2CCXA

Determination of the nuclear magnetic resonance solution structure of cardiotoxin ctx iib from naja mossambica mossambica
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
b'LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTNKCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN CTX IIB
publication title Determination of the nuclear-magnetic-resonance solution structure of cardiotoxin CTX IIb from Naja mossambica mossambica.
pubmed doi rcsb
source organism Naja mossambica
molecule tags Cardiotoxin
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1993-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ccxA00
4OM4A 3NEQA 1KBTA 1CB9A 2OFSA 3KFDE 1H0JA 2L5SA 4IYEA 1TXBA 1KBAA 1G6MA 1REWC 3LAQU 1CRFA 2PJYC 1KC4A 1KFHA 3EVSC 4OM5A 3NH7A 3ERAA 2MUOA 1KXIA 1S4YA 1PLOA 3U74U 1FRAA 4QTIU 5DZ5A 4FAOC 2I9BE 1DRSA 1HC9A 1ERAA 5EBXA 1HOYA 4ZQYA 1ERGA 1HC9B 2PJYB 4BIKB 5IMYC 1F94A 1LXGA 2CRSA 2H62C 1IKCA 1CREA 2H7ZA 1TFSA 2LA1A 2BHIA 2QC1A 2H64C 2H7ZB 1NYSA 3HH7A 1CVOA 1M9ZA 3U73U 2K3GA 2MHYA 1BTEA 1QM7A 1LJZA 1TXAA 1CTXA 1LSIA 2MJYA 6EBXA 2VLWA 1KU6B 2H62D 2L03A 2X8BB 2CDXA 2ERAA 3BT1U 1F8UB 1ES7B 1L4WA 2H64B 1JGKA 2HLRA 2N99A 2GOOC 2BTXA 1NEAA 2LCRA 1LXHA 5DO6A 1LX5B 4AEAA 4DO8A 4BDTB 5IMTD 1NXBA 4FAOE 1RL5A 2QJAC 2GOOB 2NBTA 1RGJA 1XT3A 1IDHA 3KFDI 1YWHA 1ONJA 1KL8A 1FSSB 2JVEA 1B41B 1COEA 1JBDA 2CCXA 1IDIA 2H5FA 1FFJA 1FASA 1QKDA 4RUDA 1CCQA 1KBSA 1IDLA 5DU1A 2CTXA 1W6BA 2UWRA 1I02A 2HLQA 1CODA 1CDQA 1V6PA 1FSCA 1UG4A 4P7UA 2MJ4A 1NTNA 1BXPA 1IDGA 1FF4A 3QB4B 3VTSA 1KTZB 1CDRA 2JQPA 2QJBC 2FD6U 1MR6A 4XJJA 3EBXA 2UX2A 1NORA 3NDSA 3PLCA 1IQ9A 1ABTA 2H8UA 4UY2C 1IK8A 2CRTA 1KS6A 1MAHF 2MJ0A 2MUPA 4LFTA 1HAAA 1CDSA 3BT2U 1JE9A 1NYUA 1QKEA 1ZADA 2MFAA 2J8BA 1CXOA 1TGXA 1IJCA 4EY8B 2QJ9C 1CHVS 2ABXA 3FEVA 1HAJA 1NTXA 1VB0A 4HQPF 1CXNA 1CDTA
chains in the Genus database with same CATH superfamily
4OM4A 3NEQA 1KBTA 1CB9A 2OFSA 3KFDE 1H0JA 2L5SA 4IYEA 1TXBA 1KBAA 1G6MA 1REWC 3LAQU 1CRFA 2PJYC 1KC4A 1KFHA 3EVSC 4OM5A 3NH7A 3ERAA 2MUOA 1KXIA 1S4YA 1PLOA 3U74U 1FRAA 4QTIU 5DZ5A 4FAOC 2I9BE 1DRSA 1HC9A 1ERAA 5EBXA 1HOYA 4ZQYA 1ERGA 1HC9B 2PJYB 4BIKB 5IMYC 1F94A 1LXGA 2CRSA 2H62C 1IKCA 1CREA 2H7ZA 1TFSA 2LA1A 2BHIA 2QC1A 2H64C 2H7ZB 1NYSA 3HH7A 1CVOA 1M9ZA 3U73U 2K3GA 2MHYA 1BTEA 1QM7A 1LJZA 1TXAA 1CTXA 1LSIA 2MJYA 6EBXA 2VLWA 1KU6B 2H62D 2L03A 2X8BB 2CDXA 2ERAA 3BT1U 1F8UB 1ES7B 1L4WA 2H64B 1JGKA 2HLRA 2N99A 2GOOC 2BTXA 1NEAA 2LCRA 1LXHA 5DO6A 1LX5B 4AEAA 4DO8A 4BDTB 5IMTD 1NXBA 4FAOE 1RL5A 2QJAC 2GOOB 2NBTA 1RGJA 1XT3A 1IDHA 3KFDI 1YWHA 1ONJA 1KL8A 1FSSB 2JVEA 1B41B 4KSNA 1COEA 1JBDA 2CCXA 1IDIA 2H5FA 1FFJA 1FASA 1QKDA 4RUDA 1CCQA 1KBSA 1IDLA 5DU1A 2CTXA 1W6BA 2UWRA 1I02A 2HLQA 1CODA 1CDQA 1V6PA 1FSCA 1UG4A 4P7UA 2MJ4A 1NTNA 1BXPA 1IDGA 1FF4A 3QB4B 3VTSA 1KTZB 1CDRA 2JQPA 2QJBC 2FD6U 1MR6A 4XJJA 3EBXA 2UX2A 1NORA 3NDSA 3PLCA 1IQ9A 1ABTA 2H8UA 4UY2C 1IK8A 2CRTA 1KS6A 1MAHF 2MJ0A 2MUPA 4LFTA 1HAAA 1CDSA 3BT2U 1JE9A 1NYUA 1QKEA 1ZADA 2MFAA 2J8BA 1CXOA 1TGXA 1IJCA 4EY8B 2QJ9C 1CHVS 2ABXA 3FEVA 1HAJA 1NTXA 1VB0A 4HQPF 1CXNA 1CDTA
chains in the Genus database with same CATH topology
4OM4A 3NEQA 1KBTA 1CB9A 2OFSA 3KFDE 1H0JA 2L5SA 4IYEA 1TXBA 1KBAA 1G6MA 1REWC 3LAQU 1CRFA 2PJYC 1KC4A 1KFHA 3EVSC 4OM5A 3NH7A 3ERAA 2MUOA 1KXIA 1S4YA 1PLOA 3U74U 1FRAA 4QTIU 5DZ5A 4FAOC 2I9BE 1DRSA 1HC9A 1ERAA 5EBXA 1HOYA 4ZQYA 1ERGA 1HC9B 2PJYB 4BIKB 5IMYC 1F94A 1LXGA 2CRSA 2H62C 1IKCA 1CREA 2H7ZA 1TFSA 2LA1A 2BHIA 2QC1A 2H64C 2H7ZB 1NYSA 3HH7A 1CVOA 1M9ZA 3U73U 2K3GA 2MHYA 1BTEA 1QM7A 1LJZA 1TXAA 1CTXA 1LSIA 2MJYA 6EBXA 2VLWA 1KU6B 2H62D 2L03A 2X8BB 2CDXA 2ERAA 3BT1U 1F8UB 1ES7B 1L4WA 2H64B 1JGKA 2HLRA 2N99A 2GOOC 2BTXA 1NEAA 2LCRA 1LXHA 5DO6A 1LX5B 4AEAA 4DO8A 4BDTB 5IMTD 1NXBA 4FAOE 1RL5A 2QJAC 2GOOB 2NBTA 1RGJA 1XT3A 1IDHA 3KFDI 1YWHA 1ONJA 1KL8A 1FSSB 2JVEA 1B41B 4KSNA 1COEA 1JBDA 2CCXA 1IDIA 2H5FA 1FFJA 1FASA 1QKDA 4RUDA 1CCQA 1KBSA 1IDLA 5DU1A 2CTXA 1W6BA 2UWRA 1I02A 2HLQA 1CODA 1CDQA 1V6PA 1FSCA 1UG4A 4P7UA 2MJ4A 1NTNA 1BXPA 1IDGA 1FF4A 3QB4B 3VTSA 1KTZB 1CDRA 2JQPA 2QJBC 2FD6U 1MR6A 4XJJA 3EBXA 2UX2A 1NORA 3NDSA 3PLCA 1IQ9A 1ABTA 2H8UA 4UY2C 1IK8A 2CRTA 1KS6A 1MAHF 2MJ0A 2MUPA 4LFTA 1HAAA 1CDSA 3BT2U 1JE9A 1NYUA 1QKEA 1ZADA 2MFAA 2J8BA 1CXOA 1TGXA 1IJCA 4EY8B 2QJ9C 1CHVS 2ABXA 3FEVA 1HAJA 1NTXA 1VB0A 4HQPF 1CXNA 1CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM4 A;  3NEQ A;  1KBT A;  1CB9 A;  2OFS A;  3KFD E;  1H0J A;  2L5S A;  4IYE A;  1TXB A;  1KBA A;  1G6M A;  1REW C;  3LAQ U;  1CRF A;  2PJY C;  1KC4 A;  1KFH A;  3EVS C;  4OM5 A;  3NH7 A;  3ERA A;  2MUO A;  1KXI A;  1S4Y A;  1PLO A;  3U74 U;  1FRA A;  4QTI U;  5DZ5 A;  4FAO C;  2I9B E;  1DRS A;  1HC9 A;  1ERA A;  5EBX A;  1HOY A;  4ZQY A;  1ERG A;  1HC9 B;  2PJY B;  4BIK B;  5IMY C;  1F94 A;  1LXG A;  2CRS A;  2H62 C;  1IKC A;  1CRE A;  2H7Z A;  1TFS A;  2LA1 A;  2BHI A;  2QC1 A;  2H64 C;  2H7Z B;  1NYS A;  3HH7 A;  1CVO A;  1M9Z A;  3U73 U;  2K3G A;  2MHY A;  1BTE A;  1QM7 A;  1LJZ A;  1TXA A;  1CTX A;  1LSI A;  2MJY A;  6EBX A;  2VLW A;  1KU6 B;  2H62 D;  2L03 A;  2X8B B;  2CDX A;  2ERA A;  3BT1 U;  1F8U B;  1ES7 B;  1L4W A;  2H64 B;  1JGK A;  2HLR A;  2N99 A;  2GOO C;  2BTX A;  1NEA A;  2LCR A;  1LXH A;  5DO6 A;  1LX5 B;  4AEA A;  4DO8 A;  4BDT B;  5IMT D;  1NXB A;  4FAO E;  1RL5 A;  2QJA C;  2GOO B;  2NBT A;  1RGJ A;  1XT3 A;  1IDH A;  3KFD I;  1YWH A;  1ONJ A;  1KL8 A;  1FSS B;  2JVE A;  1B41 B;  1COE A;  1JBD A;  2CCX A;  1IDI A;  2H5F A;  1FFJ A;  1FAS A;  1QKD A;  4RUD A;  1CCQ A;  1KBS A;  1IDL A;  5DU1 A;  2CTX A;  1W6B A;  2UWR A;  1I02 A;  2HLQ A;  1COD A;  1CDQ A;  1V6P A;  1FSC A;  1UG4 A;  4P7U A;  2MJ4 A;  1NTN A;  1BXP A;  1IDG A;  1FF4 A;  3QB4 B;  3VTS A;  1KTZ B;  1CDR A;  2JQP A;  2QJB C;  2FD6 U;  1MR6 A;  4XJJ A;  3EBX A;  2UX2 A;  1NOR A;  3NDS A;  3PLC A;  1IQ9 A;  1ABT A;  2H8U A;  4UY2 C;  1IK8 A;  2CRT A;  1KS6 A;  1MAH F;  2MJ0 A;  2MUP A;  4LFT A;  1HAA A;  1CDS A;  3BT2 U;  1JE9 A;  1NYU A;  1QKE A;  1ZAD A;  2MFA A;  2J8B A;  1CXO A;  1TGX A;  1IJC A;  4EY8 B;  2QJ9 C;  1CHV S;  2ABX A;  3FEV A;  1HAJ A;  1NTX A;  1VB0 A;  4HQP F;  1CXN A;  1CDT A; 
#chains in the Genus database with same CATH topology
 4OM4 A;  3NEQ A;  1KBT A;  1CB9 A;  2OFS A;  3KFD E;  1H0J A;  2L5S A;  4IYE A;  1TXB A;  1KBA A;  1G6M A;  1REW C;  3LAQ U;  1CRF A;  2PJY C;  1KC4 A;  1KFH A;  3EVS C;  4OM5 A;  3NH7 A;  3ERA A;  2MUO A;  1KXI A;  1S4Y A;  1PLO A;  3U74 U;  1FRA A;  4QTI U;  5DZ5 A;  4FAO C;  2I9B E;  1DRS A;  1HC9 A;  1ERA A;  5EBX A;  1HOY A;  4ZQY A;  1ERG A;  1HC9 B;  2PJY B;  4BIK B;  5IMY C;  1F94 A;  1LXG A;  2CRS A;  2H62 C;  1IKC A;  1CRE A;  2H7Z A;  1TFS A;  2LA1 A;  2BHI A;  2QC1 A;  2H64 C;  2H7Z B;  1NYS A;  3HH7 A;  1CVO A;  1M9Z A;  3U73 U;  2K3G A;  2MHY A;  1BTE A;  1QM7 A;  1LJZ A;  1TXA A;  1CTX A;  1LSI A;  2MJY A;  6EBX A;  2VLW A;  1KU6 B;  2H62 D;  2L03 A;  2X8B B;  2CDX A;  2ERA A;  3BT1 U;  1F8U B;  1ES7 B;  1L4W A;  2H64 B;  1JGK A;  2HLR A;  2N99 A;  2GOO C;  2BTX A;  1NEA A;  2LCR A;  1LXH A;  5DO6 A;  1LX5 B;  4AEA A;  4DO8 A;  4BDT B;  5IMT D;  1NXB A;  4FAO E;  1RL5 A;  2QJA C;  2GOO B;  2NBT A;  1RGJ A;  1XT3 A;  1IDH A;  3KFD I;  1YWH A;  1ONJ A;  1KL8 A;  1FSS B;  2JVE A;  1B41 B;  4KSN A;  1COE A;  1JBD A;  2CCX A;  1IDI A;  2H5F A;  1FFJ A;  1FAS A;  1QKD A;  4RUD A;  1CCQ A;  1KBS A;  1IDL A;  5DU1 A;  2CTX A;  1W6B A;  2UWR A;  1I02 A;  2HLQ A;  1COD A;  1CDQ A;  1V6P A;  1FSC A;  1UG4 A;  4P7U A;  2MJ4 A;  1NTN A;  1BXP A;  1IDG A;  1FF4 A;  3QB4 B;  3VTS A;  1KTZ B;  1CDR A;  2JQP A;  2QJB C;  2FD6 U;  1MR6 A;  4XJJ A;  3EBX A;  2UX2 A;  1NOR A;  3NDS A;  3PLC A;  1IQ9 A;  1ABT A;  2H8U A;  4UY2 C;  1IK8 A;  2CRT A;  1KS6 A;  1MAH F;  2MJ0 A;  2MUP A;  4LFT A;  1HAA A;  1CDS A;  3BT2 U;  1JE9 A;  1NYU A;  1QKE A;  1ZAD A;  2MFA A;  2J8B A;  1CXO A;  1TGX A;  1IJC A;  4EY8 B;  2QJ9 C;  1CHV S;  2ABX A;  3FEV A;  1HAJ A;  1NTX A;  1VB0 A;  4HQP F;  1CXN A;  1CDT A; 
#chains in the Genus database with same CATH homology
 4OM4 A;  3NEQ A;  1KBT A;  1CB9 A;  2OFS A;  3KFD E;  1H0J A;  2L5S A;  4IYE A;  1TXB A;  1KBA A;  1G6M A;  1REW C;  3LAQ U;  1CRF A;  2PJY C;  1KC4 A;  1KFH A;  3EVS C;  4OM5 A;  3NH7 A;  3ERA A;  2MUO A;  1KXI A;  1S4Y A;  1PLO A;  3U74 U;  1FRA A;  4QTI U;  5DZ5 A;  4FAO C;  2I9B E;  1DRS A;  1HC9 A;  1ERA A;  5EBX A;  1HOY A;  4ZQY A;  1ERG A;  1HC9 B;  2PJY B;  4BIK B;  5IMY C;  1F94 A;  1LXG A;  2CRS A;  2H62 C;  1IKC A;  1CRE A;  2H7Z A;  1TFS A;  2LA1 A;  2BHI A;  2QC1 A;  2H64 C;  2H7Z B;  1NYS A;  3HH7 A;  1CVO A;  1M9Z A;  3U73 U;  2K3G A;  2MHY A;  1BTE A;  1QM7 A;  1LJZ A;  1TXA A;  1CTX A;  1LSI A;  2MJY A;  6EBX A;  2VLW A;  1KU6 B;  2H62 D;  2L03 A;  2X8B B;  2CDX A;  2ERA A;  3BT1 U;  1F8U B;  1ES7 B;  1L4W A;  2H64 B;  1JGK A;  2HLR A;  2N99 A;  2GOO C;  2BTX A;  1NEA A;  2LCR A;  1LXH A;  5DO6 A;  1LX5 B;  4AEA A;  4DO8 A;  4BDT B;  5IMT D;  1NXB A;  4FAO E;  1RL5 A;  2QJA C;  2GOO B;  2NBT A;  1RGJ A;  1XT3 A;  1IDH A;  3KFD I;  1YWH A;  1ONJ A;  1KL8 A;  1FSS B;  2JVE A;  1B41 B;  4KSN A;  1COE A;  1JBD A;  2CCX A;  1IDI A;  2H5F A;  1FFJ A;  1FAS A;  1QKD A;  4RUD A;  1CCQ A;  1KBS A;  1IDL A;  5DU1 A;  2CTX A;  1W6B A;  2UWR A;  1I02 A;  2HLQ A;  1COD A;  1CDQ A;  1V6P A;  1FSC A;  1UG4 A;  4P7U A;  2MJ4 A;  1NTN A;  1BXP A;  1IDG A;  1FF4 A;  3QB4 B;  3VTS A;  1KTZ B;  1CDR A;  2JQP A;  2QJB C;  2FD6 U;  1MR6 A;  4XJJ A;  3EBX A;  2UX2 A;  1NOR A;  3NDS A;  3PLC A;  1IQ9 A;  1ABT A;  2H8U A;  4UY2 C;  1IK8 A;  2CRT A;  1KS6 A;  1MAH F;  2MJ0 A;  2MUP A;  4LFT A;  1HAA A;  1CDS A;  3BT2 U;  1JE9 A;  1NYU A;  1QKE A;  1ZAD A;  2MFA A;  2J8B A;  1CXO A;  1TGX A;  1IJC A;  4EY8 B;  2QJ9 C;  1CHV S;  2ABX A;  3FEV A;  1HAJ A;  1NTX A;  1VB0 A;  4HQP F;  1CXN A;  1CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...