2CCXA

Determination of the nuclear magnetic resonance solution structure of cardiotoxin ctx iib from naja mossambica mossambica
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTNKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN CTX IIB
publication title Determination of the nuclear-magnetic-resonance solution structure of cardiotoxin CTX IIb from Naja mossambica mossambica.
pubmed doi rcsb
source organism Naja mossambica
molecule tags Cardiotoxin
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1993-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ccxA00
4LFTA 2CRSA 2L03A 2PJYC 1HC9B 1LSIA 1CHVS 3NEQA 1FF4A 1KXIA 2X8BB 1ES7B 1TXBA 1YWHA 2HLRA 2ERAA 4QTIU 1HAAA 2JVEA 1NYUA 2H62D 1G6MA 1KS6A 1L4WA 1IKCA 1CB9A 1KFHA 4ZQYA 2LA1A 3FEVA 1BTEA 1LJZA 1H0JA 1KU6B 1CXOA 1F94A 1W6BA 6EBXA 1FRAA 2NBTA 2QJBC 2UX2A 2GOOB 3ERAA 1VB0A 1TFSA 4XJJA 2UWRA 1IQ9A 2CTXA 3KFDE 1CDQA 1LXGA 1UG4A 2H5FA 3NDSA 1CCQA 4RUDA 1CXNA 2H64C 1PLOA 1HAJA 3PLCA 2QJAC 1HOYA 2H62C 4BDTB 1REWC 1QM7A 1NYSA 2K3GA 1IDLA 2H7ZA 5DO6A 3U73U 1IDGA 3EVSC 2GOOC 2MHYA 1CREA 1RL5A 3KFDI 1ONJA 2VLWA 1MAHF 5IMYC 2QC1A 3QB4B 1IJCA 1ZADA 1NORA 2MUOA 1KBSA 1RGJA 2MJ0A 1F8UB 1B41B 4HQPF 1NXBA 2PJYB 1ERAA 4DO8A 1NEAA 2MUPA 4BIKB 1HC9A 1ABTA 4P7UA 1KTZB 1ERGA 2J8BA 1MR6A 4EY8B 3VTSA 1CODA 1LX5B 1DRSA 2L5SA 3BT2U 1CRFA 1FFJA 1IDHA 1M9ZA 2I9BE 1TXAA 2LCRA 2BTXA 2MJYA 1I02A 1QKDA 1LXHA 4UY2C 2CRTA 3NH7A 2MFAA 1FSSB 1FASA 1KL8A 3U74U 1FSCA 4IYEA 1V6PA 1NTXA 2BHIA 1QKEA 5DU1A 3EBXA 1TGXA 1JGKA 1JE9A 2JQPA 1KBAA 1CDTA 3HH7A 2H8UA 1COEA 1CDSA 1CVOA 1IDIA 4FAOC 2ABXA 2H7ZB 3BT1U 4OM4A 4OM5A 3LAQU 1XT3A 2H64B 1BXPA 2OFSA 1CTXA 4AEAA 5DZ5A 5EBXA 2HLQA 1IK8A 2CDXA 4FAOE 1CDRA 2QJ9C 1S4YA 2CCXA 1NTNA 2MJ4A 2FD6U 5IMTD 1JBDA 1KC4A 2N99A 1KBTA
chains in the Genus database with same CATH superfamily
4LFTA 2CRSA 2L03A 2PJYC 1HC9B 1LSIA 1CHVS 3NEQA 1FF4A 1KXIA 2X8BB 1ES7B 1TXBA 1YWHA 2HLRA 2ERAA 4QTIU 1HAAA 2JVEA 1NYUA 2H62D 1G6MA 1KS6A 1L4WA 1IKCA 1CB9A 1KFHA 4ZQYA 2LA1A 3FEVA 1BTEA 1LJZA 1H0JA 1KU6B 1CXOA 1F94A 1W6BA 6EBXA 1FRAA 2NBTA 2QJBC 2UX2A 2GOOB 3ERAA 1VB0A 1TFSA 4XJJA 2UWRA 1IQ9A 2CTXA 3KFDE 1CDQA 1LXGA 1UG4A 2H5FA 3NDSA 1CCQA 4RUDA 1CXNA 2H64C 1PLOA 1HAJA 3PLCA 2QJAC 1HOYA 2H62C 4BDTB 1REWC 1QM7A 1NYSA 2K3GA 1IDLA 2H7ZA 5DO6A 3U73U 1IDGA 3EVSC 2GOOC 2MHYA 1CREA 1RL5A 3KFDI 1ONJA 2VLWA 1MAHF 5IMYC 2QC1A 3QB4B 1IJCA 1ZADA 1NORA 2MUOA 1KBSA 1RGJA 2MJ0A 1F8UB 1B41B 4HQPF 1NXBA 2PJYB 1ERAA 4DO8A 1NEAA 2MUPA 4BIKB 1HC9A 1ABTA 4P7UA 1KTZB 1ERGA 2J8BA 1MR6A 4EY8B 3VTSA 1CODA 1LX5B 1DRSA 2L5SA 3BT2U 1CRFA 1FFJA 1IDHA 1M9ZA 2I9BE 1TXAA 2LCRA 2BTXA 2MJYA 1I02A 1QKDA 1LXHA 4UY2C 2CRTA 3NH7A 2MFAA 1FSSB 1FASA 1KL8A 3U74U 1FSCA 4IYEA 1V6PA 1NTXA 2BHIA 1QKEA 5DU1A 3EBXA 1TGXA 1JGKA 1JE9A 2JQPA 1KBAA 4KSNA 1CDTA 3HH7A 2H8UA 1COEA 1CDSA 1CVOA 1IDIA 4FAOC 2ABXA 2H7ZB 3BT1U 4OM4A 4OM5A 3LAQU 1XT3A 2H64B 1BXPA 2OFSA 1CTXA 4AEAA 5DZ5A 5EBXA 2HLQA 1IK8A 2CDXA 4FAOE 1CDRA 2QJ9C 1S4YA 2CCXA 1NTNA 2MJ4A 2FD6U 5IMTD 1JBDA 1KC4A 2N99A 1KBTA
chains in the Genus database with same CATH topology
4LFTA 2CRSA 2L03A 2PJYC 1HC9B 1LSIA 1CHVS 3NEQA 1FF4A 1KXIA 2X8BB 1ES7B 1TXBA 1YWHA 2HLRA 2ERAA 4QTIU 1HAAA 2JVEA 1NYUA 2H62D 1G6MA 1KS6A 1L4WA 1IKCA 1CB9A 1KFHA 4ZQYA 2LA1A 3FEVA 1BTEA 1LJZA 1H0JA 1KU6B 1CXOA 1F94A 1W6BA 6EBXA 1FRAA 2NBTA 2QJBC 2UX2A 2GOOB 3ERAA 1VB0A 1TFSA 4XJJA 2UWRA 1IQ9A 2CTXA 3KFDE 1CDQA 1LXGA 1UG4A 2H5FA 3NDSA 1CCQA 4RUDA 1CXNA 2H64C 1PLOA 1HAJA 3PLCA 2QJAC 1HOYA 2H62C 4BDTB 1REWC 1QM7A 1NYSA 2K3GA 1IDLA 2H7ZA 5DO6A 3U73U 1IDGA 3EVSC 2GOOC 2MHYA 1CREA 1RL5A 3KFDI 1ONJA 2VLWA 1MAHF 5IMYC 2QC1A 3QB4B 1IJCA 1ZADA 1NORA 2MUOA 1KBSA 1RGJA 2MJ0A 1F8UB 1B41B 4HQPF 1NXBA 2PJYB 1ERAA 4DO8A 1NEAA 2MUPA 4BIKB 1HC9A 1ABTA 4P7UA 1KTZB 1ERGA 2J8BA 1MR6A 4EY8B 3VTSA 1CODA 1LX5B 1DRSA 2L5SA 3BT2U 1CRFA 1FFJA 1IDHA 1M9ZA 2I9BE 1TXAA 2LCRA 2BTXA 2MJYA 1I02A 1QKDA 1LXHA 4UY2C 2CRTA 3NH7A 2MFAA 1FSSB 1FASA 1KL8A 3U74U 1FSCA 4IYEA 1V6PA 1NTXA 2BHIA 1QKEA 5DU1A 3EBXA 1TGXA 1JGKA 1JE9A 2JQPA 1KBAA 4KSNA 1CDTA 3HH7A 2H8UA 1COEA 1CDSA 1CVOA 1IDIA 4FAOC 2ABXA 2H7ZB 3BT1U 4OM4A 4OM5A 3LAQU 1XT3A 2H64B 1BXPA 2OFSA 1CTXA 4AEAA 5DZ5A 5EBXA 2HLQA 1IK8A 2CDXA 4FAOE 1CDRA 2QJ9C 1S4YA 2CCXA 1NTNA 2MJ4A 2FD6U 5IMTD 1JBDA 1KC4A 2N99A 1KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFT A;  2CRS A;  2L03 A;  2PJY C;  1HC9 B;  1LSI A;  1CHV S;  3NEQ A;  1FF4 A;  1KXI A;  2X8B B;  1ES7 B;  1TXB A;  1YWH A;  2HLR A;  2ERA A;  4QTI U;  1HAA A;  2JVE A;  1NYU A;  2H62 D;  1G6M A;  1KS6 A;  1L4W A;  1IKC A;  1CB9 A;  1KFH A;  4ZQY A;  2LA1 A;  3FEV A;  1BTE A;  1LJZ A;  1H0J A;  1KU6 B;  1CXO A;  1F94 A;  1W6B A;  6EBX A;  1FRA A;  2NBT A;  2QJB C;  2UX2 A;  2GOO B;  3ERA A;  1VB0 A;  1TFS A;  4XJJ A;  2UWR A;  1IQ9 A;  2CTX A;  3KFD E;  1CDQ A;  1LXG A;  1UG4 A;  2H5F A;  3NDS A;  1CCQ A;  4RUD A;  1CXN A;  2H64 C;  1PLO A;  1HAJ A;  3PLC A;  2QJA C;  1HOY A;  2H62 C;  4BDT B;  1REW C;  1QM7 A;  1NYS A;  2K3G A;  1IDL A;  2H7Z A;  5DO6 A;  3U73 U;  1IDG A;  3EVS C;  2GOO C;  2MHY A;  1CRE A;  1RL5 A;  3KFD I;  1ONJ A;  2VLW A;  1MAH F;  5IMY C;  2QC1 A;  3QB4 B;  1IJC A;  1ZAD A;  1NOR A;  2MUO A;  1KBS A;  1RGJ A;  2MJ0 A;  1F8U B;  1B41 B;  4HQP F;  1NXB A;  2PJY B;  1ERA A;  4DO8 A;  1NEA A;  2MUP A;  4BIK B;  1HC9 A;  1ABT A;  4P7U A;  1KTZ B;  1ERG A;  2J8B A;  1MR6 A;  4EY8 B;  3VTS A;  1COD A;  1LX5 B;  1DRS A;  2L5S A;  3BT2 U;  1CRF A;  1FFJ A;  1IDH A;  1M9Z A;  2I9B E;  1TXA A;  2LCR A;  2BTX A;  2MJY A;  1I02 A;  1QKD A;  1LXH A;  4UY2 C;  2CRT A;  3NH7 A;  2MFA A;  1FSS B;  1FAS A;  1KL8 A;  3U74 U;  1FSC A;  4IYE A;  1V6P A;  1NTX A;  2BHI A;  1QKE A;  5DU1 A;  3EBX A;  1TGX A;  1JGK A;  1JE9 A;  2JQP A;  1KBA A;  1CDT A;  3HH7 A;  2H8U A;  1COE A;  1CDS A;  1CVO A;  1IDI A;  4FAO C;  2ABX A;  2H7Z B;  3BT1 U;  4OM4 A;  4OM5 A;  3LAQ U;  1XT3 A;  2H64 B;  1BXP A;  2OFS A;  1CTX A;  4AEA A;  5DZ5 A;  5EBX A;  2HLQ A;  1IK8 A;  2CDX A;  4FAO E;  1CDR A;  2QJ9 C;  1S4Y A;  2CCX A;  1NTN A;  2MJ4 A;  2FD6 U;  5IMT D;  1JBD A;  1KC4 A;  2N99 A;  1KBT A; 
#chains in the Genus database with same CATH topology
 4LFT A;  2CRS A;  2L03 A;  2PJY C;  1HC9 B;  1LSI A;  1CHV S;  3NEQ A;  1FF4 A;  1KXI A;  2X8B B;  1ES7 B;  1TXB A;  1YWH A;  2HLR A;  2ERA A;  4QTI U;  1HAA A;  2JVE A;  1NYU A;  2H62 D;  1G6M A;  1KS6 A;  1L4W A;  1IKC A;  1CB9 A;  1KFH A;  4ZQY A;  2LA1 A;  3FEV A;  1BTE A;  1LJZ A;  1H0J A;  1KU6 B;  1CXO A;  1F94 A;  1W6B A;  6EBX A;  1FRA A;  2NBT A;  2QJB C;  2UX2 A;  2GOO B;  3ERA A;  1VB0 A;  1TFS A;  4XJJ A;  2UWR A;  1IQ9 A;  2CTX A;  3KFD E;  1CDQ A;  1LXG A;  1UG4 A;  2H5F A;  3NDS A;  1CCQ A;  4RUD A;  1CXN A;  2H64 C;  1PLO A;  1HAJ A;  3PLC A;  2QJA C;  1HOY A;  2H62 C;  4BDT B;  1REW C;  1QM7 A;  1NYS A;  2K3G A;  1IDL A;  2H7Z A;  5DO6 A;  3U73 U;  1IDG A;  3EVS C;  2GOO C;  2MHY A;  1CRE A;  1RL5 A;  3KFD I;  1ONJ A;  2VLW A;  1MAH F;  5IMY C;  2QC1 A;  3QB4 B;  1IJC A;  1ZAD A;  1NOR A;  2MUO A;  1KBS A;  1RGJ A;  2MJ0 A;  1F8U B;  1B41 B;  4HQP F;  1NXB A;  2PJY B;  1ERA A;  4DO8 A;  1NEA A;  2MUP A;  4BIK B;  1HC9 A;  1ABT A;  4P7U A;  1KTZ B;  1ERG A;  2J8B A;  1MR6 A;  4EY8 B;  3VTS A;  1COD A;  1LX5 B;  1DRS A;  2L5S A;  3BT2 U;  1CRF A;  1FFJ A;  1IDH A;  1M9Z A;  2I9B E;  1TXA A;  2LCR A;  2BTX A;  2MJY A;  1I02 A;  1QKD A;  1LXH A;  4UY2 C;  2CRT A;  3NH7 A;  2MFA A;  1FSS B;  1FAS A;  1KL8 A;  3U74 U;  1FSC A;  4IYE A;  1V6P A;  1NTX A;  2BHI A;  1QKE A;  5DU1 A;  3EBX A;  1TGX A;  1JGK A;  1JE9 A;  2JQP A;  1KBA A;  4KSN A;  1CDT A;  3HH7 A;  2H8U A;  1COE A;  1CDS A;  1CVO A;  1IDI A;  4FAO C;  2ABX A;  2H7Z B;  3BT1 U;  4OM4 A;  4OM5 A;  3LAQ U;  1XT3 A;  2H64 B;  1BXP A;  2OFS A;  1CTX A;  4AEA A;  5DZ5 A;  5EBX A;  2HLQ A;  1IK8 A;  2CDX A;  4FAO E;  1CDR A;  2QJ9 C;  1S4Y A;  2CCX A;  1NTN A;  2MJ4 A;  2FD6 U;  5IMT D;  1JBD A;  1KC4 A;  2N99 A;  1KBT A; 
#chains in the Genus database with same CATH homology
 4LFT A;  2CRS A;  2L03 A;  2PJY C;  1HC9 B;  1LSI A;  1CHV S;  3NEQ A;  1FF4 A;  1KXI A;  2X8B B;  1ES7 B;  1TXB A;  1YWH A;  2HLR A;  2ERA A;  4QTI U;  1HAA A;  2JVE A;  1NYU A;  2H62 D;  1G6M A;  1KS6 A;  1L4W A;  1IKC A;  1CB9 A;  1KFH A;  4ZQY A;  2LA1 A;  3FEV A;  1BTE A;  1LJZ A;  1H0J A;  1KU6 B;  1CXO A;  1F94 A;  1W6B A;  6EBX A;  1FRA A;  2NBT A;  2QJB C;  2UX2 A;  2GOO B;  3ERA A;  1VB0 A;  1TFS A;  4XJJ A;  2UWR A;  1IQ9 A;  2CTX A;  3KFD E;  1CDQ A;  1LXG A;  1UG4 A;  2H5F A;  3NDS A;  1CCQ A;  4RUD A;  1CXN A;  2H64 C;  1PLO A;  1HAJ A;  3PLC A;  2QJA C;  1HOY A;  2H62 C;  4BDT B;  1REW C;  1QM7 A;  1NYS A;  2K3G A;  1IDL A;  2H7Z A;  5DO6 A;  3U73 U;  1IDG A;  3EVS C;  2GOO C;  2MHY A;  1CRE A;  1RL5 A;  3KFD I;  1ONJ A;  2VLW A;  1MAH F;  5IMY C;  2QC1 A;  3QB4 B;  1IJC A;  1ZAD A;  1NOR A;  2MUO A;  1KBS A;  1RGJ A;  2MJ0 A;  1F8U B;  1B41 B;  4HQP F;  1NXB A;  2PJY B;  1ERA A;  4DO8 A;  1NEA A;  2MUP A;  4BIK B;  1HC9 A;  1ABT A;  4P7U A;  1KTZ B;  1ERG A;  2J8B A;  1MR6 A;  4EY8 B;  3VTS A;  1COD A;  1LX5 B;  1DRS A;  2L5S A;  3BT2 U;  1CRF A;  1FFJ A;  1IDH A;  1M9Z A;  2I9B E;  1TXA A;  2LCR A;  2BTX A;  2MJY A;  1I02 A;  1QKD A;  1LXH A;  4UY2 C;  2CRT A;  3NH7 A;  2MFA A;  1FSS B;  1FAS A;  1KL8 A;  3U74 U;  1FSC A;  4IYE A;  1V6P A;  1NTX A;  2BHI A;  1QKE A;  5DU1 A;  3EBX A;  1TGX A;  1JGK A;  1JE9 A;  2JQP A;  1KBA A;  4KSN A;  1CDT A;  3HH7 A;  2H8U A;  1COE A;  1CDS A;  1CVO A;  1IDI A;  4FAO C;  2ABX A;  2H7Z B;  3BT1 U;  4OM4 A;  4OM5 A;  3LAQ U;  1XT3 A;  2H64 B;  1BXP A;  2OFS A;  1CTX A;  4AEA A;  5DZ5 A;  5EBX A;  2HLQ A;  1IK8 A;  2CDX A;  4FAO E;  1CDR A;  2QJ9 C;  1S4Y A;  2CCX A;  1NTN A;  2MJ4 A;  2FD6 U;  5IMT D;  1JBD A;  1KC4 A;  2N99 A;  1KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...