2CCXA

Determination of the nuclear magnetic resonance solution structure of cardiotoxin ctx iib from naja mossambica mossambica
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTNKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the nuclear-magnetic-resonance solution structure of cardiotoxin CTX IIb from Naja mossambica mossambica.
pubmed doi rcsb
source organism Naja mossambica
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN CTX IIB
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1993-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ccxA00
3FEVA 2N99A 3EBXA 1KBAA 1ES7B 4LFTA 2H62D 1KU6B 2ABXA 2BHIA 2MUPA 1KS6A 2L5SA 5DU1A 1I02A 1IQ9A 1NEAA 1L4WA 1TGXA 1RL5A 2PJYC 4OM4A 1IJCA 1ZADA 1TFSA 1IK8A 1KL8A 3KFDE 2LA1A 1CXOA 5IMTD 4FAOE 1HAJA 2VLWA 4P7UA 1VB0A 5EBXA 1YWHA 1NYSA 1CHVS 2CRTA 2QJAC 4AEAA 2NBTA 2UWRA 2FD6U 1KFHA 2I9BE 4FAOC 1CTXA 4RUDA 1JGKA 1V6PA 1QM7A 1CVOA 2LCRA 2MUOA 2MFAA 2H8UA 1IDIA 1LSIA 1NXBA 1JE9A 1FFJA 2QJBC 1IDLA 1H0JA 3EVSC 1FASA 1IDGA 3NDSA 5DO6A 1M9ZA 3U73U 2X8BB 2H5FA 3HH7A 1G6MA 4UY2C 1KTZB 4EY8B 1NTXA 2PJYB 1HOYA 1MR6A 3QB4B 1CCQA 1UG4A 1LX5B 1HC9A 1CREA 1LJZA 3U74U 2GOOB 2MJYA 1XT3A 1CDRA 1QKDA 1KXIA 2JVEA 3PLCA 1MAHF 3NEQA 2ERAA 2MJ4A 1FF4A 3VTSA 2H62C 1IKCA 1QKEA 1BXPA 1BTEA 1PLOA 2HLRA 4BIKB 2UX2A 2BTXA 1CDSA 1F8UB 1NYUA 1KBTA 5IMYC 2H64C 4OM5A 2L03A 4QTIU 2MHYA 1CRFA 1ONJA 1CDTA 3LAQU 1FSCA 2CCXA 1NTNA 1FRAA 1LXGA 1W6BA 2CTXA 2H7ZB 4XJJA 1ERAA 2QC1A 1S4YA 1F94A 1FSSB 1ABTA 2J8BA 4HQPF 4BDTB 1KBSA 1DRSA 3ERAA 3NH7A 2JQPA 1B41B 1KC4A 3BT2U 3BT1U 6EBXA 2QJ9C 2H7ZA 2HLQA 1HAAA 1IDHA 1HC9B 2CRSA 2CDXA 1TXBA 1NORA 1TXAA 4IYEA 2OFSA 2H64B 5DZ5A 1CODA 2MJ0A 1RGJA 2K3GA 1CXNA 4DO8A 1CDQA 1CB9A 3KFDI 4ZQYA 1JBDA 1ERGA 2GOOC 1REWC 1COEA 1LXHA
chains in the Genus database with same CATH superfamily
3FEVA 2N99A 3EBXA 1KBAA 1ES7B 4LFTA 2H62D 1KU6B 2ABXA 2BHIA 2MUPA 1KS6A 2L5SA 5DU1A 1I02A 1IQ9A 1NEAA 1L4WA 1TGXA 1RL5A 2PJYC 4OM4A 1IJCA 1ZADA 1TFSA 1IK8A 1KL8A 3KFDE 2LA1A 1CXOA 5IMTD 4FAOE 1HAJA 2VLWA 4P7UA 1VB0A 5EBXA 1YWHA 1NYSA 1CHVS 2CRTA 2QJAC 4AEAA 2NBTA 2UWRA 2FD6U 1KFHA 2I9BE 4FAOC 1CTXA 4RUDA 1JGKA 1V6PA 1QM7A 1CVOA 2LCRA 2MUOA 2MFAA 2H8UA 1IDIA 1LSIA 1NXBA 1JE9A 1FFJA 2QJBC 1IDLA 1H0JA 3EVSC 1FASA 1IDGA 3NDSA 5DO6A 1M9ZA 3U73U 2X8BB 2H5FA 3HH7A 1G6MA 4UY2C 1KTZB 4EY8B 1NTXA 2PJYB 1HOYA 1MR6A 3QB4B 1CCQA 1UG4A 1LX5B 1HC9A 1CREA 1LJZA 3U74U 2GOOB 2MJYA 1XT3A 1CDRA 1QKDA 1KXIA 2JVEA 3PLCA 1MAHF 3NEQA 2ERAA 2MJ4A 1FF4A 3VTSA 2H62C 1IKCA 1QKEA 1BXPA 1BTEA 1PLOA 2HLRA 4BIKB 2UX2A 4KSNA 2BTXA 1CDSA 1F8UB 1NYUA 1KBTA 5IMYC 2H64C 4OM5A 2L03A 4QTIU 2MHYA 1CRFA 1ONJA 1CDTA 3LAQU 1FSCA 2CCXA 1NTNA 1FRAA 1LXGA 1W6BA 2CTXA 2H7ZB 4XJJA 1ERAA 2QC1A 1S4YA 1F94A 1FSSB 1ABTA 2J8BA 4HQPF 4BDTB 1KBSA 1DRSA 3ERAA 3NH7A 2JQPA 1B41B 1KC4A 3BT2U 3BT1U 6EBXA 2QJ9C 2H7ZA 2HLQA 1HAAA 1IDHA 1HC9B 2CRSA 2CDXA 1TXBA 1NORA 1TXAA 4IYEA 2OFSA 2H64B 5DZ5A 1CODA 2MJ0A 1RGJA 2K3GA 1CXNA 4DO8A 1CDQA 1CB9A 3KFDI 4ZQYA 1JBDA 1ERGA 2GOOC 1REWC 1COEA 1LXHA
chains in the Genus database with same CATH topology
3FEVA 2N99A 3EBXA 1KBAA 1ES7B 4LFTA 2H62D 1KU6B 2ABXA 2BHIA 2MUPA 1KS6A 2L5SA 5DU1A 1I02A 1IQ9A 1NEAA 1L4WA 1TGXA 1RL5A 2PJYC 4OM4A 1IJCA 1ZADA 1TFSA 1IK8A 1KL8A 3KFDE 2LA1A 1CXOA 5IMTD 4FAOE 1HAJA 2VLWA 4P7UA 1VB0A 5EBXA 1YWHA 1NYSA 1CHVS 2CRTA 2QJAC 4AEAA 2NBTA 2UWRA 2FD6U 1KFHA 2I9BE 4FAOC 1CTXA 4RUDA 1JGKA 1V6PA 1QM7A 1CVOA 2LCRA 2MUOA 2MFAA 2H8UA 1IDIA 1LSIA 1NXBA 1JE9A 1FFJA 2QJBC 1IDLA 1H0JA 3EVSC 1FASA 1IDGA 3NDSA 5DO6A 1M9ZA 3U73U 2X8BB 2H5FA 3HH7A 1G6MA 4UY2C 1KTZB 4EY8B 1NTXA 2PJYB 1HOYA 1MR6A 3QB4B 1CCQA 1UG4A 1LX5B 1HC9A 1CREA 1LJZA 3U74U 2GOOB 2MJYA 1XT3A 1CDRA 1QKDA 1KXIA 2JVEA 3PLCA 1MAHF 3NEQA 2ERAA 2MJ4A 1FF4A 3VTSA 2H62C 1IKCA 1QKEA 1BXPA 1BTEA 1PLOA 2HLRA 4BIKB 2UX2A 4KSNA 2BTXA 1CDSA 1F8UB 1NYUA 1KBTA 5IMYC 2H64C 4OM5A 2L03A 4QTIU 2MHYA 1CRFA 1ONJA 1CDTA 3LAQU 1FSCA 2CCXA 1NTNA 1FRAA 1LXGA 1W6BA 2CTXA 2H7ZB 4XJJA 1ERAA 2QC1A 1S4YA 1F94A 1FSSB 1ABTA 2J8BA 4HQPF 4BDTB 1KBSA 1DRSA 3ERAA 3NH7A 2JQPA 1B41B 1KC4A 3BT2U 3BT1U 6EBXA 2QJ9C 2H7ZA 2HLQA 1HAAA 1IDHA 1HC9B 2CRSA 2CDXA 1TXBA 1NORA 1TXAA 4IYEA 2OFSA 2H64B 5DZ5A 1CODA 2MJ0A 1RGJA 2K3GA 1CXNA 4DO8A 1CDQA 1CB9A 3KFDI 4ZQYA 1JBDA 1ERGA 2GOOC 1REWC 1COEA 1LXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEV A;  2N99 A;  3EBX A;  1KBA A;  1ES7 B;  4LFT A;  2H62 D;  1KU6 B;  2ABX A;  2BHI A;  2MUP A;  1KS6 A;  2L5S A;  5DU1 A;  1I02 A;  1IQ9 A;  1NEA A;  1L4W A;  1TGX A;  1RL5 A;  2PJY C;  4OM4 A;  1IJC A;  1ZAD A;  1TFS A;  1IK8 A;  1KL8 A;  3KFD E;  2LA1 A;  1CXO A;  5IMT D;  4FAO E;  1HAJ A;  2VLW A;  4P7U A;  1VB0 A;  5EBX A;  1YWH A;  1NYS A;  1CHV S;  2CRT A;  2QJA C;  4AEA A;  2NBT A;  2UWR A;  2FD6 U;  1KFH A;  2I9B E;  4FAO C;  1CTX A;  4RUD A;  1JGK A;  1V6P A;  1QM7 A;  1CVO A;  2LCR A;  2MUO A;  2MFA A;  2H8U A;  1IDI A;  1LSI A;  1NXB A;  1JE9 A;  1FFJ A;  2QJB C;  1IDL A;  1H0J A;  3EVS C;  1FAS A;  1IDG A;  3NDS A;  5DO6 A;  1M9Z A;  3U73 U;  2X8B B;  2H5F A;  3HH7 A;  1G6M A;  4UY2 C;  1KTZ B;  4EY8 B;  1NTX A;  2PJY B;  1HOY A;  1MR6 A;  3QB4 B;  1CCQ A;  1UG4 A;  1LX5 B;  1HC9 A;  1CRE A;  1LJZ A;  3U74 U;  2GOO B;  2MJY A;  1XT3 A;  1CDR A;  1QKD A;  1KXI A;  2JVE A;  3PLC A;  1MAH F;  3NEQ A;  2ERA A;  2MJ4 A;  1FF4 A;  3VTS A;  2H62 C;  1IKC A;  1QKE A;  1BXP A;  1BTE A;  1PLO A;  2HLR A;  4BIK B;  2UX2 A;  2BTX A;  1CDS A;  1F8U B;  1NYU A;  1KBT A;  5IMY C;  2H64 C;  4OM5 A;  2L03 A;  4QTI U;  2MHY A;  1CRF A;  1ONJ A;  1CDT A;  3LAQ U;  1FSC A;  2CCX A;  1NTN A;  1FRA A;  1LXG A;  1W6B A;  2CTX A;  2H7Z B;  4XJJ A;  1ERA A;  2QC1 A;  1S4Y A;  1F94 A;  1FSS B;  1ABT A;  2J8B A;  4HQP F;  4BDT B;  1KBS A;  1DRS A;  3ERA A;  3NH7 A;  2JQP A;  1B41 B;  1KC4 A;  3BT2 U;  3BT1 U;  6EBX A;  2QJ9 C;  2H7Z A;  2HLQ A;  1HAA A;  1IDH A;  1HC9 B;  2CRS A;  2CDX A;  1TXB A;  1NOR A;  1TXA A;  4IYE A;  2OFS A;  2H64 B;  5DZ5 A;  1COD A;  2MJ0 A;  1RGJ A;  2K3G A;  1CXN A;  4DO8 A;  1CDQ A;  1CB9 A;  3KFD I;  4ZQY A;  1JBD A;  1ERG A;  2GOO C;  1REW C;  1COE A;  1LXH A; 
#chains in the Genus database with same CATH topology
 3FEV A;  2N99 A;  3EBX A;  1KBA A;  1ES7 B;  4LFT A;  2H62 D;  1KU6 B;  2ABX A;  2BHI A;  2MUP A;  1KS6 A;  2L5S A;  5DU1 A;  1I02 A;  1IQ9 A;  1NEA A;  1L4W A;  1TGX A;  1RL5 A;  2PJY C;  4OM4 A;  1IJC A;  1ZAD A;  1TFS A;  1IK8 A;  1KL8 A;  3KFD E;  2LA1 A;  1CXO A;  5IMT D;  4FAO E;  1HAJ A;  2VLW A;  4P7U A;  1VB0 A;  5EBX A;  1YWH A;  1NYS A;  1CHV S;  2CRT A;  2QJA C;  4AEA A;  2NBT A;  2UWR A;  2FD6 U;  1KFH A;  2I9B E;  4FAO C;  1CTX A;  4RUD A;  1JGK A;  1V6P A;  1QM7 A;  1CVO A;  2LCR A;  2MUO A;  2MFA A;  2H8U A;  1IDI A;  1LSI A;  1NXB A;  1JE9 A;  1FFJ A;  2QJB C;  1IDL A;  1H0J A;  3EVS C;  1FAS A;  1IDG A;  3NDS A;  5DO6 A;  1M9Z A;  3U73 U;  2X8B B;  2H5F A;  3HH7 A;  1G6M A;  4UY2 C;  1KTZ B;  4EY8 B;  1NTX A;  2PJY B;  1HOY A;  1MR6 A;  3QB4 B;  1CCQ A;  1UG4 A;  1LX5 B;  1HC9 A;  1CRE A;  1LJZ A;  3U74 U;  2GOO B;  2MJY A;  1XT3 A;  1CDR A;  1QKD A;  1KXI A;  2JVE A;  3PLC A;  1MAH F;  3NEQ A;  2ERA A;  2MJ4 A;  1FF4 A;  3VTS A;  2H62 C;  1IKC A;  1QKE A;  1BXP A;  1BTE A;  1PLO A;  2HLR A;  4BIK B;  2UX2 A;  4KSN A;  2BTX A;  1CDS A;  1F8U B;  1NYU A;  1KBT A;  5IMY C;  2H64 C;  4OM5 A;  2L03 A;  4QTI U;  2MHY A;  1CRF A;  1ONJ A;  1CDT A;  3LAQ U;  1FSC A;  2CCX A;  1NTN A;  1FRA A;  1LXG A;  1W6B A;  2CTX A;  2H7Z B;  4XJJ A;  1ERA A;  2QC1 A;  1S4Y A;  1F94 A;  1FSS B;  1ABT A;  2J8B A;  4HQP F;  4BDT B;  1KBS A;  1DRS A;  3ERA A;  3NH7 A;  2JQP A;  1B41 B;  1KC4 A;  3BT2 U;  3BT1 U;  6EBX A;  2QJ9 C;  2H7Z A;  2HLQ A;  1HAA A;  1IDH A;  1HC9 B;  2CRS A;  2CDX A;  1TXB A;  1NOR A;  1TXA A;  4IYE A;  2OFS A;  2H64 B;  5DZ5 A;  1COD A;  2MJ0 A;  1RGJ A;  2K3G A;  1CXN A;  4DO8 A;  1CDQ A;  1CB9 A;  3KFD I;  4ZQY A;  1JBD A;  1ERG A;  2GOO C;  1REW C;  1COE A;  1LXH A; 
#chains in the Genus database with same CATH homology
 3FEV A;  2N99 A;  3EBX A;  1KBA A;  1ES7 B;  4LFT A;  2H62 D;  1KU6 B;  2ABX A;  2BHI A;  2MUP A;  1KS6 A;  2L5S A;  5DU1 A;  1I02 A;  1IQ9 A;  1NEA A;  1L4W A;  1TGX A;  1RL5 A;  2PJY C;  4OM4 A;  1IJC A;  1ZAD A;  1TFS A;  1IK8 A;  1KL8 A;  3KFD E;  2LA1 A;  1CXO A;  5IMT D;  4FAO E;  1HAJ A;  2VLW A;  4P7U A;  1VB0 A;  5EBX A;  1YWH A;  1NYS A;  1CHV S;  2CRT A;  2QJA C;  4AEA A;  2NBT A;  2UWR A;  2FD6 U;  1KFH A;  2I9B E;  4FAO C;  1CTX A;  4RUD A;  1JGK A;  1V6P A;  1QM7 A;  1CVO A;  2LCR A;  2MUO A;  2MFA A;  2H8U A;  1IDI A;  1LSI A;  1NXB A;  1JE9 A;  1FFJ A;  2QJB C;  1IDL A;  1H0J A;  3EVS C;  1FAS A;  1IDG A;  3NDS A;  5DO6 A;  1M9Z A;  3U73 U;  2X8B B;  2H5F A;  3HH7 A;  1G6M A;  4UY2 C;  1KTZ B;  4EY8 B;  1NTX A;  2PJY B;  1HOY A;  1MR6 A;  3QB4 B;  1CCQ A;  1UG4 A;  1LX5 B;  1HC9 A;  1CRE A;  1LJZ A;  3U74 U;  2GOO B;  2MJY A;  1XT3 A;  1CDR A;  1QKD A;  1KXI A;  2JVE A;  3PLC A;  1MAH F;  3NEQ A;  2ERA A;  2MJ4 A;  1FF4 A;  3VTS A;  2H62 C;  1IKC A;  1QKE A;  1BXP A;  1BTE A;  1PLO A;  2HLR A;  4BIK B;  2UX2 A;  4KSN A;  2BTX A;  1CDS A;  1F8U B;  1NYU A;  1KBT A;  5IMY C;  2H64 C;  4OM5 A;  2L03 A;  4QTI U;  2MHY A;  1CRF A;  1ONJ A;  1CDT A;  3LAQ U;  1FSC A;  2CCX A;  1NTN A;  1FRA A;  1LXG A;  1W6B A;  2CTX A;  2H7Z B;  4XJJ A;  1ERA A;  2QC1 A;  1S4Y A;  1F94 A;  1FSS B;  1ABT A;  2J8B A;  4HQP F;  4BDT B;  1KBS A;  1DRS A;  3ERA A;  3NH7 A;  2JQP A;  1B41 B;  1KC4 A;  3BT2 U;  3BT1 U;  6EBX A;  2QJ9 C;  2H7Z A;  2HLQ A;  1HAA A;  1IDH A;  1HC9 B;  2CRS A;  2CDX A;  1TXB A;  1NOR A;  1TXA A;  4IYE A;  2OFS A;  2H64 B;  5DZ5 A;  1COD A;  2MJ0 A;  1RGJ A;  2K3G A;  1CXN A;  4DO8 A;  1CDQ A;  1CB9 A;  3KFD I;  4ZQY A;  1JBD A;  1ERG A;  2GOO C;  1REW C;  1COE A;  1LXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...