C;  3UUX B;  2LT3 A;  2XPK A;  2C5I T;  3J7Y q;  4Q25 A;  3U78 A;  5F8P A;  4NUU A;  5JR9 A;  4UV9 B;  5C3J A;  2WDV A;  2YU1 A;  4HN9 A;  1CHU A;  2WAU A;  4G2A A;  2IDO B;  3ZST A;  3EDU A;  3PUS A;  4KUM B;  3NVO A;  3C4X A;  3CQC B;  5JH7 E;  1OWA A;  2DNX A;  2KND A;  3H37 A;  4IL9 A;  3ZJ1 A;  5FXW A;  2D0U A;  5HEU A;  2ACZ A;  3ZEF B;  5A1L A;  4IE7 A;  1HG2 A;  2BDE A;  4NIQ A;  2ODU A;  5LG4 A;  5FXV A;  3FHN A;  3EVY A; 
#chains in the Genus database with same CATH homology
 5JVD E;  2X67 A;  3NZQ A;  3CML A;  3O4X E;  2KT9 A;  3ZC0 A;  1HFA A;  3DTO A;  4JEU B;  4O2B E;  3HI2 A;  4HFV A;  3ZMZ B;  4IDZ A;  3AB3 B;  3FB2 A;  2GK9 A;  3HA4 A;  3RPU A;  2VK9 A;  4U72 A;  5FY0 A;  2D0T A;  3PUQ A;  1B7T A;  4UEL A;  4OK0 A;  2BZB A;  5HXH A;  1SHZ C;  5KMG P;  2CXF A;  2XTL A;  4G63 A;  3WAJ A;  4OFZ A;  4O2A E;  4DBQ A;  4HGA A;  4QHO A;  3GN5 A;  4FI5 A;  2NTY A;  1LRZ A;  2KIN B;  2X51 A;  4UF0 A;  3DP7 A;  3I9Y A;  5FY1 A;  3LBX B;  3N9L A;  3W15 B;  5JDM A;  2H3R A;  2L8K A;  3N9P A;  3UTK A;  4UXN B;  1H7C A;  2YIN A;  4XAX B;  2BVM A;  1O3X A;  2K5B B;  4QXB B;  2QA7 A;  3CVR A;  2WSS V;  3C64 A;  3KV4 A;  5LHI B;  3PDY A;  2NOX A;  2XAJ B;  4TZ4 C;  3S4U A;  4PFO A;  5LJN A;  3N2G E;  4KBM B;  3PTR B;  4PK4 A;  2IC6 A;  5IYZ E;  4HTE A;  2V7J A;  4UVA B;  4ZOL E;  1G73 A;  5F3J A;  3MZK B;  5EK2 A;  5L3D B;  2CMR A;  3AVS A;  2WMN A;  3Q2M A;  3ZN0 B;  4QKN A;  2W63 A;  1D0X A;  2A72 A;  1D1B A;  2ZMA A;  4UV8 B;  4PFP A;  2E9X C;  2XUE A;  2E9X A;  3AA6 B;  4CI2 B;  4PJM A;  5FXZ A;  4CXX A;  2X9W A;  5JDF A;  3VU7 H;  4QXC B;  3RX6 A;  1WYC A;  1WYB A;  4PJJ A;  4MHC A;  4IGU A;  5H6Q B;  4EIW A;  2Q9Q B;  3ZCI A;  2XAF B;  1OXZ A;  1NAF A;  4PK6 A;  5JRE A;  5C8Y E;  5CA0 E;  4DO0 A;  2EHO A;  2IC9 A;  2LHR A;  4P09 A;  3ZCJ A;  2JRK A;  2LOS A;  2XQY A;  4ZHQ E;  3TKL B;  5L3B B;  3ESL A;  5LXT E;  3BQI A;  4F6R C;  2PFV A;  4GIW A;  4TUY E;  3ANW A;  2XAS B;  3AA0 B;  2LE8 A;  2RA1 A;  4JEH B;  5LBM A;  1MMD A;  1WLX A;  1US7 B;  3B57 A;  3N2K E;  5LBQ B;  4C90 A;  3CX8 B;  5JDH A;  3GMI A;  4TV9 E;  2CLY B;  4PJL A;  3AAE B;  2Q9Q D;  2VKD A;  3AAI A;  2V1D B;  3PE0 A;  4WW0 A;  3HR0 A;  3ZYM A;  2E8I A;  5E0O A;  3LJC A;  4V1A v;  1U5P A;  2XHE B;  4O8S A;  4BA9 A;  3LFM A;  2LSY A;  4HEA A;  4C91 A;  5ETW A;  3CQX C;  3MJX A;  3N9N A;  1LVF A;  2VKO A;  5JQG E;  2VWA A;  3H3A A;  1D1A A;  4EB6 E;  3CX7 B;  1QSD A;  3KBT A;  2ODV A;  5LYJ E;  3ETV A;  2V7K A;  3KFW X;  3VKG A;  4DND A;  2VL8 A;  4U74 A;  2LSI A;  2JMH A;  4ANJ A;  3ZYK A;  2KXP B;  3HKC E;  2CWO A;  3KVA A;  3WI3 A;  2DWG A;  5M4Y A;  1MIW A;  4I50 E;  4J2C A;  4BAY B;  4DBR A;  3QK6 A;  3C51 A;  1CUN A;  2WM9 A;  2V7I A;  4L0R A;  3QUJ A;  3SS1 A;  4AXP A;  1V9D A;  2Y6X A;  3C4Z A;  2JMK A;  3HKE E;  4TN7 B;  4GK5 E;  2ACX A;  2HH7 A;  4AKR B;  5EZY E;  2NW8 A;  4M1P A;  4X1Y E;  2LSK A;  3MXZ A;  3UUL A;  2CXD A;  4PNI A;  1IJ6 A;  4PW8 A;  1BR4 A;  5HXS A;  3ETU A;  3KV9 A;  5JDQ A;  4EAH A;  1IJ5 A;  1HG5 A;  2VKH A;  1D0Y A;  3Q5W A;  5L3C B;  2C0S A;  5LNK A;  1HX8 A;  4YLH A;  2ES0 A;  4ILU A;  1IAP A;  1ZKE A;  2HPJ A;  3LK2 B;  3RC8 A;  2H7V C;  4KMC A;  4QWN B;  3R6N A;  4CXW A;  3SWH A;  1MIV A;  2ZLY A;  3L09 A;  3LBX A;  5H6R B;  2NW7 A;  4PJN A;  4O4I E;  1BR0 A;  2YU2 A;  2ZM8 A;  3OYX A;  2IAK A;  4L5G A;  3F31 A;  3FXD B;  2X68 A;  1BR2 A;  2W00 A;  3KV5 A;  2UXX B;  3ZMS B;  1FIO A;  5IHY A;  1HCI A;  2NWB A;  5HYA A;  5J2T E;  4EZH A;  3OBV E;  4OYK A;  3T8O A;  2N1G A;  3VHL A;  2KMF A;  5AFU L;  4IE5 A;  3E0Z A;  1FMV A;  4CQI A;  2Y48 B;  4AQG A;  4OYJ A;  1BR1 A;  4MFR A;  2CEA A;  4EZ4 A;  2JPF A;  3O9X A;  5JRC A;  3CQG B;  3IF8 B;  4GOU A;  3V5U A;  4DMW A;  2D5U A;  2V7M A;  4GK0 E;  3NBX X;  3N9O A;  3O1J A;  3FXE B;  3K3N A;  3HKB E;  5LP6 E;  3EDV A;  5LHG B;  2XAG B;  1ZEE A;  4I55 E;  5FP3 A;  4E7Z A;  4P0A A;  2SPC A;  2CE7 A;  2Q9Q C;  5EK4 A;  2A2F X;  4CI1 B;  2Q9Q A;  3SRZ A;  4I4T E;  3ZMT B;  2LEH A;  1Z0P A;  2VAS A;  1MIY A;  2Z6E A;  3Q5X A;  5FMN A;  2V7L A;  3U3I A;  2K24 A;  4CXY A;  3I0O A;  4FJO A;  2LHN A;  2OA5 A;  3BK9 A;  2MYS A;  3OKQ A;  4ADZ A;  4GYS A;  2KLQ A;  4ZI7 E;  2N2N A;  4YJ2 E;  5DAB A;  4H9N C;  3R84 B;  4AKL A;  3F2E A;  3UT5 E;  2ZM0 A;  3AA7 B;  3MK7 C;  2KZ7 B;  5L3G B;  3J9X 1;  3ZMV B;  4CI3 B;  2CLY C;  3RYC E;  4DVD A;  2W62 A;  3K3Q C;  4X1K E;  1QUU A;  3V5S A;  5L3F B;  4ZI3 D;  4ZS2 A;  5L2L A;  1EZ3 A;  4CZZ B;  4H9Q C;  4ISS A;  2H7O A;  2I59 A;  3ZJ2 A;  3VKH A;  3GWH A;  2YK0 A;  4AKH A;  3FBL A;  2EHO B;  1MMN A;  2W61 A;  2QGS A;  1UX5 A;  3CWZ B;  3IBP A;  3A5X A;  3QC9 A;  1SA0 E;  3UFE A;  3ZYL A;  1FMW A;  1MMA A;  3SOL A;  4WBO A;  5JDL A;  3EUH A;  3D0T A;  3KBU A;  3OYZ A;  2E9X D;  4HE8 A;  4BJM A;  3PUG A;  2HPL A;  3HKD E;  1UCU A;  2CWY A;  4H63 V;  4UEM A;  2LSJ A;  2LSG A;  5JR9 B;  4NUV A;  2PBI A;  4OHF A;  3E22 E;  5LHH B;  4O4L E;  3RRC A;  3DJB A;  3RYF E;  5HWX A;  1ZV4 X;  4IHJ E;  3KV6 A;  3O1H A;  3RRW A;  3ZC1 A;  3ZMU B;  2KWI B;  4Z8X A;  4XBF B;  1ZHC A;  1X79 A;  2BVL A;  3RYH E;  1S35 A;  3C4W A;  4IIJ E;  5LGN B;  4YHJ A;  2MBG A;  2EHO D;  3N2O A;  3PU8 A;  5LOV E;  2XAQ B;  4A56 A;  4WNK A;  5DJQ C;  2DWK A;  3NRX A;  1HF8 A;  1YD8 G;  2Y8D A;  3F57 A;  4YJ3 E;  2C5J A;  4EOZ B;  4ZI2 D;  5J1G A;  3M65 A;  4IST A;  4H63 H;  2V26 A;  4TX5 A;  3N5L A;  4AQF C;  3HL6 A;  4AQF A;  4MAL A;  4ERR A;  4EYY R;  4AI6 A;  3BQK A;  1YW0 A;  4X20 E;  1LKX A;  5HXR A;  4DMV A;  3MA9 A;  2K48 A;  2IW5 B;  1Y64 B;  4O4H E;  1HS7 A;  2UXN B;  3N9Q A;  3MKD A;  3UUN A;  2J1D G;  2WWU A;  3L3P A;  5HXC A;  1NWM X;  2L3L A;  2DCF A;  3JC6 D;  3MAC A;  4PK5 A;  5FNV E;  2RP4 A;  4L9I A;  3Q9D A;  1FEW A;  3IHR A;  3PUA A;  3ZN1 B;  5DQV A;  5DQW A;  3C98 B;  5JDG A;  3RKO A;  1D1C A;  2YEV C;  4IE4 A;  5LA6 E;  5HAX A;  3ZPO A;  3GN5 B;  5CA1 E;  3AAA B;  4UF0 B;  4AKG A;  2JQQ A;  2P9B A;  3K3O A;  4K0U A;  1VOM A;  4WBN E;  3N9M A;  4P0B A;  4O4J E;  5ADX L;  5FYM A;  1IZN B;  3AVR A;  1YKH B;  2DLR A;  4ZI3 C;  1S94 A;  4ASK A;  3UUM A;  2DI4 A;  4B6X A;  5FXX A;  2CXL A;  2X9X A;  3ONX A;  2X0L B;  1KK7 A;  3BQL A;  3ZLI A;  3CKD A;  3CX6 B;  2PJQ A;  1U4Q A;  2XAH B;  2NP9 A;  2MOZ A;  2KWH A;  3C50 A;  5KDM C;  5CB4 E;  2K9A A;  3I0Q A;  5JRC B;  4XZC A;  3KIN B;  2CM0 A;  2X9H A;  3LK3 B;  5HWY A;  4H9P C;  2D2S A;  3KVB A;  1AJ3 A;  2VKJ A;  3LK4 2;  5LJM A;  4JLE A;  2W0G A;  4UVB B;  2MTQ A;  4IE6 A;  2E9X B;  1WR6 A;  4UVC B;  4TV8 E;  5LGU B;  3NZP A;  1MND A;  2WMO A;  5BMV E;  2X66 A;  5TAO A;  3O1I A;  4QX8 B;  2VB6 A;  5FY7 A;  1T98 A;  2L9Q A;  2LOP A;  4H9O C;  4KP3 C;  3OJA A;  4MBQ A;  4IE0 A;  4BJN A;  1KNZ A;  2LM9 A;  2A3D A;  2CA5 A;  2LJL A;  3GA8 A;  2EHO C;  4H9R C;  1VRB A;  3I1A A;  3E08 A;  4X1I E;  3K8P C;  2JJ9 A;  3UUX B;  4H9S E;  2LT3 A;  2G0U A;  4AKI A;  2C5I T;  1HTJ F;  3J7Y q;  2ZM2 A;  2PG8 A;  1WRD A;  4ZI2 C;  3KDS E;  3U78 A;  5F8P A;  1E1H B;  2C5K T;  4NUU A;  5JR9 C;  4YFS A;  3ANW B;  5JR9 A;  3RYI E;  5LGT B;  3NRY A;  3FBZ A;  4UV9 B;  4QXH B;  2NW9 A;  4PAG A;  2YU1 A;  4HN9 A;  2B1E A;  5J2U E;  2NTX A;  2WAU A;  3CPZ A;  3PUR A;  4G2A A;  3EDU A;  1MMG A;  4HKA A;  3PUS A;  2WBL A;  1LVK A;  3C4X A;  4KUM B;  3CQC B;  5JH7 E;  1OWA A;  5KX5 E;  3P7I A;  2DNX A;  3P8C D;  2M67 A;  2KND A;  4EYU A;  3H37 A;  3IEE A;  4GYR A;  4UIG A;  3LG7 A;  4MLK A;  3JC6 C;  4JUY A;  5L3E B;  1G8X A;  1MNE A;  3ZJ1 A;  3RC3 A;  5HXE A;  5FXW A;  3PU3 A;  2D0U A;  4I43 B;  2X9Y A;  3B13 A;  3ZEF B;  3AA1 B;  4ZS3 A;  5GON E;  4QX7 B;  5EK3 A;  5A1L A;  4E7S A;  4IE7 A;  1HG2 A;  2BDE A;  3WAK A;  1D0Z A;  2DHR A;  2ODU A;  5LCY A;  5LG4 A;  2N9D A;  5JDN A;  2CCQ A;  5FXV A;  4N78 D;  3FHN A;  3RH3 A;  1UX4 A;  4EXT A;  3I9W A;  3EVY A;  1YKE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...