2CD0A

Structure of human lambda-6 light chain dimer wil
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of human lambda 6 light chains.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAM
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cd0A00
3W2DL 2DYPB 1LO4L 2A0LC 5GS3A 1VFBA 4XNXL 1FC2D 2HJLB 1MCLA 3Q6FB 4JRYD 3DX6B 1U91A 4LQ1A 3QEQB 3T3PE 2OI9B 5MEPA 1CDIA 4PREA 1LO4H 1QUNA 5LWYH 1WQVT 4V1DB 4XP6H 5CSZB 4HV8A 4ZPVA 4L8SC 5KOMC 1JPFB 2D31B 3MROB 3INUL 3VRIB 2EDDA 5SWZE 1JWMB 1NJ9A 2I60H 2BNUA 5INCA 5MHSE 4MAUH 5FF6A 4GBXB 4XAWL 1NFDB 4PR5B 2M8XA 5HDQL 4I18C 4PJ5B 1D9KA 4LCCB 5FKPA 4DOHB 4Y19A 4FTVD 1QLRA 4ZFFB 2H2SC 3MV9A 1MLCB 5EIIB 5BO1L 4NGHL 1SVCP 2J8HA 3P4NA 5CEZL 1ADQL 3E6HB 1BM3L 5EUKA 1FYTB 3MGTB 3ARFA 4PPTA 2VXVH 1U3ZA 4MD0B 3S88H 3BPOC 2ICEA 3WIIL 1WC7B 3DJ9A 3U30B 5C0BE 1BP3B 5MEPB 2VDOH 2VDML 3LKPA 5DRZB 5FFLA 2ESVD 3AREA 3HB3C 2XWBA 1S7VA 1NCDL 2NXYD 1R6VA 3Q6GL 3V6ZA 3IKKA 2G60L 4HS6A 1NGXB 2DQJH 2XXCB 1BD2A 1ZSDB 1CD9B 1H5BB 3HRPA 1JV5B 2QKIA 1WFOA 4DVBA 1D3CA 3D3VE 4U0RC 4LVHC 3TVMC 3LMJL 3IAGC 3CZJA 4G6KH 1NBZB 1U36A 1INEH 3DVFA 4PJBF 5KJRH 3HC3L 3TZVA 4BH8B 1I7ZA 3KR3H 4YDLC 1MI5B 1UZ6E 5DT1H 4UT6H 3ARBB 3DXAB 4PRDB 4XCCH 4DKDC 3WHE1 3O2DL 3BJLA 5CZXD 4LSVH 2BVPA 3X3FH 5E99L 4M7JH 4OF8A 3GKWH 4XHJC 3RTQB 1HN1A 2OK0H 4PLNC 2AQ2A 4M5YH 4N8VB 4OZIA 1FRGH 1I8KA 4X6EB 3RWEB 5I16A 3BZFB 8CGTA 1FDLH 1XF2A 1T5XB 3DO3A 1M7IB 3RWHA 3MRLA 4U05A 1BECA 4OLVL 4WTXA 3T4YB 3V95A 1CICC 4NN5C 3SCMA 2C4FT 1W0WA 3GBNL 5A2LH 1AD0B 1GIGL 2R1YA 1FV1A 2BY2A 4GRWH 3SJVD 2V2WB 2DIBA 5E00A 5E7FA 3HNSL 1CICB 4LLVB 3OAUL 4RAUB 2P8PB 2FL5B 4HF5L 3MRPB 1M6OB 4P5MA 3OR6B 3V0VB 1S7WB 3IDGA 4P5KA 4MLIA 3HA0A 1D5XB 3L3DB 7FABH 2I07A 5L9DL 3QWRA 1A1NB 4U1HB 3V52H 3L3GB 1MI5E 4A6YA 1A9EB 2Q8BH 1T20B 4FQIL 4L4VB 2OR7A 1FO0L 3RFZC 5D5MB 4XBPB 1D5ZA 2VDPL 1EMTL 2AQ3A 4MXQC 5A2IH 2EDQA 1A8JH 4TSAH 3SDDD 2ZUXA 3MRLB 5CD5C 1Z5LA 5ALBH 1ETZA 2VOTA 3CZFA 3D3VB 3VD9A 1T0NB 1OGAD 3BPLB 2I9TA 1AR1D 5TPWH 3RVVC 3SOBL 3TA3B 2BOCA 4NZUH 1KCRH 1ZHKB 4QYOB 5TE4H 3VWKB 2B1HH 3RRQA 1E6JL 1TIUA 2UVEA 2HG5B 4FZEL 3FT2A 1BQSA 5IB5A 3WO4C 2R56L 2CRYA 3IU4L 4DZ8A 3LRSA 2DQFA 4L29B 2A77L 5I9QB 2EIZB 3FZUC 4JKKA 1JRHI 5ADOL 2VKWA 4UV7L 3FB5B 3B8SA 3QEHB 1PJ9A 3UTZA 4MAYB 1VGEH 4XHQA 5CAYB 1VEPA 3QNYB 4TNVK 1FYTE 3UROR 3HHRB 2VKXA 3SKUD 3TNNB 2BVEA 4YXHL 5KVFL 4LMQI 3GGWA 1G9MC 3OWEA 3EHBC 5LXGH 4OLUL 1N0LA 2NY3B 1FFNA 1WZLA 3V6OE 1F4AA 4DOHE 3TWCH 4QHNB 3VGAC 2VDQL 3UEZA 5HHNB 1W72A 4HEPG 1RY7B 4PJIF 4KTDL 1RIUH 2F74A 1RZKC 3CFIC 4JY6A 3RGVD 2LVEA 4PRIA 4NO2A 4RISL 1FC1A 4PJ7B 3OGCA 2XWBB 2X42A 2Y7QB 5C86A 4EDWL 3QPQC 5EU4B 4V1DE 4DCQB 2D03L 5IB3B 5H94B 12E8H 2ZCHH 5IOPA 3R0MA 4J6RH 3CFEA 2QLVB 2X41A 3IDXH 4DZ8B 4KDWA 3MRDB 3C2AH 1FYTA 4EDWH 3UYPA 3V9FA 4G3YL 1ZHKA 5I8OL 2ICWI 1KIQB 1A6PA 5JORB 3MLSL 3ULVC 3AAZA 1A7OH 5GQBA 4CDHA 5ITBH 5EO0A 4G5ZL 3LD8B 3EDJA 1UWEH 3L3OA 2DQEL 4HZLA 3WMSA 3DRTA 5A16B 4BK5A 2AP2A 4DN3H 2GTZB 1NFDA 5C08B 2LU7A 5IHLB 1CICD 4ZUVB 1DDHB 4M1CC 4JG0L 2Y06H 3CFDB 2H1PL 5TDPB 4FQLL 2CJUH 3G6JA 3FCTB 5JOPE 1CL7L 5MEND 1A6ZA 3P9MB 4Z7QF 3L1OH 3CSBA 4BFIA 4F2MA 1BJ1H 4LLUA 2HVJB 2F5BH 4F7MA 3TBWA 2WWMC 3FN0L 1QR4A 2QTEA 3V0VA 1JZ5A 1LNUB 3CMOL 4IEFB 1YPZA 4TUKL 3O3AB 4G9DB 5DJXB 2P5EA 3RDTB 5E4EC 4L8DA 2ICCA 4XBEL 5IBLC 5IW1B 1SBSL 4HDIA 1G84A 4TUKH 3X11B 4DK3A 3GDBA 2GFBA 1J0IA 3G5VB 2VXVL 3WYRA 1DQMH 1CE1L 2D0HA 4Y1AA 3VXRA 1NEUA 3RWHB 1VFMA 1XR9A 4OZGB 4XT1C 5DEZA 2IALA 4Y4HA 4UDTB 2NY5C 2FGWL 2EXYD 2GITA 2YZ8A 2FO1A 5B39B 1YECL 4OSUL 4ZG1A 3O3EB 2L4OA 1NAML 1SBBA 1I1YA 2XRAL 5L8LB 1G9EA 1S7XA 1LE9B 1JPSH 3CVIH 3Q6GH 5DK0A 5IEKA 5HDQH 4NNYA 2P45B 3NAAL 4URTB 2JTDA 5DD0H 4TOYL 4I5BB 4HWNA 2LAGB 3ZYJA 2X89A 4GFTB 5C0DA 5FK9A 1T7WA 3S96A 1CTNA 3TBTB 4FTVE 5I1EL 1TQBC 5L7XH 3CLEH 3SO3B 1RZKH 4H20H 5ICXA 2PW2B 5IR1A 2E7LA 1B9ZA 1TZHA 4KDVA 4X98B 1M4KA 4PGCB 5TFSL 3FOMA 3TJEL 5HHOD 1MHCB 4OKVB 3QO0B 5L7XL 3LSOA 4WFFE 3VJ6B 3GRWH 4DZBA 2Z93A 3LAFA 1JCKA 3TESA 3RWFB 4KKBC 4ZDHA 5FGCB 2W59A 4NCC2 5C70A 4C56E 3PNWA 4HS6B 4NKQB 4CADA 4F57H 3DROA 2DI9A 1MFDL 5IWLA 1H3TA 3S4SG 1DBJH 3VXPA 1ZS8B 5DMYA 2NW3B 1NC4B 5KVEL 4G42A 4ACPA 4E41D 5HVWA 1F4YL 3BHBB 1CIDA 2VITB 4XPFL 4LCWD 3VWJC 1MWAH 3TIDB 2ATKB 4MD0A 5DUML 4PJIB 3HG1D 3BKMH 1M7DB 3MGTA 4KC3B 5EO9A 2PTVA 2VL5A 4NHCH 2W0PA 5D6DC 2MJWA 1AGDA 1RIHL 3BP5B 3QEGL 4JR9H 4X5LA 4LLQB 1EEQA 4AK1A 3PQYE 4UU9A 1KBGL 3P4NB 4LCWB 2ZKHL 3DMMC 15C8L 1GL4B 5E0QA 2R1XB 2BNRD 1U92B 4HD9A 3FB8A 3ZDXF 4UAOB 2DDQH 1JL8A 3IT8D 3RBSA 5DD6A 4HHAB 3EO0B 4ALAH 5EOTA 3SPVB 1VADA 1A1OB 4HCRL 1X6NA 2BNUB 2JE8A 4QF1A 3MROA 2W9EL 1J10A 3LKSB 3UTQA 1IGMH 4J3SA 2YS4A 4ODHL 3OKLB 5HHME 5I30H 5EUOA 1MFNA 3CUPA 4HJJH 3RZCD 3VFOB 2J6EH 3QEQA 5E6ID 2VJXA 1CI5A 4JFFD 1YPZF 4MS8C 4ZODA 2DYPA 4O5LL 3T65B 2YKLH 3K80A 1KB5L 2EDOA 3KLDA 3NFNA 3QNXA 4MXVF 1FFOA 1MIMH 2Y36L 5SV3A 5T1LA 3L7EB 3FMGH 1CTOA 3HAEH 3JV4B 3MXWH 2FZ3A 1UQSA 3L5XH 1LEKA 3MRMA 3NH7H 4HF5H 4YBLB 2V17H 1BEYL 2B4CC 2FATH 2R0LL 3QUMA 3WXWL 4CRPA 2GIYA 4PRPA 4NOBA 4PGJA 3TH2T 4MZ2A 1UEMA 5T1KA 1G7JB 4Z7VA 1CF8L 2EYRA 4Y16B 3U4AA 1AY1H 1QZ1A 3NMEA 3WFEH 2Q76B 3DIFA 1S9YB 3LQMA 1IE5A 4GXVH 3TPUB 4J3TA 4OTXL 1NMBH 5HXMA 4I13B 3KPSA 1FRGL 4JKWA 1K3IA 2A9ML 1JZ3A 3TO2A 2NYYC 2AJXL 3MGAA 4YPGA 4NZTH 1P2CA 3VGFA 1FIEA 5ENWA 1AGEA 5DYOB 4ENED 3EO1B 4JFOB 4JQXA 4PRHD 4Q58C 2CIIA 4PJHF 1PYWB 2AXGA 5HGDA 3VMOA 2Y36H 4LPVA 3BAEL 1S8DB 4WI7A 2YXMA 2BHZA 4XP5L 3ZZ1A 5KVGL 1DSFL 4MD5B 1K4CB 3D5OF 1RJYA 1HH9B 2CLZB 1EIBA 3O2WH 5BRZB 4N5EC 5EFIA 3PP4H 2GHWB 4N0YH 4Y16D 2X40A 1S7RB 2FJFA 5E8EA 1U8JA 5E08L 3SKNA 4GSDL 3WHE0 1F6AA 4HMDA 4U6HA 4YDVB 1N5AA 4QRRD 3MCLL 1DVFA 3BPOB 4DKEL 1B6DA 3GMMA 1BF8A 3VGDA 3LN5B 3W81A 4TSAL 1FGNH 2VQTA 5DD3L 1C1EL 1N26A 3ARYA 2IQAA 1YN6A 2DDQL 5BXFA 3H9HA 5CGYC 4LPTA 5E1AA 1L9MA 4Z9KB 3BH9A 4YHPA 1OP5H 1KBGH 2F53E 1H8SA 5F1IA 1NCWL 3QNZB 1EJOH 4WO4C 1E4XI 2XPGB 5BVPL 4FQCH 3SQOL 1UB6B 1WICA 3MNZA 4PJGB 1D5MB 1QRNA 2AJSH 3MV11 1KGCD 3ZE2F 2A6IA 2UWEB 4GQ9H 5AYUH 5IGXH 1KTKE 1J0KA 5GGQL 2RR3A 1FVCA 4NC1E 1ZHBB 4NKDA 5CWSA 3MR9B 2YUXA 2VYRE 2YRZA 1E4XH 3RZCC 5E8NA 1MCSA 5ICYA 2XQBL 4Z7WE 5JIIA 3QDJD 4HPYL 4HXBL 3T2NL 1LE5B 4QRRA 1FG9C 2BC4A 1I1FA 1PZ5A 2W0FA 2YWZA 4GKSB 4RQQA 4X6CF 2WMPA 3ZDZE 3RVVD 3TLRA 1B6UA 5JW5A 1JZ7A 4HWUA 1WWAX 4PP1C 3O6KL 1MHEA 1D6EA 1K6QH 1RJCA 3FQXA 1KEML 4P3CH 3JV6A 3QFJB 4LQFL 1IGFL 4JDVA 4K3EH 4QHMB 2X7LB 4IOSD 3QBTB 4CVXB 4NO5B 2BP3A 4M8QB 1WZ1L 2YPKB 3UO1H 5J9PA 1A6AB 4Q6IC 1QFUL 5KSBF 5FUOL 4ONGH 5F7FA 3V0AC 5C0JA 4L8BB 3MRNB 2RAMA 2A38A 5I8CA 5D71H 1MY5A 3TNMA 2AVGA 3LIZH 1FDLL 3KPLA 5HI4D 3CU1A 4RWYL 4LDEB 3W11C 1H3GA 5K9JH 1T0PB 5ETUA 2J3SA 5CJQH 3DV4A 4G80A 5D1QC 3DX7B 5H2BB 4LPUA 3QDMA 4Z0BL 4PJ9C 4FQJH 1A9BA 4MA3B 4NNXA 1RUML 3ELAT 4DK6A 2HKHH 3EO9H 5D7LA 1IM3A 4NIKB 3JWOC 2KBGA 3O0RH 5CJ8A 3KYNB 4M7LL 5B3JF 1DQDH 2HT3D 4PJ9B 4H1LG 4NDMA 5F6HJ 4GKNA 1XF4A 1F3JA 2GK0B 1EERB 4NQCE 4OD2A 3QPQD 3ULUC 2YPVL 4JM2C 5J57B 1TZIA 4LARH 4YGAB 5IQ7L 3JSSA 5CS7A 3WCYA 3BPLC 1S9WB 5I0ZA 1RZGA 3QXAB 2F5BL 4JB9L 1XGQB 1IGCL 1CGYA 1MFCL 4JFED 4CU6A 4Y19D 3REVB 3MBEC 2ICES 5TDOB 4R26H 3A67H 5ANME 3NPSB 3V4PL 1ZGLP 3ARGC 4HZAA 2IANE 5I73B 1OAYH 3O3DB 3O2VH 5DJ2B 5LQBL 4P9HL 2WNGA 3S98A 1AQKH 3P73B 2VZSA 4P2RB 1BOGB 1IC1A 3TYFA 5CP3H 3IDYB 4JFYB 1V05A 3C6LA 1IFHL 1AJ7L 2Y07H 4E41E 2QADC 3T0EB 5FO9A 4PG9B 4ZOEA 2R1WA 1KV3A 2JB5L 1AHWA 1TVBB 1P6FA 4NN7C 1N7ML 5AD0B 1ZANH 4I0PC 2PW1A 4NWTH 1J0HA 4R9HA 2CUIA 4LBEB 4U1NB 4I9WD 3BFOA 5SWSB 4H5SB 3IFOB 1HQRB 1FL5A 3WL9B 4PP2A 4YIQB 1XF1A 5FYJU 1FLRL 1FL3B 2CJUL 1KEMH 3N50A 3F7VB 2DICA 2Y06L 2DMKA 3ARZA 4ZOBA 4I4WB 3I6KB 5DMIL 5A40E 3MO1A 4GKZA 4DKFH 3D39E 3QUYB 1UWEL 2XQBH 1PX3A 3RL2B 2E9JA 4OGZA 2OXHA 1CN4A 4HFWB 2IPKB 4PRID 1P84J 5JPNB 4S1SH 1WZ1H 4G9FB 5T1DH 1PDKA 5FDWA 5FIEA 32C2A 4U33A 5GHWL 4KY1L 3KLAB 1NGYA 1CD0A 2BNQB 2DLTA 4K3DH 1HSAB 1RHHB 3VFGH 2NZIA 4X6BA 3DUHA 5I1GL 1XF5B 4AEHL 1N7MH 2D4FA 1IT9L 4XPAH 2OMBA 5ESQA 2JELL 4K94H 2E7CA 2Z31C 5I8KH 2VIRB 2NR6C 4Y5VA 4P2CG 4X6CB 1KB9J 3T2QA 4G6ML 4ETYA 4IRJC 5SWSA 3C8DA 4OAWB 5EOCJ 3R8QA 1NC2D 4HKZA 1I9RH 4Y2OA 3BPNB 4CMHC 1HHGB 3QH3B 1F58H 3MJ9A 2E9IA 1KN2L 3NGBC 5J89A 4GAYA 5E8PA 4JFDE 1QNZH 4CMHB 3O9WB 5KSBB 4LSUH 1YEHH 1CFQA 5AAMA 2OX5A 2UY6A 3HS0A 4P2RA 5FYLH 4ORZC 3U36B 1YNKH 2A1WL 3TVMB 2WIIB 3SDAC 2W1NA 3IDMA 5JA8B 2OQJB 2FRGP 4KKCC 4HUVA 2EDXA 4HJGA 5EBGA 5HHXH 3MJ8A 3QQNA 4H1LH 2OSLA 2FHFA 5JIHA 3EOBB 4Q9QH 4KI1A 1I7RB 4OIBA 4Y5XB 4O2FB 1I4FA 3QDHA 4Y2DA 1KCRL 4PB9H 5I74C 2R69H 2YXFA 5BS0E 2Z35A 1OSPL 3D25B 4HCRA 4HIEB 4KVCL 1Q1JH 1OQOA 1IM3B 2EEAA 5B3NA 3D3VD 5HGHB 4WUKH 3VXMB 4U1GB 4FNLH 1TJHL 3QDMB 2CDGA 5IJKC 3H9YA 4G80B 5DI8B 4O00A 3OBAA 1KG0A 3OKEB 4TRPH 3QIUD 1KPVB 4U3CA 3VFNB 2NY0D 1YY8B 1BJMA 2DQIH 1VDGA 3E6FB 1QR1B 1BREA 1YMMB 3SKMB 3HAEB 5LXGL 4MD4B 3QRGH 3O4OB 4XNZC 1SJHA 3L5XL 3S37L 2AK4A 3DV6A 2YD8A 3RVUC 3O8XC 4IHOA 3O3UN 2YPKA 3D39D 1JBJA 1PX4A 5IBTL 3V0WH 1UH2A 4QHKJ 4AMKH 4W4OC 2VE6A 1VSCA 4MQ7B 3TO4D 4KMQA 3CFBB 4NT6B 1YDPA 1Z6JT 3VH8B 4KRPD 1KG0B 3MUZ1 4K23H 4HJJL 2O5YL 2HJKB 1MAKA 1OL0A 5HYJA 4PJCF 4Z8FL 3RVUD 1ZT7A 4P4RA 4WGVB 5FM5M 3D69A 3D25A 4HIEA 1QBLL 2OCFD 1CGVA 4XVJL 3CVHB 1FYTD 4M93C 5EZIH 1IC4H 2AJYL 4LLDA 2PXYC 1J18A 3LH2L 4LPXA 2DWDA 5IROA 1F4WL 5GGSA 3HG1A 1YN7A 4J8RB 2VH5L 2FGZA 4TVPE 1MJUH 2HJFA 1HILB 1D5MA 3S6CA 1NMCB 2DBLL 3C5SB 4MB4A 3EFFA 4APQD 1TJIL 3EDFA 1NCNA 2XYCA 1QSVA 5I8EA 1MWAL 2PCPB 3GMLA 3L5JA 4AM0B 4Q0XL 3WIHH 5KBNC 5TGBA 2DLHA 4NYLB 2PTTB 1YN6B 1CXFA 3OHXA 1HYRC 3O9WA 2Q3AA 3WIHA 2X2YA 4HUXA 3BKJL 5EBLB 5AUMB 1MHHA 2ENYA 1L6ZA 3NCCB 3Q5OA 3MLVL 1JNNL 5DSCA 1DVFC 5C2BL 5IMMA 4U31A 3TZVC 2DM7A 3KPOA 2HT4D 2CDFB 4U6HB 4MCYB 4IOFC 2WQ8A 1MF2H 3V4VH 5CZVH 1D9KD 1NUGA 1KCSL 2DJ4A 1TNNA 2XFXB 3HG1E 2SEBB 4NC2B 5GSRA 2NY5H 1MCHA 5LGJB 4J8RA 1Q9OB 1OTSC 1FL6A 4TULL 3HNSH 5T1LD 4LLDB 2WBJD 3Q1SL 4LFHD 4X6BB 5EWIL 3RUGE 1KIUA 4AEFA 1YMME 4KGJA 5IKCA 5F7EL 1X4XA 5ACMA 1DN0A 2AJZB 3QIBA 1ZANL 2XY2A 4ZPTA 3GI9L 5AZ2L 3S97C 1P2CB 2EC8A 2AAVA 4FFWC 1F90L 3SBWA 4KK8C 4ONFL 1EFXB 1P7KB 2MCG1 2Z92B 5D7LE 2J5LC 2AGJL 4D8PA 4AEIL 4OKDA 4TSCL 2FATL 4YFLF 5MEOB 5BS0B 4KROD 4RFNC 4WHTA 3FQTA 4XVSL 4DWHA 1OW0A 3BN3B 1Q9LB 2B4CL 3ALPA 1V7MH 1HOCB 1CZ8H 4X4YB 5GZOD 2XA8L 4LSTH 2F54D 2P46B 5C8JB 3DTXA 4QY8B 3TIEA 3U1SL 1G7IA 4PRHA 4XMPL 2G2RA 5GGSB 5I75C 4X8JB 4I18A 3L95B 4N8CL 3MRMB 4P4KC 2H9GA 5HGAB 3RU8L 1ERNA 5CINH 2RGSA 1S3KL 3M1BB 2L7UA 3KHQA 5F89A 1MSPA 4LEXL 5DI8A 4WO4B 2HTKD 3C6LB 3QB7C 3KPQB 1QFPA 2YBRA 2Y4SA 4EI6B 2VABB 2XI9A 2X5PA 4JFDB 4ZQKB 1G9NL 5HGHA 4E41A 5C9JA 3N06B 4QLRA 4LLYB 3WFDH 3UJJL 2APFA 4WFGE 4NP4L 3ZL4H 2G5BA 3GO1H 3SDAB 1T1XA 3ROLA 5A1AA 3UTQB 5AWNH 3VG9B 1XGQA 1U8QA 2R0ZH 3KPRE 3QXAA 3EOAB 3IJYA 4BA8A 1B4RA 1J1OH 1Q9KA 1UACH 3WFCL 4KRLB 4TVSa 2VWEC 1RURH 3SCMD 1IAII 1CYGA 4BSWA 5E2JA 5FYJH 1T6VN 4O4YH 1WBYB 4GKNB 2MQ0A 3PV7A 4U1JA 1TCRA 2O93L 3TVMA 2FD6L 1O7VA 1U93A 1E4KA 2FX7L 2BNQE 1QA9A 2O5ZL 1T2JA 4Z7NF 1AGDB 3BP5A 4G9FE 5DJ8A 1JZ4A 3S35L 4IRSA 4TSCH 1NKRA 1FN4B 1KFAL 1OGAE 4DTGH 4KUZL 4LGSB 2HFEB 5KOVC 2ESVE 1GGYA 3SE4A 1T6WA 2XQYG 5GS0H 1MNUL 1RMFL 1OY3B 1DL7L 1LD9A 2F58H 3BVNB 5JZ7D 1HDMB 5C07A 1JGUL 1UENA 1MAMH 4KK6C 43C9A 3EYSL 3O6FC 4X9IA 3WNMA 1KELH 5DJAB 1TPXB 2R0WH 3BDXA 1UM4L 2XTJB 4Y5VB 1UH3A 5GRJH 4Y5XA 1T1YB 5DFVC 3TGXA 2RQ8A 4ZOAA 3PDOB 5I19L 5SWSE 2C1PB 4EN3C 4LQFH 4H26A 1WZMA 2CKBB 3RNKB 4HJGB 5TF0A 4XP4H 3ROOB 1JYWA 1HINH 1FLTX 3S4SA 1ZA6B 3MNVB 4MVBD 4GG6E 2R39A 3FFCB 2MCPL 2P8LB 5FUCE 5FB8A 3CDGA 3D0LB 4ZTPL 4PGCA 4G9FA 3K8LA 4S10A 3WLWD 4F7PB 4E0RA 5T3XL 1PZ5B 2W0FB 4HMEA 3T0EE 3NFPA 5D7SH 1A6WL 3HS0B 5C0NC 2FB4L 5C09E 4MA7H 5F71A 4P2RE 1R3LB 5FCUL 4P5TB 4YFEA 1P4IL 5C07E 4MSWB 3MO1B 3MACH 3ZKND 5F21B 4E5XB 5IB4B 5CWSB 3QH3A 1KJ2H 5ANMB 2IH3B 2J6EA 1N5YH 3DUSB 4OM1L 1IKFH 1RVFH 3P0VL 4OAWA 2VDKL 1MJJA 1SJVA 1R5WA 4M03A 3LB6C 5F9JB 4ELKB 3C08L 3O2DA 4KJPC 5DS8B 1EGJH 1I9RL 4MB3A 4ODUA 2AJ3A 4PYHA 3MV8D 4X6CA 4XBEH 5SWQB 4R8WL 4Y4HB 1YEEH 3VGHA 1AP2B 1QFHA 3NCEB 4HKBB 2QQNL 1DANT 3CD4A 3VW3H 4LAJH 2GSIB 3WLBB 5DRNA 2JB6A 1FFRA 1H9VA 2UYLB 2P5WB 2FH8A 3QJFA 5DJYA 4YHMH 1G0DA 1HH6B 3DETD 1DVFB 1KN2H 2R2CA 2HLFD 1JZ8A 3BN9C 4POZC 4XPGH 4PB0L 3V6FA 3DBXB 5DZOA 1XIWB 2P24B 5DUBA 4GW1B 2KDGA 4PTUA 2DQEH 1M7XA 1A6ZB 5HHVH 4AYFA 4IOFD 3MLTB 2L0DA 4ONHA 4ZTPH 1LO5A 2A73B 3I9GH 1D5IH 1U8PB 2YD5A 1HQRA 3TCXA 5FGRA 1ADQA 4K3DL 4Y7MA 5C71A 3AAZB 3O45B 1NSNL 2AXJA 3EO1A 3BIAX 2X4RA 3QFJE 4UINH 3CXHJ 4ZS7H 5C0AA 3IU3B 4WI5A 3IVKA 3MRDA 3C8HA 3RVWD 1JPGB 3QUZD 5IHUL 2FCBA 5AEAA 2Q7NA 4FFWD 1F6LL 2J88L 3KVQA 4CN6A 4JZNA 4KQ4L 2H3NA 3AY4C 4LSQL 4NZDA 3L3IA 3EJYD 5L88H 1A7BA 3QUML 2FDBP 5DJCA 3K8MA 4JANB 4PJDE 5DJ2A 3MV8B 4HT1L 3WUWA 3GSRA 5LCVH 4KAQL 5HBBA 2XRAH 3BZEB 5I2IB 4CW1B 1AE6H 1TVHA 4U7SA 3HUJE 1JI2A 3QUMB 3G9VA 1S9WA 1H0DB 4PJGE 3UC0H 1IC5L 1WIPA 5HD8C 4KJQC 2ENSA 4LSSH 4NO5A 4MA8H 1N0XH 5HVHB 4OM0L 5D1ZC 5FYLD 4MVBC 2JJSC 4HX1B 2VLRA 1NAKH 4CMMB 2F53B 1RURL 4XGZA 2VDMH 3FQXB 4A6YH 1M71B 3BRFA 5D1ZB 5ESAB 2FJGB 3MCG1 3LH2H 4W6YB 5C0ND 2BSSA 1DTUA 4QOKD 1N2RB 1B2WL 3FFCD 3CIQA 5H2BA 2N7AA 4U0RB 2EIZA 5E8NB 4XPFH 1UM5H 4BSVB 3H2WA 1VACB 4QHUA 2XKUA 3LKSA 2HT4C 4H0GA 4O2EB 3U9PL 3D18B 3BT2H 3QZWA 2C1OB 1HIMH 4YDLB 4LEXH 4GW5A 2W9LA 3VWKA 4R4BB 3GSQA 4JFHD 4ZUWB 3GNMH 2YPLE 5TE7L 4YBQD 4DN3L 3OGOE 1NFIA 1MH5B 2Q86A 3VFWA 1A5FH 3GUTA 1BVKB 5FYLE 2X44D 2J88H 5DUPH 1U92A 4WFHE 3LEXB 2UWEF 4M8QA 4Y8AA 2GT9B 4JEGB 3QHFH 4G3YH 3RTQC 1DE4A 3L3JA 4LVOB 5DD5L 3QG6B 4D0CB 3C9NB 5T3ZD 5DHVA 3NFSH 1MCOL 1W0VB 1AO7E 3EFDL 4BUGA 1IGFH 1A4JA 2CMRH 5F7LB 2I07B 2WWMD 1AE6L 4MX7B 1VEOA 4P5KB 5FECA 4M62L 2X4SA 4OUUA 1ODAA 2PO6A 3EJZD 2E7BA 4QOKA 4N8PA 1HZHH 1K4DB 5ICYB 4RRPG 4WV1A 5I1HH 1U8MB 3HN3A 3OAZK 4YBHA 1WITA 5KVDL 2IPUG 4J1UA 4N1HB 3V7AG 2YD4A 4RFOH 5EU6A 1OP9A 1BVLA 4PJHB 3AGVA 1H3WM 1JP5A 3LEYH 4OZ4A 1AD0A 2CPCA 2P1YA 5KTEH 2CLZA 1RJYB 1BJ8A 43CAB 4EEEA 5I1KH 4MWFB 4YFLI 4ODWB 4OCYL 1T5XA 5EBWA 2FEDC 2DI7A 2VAAB 2VXSH 3P0YH 3FHAA 4P2OB 3W2DH 4MDIA 5E2WH 5K9OA 2DQTH 3ZSSA 1Y6NR 1MCPL 3ZT5A 1BLNB 1LGVA 4DEPC 4BQBA 1F00I 3QUZC 3O3BB 1S5HB 2VH5H 2WUCL 4P2OC 5E24E 4UTBH 4N90E 5GRZA 5FK9B 4NKOB 4Z78B 3VXRD 3GNML 3NCYS 3EJYC 1QFWH 1WSST 3MLVH 4YZFF 4L3EA 5HHMB 2AQ1A 1R0AL 4P9HH 4X7TA 3QJHB 1T2XA 1G7JA 3EOTH 5IFAL 3P30L 1JF1A 4UAOC 3S7GA 3O3EA 5LVEA 3WIHL 2GITB 5BS0D 1A22B 1JPTH 1B2WH 4DGVH 2W65B 3CH1A 4KJYA 1GOGA 2VUOA 5I9QC 3ARGB 3HZKB 3RJQB 3TH4T 4ZFZA 4KTEL 1U3JA 4JREB 3X11A 4TPRH 5DURB 5J6GA 5EU3B 1N8ZB 2AXGB 3OF6D 1DFBH 3CMOH 3H3BC 4ZXBC 4RGND 1BQLL 4QXUH 4D9LL 2BXYA 1U8KB 3O3AA 2VDNH 5SX4H 3VDCA 3UTPE 2UZYB 4K7PH 5JQ6L 1WWBX 3WS6C 5JW4R 1GGCL 4K8RC 3KPSB 1X6LA 2XKNA 4RGNB 3EZ8A 3IDIB 3M07A 4WCYL 2R0WL 2CUHA 4KTYA 4Z7NE 1F11B 5HDOA 4GO6B 4WU7B 1MHPL 5DXWA 3RL1B 5B8CA 3RJDA 2VAJA 4RGNC 1G6VK 3MRIA 4CDGC 1NCCH 2V9QA 4F7EB 1Z9LA 3LY6A 4KPHL 4ZSOE 3U0TB 2GTZA 3INUH 1QLRB 5FHBH 3QR2A 2WLYA 3MRJA 4DKFL 4Z77B 3DO7A 2QADD 4R2GD 3C87A 3UTTA 1AO7D 2C4FU 2R9HC 1EHLL 2FZ3B 2QSCL 3ARSA 3F65A 4HK3J 4XCFL 1GAFH 4OIAA 4P23A 1FO0B 1TXKA 5DGQA 1JPFA 1M7DA 4I9WE 1YEKL 2F8VA 3IB4A 4FABL 1KELL 3FRUA 5DLML 3EYSH 5A2KH 5L2KD 2YK1H 1KB5H 4DCQA 4Z0XA 3TV3L 2HJLA 3VFOA 2Y7QA 5BJTB 1HXYB 4QXWA 3BP4A 5CBAB 1CDBA 4PRIB 3QDGE 1RIVL 3H8NA 3FN9A 4PUBL 3PNWB 5CEZD 4JPVL 2F9BT 4OGYH 1QSFB 4Z18A 1E6JH 3IDJB 5GGQH 2CLRA 1JJUA 3C5JB 4D0BB 5IGXL 1VADB 3ARUA 4AH2B 1OCWL 1HHJB 4K7PY 2J8UF 3VE0B 1GGCH 1RZ7H 3LSOB 3MV9E 4J7RA 4EDXB 4KZEH 3CFKB 3U30C 3RDTC 3T0AA 3WO3B 1KEGH 1RUQL 4EI5D 4RBPK 3UTTD 5C92A 4LLQA 3ULVD 2EDLA 2X70A 5L2JA 4KXZH 4PJAE 3ZSTA 2A1WH 2ZUSA 5LGKA 2DJSA 4PJIA 5L9DH 1EGJL 2DAVA 1QLFA 4X99A 3P77A 1YNTA 1ONQA 5J1TC 3BHBA 1IQDA 3BN9D 4HKJB 2VR9A 1JPTL 2HN7A 3RWCB 1ES0B 1U2HA 5GHWH 5BV7L 2E6PA 5DA4A 1S7XB 1UM4H 5DRXB 4WEBH 1HHHB 5IIEA 4ALAL 5ALBL 4ZS6D 4IOIB 3GBNH 1W72H 4YHOL 5B4MC 3MV9D 3BRDA 4G6FD 3LIZL 4QRQA 1SY6A 1A6VL 1BAFL 2BVOB 5DHYA 3RU8H 3IFLL 1MHCA 4OKVA 5F88A 2ZCKH 4HDIB 1U41A 4K07A 5H8DA 3MPCA 1QBAA 3OPZL 2EE2A 5DJXA 1NGWB 1MCQA 3FL7A 3BZDA 3MCKB 3O6FB 4I1NB 4XCNA 1WTGT 3M17A 3IDUA 1ACYH 2JCCB 3IDGB 4R97C 4K8RD 1E4WH 4JFXA 4PJ9D 1S5IL 2BNRE 1UFUA 2FR4A 4G7VH 2CK0H 4PJDA 2DKSA 5HPMB 1NDGB 1EXUA 1KT2B 3JWDL 4M6NH 4Y5YC 1QEWB 1UM6H 3KPPA 1FV1B 4R6UA 2ZPKH 3ARDB 4PGEA 5CIPH 2FIKB 3HUJA 4N5UA 4MXQD 5J56B 5EA0L 1N6UA 3OXRA 1A3RH 5E6IC 3CAFA 5KSUA 5A16A 4R96B 5DTFB 2E8ZA 3CSPA 4XPTH 3HPJB 3QI9B 3BKJH 3ILPB 1AKJB 4G8GA 1XR9B 4OZGA 1XAUA 3S5LA 4IDJL 5EOCH 3Q1SH 2WINA 4RFEA 3J7HA 2J4WL 3EYUH 2WBJA 1QO3B 3LKNB 1C7SA 1QQDB 4ODSL 1PD6A 5HGBA 3SQOH 4W81A 1H15B 2DBLH 3PWPD 2X6MA 4GT7A 4P2OD 5IOPB 5D7JC 4EUPA 2VDOL 4XPBL 2CKBH 5JW4M 4OZFA 3P40A 2Y5TB 2NY6C 4Y4HC 1TETL 2EDYA 4F2MB 1MI5A 2DM2A 3OGCB 2Z4QB 4U49A 5FKAA 5DGRA 5JPMA 5E7BA 4YGVB 1UKTA 2AI0H 3B6SA 5BZWB 5MERB 5INDB 1KPUB 5C08A 5CP7A 5FHAH 2NYYD 1ED3B 4BZ2H 3CNKA 4QWWD 4KI5F 5GIRB 4K23L 3TT1H 3V6ZB 2Q6WB 2AXFB 1WFUA 2E7LC 3QAZC 5F1NB 2ICWJ 4OJFH 3UTSB 4R4FH 4H1LB 4XP5H 3WHXA 3FN0H 1OM3L 2NY4C 2FLBT 3ISWA 4XVJH 3C6SB 1H15A 1JK8A 4NZJA 5HDLA 4F37F 2HH0H 2ZZUT 3QIWA 5IB3A 4NQVA 4WWKB 3LKNA 1NLBH 3TFKC 2FX9H 4H1LA 2X4QB 3SE3C 4FS0A 2V5YA 3MOAH 3O4LE 1M1SA 3VXSE 2X4NB 4HH9B 1X3DA 1Q94B 2WINB 4L9LA 2P44B 1SEBA 2AXFA 1MLCA 1DBBL 5EIIA 3S5LB 4F3FB 1CXEA 4L4JA 4GMTL 1WBZB 3QI9A 4XWGL 5IB1A 3E3QE 1XR8B 4LSQH 2IAND 3OXRB 3IDNB 4XRCA 5C2BH 4UOJA 4GBXA 1FCGA 1G7PA 4PJAF 2APWA 5HHPB 4GRMB 3QUYC 1A7PL 1YA5A 2AJVH 2EDRA 2BFVH 1KB9K 3RX8A 2R8SH 1JGDB 3WFHA 3V5DB 4PREB 2FSEA 4NFDA 1I1AB 5IV2A 2P43B 3SDYH 1UVQA 1TQCB 2NY2C 1P1ZA 3QFDA 5I1EH 1VFBB 5F7NC 4HLZG 2P8PA 5CZVL 1VKXA 3UTSE 4G6JL 5E00B 1OWWA 3TBYB 4PJXA 3ZTJH 5IM7B 5TE7H 4JQIH 3DMMD 3FHQA 3ILQD 4KTDH 1W0WB 2GEEA 4UNVA 3P4LA 5EOQH 5I1AA 1NAMH 3FQRB 1AKJA 5TF1H 3FO1B 5FEBA 4OM1H 2DQCL 3T3ME 2QV2A 3CZFB 1MCCA 5IIEB 2GJ6B 5HVHC 1QYGL 5DRXA 5D5MF 1UXSA 5FYKH 4HK0B 5I1DA 1CE1H 2VISB 4LU5H 5LGHH 1JWSA 4RSVA 5JDSA 1RQ5A 4HWBH 1J0JA 3K3QA 4A6YB 4LRNH 2BVPB 4M1DH 3D9AL 4MJIB 5CGTA 1VKXB 4AMKL 2Q8BL 4ISVA 1I3GL 1UCBL 1Z3GH 1X5KA 2V7NB 2VLRD 5H37H 2E9BA 3U7AA 1S7WA 3ULUL 3MRPA 3VGBA 4DJMA 2VUYA 3HE6B 2D3VA 5AAWA 4FQQB 1JGDA 1I9JH 4JRYA 1CS6A 5DMJB 2WQRA 3WSQH 3SCMB 1WCBB 2BVOA 1NCAH 3EIFA 4YR6B 4PIRF 4JHBA 4JPVH 5KSAB 1JV5A 3NPZB 3D2UA 2VDPH 3IDJA 1MCKA 4RZCB 3TBSA 2ED9A 1NGXA 3GI8H 4NWUH 1QFWI 3I6GB 3OL2A 3IJSB 5I1HL 1Q94A 4TUJA 4LVOC 4OZIB 3AREB 5EU6D 5JXAL 1N64H 2BNRB 4FTVA 1LMKA 2KL6A 2P5ED 25C8H 2BERA 2ICEB 3QEQE 3S3SA 5EBMB 2VQUA 3GSXA 4X6FA 1N64L 5E2TH 3QQ4A 3B83A 5L2JB 3UPAA 2BFVL 3D85A 1RZKL 4JN1L 4OGXL 5GPRA 3ZKSD 1EO7A 1X4YA 4CJ1A 3O41A 4L5FL 1NC2A 1RK1A 3U9UA 1UACL 2ATPA 1MRFL 5JW4Q 4YHKL 3TT1L 1I7UB 1A7NH 4TOYH 1ED3A 8FABA 5H37G 5TQ0H 1P7QA 1EBPA 3B43A 4Y4FB 2QKIB 3EYVB 3N85L 4I3GA 2YD2A 3RIFF 3N1GC 4X9BA 1J8HE 3MLZL 3ECBB 1S7VB 4DEPB 3NABH 3U2SA 2G60H 1J0YA 4PRBA 3VH8G 1AI1L 1T4KB 4WWID 3CGTA 4CNIB 3T0DA 4HUWA 4M1CD 4XBGB 5C1MB 1FSKC 3QIUC 1XCQA 2MKWA 3LKQB 5EU3A 1QO3A 4N9OB 4FZEH 2JJWA 3LRGA 1B3JA 4QRTB 1P7QB 4Y4FA 3SO5A 1Q0XH 1FSKB 5EO1B 2HKHL 3EO9L 4NBXB 3MV9B 3B2UC 5LG1A 2AW2A 4AT6A 3V6OA 2AJUH 4JVUA 1NDMA 3PWLB 3AMLA 1CL7H 3PWJB 3MRJB 1BZ9A 1CXLA 3VFPA 3ZKQD 5BVJB 2KZWA 4XNUH 3O41B 1IGCH 4N0FB 3SDCA 1NUDA 2XZAL 1S9VA 1QSFE 2H2PC 1EO8H 2CR3A 4X7TB 3QDGB 4JO4H 1JWMA 4PRIE 3RL1A 5IQ7H 3KPPB 1CIUA 4LCIH 4IMKA 2V5TA 5KVDH 3BIKA 1EXUB 4GG8B 4LDLB 4V1DA 2J8UE 2XZCL 4Z7UE 4ZO8A 4X7FC 1R3IH 1G7MA 4LK4A 4GS7B 2BRRL 3E8UH 3K4ZA 3NOIA 4PP1D 4PTTB 1EEYB 5GZNC 3FO2A 4N0CD 1RUMH 4BFBD 4ORGA 4TN9A 3GJFB 3RDTD 2QR0A 1C5CL 3LQAC 5IP4A 3BX7C 5GRJL 1BIIB 3KXFD 1KLFA 2R0KH 2P42B 1N8ZA 5FOJA 4JY5H 5F88B 5EBWB 3WXVH 1S9XB 2J7LA 3PWPE 3A6OA 4ELME 3SE4C 1IZKA 3SGJA 4QRQB 1K3ZA 4YHLL 4K94C 3BOVA 3BUYA 3VXQB 2X4OB 3WEXA 5F7HA 3X14A 4ZSOB 2B5IB 5F9OL 5I1JH 3G5ZB 4JM2F 3K2UL 1XGPA 4X7CC 4YHLH 1VCAA 1A02N 1U58B 3LDBB 3OZ9L 3G6JE 3RHWK 3H9SA 5KANI 1DN2A 1JGEB 1RUKH 4JAMA 3RKDD 2JJTC 3MUY1 3H0TB 3B2UD 2J8UA 1FE8L 4Z7UA 5CEYA 3KPSE 4PBVC 5KANG 4Z7WA 1MFCH 4NKOA 4Z78A 2XA3A 1Q0XL 3DVNB 2P47B 2WIMA 1HHKB 3CCHA 3FFDA 5IMLA 1FZKB 5DHVB 3VD3A 5JDSB 3V4VL 3FKUS 3MLUH 1UCTA 1EEZA 4NRYA 1WBXA 2Q7YB 3PGDA 1UCBH 1Z3GL 2DRUA 3IRPX 1HYSC 4G6AC 5L2KA 4LCUB 3SGEI 5CJ5A 1BVKA 2R56H 3PWNA 4JHWL 3TH3T 3MGOA 3B9KB 3NTCH 5T5FL 1OLZA 1NFIB 4Z95H 1FVDB 4JHAH 5JMOC 2VL4A 3M8OL 5IVZA 5B38A 3RIAF 4PJXB 3ZDYE 3C60C 2YRPA 1BVLB 1Y18A 2OP4H 3UBXG 1P9MA 4XWOC 1DQML 1H5BC 1LDPH 3W39A 4NJ9L 1OWRM 1UH4A 1K4DA 1S3KH 1YY9D 5GGRY 1FBIH 2ILLA 4LARL 4ZAKD 5JXEC 4GW4A 4JN2A 4M5ZL 3V5DA 1EEUA 4WJ5B 2ZNWA 2O61A 3MOQA 1A6UL 2FO4B 3CFCL 3W0WE 3QZWG 2IQ9H 4XHJD 5DURD 5I74B 2EZ0C 3O0RL 4YNYB 5DJ0B 3SDXB 5DEFB 3B3IB 4XP4L 4M6AA 3LS5L 4O02H 4LEOB 5C09D 1GAFL 5C3TA 1R3HA 1VGKB 3L6FB 4HBCH 4U1GC 3HE6D 1MFBL 1BFVH 5C0GA 1WBZA 2IJ0C 5ITFB 4MS8D 4JPWL 2VXTH 3MJ6A 3LN9A 4P57B 1U3HA 4GUPA 1JHLH 4C83B 3JZ7A 3OMZA 4MHHG 2NW2B 3SY0B 5CLWA 5JW3H 3FONB 2EKSA 3L5WB 2NXZD 4WVRA 1F11A 3SQBA 3C5ZB 1G1YA 1C5BL 1P5UA 1FGVL 4GXUM 1YPZE 4E42A 3DSFH 3UTSA 3V6BR 4CN4A 3K8KA 3PHQB 5EU5B 3VXTA 2OK0L 3IKCB 5E94B 3OAYK 5F1NA 1OPGH 4FXLA 3QCVL 4OCWH 3O45A 3ZTJG 2ZUVA 1IAIM 1F4XL 4JG1H 1GHFL 5J6GB 4KMLB 4OLZH 1P5VA 3BQUA 4HIIA 1A6VH 5HYEA 2A77H 1CLZH 1ZLVK 1YEJL 4LLMB 5F97E 4L3CA 4KJYB 3QI9C 3Q3GB 1FNEB 2D2OA 4HWBL 4P9HC 2BNQD 4ZO6A 1XMWA 4G7YH 3BZEA 5JDJA 1XIWA 2P24A 2VC2H 3OG4B 5DUBB 5EZJB 2BRQA 3GSRB 3R06B 2DTSA 1ZT1A 2AEWA 4FP8L 3MREB 3LS5H 4PG2A 4U6YB 3MA9H 3MJ7A 3B9EA 5SV4A 5CJOL 2FEDD 1A7RH 1RUAL 5HGBB 2VZOA 1JPGA 4JFFE 4JM2B 2XG4A 1JGVL 1OB1B 2Y25A 3WD5L 1JHTA 4OZHA 4U1KA 3ORJA 4G6JH 2F54E 3P9WB 1WAAF 3FT4A 4LLAA 4DUXA 4HKBA 3MBEB 3MA9L 4G8GB 1D5BB 3NPSC 4JKMA 2P7TA 3P2TA 3HE7B 3DLQR 4WFED 5FAAA 2FIKA 3HUJB 4PV9B 5B22A 3UZEA 3DUSA 2BDNL 3KDMB 5I17A 2IH3A 2DD8H 1A7PH 2H2PD 5FA3B 3KGRA 2OJZH 1OAKL 1NDGA 1WLHA 1CLOL 4PJDB 3RWDB 2Z8WC 3KPMA 1JNJA 3RGVB 3PXJA 2JCCA 4PJGF 1CDHA 1MEXH 5FECB 4I0KA 1HKFA 4HK3N 4PBXA 5AG9A 1DUYB 3ETBF 5L6YH 1U8HB 1G7QB 4MMXC 1KFAH 2UVFA 3DGGB 2OTWA 5C0FB 4AEHH 4K7FA 4M5YL 2UYLA 1UYWL 1UC6A 2NTSP 5DRNB 4NPYA 1A64A 4O02L 4D9QE 4HPOH 4L8SB 3AM8A 3K2MC 2IPTH 4PRAA 3LEXA 2BMKB 1ZLSH 2B5IC 4TNVF 3MXVH 5D4QA 1LO3L 3VRLE 3MRKA 1R5IA 1Z9OA 5EG6C 4ZUWA 3OKMB 3BPCB 1O0VA 3SDXF 4YO0B 2C1OA 4ZFOL 5AWNL 2W0LA 1IQDB 2D7OA 5BW7A 1P4BH 2FBOJ 2VZUA 4X80H 3GBML 4P5TA 2XG5A 5IVXF 1I1AC 2V17L 4IRJA 1T21B 5D1XB 1Q9WB 1CDCA 3RZWA 2QSTA 3TA3D 1YEIH 1AKJD 3UPCA 5CEXB 4U1IB 3BO8A 1CK0H 4P9ML 3Q5YA 1KXTB 3F7YA 3SE9H 4ODTL 5DT1L 3QEQD 3ZDYF 4RMTA 2ARJQ 4CMMA 3GZKA 1SQ2N 4FMFA 4DGYH 2R23A 4BSWB 3BPNC 3KYKH 3VG0H 4H26B 1RIHH 4JR9L 3U79A 2Y07L 4ODTH 4CKVX 4Y1AD 1KXQE 1X7QB 1H0DA 1WFNA 3RWJA 4PRPE 1MCRA 2WLZA 3NABL 2NX5B 5EZIL 1E27A 1KPRB 3SDAA 5CHNB 5CEZH 5EN2B 3WIFA 2ZWLT 5GGSY 1YYMH 4OLXH 3V4PH 3O6FD 1T83C 1QBML 3STBA 5DF0A 4LLYA 1J05A 5D72H 3BVNA 3CPLA 3GSOB 4OCMC 1KYOJ 5E8OB 3RVWC 5T5FH 4L3AA 4EXPX 4WW2A 4F7TB 2F19H 1FO0A 2A2QT 1KJMB 2BCKB 3G6JF 3UZQA 1MI5D 4YDJB 1U93B 3FFCE 4GG6B 4FN0A 2G2RB 3IXAB 3P0YL 4ODSH 3QIBC 3DTXB 3TIEB 1IC5H 4KKAC 2Z8RA 4C4KO 5HYSB 4UQ2A 3CLFL 4FHBD 1BX2B 3D0VA 1HOCA 4JE4B 3AS2A 3U0TA 4S1SL 3SO3C 4FQ1L 3FQTB 2BRRH 3E8UL 1J8KA 1INQA 4UIMB 1DANU 4M7ZC 4BKLB 1A3RL 3HLAA 2XN9B 3DHJA 5C0EA 5GISH 2P8MB 3DOSA 1KACB 5IJVB 5DJ6B 1CGTA 2AV1B 2JCCF 5I1IH 1JNNH 2ESVB 3GSUA 1LO2H 3UBXB 4ZUTA 4D0DB 1U8KA 4U6VH 3QHZH 3FTGB 2YBRB 3KPQA 2YWYA 4WO4A 4QTHA 4XNMB 3MRGA 2X05A 3LQAL 3V5HB 3HZYA 1JFQH 2CO7B 2I25N 4PY7B 2HRPL 3GEWB 1FH5H 1M05A 25C8L 4WUUB 1C12B 2H9GB 4LL9A 5HGAA 1HYSD 3L95A 3NZHH 3FQNA 1S7SA 4IM8A 1OAXL 5LGJA 4D9LH 4XVUC 2W65A 2ZOKB 2Y6SD 3CH1B 5SWQA 2E8YA 3OV6A 4IMLA 5JHDB 4B0MM 1F4WH 1Q72H 2ARWA 4WHDA 3DX8A 3FAXA 4UT7L 2E9WA 2B8OT 2CDFA 5IESL 4OSUH 4R7NA 4OLYL 3L1OL 1ZHLA 2BOBA 4M1GH 1RZ7L 2HTLC 5DFVD 4OZFG 5GRUL 5F7UA 4Q0XH 2R2BA 5TE6H 1RK0B 4M61B 2H32A 2H6PA 2MQ3A 4MDIB 3PWUB 4NM8L 2EE3A 5FO7B 2EZ0D 3HI6H 4J4PC 4IJ3C 4JKLA 1T2QH 5A43C 2HLAA 2VLLB 4JVPA 3OX8B 3MBXH 2X10A 1HILA 3LVEA 5KZCB 1N6VA 5DHXB 4KRNA 1PKOA 3STLA 1TZGL 4JJ5A 2C1PA 3O6MH 5FGBC 3NZHL 5HY9A 5HY9B 1AXTH 3IFNH 4JM4H 3FO9A 4FXGA 1ZGLM 3PHOB 4OZ4B 4KDTA 3BGFC 4X9GA 4NSKB 2WWKT 4X4ZA 5FYKL 5KG9B 1YMHB 2IH1A 3I50H 1UT9A 5DQJB 2EECA 1OT1A 3HNVH 1R5VA 5K9QG 4C56D 3KPOB 3VFSB 1HCFX 5DZNA 3B5HA 2Q1EA 2JLLA 5FYJD 5D2LB 3G5XB 4NQSA 3AS3A 2IC2A 3RNQB 4NT6A 2JJUA 3FQUB 4ODBD 3RVTD 3TWCL 2EXWC 2AABL 4QT5A 4M62H 4GLRI 5JUEL 1JF5A 3SDYL 4I3RH 3RUGB 1LEGA 5HYQA 2ITDA 5E03A 3S35H 3MNWA 1WIUA 5GSVB 1YY9C 2DTML 3AVEA 1VENA 3J8F7 2D9QB 3LOWA 5GS0D 3TJHD 1TZGH 4QO1A 3S3JA 3G9AB 4R0LC 1Q8MA 1QR1A 5DQDL 1ROWA 5F8RC 1SEQH 1MAML 2Q8AH 4XXCC 5I1LA 1J87A 3D48R 3KS0J 2EDKA 1XZ0B 1YUHA 4LPYA 1NFKA 2KUTA 3PABB 4JRXB 2DQHL 4W4OA 3WUWG 3STZA 4HAFA 3U83A 4JO2L 2CDGB 3SGKC 2DD8L 4KUZH 5L0QC 1NBYA 5HYFA 1XGRA 4WCYH 3K7UA 2PYFB 5IMOA 3ABZA 1OF2A 5K33A 5J11B 1NLBL 2WBJC 3M8OH 4BQ9A 4QNPE 3VH8A 5BMFH 5GRXG 4ZNEE 3NGBB 4JHZA 3DUUB 2EC9T 5EIVA 1MRCL 2EYTB 1I7RA 2X1PA 1B90A 4HUUB 4I77H 1KC5H 3EUUA 4PJCB 1ZVHA 1G7IB 4FQIH 4XVUD 4HW6A 4Q6YA 2YPVH 1KTDA 3LPWA 2D7TL 1K8IA 4KJWD 5CSBA 3IDMB 3MMEB 3MZGB 2EIDA 1QRND 4N0UE 3O11A 4G6KL 1MFAH 3F5WA 3BEWA 4Q9CA 4WY7L 2EIBA 1AXSB 2W9DH 2KH2B 3EHBD 5MI0B 1CFQB 3RNQA 2Y23A 4YDKH 3OKEA 4LRIA 4JHAL 1TITA 3SDDA 3OKDB 1KN4H 1V7NL 1MFDH 3G04A 4OLEA 5C09A 1MCFA 5FOBB 4MNHB 1OT2A 1EMTH 4XMKL 4BQ8A 2V7HA 4S2SA 3UPRB 2XACC 4BQ6A 2XY1A 1GH7A 1I3UA 4Q9BA 1GC1L 2CKBL 3QIBB 2PR4H 4N8CH 4ZXBD 1QG3A 5IF0B 3SE8H 2V5RA 4N1EA 3FB7A 2O5XH 1E28A 4XB7A 4U1LB 4X8XA 2FWOB 2A73A 4EIGB 3QXWA 1U6AH 1L0YA 5ESQB 3VDAA 3T1FA 1D6VL 2J4WH 3EYUL 4DUWA 3OB0H 5ID1A 3MJ8B 3DSFL 5GSRB 1AGFB 4POUB 5EULV 5CCKH 3X13B 3H42L 4WI2A 4MCYA 5FDWB 4OZIF 4BZYA 2A6JB 2CIKA 4WI6A 3S8WA 2ZCKL 3CVHH 2H32B 1OGAA 2FJHA 4JJHA 1I1AD 3GSVB 3BQUD 3VXME 4R3SA 4XPHH 3QUYA 2NY6D 4OD3H 1RULL 2P5WA 4XNYL 3NZ8B 4P23D 1V7NH 2J2ZA 1ZHLB 3NCJL 4NKIL 2GCYA 1YYML 4OLXL 3HR5A 2GJZB 3A67L 4C59B 4KVNL 2QQKH 2HH0L 3QQ3A 1V3MA 1PKQE 2FD6H 4EI5A 4JCLA 4HG4K 4OLWH 3L9RA 4CU7A 2BMKA 4BYHA 3EJZC 1IKNC 1YN7B 1KTLA 3QQ3B 1YMMD 4DGIH 3IAQA 3DRQB 2NZ9D 4Y8DC 2YEZB 4MYWB 3KWWB 2NY0B 1U42A 5TQ2H 2HFFB 4O2CA 5IB4A 4E5XA 3B9VA 3K46A 4X4XA 1CVRA 4K7FB 4TTDC 3OKKA 4BFEA 4Y4KC 4S1QH 5JPNA 1ZT7B 4JFYA 3RY6A 1FNAA 3VWKC 1IQWH 5KSBE 4Y2DD 1DUYA 4XH2A 5HDBE 4U4BA 4YK4C 4F15B 5HYJB 3O3DA 3HE7C 1NBQA 2UV3A 4KAQH 2AEQL 3CDGB 1K2DB 5FCUH 5EH1A 1CD8A 5EA0H 5I73C 1X4ZA 4BKLA 1ULVA 4W68A 2DWEB 2ZUTA 4B41A 5TJWK 2IMNA 1QACA 2CSPA 4OV5A 3BD5A 3SKOA 1BIHA 4X6CE 3ZDZF 1TZIB 3WIIH 1NGPH 3MV7D 3U4BL 2YK1L 1IEAA 3U48A 2M1KA 4LF3A 1A3LH 3THML 5IG7A 4U1NA 1XGTA 4OF5A 2PW1B 4JFQA 2DTMH 2G5RA 4GS7C 3E6FA 1TVBA 4U1KB 3KJ4C 2DQGH 1P4BL 3LB6D 4WTZA 3SDDB 1WEJH 4H88H 4HT1H 2CGRH 3IXTA 4QKXB 1CDUA 2B39A 1A4KB 4CN1A 3RX5A 3GSOA 3R0NA 5MENA 4X7SH 2LAAA 4P59L 1ZT1B 3PIQB 4RAVB 4KH2A 4YHOH 5HVGB 4AENB 1L0QA 4PB0H 4R4ND 1FNGB 4GMSH 5CKGA 3JV5A 1WBYA 4H88L 4L8BA 4TTDD 5LWYL 1AGBB 3CFJB 4B50A 1IEAB 2OI9C 1I4FB 5J1AB 4OCLC 5KW9L 1BEYH 2YD6A 2VLJB 4NQEA 1A6TA 1CL7I 4LLMA 2O5ZH 2Z91A 2OBGA 4YHML 4NUGL 5HD8D 4HUVB 5ACLA 1L7IL 3DUUA 3NIGE 4X6DE 2MWCA 4NDMB 4GBXC 1B0GB 1C16A 1SYVA 4KK9C 1UJ3A 3X17A 2FX8H 4KK5D 3U36A 3QUKB 2W92A 1I1FB 5CIPA 1LE5A 4MA3A 2G75A 3T3PF 1X5JA 4P4KB 2RFXB 1JTTA 3QQ9D 1ZLUH 4E42B 4IRJB 3EGSB 4X0KA 3UTPD 5GGVY 4HQQL 1WZKA 5IK3B 3QRFM 2IANB 3ZKMC 2W9EH 4UNUA 1IL1A 4D9RD 1HHGA 1FVCB 1MREL 1S78C 2XTJD 3KPTA 4LAQH 4YO0A 5BOPA 5SX5H 5EU6E 4JKPL 2NX5E 4JM4L 3DXAD 2C5DC 3KPRD 4C83A 5J7CC 4F37K 2E5EA 5E4EB 4YBQC 3MRKB 2VZTA 4QTIL 2VIRA 5B38G 1Q9LA 3VG9C 2ITDB 4WHTB 4HS3B 3QNZA 5F1IB 4ERSH 3MLUL 4HIXL 1DQQB 1J7VR 4OQ1A 3DYPA 2Z92A 4KZEL 1Q0YL 4NQSB 3BXNA 2OL3H 4LSUL 3VFGL 4EVNA 3VFUB 3SKJL 3VRLF 2EH7L 1RZJC 4H0IA 4F33B 3UJIL 1U2CA 2FJHB 4YXLH 1MUJA 3SDCC 3VFSA 1KNOA 4KI5C 1JI1A 2YUVA 3EOTL 4U6VL 1CT8A 2ID5A 4YEEA 1C5BH 3PHSA 3RVTC 4YHKH 1QKZH 1Y18B 1YMHA 5FUCC 4QRSA 3I6KA 2B0SH 2FX8L 2YMXL 1PFCA 3MLXH 1EUUA 5BRZA 1ZEAL 2E7HA 4PJEB 3QIWD 1P7QD 1OAXH 2VO5A 4YIQA 1IAMA 1KIPA 2DQTL 2YZ1A 2P48B 3B9KA 1QPPA 1S8DA 4KHTH 3V7MA 2HLAB 2VLLA 3GKWL 2CIIB 4WTWA 2VN7A 1TPXC 3LQAH 5A2FA 2VDNL 5ISZE 2LFGA 5I71C 2OM5A 3GIZH 5DSCB 3CXHK 1G7HB 2DBJA 2GY5A 2C4XA 2YKLL 3CCHB 3FFDB 3G6DH 3MJ7B 2I5YL 2VR5A 2JIXA 3BP6B 1I8LC 5D7IA 3MREA 2PTTA 5CEYB 4AIXA 3BDYL 1WTLA 2KPNA 1WWWX 2VB5A 1JGEA 3ZKXB 2VNCA 1KN4L 4XNUL 3SKNB 3WXWH 3BYYA 3EFFB 5SWZA 2ICWA 3ARDD 5JHDA 1W2KT 4NO3A 4R26L 2ARJA 3ZLQC 5CILL 3QSKB 3Q48A 1KUMA 2OR9L 3BEVB 1FAIH 4UIKH 1VPOL 4LNRB 1K4CA 4QXUL 1ZVYA 4UBDC 5M7QA 2EIEA 1XF4B 2J8OA 5ISZA 4CVWA 3H7BA 4A6YL 3NFNB 4V1DD 4XMPH 2WBWB 3ZE2E 5IMOB 4PJ8C 1PZUB 1QHPA 1GGUA 4KWUA 1XGRB 4ZAKB 3WNNA 2ESVA 3T09A 3ARED 3SHSA 3TBVB 2YOCA 3MJ9L 1NAMA 1YEHL 3LMJH 2HJKA 3ULUF 4XP1H 4FFVD 5FA4B 5C0BA 4DQOH 5GS0C 3DV4B 1FG2A 2BSTB 5GZND 5T1KD 5C0EB 2WP3O 3IDYC 5ETUB 2JIXD 3HLAB 1J1XH 1BZ7A 4OCXH 3WNOA 3MRRB 2DQJL 3TNMB 2EKSB 4Q2ZA 3U0WH 3EO0A 4IHOB 5C0JB 5K59E 3PWJA 3EDEA 3CSYB 1B4JL 5C07D 4MD4A 3HUJF 3L6FA 4R2GC 4L8CB 1R3HB 3TZVD 4OI8A 4NHCL 4JY4B 3ARRA 3SKMA 5JOPD 3RX7A 4H0HB 2BCKA 2C26A 4QT5B 2IAMA 1NCBH 4M48L 5DEFA 3UC0L 4KVNH 3I84A 4FQJL 5IB2B 3G5XA 2GUOB 3T65A 1U0QA 1IAIH 4ZUUA 2VDLL 5DHVH 1D5IL 1EHNA 1PY9A 3OKNA 2YD3A 4GOSA 3F12A 3IFLH 1MQKH 4F9LC 3O6LL 2ADIA 3CVIL 1KULA 2E3VA 4XPGL 4Z5RA 5JIKA 5EOTB 3SPVA 2CK0L 3HNTH 4HWZB 5BQ7A 2E6JA 5D1QD 4NO0A 1U8NA 3D85D 4PJGA 5F3BA 5L0QB 4LCCC 4MZ3A 4RA3A 4FQ2H 3U9UB 1D6VH 2IBGA 5LKNA 1N4XL 2OTUB 1A1MA 1KLUA 2HWZH 5F1KC 3PDGA 4XCCL 3SDXE 3BE1L 1I3RB 4UOW1 5DC9B 3O6KH 4A2LA 1FPTL 1LWRA 4ZD3L 3FO0H 2XZCH 3D85B 5HHXL 1EA9C 4JPKH 3H9HB 1FIGL 4LSPH 5IVXB 3BP7B 1CGSH 2XQYK 5KSBA 1QSZA 4QXGL 3S96B 2YD7A 4GAYB 1ZT4B 2VITA 4OM0H 4LLWA 4B53A 5E1HB 5F9AC 4GJTB 1XH3A 1QBLH 1G6RH 4M3KB 4U1MB 3DX8B 1ZLWK 3QUXD 2A9NH 1KJ2L 4RZCA 3OJDA 3TBSB 1T89A 1G6RA 5EFIB 1YEGL 4UDTA 4WNQA 2A6KB 3QA3B 3WEXB 1S7SB 4X4MA 1K5NA 3P4OB 3VJ6A 1OTUD 4KQ3H 5CBEA 1MLBB 5ITBL 3EAKA 4TNWF 3G6DL 3HZYB 4LKXA 3OJ2C 3TYGH 1KC5L 3MRGB 3IFPA 4BK4A 1TZHB 1KENH 4NFBA 5J06A 2IPKA 1ZLVH 6FABH 3E2HB 4PJIE 1BD2D 5BMFL 1IGJA 2ZUUA 3KPMB 4RNRB 4KI5D 3QCTH 4MJIA 3VXOA 1FNHA 2R4SL 4JFHE 1UWXH 2DOCA 3G6JB 3OAYH 4I4WA 3HMWL 4Z7VB 4GG6F 1INQB 4C56B 4JDTH 2RCSL 1TLKA 3WN5C 1A6WH 4NC0B 5FGCE 2GJ6A 1BX2A 3D0VB 1RMFH 2X4TB 5BVJA 5ALCH 3IFOA 5DO2C 5IHUH 4MNQD 1F3DH 3MBEA 2BSRA 4ELMB 5T3ZE 4YDJA 1LEKB 1IRAY 4HPOL 3U7YH 1X5HA 5FO9B 4NZTL 5E95B 3QNXB 1SM3H 4ZUSB 3SJVA 4RGMC 3OPZH 5IW3A 5FCSH 1KENL 4JDZB 4CNIA 5HDBF 4G8EB 3MRQB 1T4KA 3NIFE 1OTUC 4OV6F 2PTUA 4LLUB 3MLRL 2YA1A 4BFIB 5JLZA 4LRNL 3HC3H 3OKLA 4M1DL 1KB5A 4WUKL 1QLEL 5ESVB 1T1WA 3WE6A 4HG4J 2VDQH 1MELA 5F7YC 3ULVF 3EYVA 1BFVL 1W72B 1G7PB 5ADPL 5HHPA 1ZWIB 4RGOH 4HHAA 4YUEH 3OJVC 4OZGE 4MXWH 1FFNB 4YHNB 4GRWE 2DL9A 2FYYB 3AXLA 3BQUB 3ZKNC 2IFFL 5EIQA 3QYCA 4U1SA 2IBBA 3T0VA 1KIQA 1JYNA 4JQIL 1RZIB 2YD1A 3GMRB 1EBAA 5EO9B 2PO6C 1PEWA 3QIWB 4AZ8A 5DO2D 2NY1C 4C58B 3LRSB 3W82A 2DQUL 5H94A 4ODHH 5DR5L 1YEGH 1E4KC 1XT5A 2P5EE 2DIAA 5LAXA 1XGYH 3MSPA 1YEIL 1J8HB 4EXKA 2NW2A 4IRSC 3SY0A 3OKMA 4R7DA 5C9KA 5EOCL 4NO2B 4JPIB 3WS3A 4CADB 2BOCB 5CJQL 1DBJL 4OFKA 5ITFA 4YE4H 5GIRA 5EOQL 2PO6D 4WWKD 1RFDL 3EYQD 3RWFA 3ZE0F 2EEBA 1E0OB 1VFOA 4I0PB 1YQ2A 4XWGH 1WGOA 1B0WA 1D5ZB 1OSZB 3QO0A 3ZE1F 3JV6B 4D94A 1X44A 3E1F1 1T1WB 1URLA 2OTWB 1IEHA 2FO4A 4JFPA 1KB5B 3F62A 3HE6A 4S1RL 1LP9A 3LV3B 5D9SB 4HEME 5GJTH 1QFWM 1ACYL 3QEHA 2V7NA 1YZZA 4P5MB 2OJEA 5D2LF 4S1RH 4RAUA 3SGDI 3P4MB 2DN7A 3O4LA 3VXSA 2K1MA 1GPOL 5D6CB 2PR4L 2F19L 1OAZL 3B5TA 5E8DL 1BAFH 2HFTA 4W4NA 3ULUD 3C2SA 5I18H 4OFYD 1AC6A 2P7TB 4DTGL 1JPSL 2I9TB 2AXHA 3D3VA 3UJJH 3WXVL 3NCMA 5FM5O 1HSBA 1NEZB 2GAZB 5I76A 4OGAD 5J1SC 2BY1A 5HYSG 1JHTB 3FN3A 4EUPH 5D6CA 5EZOL 3ARPA 5IMLB 1NFDF 3MRHB 1EPFA 5FO8A 3QCUH 4G9DA 3L3DA 2EEDA 1EJOL 2YA2A 5CLTA 2NY7H 2OJEB 4LSRH 5EORL 1I8MA 4KKBD 2D7PA 4YDVA 4ELMF 1OAUH 3TBWB 5L8KB 1GGIL 1I1AA 1RSFA 3R06A 4KKLD 3VMNA 5D7JA 1ZMYA 1I8LA 1CICA 3DYMA 5MHSD 2YUZA 2FECI 4OZFH 2NTFA 5ABDE 4OB5H 1FNLA 1QBMH 3X14B 4L3CB 4NGHH 2WM0A 3N1MC 2CO6B 3P30H 4X5XA 4FZ8H 1VA9A 1DUZA 3N85H 3QT2A 1EHXA 3MJ9H 3UTTE 4LHQB 2PYEB 4RDQG 4KMTH 2VLKD 2CH8A 1IGYA 4CVZB 3ARBC 5D5ME 3AFLA 1OARL 5DQ9A 4U6XA 1PG7W 4W70A 1MJUL 3QP3A 3MC0A 2V9TA 1D9KC 2K3TA 2N56A 2EDTA 1P6AB 2IWGA 4K3JL 2M26A 1J1PH 2HWZL 5J3HC 2D7MA 3FB6B 2RB8A 4UDUA 4PJ8A 5F7DB 3BP7A 4XNXH 2X70B 3QDGA 1U6AL 1EHLH 5F9WB 2ZSVA 4NQCD 3KLSA 3RUGF 4R97B 4ZFFA 3GRWA 3JUYA 4YPJA 1Z0MA 1MCWW 3CU7A 1IM9D 3AREC 4KPHH 3VE0A 1RIUL 1JTPA 4KJQD 4NO0B 1HHJA 5I15L 2I5YH 4QHNA 4FFVC 1AR1C 1ZWIA 5DMGD 4BM7A 1WT5C 1NBVH 3BSZH 4NQDD 5MERA 2CLRB 4NNPL 2CUMA 2D31A 2WSKA 3IS0X 5T5NG 4YXLL 3TNNA 2VQ1A 3IJHB 5CBAA 5I71B 4WY7H 3QNYA 4P46C 5C0RH 2Z4QA 5FKAB 3F12B 2Y5TA 3UTZB 4KHTL 5DRZA 1DLFH 1UYWH 1U8LB 1HQ4A 3DXAE 3BGMA 3W39B 1YYLL 3IJHA 1MF2L 2MPAL 2VQ1B 3KJ6L 2R4RL 3MLXL 3CFCH 2DKMA 2ED7A 5E5UB 2FEEI 4P23B 5EUKB 4RFEB 3HZVA 2HT2D 4QYOA 4PGBA 2PYEE 3UTTB 2H26A 3NIFF 1FFQA 4U6TA 4LAQL 1I9IL 3LN4B 3MLWL 1RK1B 4QRPD 5D93C 1YEFL 3PGDB 1NUNB 5SWZD 2OYPA 5FF6B 4HKXB 5E5RB 1GGBL 3ARDA 4PGEB 2VL5B 4PLKC 1I9EA 1PSKH 2MFNA 1A1NA 1DQTA 2BK8A 3U46A 4PJ8B 3TIDA 3JWOL 2XKNB 4ZAKC 4RNRA 2Q8AL 3R4DA 5JXED 4JFXB 2QADB 2NNAA 2VXQL 3TBVA 1PSKL 2MNUA 1RUAH 1T0MB 1BWMA 4J23A 4O9HH 4PGZA 3LRHA 1MJ8H 3VXPB 3H9SB 4DFIA 4N0CC 5DQ9B 4XZUB 1XGPB 3VGAB 1P84K 1J12A 2VDRH 3G5ZA 1CGWA 5GGVH 2PYEA 3D2UB 3HCVB 1L6XA 3GMNB 3L3HA 5L2KE 3X12B 1P4IH 1QTYT 3WFZA 2APVA 1ZAGA 5E08H 3VU2A 4PJ5E 2APTA 2DKUA 1NFDE 4R2GB 1XF2B 4OI9A 1F3DJ 1F3RB 1BIIA 4GH7B 1NCCL 3QWOB 2NXYB 1TJHH 5SWZB 1DSFH 2LVCA 4WO4D 1PQZA 3MUGA 1EEYA 2HT2C 1XH3B 1CU4H 1CBVH 2NNAB 3FT3B 4HKJA 3KYMA 4HBCL 1YNTB 3MYJA 3ARQA 3BP6A 2JIXB 5IROC 1JN6B 4NHUB 4K7PX 5D1QA 1J88A 2CD0A 5FM4A 2AABH 2VISA 2HVKA 1LILA 4HUMB 4MDJA 2Q87A 4BH8A 3PJSB 1I1YB 1WIOA 3PWPA 4P2OA 3CX5J 4GAJH 4WI8A 4KKCD 1IARB 3LN4A 4ODVH 3S3PA 5GZOC 2X1WL 2RCSH 4CU8A 4WU5B 4AT6B 3TN0A 3VXRB 4HWZA 1HIML 4OGAC 3HI1B 3U9PH 4ZTOL 4ODXB 3B9KD 3I2CH 4R4NC 1CD1B 1MRDL 1RHFA 1F58L 2P5EB 1IBGL 3BGMB 4NO0D 4PY8I 1AFVL 2ORBL 1IM9B 1T5WA 5FDYA 4ZFGH 5I1CL 5J11C 1KNOB 2X4SB 4MX7A 2FSEB 1HHIA 5TQ2L 15C8H 4PJAB 4G6MH 3AB0B 3P9MA 3VFUA 4EVNB 3KYKL 4N8VG 3VG0L 3W9EA 4ZXBA 5IB2A 2VLKB 3C6LC 3RWGB 4KUCF 3TM6A 2BVUA 4D3CH 1NKOA 1FBIL 4KK9D 1DQDL 1X5LA 3GO1L 1N0XL 2E7MA 3FAWA 4XXDB 3C60B 1BGXL 1J86A 1BM3H 1DEDA 3DRTB 4LHUB 3F7PC 3CSYA 5JIPA 2C7UB 4B5EA 4F3FA 4PR5A 3GMOB 4OCRH 1KCKA 2ZSVB 4MA7L 4Q2ZB 4GW5B 1KLGB 1JMXA 2DMCA 3V79C 3VRIA 4BJLA 4M7KH 1LP9E 4MA1B 5AZEH 4QXGH 4U7KA 2IANA 2ZPKL 5ISZD 5KSAC 4JFZH 2CR6A 3CFEB 3MRFB 4OZGF 1EJ6A 2P5WD 4ZMAT 1U3HC 4PGDA 5JR1H 2FH6A 2HFGH 1AD9B 1GZPA 4M7LH 2I26N 3KS0H 3GMRA 3V8CA 1HXMB 3QDJA 2VXSL 3ULVE 1DBML 1RZIA 4TUJB 2EICA 3CLFH 4U6XB 2Q6WA 1JRHL 4RAHA 3AU1B 3KPNA 3PQYA 3L3KB 5D2NA 4Y1AE 4ZO7A 1XEDA 5JXAH 4OF7A 4PJEF 4NCC1 5JQHC 2K7PA 4F57L 5HSFA 3HZKA 2Z91B 3ET9F 5L6YL 3P11L 4KJWC 2ITCB 5F9OH 2MKLC 1GCFA 5DD0L 2NTFB 5CJBA 4Y5YB 4APQC 4YXKL 2JK5B 4Y5VC 4EQ3A 1CLOH 1L4IA 3GKZA 2VRAA 3MLYL 3PG2A 2UUDH 3H42H 5MENB 4OLUH 4M6ML 4IRZL 3L3IB 3ZKXC 2EH7H 4ISVB 1FQ9C 1F42A 5FO8B 4AIOA 2DQFB 1SJEB 1GOFA 4NWTL 4IRJD 4LP4A 2HFGL 1CFTA 5C2UB 1MFEH 1BLNA 2F8OA 4I48B 4OJFL 4M93B 1NCWH 3HRZA 3K1KC 4JFQB 1LQSR 1B88A 1HSBB 1NEZA 2GAZA 1JHKL 1W8NA 2VAAA 2W60B 4GAGL 2BZDA 4LF3B 5A3ID 1QRKA 4R96A 5DTFA 5DFTA 1KIPB 3C08H 3BDBA 5M95B 1NGZA 5F6IB 2NY1B 4NCDA 3ZMRA 3QDMD 3TBYA 4NKMB 3GJEB 2A6DA 2PXYB 3OXSB 1EDQA 2NXZB 3T0ED 1K2DA 4G7YL 3MOBL 3UDWA 5CKAA 3PP3H 4WV1B 3IETB 4B7IA 4QOKB 4N0YL 4M4RA 2PO6B 5J3HD 4U3HA 3MLRH 3BRGC 3WFHB 1FFPA 4G8IB 4GAJL 3RY6C 1HH6A 3WJLC 1MCIA 3ZYOA 1A7RL 1RUQH 4IS6B 5TH2A 2PETA 2NY3C 2OR9H 3L3JB 1ND0B 3VGEA 1JYXA 1RZFL 1EHAA 4NN7B 3IDXL 3F58L 5J13B 4NBYB 2DL2A 1XR8A 1G7LA 1J5OH 4WNQB 3OTTA 4MJ4A 1VFUA 1G9ML 3OJDB 4MAYD 4ODUB 1KOAA 3TFKD 5F9JA 4GXVL 4RIRA 2B1AH 3QUMH 3ESVF 4PJHE 4U1MA 2OR8A 3VI3F 5E8DH 4KV5E 5KAQF 4WWKA 3ES6B 4FNLL 4LLWB 2HKFH 4KZDH 2BXZA 3MXVL 5KVGH 3RBGA 4OGXH 4QCIB 3EGSA 1WV7T 3VWKD 4FQHA 4PRDA 1S5IH 3QIUA 2VSDA 5IQ9B 4P4KA 4NM4L 3GSVA 4FG6C 2FJGA 2HP4A 4P2QA 4XCFH 2D9CA 4TSBL 4MJID 3IF1B 1T7XA 4I3SL 5JO5A 3D0LA 3MUJA 1CU4L 2V2TB 3FFCA 3S4SB 3OKOB 3U4BH 3MBXL 1A6UH 1I3GH 1PAMA 5ALCL 4L4VD 5ID1B 1F97A 3T1FB 4D0BA 2J5LB 5INDA 2J1KA 5HYIA 2GJ6D 4TNWK 5I75B 2FWOA 4HIJA 2J6EL 4FXKA 3UYRL 5BV7B 4DKEH 3CDYA 3CK0H 3GIVA 1FNGA 3QUXB 1J11A 1MAJA 3BZ4A 4RAVA 1HDMA 4UT9L 3F58H 3H9ZA 3CK0L 4PYGA 4Y88A 5FOBA 2H3NB 4JDZA 1HEZB 3AC0A 4HC1H 4EZMA 3TJHC 3HI5H 4IIQB 3SGDH 4LKCB 3O9WC 1Q72L 1CFNA 4AL8H 3S36L 3W0WA 1U8OB 2WUBH 4KK6D 4PJFF 4Z7VF 4K3GA 4JY4A 1XCTB 3IAPA 2NLJB 1XGTB 7FABL 2X09A 5ELIA 3RVXD 4JLRA 3DO7B 3HPJA 4D9QD 1D9KB 3MRIB 4PJCA 4CVUA 1WAAE 3T04D 2EYTA 1OHQA 3MRRA 4MJ5A 5HHOA 4OBRA 3NCJH 4MA1C 3VXNB 1U8QB 5E9DE 1JNLH 3BKCL 3ZHDA 3MV8E 5JA9A 2BSTA 3NACH 3DBXA 2AV7B 4ZYKB 3V5KB 3V6FB 1C5DB 1IGJB 4HGWA 5IW6A 4JFEB 3M17B 2FHBA 5IBTH 2R4RH 1OQXA 4ZOCA 2VXTL 3C09B 1C08B 4MQXD 3NCFB 1MPAH 1N59A 3OKKB 5F7EH 5ISZB 5ERWB 3NN8B 3DGCR 3AS1A 4KV5F 5JHDD 5I19H 3KG5A 3PL6A 2JJSA 4L4TD 4RRPA 3VI3E 4UQ3B 1RZFH 3DVGA 3HFMH 3X3FL 1K5NB 3P4OA 4S1DD 4X8JA 3ARGA 3N1FC 1QRNE 1G9NC 4L3ED 3L9RB 2Y6SC 1OGTA 3I75A 4PJEE 1PEZA 1KJ2B 1AGCA 1B4JH 1KXVC 1MJJB 1SY6L 5IBLD 1FVEB 1W0YT 3RUGA 1ES0A 2GCYB 3AS0A 2QEJA 4JO4L 2ADGA 4YWGL 1MOEA 4JPWH 2VERN 5BZDA 4BZ2L 4MJ6A 1JMZA 4YE4L 1OD7A 1P7KA 4QRRE 4OCXL 1OAQL 1LEIB 5F6HI 1GOHA 2FX7H 2RHEA 2F8XC 1G7HA 1LK3H 4P5TC 4ZFOB 3NFPB 1MJ7H 1I3RA 4L4TE 5DK2B 5IFHL 1R5VB 2K9UA 4R90L 1JGLL 2OTUA 5FYJL 3RZCA 4OZHE 5GGTH 2AJZA 2G9HB 4JRXD 4M6OL 4R4FL 5EC1A 1GGIH 3O4LD 1MWAB 1SBSH 3VXSD 4KKNA 2IH1B 4MWFA 2F54A 4OQTL 4WIQA 4LCYA 3BH8A 3UJTH 4AH2A 4M6OH 4LSTL 3BESR 3STLB 4EN3D 4U1LA 3TA3C 4PRHE 1FAIL 3MFFA 5EU6B 1IGIH 2QJDA 3VFTA 1A2YA 1TENA 2YUWA 3U4EB 4WV1C 5BJTA 1GXEA 1CT8B 5KS9E 3HZMB 3G5YB 5C07B 4XAKD 5ADPH 1II4E 2V7HB 4S2SB 5C6PB 5LCVL 2AGJH 4JG0H 5HI3D 3GK8L 3G04B 5C09B 4ZUUB 3FRUB 1O7SA 3V7AE 5KSVA 2HFEA 3QXVA 4XCYB 3AMKA 1FN4A 4GKOA 5DJ8B 5FYKD 1ZA3A 3RPKA 2ED8A 1XF3A 1MCPH 1HI6A 3I3DA 2XA8H 4X6DB 1T7YA 1X5AA 1JGLH 3BWUC 2OZ4L 3VXUA 2MHAA 2W38A 1N4XH 3KJ4B 4L8CA 1RZJH 4JO1L 3S34L 5CD5D 2O26U 1N3NB 3VFWB 2Q86B 1K8IB 1FE8H 3MYZA 1OAQH 2ZOKA 4TVPL 1JNHB 2NPLX 1MCNA 4I2XA 3TVMD 2XTJE 1XIWC 3I2CL 5C0CA 2H1PH 3EYOB 3ZKMD 1T3FB 4XNYH 4XNQB 2O5XL 3QPXL 4WUUA 2KQNA 3ZYZA 2PYED 1EAPA 4PJFB 3CVHA 3DI2B 3A6CH 1CR9H 4XAKE 1EFXD 3V5HA 4ODVL 3VDBA 1DLHB 3H9SD 2FIRT 1MY7A 3GRWL 2BSSB 1IILE 1EUTA 4EI6A 1Q1JL 1UJ3B 1M71A 5HHQB 4GQ9L 5AYUL 3V8OA 2B2XL 3QCTL 5DVMA 5GRVK 5CJXA 4F58H 4HX1A 1BGXH 4MQ7A 5DD5H 4J6RL 1EAPB 1ORQB 3CLEL 3EYOA 3WNKA 3LD8C 3K4AA 2XWTB 2Z0BA 5J1AA 4NO3B 3LCYA 3TYGL 5CZKA 2QHRH 5HYSA 2ZUQC 2ICWB 3F7QA 2EDBA 4LASL 3HI6L 3KPRB 1YNKL 1JWUA 5C0CD 1T04A 1KEGL 4L3EB 1ZA3B 1TNMA 3GHEL 3VWJA 4WEBL 5T5NF 4D8PB 4NZUL 5B8CC 3NA9L 5D7IB 3IXTB 1MREH 4XCYA 1EFXA 1ZHNA 4F9PC 4HXAH 4ZNCD 4Z76A 4OBSA 4AIZA 4F7CA 3O8XA 4YHZH 4ZNEA 3VW3L 2Y9RT 3MRBA 2HMID 2QQLH 3ZHKA 2VXQH 4LVNB 3U4EA 5ADOH 5DQJA 5EN2A 3WIFB 4C54A 1WFTA 4KRPB 2DS4A 1SEQL 4J3OC 4R8WH 4MGXA 4J3VA 1KSRA 4QTIH 3VMPA 3FO9B 4FXGB 4HGMA 1LO5B 3EOBA 2AK4E 5DRWB 5IHZB 2GW5A 3MLTA 1RJZA 4JZJA 1TQBB 4QRSB 4PJHA 3VXMD 1MRDH 2B2XH 3TF7C 4I3RL 3RZCB 3BGAA 1CLYH 3U7WL 3MX0A 5TQ0L 4OT1L 2RJMA 5CUSH 3BSZL 3U6RA 1BQUA 4XC1H 2EDWA 5D1XA 4NUJB 4RDQF 5GISL 3TPKA 4LGPB 1CFVH 3FOLA 5CUSL 4BH7B 4MJ6B 2AK1H 4OD1L 2GSIA 1ZLSL 3LKOA 3WLBA 1NCAL 1DE4B 5IFJA 4M43L 5B39G 3HMXL 1G9MH 1PVHA 4UINL 2X1OA 1CGXA 4KVCH 5GGVL 3BPCA 1JUFA 5J4MA 2QSCH 5DS8A 1IAKA 4M43H 4P46B 3HG1B 4PRAB 1GJIA 1WISA 2LTQB 2EYSB 2YSSA 5C0AD 4Q9RL 3PP3K 2OZ4A 1VACA 4QHUB 1J1OL 1UA6L 2JF1A 3QUZB 2LTQC 2VLJD 1BFOB 2QL1A 3FTGA 1T1ZB 5GRWA 1LHZA 3RAJL 3C5ZD 1WEJL 4HFWA 4F8QA 2XWJA 3QI9D 1HKLH 4HGWB 5FUZH 5C3LD 3KNBA 1SYVB 5D1XD 3V5KA 5F6IC 1IQWL 3CDCA 1UG9A 2EC9U 3FMGL 3MNVA 1ZA6A 5D93B 3VXNA 5K93A 3O2DH 4NN6B 4N0UB 5IHZA 3KDMA 4Q7DA 4LASH 5IJKA 5DRWA 4YC2C 1A6TB 3HE7A 3IRZA 1OTSD 4EJ1C 4PJCE 3VD4A 1YYLH 5DJAA 3FO0L 1UXWA 4KUCD 4YHZL 5IF0A 5TE6L 2WZPD 3TN0D 1CDYA 2QQQA 3OB8A 3UAJC 3PIQA 4MNQB 3CC5A 1LD9B 5DJCB 3X3GH 1KJMA 4XVTL 2Z8VC 2DF3A 1G9NH 5GS1A 3HNTL 2NY4D 3AM8C 5KTEL 2BVQB 3OZ9H 1MVUB 3QEUB 4IRSB 5M94B 4XB8A 5DZLA 2XZQL 4GAGH 3BEWB 1YEJH 1J05B 3UZVB 2FECL