2CD0A

Structure of human lambda-6 light chain dimer wil
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of human lambda 6 light chains.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAM
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cd0A00
1I7ZA 2Z4QB 1P4IL 3RFZC 3H6JA 3PWLB 3QUYD 5GRJH 4L8SA 3UBXG 1Z9LA 1DQMH 5KSBA 1UXSB 1Y18A 2V2WB 2VZ1A 2BXYA 4WV1B 3VMOA 1F11A 5FYKH 4LCCB 5E03A 3HZYA 4DOHE 2BC4A 3LRGA 4JFEE 4XWOC 5F9WC 4NN5C 4X8JA 1P4BL 4RGNE 1YEKH 2NY4B 3QPXL 4OLZL 4XHJD 3IDJA 1AGCB 3HC3H 4OB5H 1X5XA 4KROB 1ZMYA 4F58L 1U36A 3UDWC 3MLYH 4OFYD 1CD0A 4ZPTA 2F8OA 3KR3H 3LZFL 1NGPH 5MERA 2HTLD 4DTGL 2EE6A 3QIUD 3CDYA 3BWUC 5E5MB 1DVFB 1GH7A 3MODL 1MI5D 3G6JE 3QUXC 3QAZC 4IRJC 5E4IA 1A6VH 5DJCA 4HMEA 1A6ZB 4JFFD 3LOWA 3O9WD 2AEIT 4HUNB 4OCRL 4AEEA 3C5SB 2H1PH 2X1PA 3JTTA 2OMNA 5DUBA 2P7TB 1NCBL 5EOQH 5HYSG 3EYFA 3B3IB 4XBPB 2AJVL 4OF5A 1KJ2A 2XQBL 5FUCC 4XNQA 3MRLA 1BFVH 4JFED 3VFOB 3FO9A 2DL9A 1NC4B 3I50L 4JO1H 1XCQA 2G9HB 4GKSB 3I3EA 3DNKA 2ESVA 3BOVA 4MHHG 4PJ8A 4NQSB 3RIAF 3ZE0F 5I8EB 2OK0L 4P2CG 2GHWB 3PF2A 3QXAB 4F15B 4DUWA 5JR1H 3UJJH 1KCUH 4MQXC 4QXUL 3RTQA 5EOTB 2CIKB 5GS1A 2H45A 5MEPB 3ESUF 1ZT1B 4LSPH 3OTTA 1J1XL 1F6AA 3ZTNH 4LEXL 5E7FA 2ED7A 4JFXB 1FPTH 5H37H 1NPUA 4UT7L 3ULVH 4UIMB 4XX1G 2Z8SA 5EZOL 3RKDD 4I1NB 4FZEL 3UPCA 3EOTL 3RI5F 3V7AG 4P46B 3UTTE 3TNMA 1HOCA 4KXZI 1KT2A 3VFNB 4BQ8A 4JM2F 2GY5A 4TSAL 4O5LL 1QKZL 1SYSA 4P5TB 4LSVH 3HUJA 3QDMD 1A02N 3VXSE 1ZLWK 3ZKXB 5HHVH 1J8HA 4GAYA 1H8SA 4MA7L 5IJKA 2VIRA 3HC4H 3DYOA 4KJPD 3RHWF 4NHCH 5C09B 2FBOJ 2CIKA 3WFBH 3WKMH 5DQDL 1MHHB 4KPHH 1MFAL 3B83A 2CLVB 2DQEL 4WEBH 4NT6B 4R4FL 1LMKA 4L3EE 1EBPA 4U6YA 2X4UB 5EUOB 1WFNA 3TV3H 4RA0C 4LCWE 4OF0A 4XPHL 1NQBA 3MV9E 4PJ5B 1N8ZA 3RTQB 4QRUA 1ZSDA 4IMLA 2IADB 4ZUWB 5D1ZA 1N6VA 5CMAA 4M00A 4OQ1A 2RHEA 3BDBA 3DURA 4OGXL 5B8CB 2FB4L 4PRPB 3H8NA 2B2XH 5ESAA 3S37L 2NZIA 4YE4L 1BJMA 1CBVH 1UM6L 3QUMH 5C0CB 2BOCA 3GIZL 3S98A 1F5WA 3ARDD 1CU4H 4OV6F 2XKUA 4JDVA 4R2GB 4F9LC 1WIUA 4LNVA 2BRRH 2WIIB 4RZCA 4Y19B 1I8MA 4MB3A 3BWAA 1H3GA 2NLJB 4BK4A 2QSVA 1IRAY 3ARBC 5CINH 4L9LB 5I1GH 4LAQL 1MHEB 4P2RA 3VXSB 1KTRL 4JHAL 5IVXB 4XWOD 3MBED 1JPFA 2X4NA 5B38A 1ZS8A 1M7DB 3O4LA 2RCSH 1KTDB 2VLJA 4RMUA 1EO8H 1T5XB 5F3HA 4JQIL 1OAKL 1ZA3B 4J1UB 4KTYA 4W68A 3CSYB 2JCCF 1FFNA 4V2CB 4HGWB 1FFOA 3OR6A 4RQQB 2VDQL 1AGBA 2VE6A 4N1EA 5IB1A 3WS6A 4HXBL 1G6RH 1LP9A 5A2JH 2XZCL 2YD6A 1XGQB 3A6BL 1XR9A 2BY3A 1G84A 4PJEE 1FNLA 3O6FA 4Z7QE 5IFAL 4IM8A 5DJ2A 3PDOA 4X6FA 1BD2E 1I1AD 1M1SA 2BNRD 4BZ2L 5HYJE 1DEEA 3JVGA 4TUJA 4R6UA 1YPZE 4JFOB 4OIAA 4EI5A 4NHUB 4CDGC 4PRPA 3G9AB 4HIJB 4MMZC 2FJHB 3QCUH 1IGCH 1HXYA 4RNRB 3MZTA 4NZRH 5DZLA 1VADA 2A74A 1Q9KA 4EBQH 1X9QA 2W0PA 3M8OH 5L88L 4UOW1 4MNQD 4I4WB 2XZAL 3TH2T 2YPLE 3MV7A 2AKRA 3MROA 4W4OC 1A6WL 5JHLH 2FRGP 3O4LE 1RK1B 3TVMB 3U4EA 4R90L 1B2WH 2FSEA 4MA8L 1KJ3H 5TE7H 4KY1L 4R2GC 2V6HA 4HCRL 2C7UA 4ODBD 4LRIA 2P4AB 5SX4H 2WLYA 4XP1L 4Z77A 1U8PA 4HH9A 3MXWL 5E5MA 4R7DA 3L3KA 1FVCA 5A2LH 4LLUB 5IMKA 4EJ1C 3W9DB 4YXLL 2PW2B 1NCWL 1JF1B 1X5YA 3MNZB 4U1JB 3T2PA 5E2WL 2J5LC 2FR4A 1S7UA 2HKFL 4QRUB 1QHPA 3S37X 3U0PA 4Q2ZB 4UT9L 1XH3A 3LB6C 4JKPH 4YWGL 4PJ8C 4Z7UA 5K9KA 1EMTL 3VMNA 5SWSE 3CC5A 1FORH 5GS0L 2DKUA 4Z5RA 1U92B 3BDXA 3BUTA 4PJ7F 1CS6A 1HXMB 2E7BA 1EEYB 5GS2D 2HFTA 3F65A 3FAWA 1BLNB 2P8MA 1R5VB 1DLHB 4NQED 2FX7L 3IDGA 5I17A 3VFMB 2JELH 1LP9F 1MRDH 1PSKL 2MTPA 2VLME 4KUCD 5JA8B 3QEHB 1ETZA 2XN9B 5JUEH 3ARSA 4ACPA 3KPOB 4NZDA 5CWSB 1CE1L 3QAZB 3VA2C 3N85H 4OD2B 3EAKA 3C8HA 4V1DA 1FVCB 2D7TL 3MLRH 4UMGA 4YGVB 1BIIB 4KUZH 1YEIL 4N8VB 5EOCH 5EA0H 3P40A 3QIBC 5F9OH 4P2OD 5KVEL 2ADFL 1A4JB 12E8H 4K7FA 3HNVH 4R26L 5J1AB 5C0GB 5TFSH 1WISA 1D5BA 4JZOA 4YFLI 4NO0B 5DURB 5TF0A 3FO2B 5GPRA 4YDLB 5J3HC 3LKOB 1U92A 3INUH 5HY9B 3O3AA 2QSQA 1I3GL 1HILB 5EU7E 3ARBD 5EO1A 5KSVA 3ULUC 2R39A 4YHLL 3I6LD 4GRLD 1A5FL 3BYTA 3ZE2F 2P8PA 1N7MH 1FVDA 2XN9D 3P4LA 2RJMA 4FQJH 1TPXB 1PYWB 1NDMA 4U1IA 5FYJL 4DEPB 3BPLB 4JFFE 2CUHA 4OIIL 5EZIL 1SY6H 3BKJH 4JLRB 4AG4H 4BSWB 1RVFH 2GSGB 3TM6A 4ZFGL 5ESQB 3B9AA 2YD1A 2CLRB 3T1FA 2DYPA 3R1GH 3C6SA 1T2QH 2EDWA 3ES6B 2HJLA 3MFGB 4PBVC 3C2SA 1UKSA 4YH6A 3TBWA 5TF1H 4PJXF 4MDIA 3C60B 4KROD 5LCVL 4LU5H 1T5WA 2W07A 3EZ8A 3ARDA 4HIIA 3S5LG 4M6OL 1U8JB 4CW1B 1VGKB 1RY7B 4N8VG 1JN6B 4HIHB 3CC5B 4M62L 5K59F 4AL8H 2A9ML 1T6VN 4Q6IB 2X4NB 1D9KA 1HHKB 1PYWA 2EDTA 3GIVB 4GS7C 3WDJA 1INDL 1Z3GL 2ICES 4KJQC 4CGTA 4PLKD 1F13A 4GOSA 4GKNA 2CMRH 5LWYH 5TE6L 3RGHA 3MRKA 3ECBB 1FFNB 1CXIA 5MENE 4IRSB 5D8JL 4JVWA 4K8RH 1G9ML 5I1JL 1TVHA 3PXHA 4KMTH 5FCUH 1HKLL 3VXRA 3EOBB 1HQ4A 4Y4KB 1A3QA 5GZNC 4QXGL 5LGJA 5HHPA 4KGJA 4NNXA 3CDFA 4L4TA 4H20L 4PJDF 3MNWB 3MUHL 4K3JL 2GJZB 4NN6C 4OLYH 1S7WB 1J0HA 1TZHB 3RWCB 3QO0B 5C08A 4U6HB 3STLB 2BNUB 4PJFB 4GS7B 1UWEH 3ILPB 1CLOL 4EOWL 1QFHA 4HLZG 3ZT5A 2QHRL 3MUY1 3WS3B 5HI4D 2MMXA 3R8BB 3ZDYE 4QHUA 3RWHA 3QJFA 2F53D 3QR2A 4XP9L 2ZJSL 2E7LA 4LPTA 4NKMB 1S5HB 2LVEA 1QA9A 1HILA 1E6JH 1UT9A 4I0PD 5CZKA 3ZTJG 5MEND 4JANA 3RGVC 4DAGL 2OTPA 3FOLB 5F6IB 2P8PB 1GOGA 1KN4L 1N6QH 3D3VA 4G9FD 1RZGA 4WEMB 3F6IA 5I8OH 1A1OA 4YR6B 1WFUA 4J12A 4RIRB 3U0WH 4S0TD 1RIUH 3KNBB 2YPKB 5D6DA 3L3OA 3SCMD 3NACL 1VDGA 4F9PC 3F5WA 3AREB 4MA1B 1J7VR 2CO6B 4PD4K 4KUCF 1QPXA 1WWBX 1YEKL 4FABL 5A40E 4YNYA 1YEFH 3QPXH 1C08A 1U8OA 3FO1B 3HCVB 1M05B 1KBGL 3GMQA 4O9HH 4OZFH 4WV1A 4YHKH 1FE8H 5GGVY 2AV1A 3QCVH 1IAIH 5E8DL 5F93C 5TQ2H 1OM3H 4L5FL 1FBIL 1VKXB 1AIFB 2F19H 3VXMB 5L2JB 4Y7MA 4JZJC 5JNYA 1AC0A 4AM0A 3VXUA 3NABL 4NKMA 3RVUD 2YK1L 3MO1B 2R2CA 5JIPA 1RUKH 4WCYL 3SDCD 5JXED 2XTJB 1JI1A 1EZVY 3MCKB 3PGFH 1DQTA 1OCWL 4K71C 4YDLC 3V7MA 3CUPB 4NKIL 3TF7C 5DC9B 4HF5L 1FG2B 4JB9L 4LIQH 3SOBL 3OJDA 1A6AB 1FL3B 3P9WB 4MZ2A 4JDTL 4XAKE 5E94A 3T77B 1A6TB 2I5YL 4QRQB 4PJ7E 3QEQD 4ODXB 4CBPA 1U58B 1V7NH 3KLDA 3OKDA 4JFHD 1JTOA 3L5JA 3S96B 3MLWL 3QWOB 4O2EA 1U8LB 4R97C 1TDQA 4WUUE 4K7PY 5TE4L 3MV8E 4PRDA 4ELMA 3QDGD 3VXRB 3BUYA 4IOIB 4XB7A 3D25A 2QQKH 4FOMA 3S9DB 1NH6A 1U95A 3BPNC 5JR1L 2YEZB 3L9RB 4DUXA 4Q0XL 3LKRB 4DGIL 4JPVH 4OI7A 1MQ8A 4YHPB 5KG9B 4QXUH 4DN4L 2YS4A 3BKMH 3VD3A 2X9WA 2PO6C 5ENWA 3WFHB 3MLXH 3CFBA 3BP7B 4Y5XB 5D7LD 2ADGB 2P45B 1HSBB 3ZTNL 2EKJA 4PY7B 4XI5C 1CGSL 4FQQB 4NC1E 1ZWIB 4Y4FC 1BIHA 4E42B 1NLBL 3TO2A 1XGPB 4X0KA 4DFHA 3U79A 2YPLA 3UYPA 3IDYC 5BQ7B 5BJTB 4OCWL 4XMPL 5FA3A 4D8PB 1AI1L 4DUVA 2O5YL 5HHNB 3BD5A 5KSBF 1RMFL 2DQJH 2CUIA 3NN8A 3VMPA 5IB3A 2JJSA 3OKDB 4UILH 2VLLA 5C9JA 4JLRA 4PG2A 4JM4L 4QOKB 4XP4H 3QA3A 4I9WE 3GJEA 4RMVA 1YPZF 4XC1L 1FC2D 5F7DA 1RU9L 1IM9A 2I9TB 4K55A 3VFWA 4NCDA 3CDGB 5D7IB 1MQKH 2EH7H 3KPSA 2A6KB 3ZKMD 2EDKA 5FO9B 4TUKL 1L7IL 1ZV5A 1U3HD 1H0DA 2DOCA 5JTWA 3ROOB 1Q94A 4KKLD 3VA6A 3T08A 4PGEA 4R4FH 2WUCL 3EZJB 1O7VA 2Z8RA 3TV3L 1CE6B 4OJFH 3LDBB 1JNNH 5FYKL 3LD8B 3TN0B 1JGEA 3G5ZA 3LY6A 5BV7L 5BMFH 1QNZL 4QRPE 1A7OH 4JY5L 5DQ9A 3LEYL 4NUGL 4TTDD 1CDYA 3HC3L 2B2XL 4M4PA 3S37H 4F58H 1JRHL 2EDXA 1DQQA 2YA2A 3GIZH 3RWFB 1CU4L 4MWFB 3N9GL 5LJYH 1ZWIA 4HUWB 4QOKE 2XQYK 4Z18A 2P5WA 4HKZB 2JCCE 4WFGD 4Y2DD 4JJ5A 1OQOA 1CD1B 3KXFE 4IBLT 2K3TA 5GGSB 3DECA 3MODH 5HHOE 2ZUWA 2EXYD 4JRYA 1IFHL 3QRGL 3HE6D 5C0CA 4NJ9H 3WXVH 4LAQH 1QEWA 3O6ML 4MXWL 1WSST 3CLEL 4PRPD 3SDAD 3CSBA 3B4NA 1AO7E 5KSAC 5EIIA 3LRHA 3LQZB 5EOQL 1EO8L 4ELMB 2AJVH 3DMMA 4F3FA 3L95A 3BP5B 1MIMH 2DMKA 5JHDE 5KVDL 2HKHH 4WO4B 1CFNB 4C83B 1ND0A 1VHPA 3UAJD 4JO1L 3ALPA 3TO4D 2ARWA 2CDFA 4Z95H 3E6HA 3RKDC 2AK1H 4QHKI 3RX5A 4KDTA 1E28A 3IXAA 2GFBB 5DVNA 5JPNA 1P7HL 2O5ZL 1JGEB 2WIMA 5JW5A 2BVOA 4R97B 3HE6B 5E9DB 1J1XH 1N5AA 5F1SA 4YR6A 1P2CB 4LEXH 1ONQB 3ARTA 5HHQB 4OF3A 2VC2L 5I16A 4NZRL 5ACZB 1CVRA 2WP3O 4FZEH 4G8FB 1UM5L 4NSKB 3RDTB 2XZAH 3EO1A 2CLZA 2ERJC 3BE1H 5CUSH 3IDNA 3DMMB 3MJ7B 1C8PA 1IM9B 1YYML 4YC2B 1FAIH 1RZKC 3KPSE 4FXGA 2V9TA 4KKAD 4MA8H 5DJZB 2HRLA 4XCCL 2NY5C 4TSAH 3QFJA 3CU7A 5CZXD 4Z76B 2ZOKB 5BRZD 3FQUA 1CICC 3TBYA 5I66A 2NX5A 3QEUB 2J2ZA 2BSSA 3SKOB 3BGFB 3UROR 3P11H 4KJYA 3L7EA 4NRYB 5H35A 4ZPVA 1C5CL 3V5KB 1LVEA 2HYMA 1OP3K 4YXLH 3OG4B 4NFDA 4NHCL 2ESVE 4NC1C 3WFBL 2PTTB 4G8GE 2DQEH 2YUWA 5F6HJ 3TA3D 1I3VA 4UT9H 1YMMB 3OKEB 2DQHL 3B8SA 1MF2L 5C0DB 4QRRE 1JIBA 1WTLA 4JFPA 4S2SB 3MUGA 5C0AE 1ACYH 5EG6C 5EBMA 5J13C 1BWWA 1A7BA 3O8XA 4NIKB 3L6FA 4MSWB 1S7XB 5CJQL 3K4ZA 5MI0B 3GI9H 5DRZA 3CXDL 5CBEB 3NBNA 3QI9A 2R1XA 3WO4B 4YE4H 1CBVL 3REWA 3Q2CA 2IQ9L 5K9QG 1PSKH 5GIRA 4PPTA 3P4NB 4FXKA 3VFRA 3O81A 2GK0A 5E8EB 1M4KA 3LH2L 2BRRL 1TQBB 4BQ9A 2A83A 2JB6A 5DI8B 3V6FA 5I1KH 1DLHA 2J8UA 2K7QA 2Q86A 2WUBL 5JW4M 3O2WH 1HYRC 2FHBA 2VLRA 3MFFB 5IQ9B 5IVXA 1G1CA 4KUZL 5T3ZH 3TEUA 4AENB 1FP5A 3GHBH 5C0FB 1D5ZB 5D96C 3UTPD 3FQWB 3WHXA 5TFSL 4KJYB 4NRYA 2IWGA 1ZXQA 5FM5O 1B88A 1O7SA 4OF8A 2X4QB 4PGBB 2EYSA 3RZCC 3QJHB 3MGOA 1DN0B 4TOYL 5J1SC 4X9HA 3AREC 2BY0A 3ZYJA 1AGFA 2AVGA 4RX4D 4H26B 5IFAH 1RIHH 1KB5L 5DJ2B 4MA3B 4OM0L 4XNQB 3VFOA 2FJGB 3H9SA 1QLFA 4HKJB 1JNLH 3BEWB 5HYEA 1FIEA 3MOQA 4QHKJ 3U46A 4YDVA 4G9DB 1S5IH 4LKCB 5GRJL 3SGDI 1H8OA 4NKOA 3BKJL 4UQ3A 3GMLA 3PL6D 1CGWA 3MLUH 1LDPH 2QKIB 2OR7A 3M8OL 5IKCA 1QR1B 1EUTA 1UGNA 3LPGA 3C9NA 5DWUH 4NQDD 4U1GB 1KCLA 3RWJA 1K4CB 1QO3B 5TPWH 5D7JA 2L4OA 3WNNA 4IMKC 5IB2A 4YDIH 3DV4A 2BOBB 3WJLA 3W39B 2VR5A 2X9YA 3QDGE 2GT9B 2ED8A 3JWDL 1DQJB 1UQSA 1CXEA 3MLYL 4OF6A 2R2BB 4KKNA 5E6IA 3BKCL 4LCUA 1ODAA 2CLRA 3LZFH 1IM3A 5BVJA 3FONB 5HYIA 3WHXB 3VXMD 4LF3A 5AWNH 4E0RB 3LAFA 3GFUA 1A6VL 1JF1A 4U1JA 4X7DC 1R0AH 1KUMA 1G7MA 4J3UA 1CL7H 4NRZB 2NXZB 4NWTL 3CPLB 3AMLA 3G5XB 5IBTH 4X6DA 1OAYL 4Q9QH 4KK5C 5SWSA 1QSEE 5TE6H 1K6QL 4KTEL 4CMMA 3MRCA 5I1JH 1G9MH 2WK2A 5F1KC 5FO7A 4CVZA 5FCUL 1HKLH 4OCNC 2ZWLT 4WIQA 2CK2A 3JWNC 1Q38A 2FX7H 2OTUA 1YY9C 4NN6B 2HT2D 4UQ2B 4YPGA 4OZIE 3PGDB 4PGJA 2MQCA 3MYJA 2AJYL 1MIEH 3UJJL 5IVNA 2A0LD 3C60C 4BZYA 4DOHB 5JW5B 4EXPX 5KTEH 2APVA 3VWKC 2XV6B 1VCAA 3C8DA 1W0WA 3N85L 5ACMA 5DRXA 4N8CH 1LO5B 4HKBA 2D7TH 1LK3H 3P4MB 5I0ZA 4FQHB 2ZPKL 4NGHH 3ALWA 4ZAKC 3W9EB 4CU8A 5KVEH 1AFVH 4I3SL 5KVFL 6FABH 3P9LA 4OCMC 2R2EB 2OZ4A 1T04A 2BCKB 4WWKB 4PY8J 2JIXD 5IVZB 1MHCA 5CSGA 1TTUA 3NCCB 1A2YB 4LF3B 1DANU 2HWZH 2VISB 4N0UE 4UOJA 5EBGA 1BQHG 1OF2B 3FO2A 2OJEA 3T0WA 3NTCH 4MJIE 4MCYA 5DQJB 4I77L 4XBGA 5HGBA 3MV8D 1F4HA 2MFNA 3KPRE 2RIKA 4YHLH 1EEYA 4U3CA 5GS2H 3CXHJ 1G7LB 4I3GA 4YXKL 1RIUL 3QQ4B 1PG7W 3DSFL 4LP4A 1JWUB 2H2SC 5GGUA 4X4ZA 4EI5C 1KB9J 3BAEH 4LCCA 4OAWA 4XCFH 2J3SA 1NUNB 4ZO7A 1KCRH 4YJZL 4HJGB 2E27H 4PTTB 5D7LE 1BQHA 1K2DA 1KBGH 4M6NH 3CFEB 5K9QI 4B0MM 1LO5A 4HKBB 3TJHC 5JW4R 5DXWA 4YFEA 4PJCF 2VLMD 1O5DT 5ESQA 4ZXBD 3T2NH 3PDOB 4MNGE 4RCAA 2R1WA 5E1AA 4XPHH 3ARED 4JRXB 1BD2D 1J0JA 3CZFA 3NA4A 3QB7C 5I71C 2H2PC 2UYLB 4QYOA 4TUJB 4Q9CA 4V2BA 1OSZB 1DFBH 3KWWA 4IHOB 4WCYH 4WNQB 4P2YA 3DURB 4WTXA 4Y1AA 1OCWH 4NQXA 1ZT7A 2C4FT 1MAJA 2EDQA 4FQHA 3EYSL 3SE8L 1N5YH 3PWPB 4CDHA 3VXMA 1UM6H 3QUML 3QNZB 5IHZB 1SVCP 4HT1L 3GRWL 3QNYB 4JDTH 4MD4B 4PB9H 4U1MA 1TETH 4XVUD 2I5YH 4APQA 2HA1A 4JGUA 3S6CA 4MJIA 1WBZB 1NFIA 3IB4A 5SWSB 3L3GA 1Q8MA 1OW0A 5BRZB 4AL8L 2MHAB 4XNYL 1FL3A 3SJVB 4JHAH 4WHYG 2IGFL 2CK0H 3DOSA 1INDH 3TIEB 5DDHA 4S11A 4ZG1A 2E7HA 1L9NA 4OSUL 3N50A 4JQIH 4QHMA 1NBYB 3TVMA 1EFXA 3BH9A 4F80A 5GGRY 5I30L 4KMTL 2BVQA 5DSCB 4MVBD 5J89A 5JOPD 3HI6L 3KPNA 3R06B 5DK2B 1G6RL 2P8LB 2Y5TA 2HLFD 5IMOA 4IJ3B 4Q2ZA 5CCKH 3QDGB 1U8PB 3U4BL 2QBWA 2FEEI 2EXWC 3RGVD 2EH8H 2VWEE 1NLBH 4JFXA 4IOFD 3WFHA 1KLGB 3RKPA 2OMBA 1QRNE 4EOWH 2WANA 2O5YH 3QUZB 1PKQA 1S3KH 2QHRH 1WITA 4Y5VC 4M7KH 3Q6FA 2BHYA 3ARBB 4KI5F 1QRKA 3K2UL 1JNJA 3LKPB 2VISA 1S9YB 2VXVL 4FA8A 1FJ1A 3I2CH 1LEGA 4HKXA 5HGHB 4GQ9L 2HVJB 1ED3A 2A74B 2ICWI 1AP2B 1NANH 3TIEA 4AEFA 4O2CB 4UU9A 5L88H 1BOYA 4OFIA 4P2RE 5CWSA 1JYXA 3GSNB 5F70A 2VTFA 2VXSL 4G7YL 3F6LA 5D7JB 4PYGA 4XT1C 2ENYA 1A6WH 3RWGA 2EH7L 4ZS7H 1J9CT 1KPRB 4R0LC 4RWYL 2GI7A 3P0GB 4TUKH 1RZ7H 1UA6L 1YN6A 1JGDB 5TE7L 1K8DA 5T33H 3O11B 1UCTA 3WN5C 3NACH 1VACA 4HUUA 1WJ3A 5F96H 4QHMB 1JGVL 1AD9B 3MXWH 3SDCC 5JXEC 5BV7H 5BMFL 3RWEA 1BIIA 3ARFD 1FNGA 1A7OL 1OAUL 5D1XC 4JO3L 1FL6B 5E8PA 2F9BT 3WCYA 4Z78A 1IAKB 1F8TH 4O9HL 3GMQB 4PUBL 4TVPE 3ILQD 3QCVL 3VFTB 1IAIL 5E8DH 5F7YC 3VWJD 3UTOA 4PJAF 2D0FA 4P5TC 1R3JB 5JIKA 1YDPB 3GZKA 1Y6KR 3MGAA 3HMWL 5IV2B 1TZIB 3OKKA 1MPAL 3D0LB 3ZE1F 4GMSH 3AM8C 2BRQA 2HN7A 2W65A 3OQ3B 4Y16B 4LIQL 5L8JB 1JPFB 5DEGA 3DX7A 1LHZA 4OUUA 1BREA 3BO8A 5F7WC 2WBWB 4P2QA 3GMRB 4OZHB 2E9WA 2IAND 3T3PE 5DA0B 2GY7B 1WWAX 4X7TB 1DL7H 2YPKA 3GSXA 1CE1H 5HHOA 2VQTA 2I60H 5IBUB 2R1YA 2PW1A 2ESVD 4K3EL 1ZLSH 1AR2A 5J7CC 1CT8A 3UBXI 1P9MC 5CP3H 3C5ZD 2QQKL 4MLSA 4PJGE 3G5VA 4JE4B 5FUOH 1XR9B 5CEZH 2DYPB 2N7AA 4EDXA 2W0LA 1FNSH 4FG6D 1BD2A 1YQVH 2O5ZH 2FZ3A 1I1AB 1XGRB 2DAVA 1HE7A 4KK6D 4UAOB 3WJJA 2OSLB 1RQ5A 4PLNC 3MLXL 2ICWA 3INUL 1U8QA 2GUOA 4P3CH 3OKYA 2PKDA 1I3GH 1T1WB 4PP2B 3JV5A 1FVEA 5HVGB 4PGCA 4M61B 1HXYB 1S9WA 4K8RD 3W11D 5DRWA 4HCRA 2F54A 3V6OA 4G8GA 2VOTA 4JCMA 4HUXA 1AI1H 2VLJE 1YYMH 1GC1L 5KVGL 1OTUD 3X14B 5E70A 4OLXH 4OIIH 5F7EH 4LSQH 5B4MD 4D3CL 3D2UA 4P23C 1BF8A 1KGCE 1RJZA 1CD9B 1T3FA 4JY4B 5BW7C 5C6TL 3FOMB 4XC1H 4X7FC 4HBQA 4XGZA 1SEQL 2W92A 2W38A 1JPTH 4EEEA 1I8IB 4G8EB 3SDYL 4P5MA 2CXGA 4Z77B 1TTGA 3W0WA 3EDFA 1T2QL 1Z9SA 3X13B 2HRPH 3RWHB 4JQXC 1OY3B 1E4WH 4CAGA 4LSTL 1H0DB 3KLSA 4YAQB 1U3JA 4LCCC 1Q9LB 3D85A 4LU5L 3RPIB 5EIQA 3U0PB 4P46A 2DQIL 4OD1L 1XF5A 1XZ0A 4MS8D 1ACYL 2HFEB 2JJUA 2VAAB 3QT2A 4LCYA 4OFPA 5E8OB 1RD6A 4ALAH 5GRXG 4N9OB 4PGCB 2IFGA 3UTTD 2A9MH 1S9VB 2D7OA 3BH8B 1NGYB 1RZFL 3LMJL 3ZYZA 4YFLF 5I1EL 3CXDH 4ZOCA 3S3PA 3Q1SL 2XTJE 1R5VA 3S5LB 4MWFA 3NN8B 4NBXB 3CSPA 4DZBA 2QR0B 1MY5A 1EBAA 4ZSOE 3FQTB 3U4AA 1RJZB 1VB9A 3SY0B 4GKZA 3OSKA 5D2LE 2YBRA 5DD0L 2VUOA 2VYRE 3U1SL 4EVNA 4LHUG 5T3ZD 2WUBH 4G8EA 1X5ZA 1GGTA 4PRHB 3S36H 4F2MB 2J8OA 3RNQA 3P77B 3STZA 3O2WL 2OP4L 3O6MH 3AB0B 3ZKND 4MXWH 2P49B 4JFDD 2XZQH 1DVFC 3LN4B 1I7UA 3H9SE 4QXGH 3LIZL 5HDQL 4RMSA 1P84K 3PL6A 5HTSA 2FWOA 3PWNB 4TNWF 2D03L 5CKGA 4PJDA 3CAFA 1UWEL 4KTDH 5IQ9A 4XCNA 2HKHL 3VRJA 4DQOL 4ZMAT 4HD9A 1Q9WA 1XF3B 1S9YA 1ZGLA 3QG6A 5F9WB 3O3AB 1BOGA 1P5UA 3LKOA 5L7XH 1WIOA 1RSFA 4MJ6B 1NGYA 1U8QB 2GUOB 4WWKC 1ZAGA 5FYLL 4AT6A 4MZ3A 1MH5B 5IJVB 4DJMA 1KB5H 4OM0H 1MCOH 3EOAA 4DAGH 5SWZE 1YC7A 3VFVA 4LLYB 5HYFA 3T3MF 5F9JB 3DJ9A 1IAMA 4O2EB 2HT4D 3WUWA 1N6QL 4JFDE 2NW3B 2EO1A 2ATPB 4J4PA 3CMGA 2R2HB 3L3OB 5J6GA 4ZUUB 1HSAB 1N0LA 1LDPL 5BOZG 1IGTB 4IOSD 2MOVA 3EO1B 4NPYB 1I4FB 3SKNB 5I8CB 1GOHA 3DBXB 4N90D 4U6VL 5D1QC 4OZGE 4PRHA 1EJOH 4UINL 3T1FB 3SDXA 2E6PA 4NJAH 4ENED 4FQQA 1YY8A 1BJ1J 2WQRA 3WE6A 3VD7A 3BP6A 3K3QA 1J8HD 1C1EH 3B43A 4QHNB 2H26B 3FT4B 3ULUH 3IYLW 2GW5A 3C60A 3OAZH 4MJ4A 1FBIH 1AIFA 2NX5B 2W60B 4UB0H 2ZG1A 3NABH 3U6RA 1AGCA 1ULVA 3H3PL 5K9OB 3PQYA 4MAUH 4WI9A 3W11C 5I75C 1MCCA 1F58H 2HFEA 1CL7L 1OAXL 3D87B 4NN7C 4X0KB 3D39A 4ISVB 3SOBH 3HZMB 4HULB 1JZ2A 5I1AA 1OTUC 4BUGA 2DQHH 1OAYH 3NCFB 3GMRA 4OZHA 2OTWB 2DLEA 4JGMA 5IEKA 5B4MC 2X42A 3UPAA 5I16B 4OUOA 5DMKB 2NY0D 2VH5L 1QRND 1CI5A 2YD9A 5CP3A 4PJEA 4HZLA 4YHNA 1MWAH 4NSKA 4NDMA 4QRTB 2FIRT 3OF6A 1TVHB 3GI9L 3QIWB 4HK3J 3MV8A 5KN5B 2BVUA 1ZT4B 4GSDL 4G6FD 1N64L 2IQ9H 1JV5A 1KC5H 43C9A 4Y4KA 3ARQA 2A6DB 4P23B 2NX5D 1NBVH 3KYOA 1TVBB 2AXGA 1NEZA 1QYGL 1MIEL 3CFIC 5IQ7L 3F7VA 4QGYA 3B2VH 1T7ZA 5EPMA 4EUPG 5I1KL 3O41A 3O3UN 4NQTA 1LK3L 4U1HA 5FGCE 2KZ1B 2VN4A 3ILPA 4BFIB 2IMMA 1QTYT 2XI9A 1L6XA 4DN3H 4I3SH 1PY4A 3GK8H 4G6MH 2YHGA 2ZKHH 1V3MA 1I9JL 3NVQA 4PV8B 3WEXA 3E6FB 5HGAA 2Q6WB 1F6AB 2HWZL 4LPVA 3TBVA 1W0VB 1UH2A 2NZ9C 1YYLH 3BYYA 3VG9C 2DQJL 5DMKA 3JTSA 3VXPA 4GRLA 3MV9A 3QUXA 3VFVB 1DLFL 5E00A 1T04B 4X4MA 4WW2A 2APFA 3E3QC 1EX0A 3MPCA 4NKDA 3BAEL 3QH3B 3K7UA 4UBDD 4Q97A 1P7QA 4X80H 3TZVB 1MI5E 3T04D 1B90A 4PLOB 4OV5B 2NY3B 3W0WD 1A9BB 2JB5H 3D69A 5F7LB 3PWPE 3IDUA 1UXWA 2DM2A 4ZNCD 2APTA 1VFAA 2OR9H 3QISA 4KAQH 1CE6A 3WE6B 3HC0A 1P69B 3GSQB 3F7VB 5C07A 1X5KA 2D7NA 3VXUE 4LDOB 3IAPA 1CGYA 1U0QA 3WO4C 3V0WL 1K8IB 4APQD 3BPCA 4J6RH 5ISZE 1GZQB 3LEYH 4NUGH 1KPVB 1HH6A 3PWUA 2XOTA 5CJ8A 1D9KD 2GK2A 2EYSB 3JWDH 3I6LE 4HX1A 2R1WB 3I9GL 4RFNB 5E1AB 1X5HA 3TIDA 1CGVA 2G60H 1I1CA 5KS9A 3FQTA 1ZSDB 4IMLB 3MA9H 1TETL 4Y4HA 5BVJB 5F6HI 4HS6A 3ULVE 2C9AA 3S4SB 4YHML 4HS8L 5CJBA 2IGFH 1KCSL 3HE7D 3PWPD 4JKLA 3SKUD 1PX4A 2F53E 3WN5B 2EICA 2YOCA 5GISH 1JHKL 4L8SB 3VH8G 4I18C 2XRAH 2OX5A 1ZT4A 4KMLB 4NZJA 5FDWB 3ES6A 3M45A 4XPGL 5DJZA 2VMFA 3VRJB 3IT8D 2AW2A 2VDNL 5KVDH 5DK3A 5C0EB 5DS8B 3BFOA 4MDIB 4NFCA 1A47A 2EO9A 5ENWB 2CKBH 3PDDA 2NY1B 2QQLL 4R9HA 3IDJB 2VDOL 4NO0D 4M5YH 3LEXA 1ZGLM 1MCQA 2VUYA 1A6PA 4G6AD 3MRRB 3VFPB 3PGCB 4Y5VB 1U8MB 1QBBA 3O6FD 2NY6B 4RX4A 5BZDB 4NNYB 5FM4A 4HC1H 3MUJA 5FYKD 5DRXB 1CWVA 4LSRL 4JFFB 1MCRA 2ZPKH 4NGHL 2ATPA 3MCG1 5IB3B 2XICA 5TGBB 2VC2H 3P4NA 4EI5D 1AGEB 4PBXA 6FABL 1ZHBA 1GC1C 4LLVA 3FRPA 5CBAB 2EC9U 4JG1L 3G5XA 1UM5H 3I6KB 1BVZA 1Z9OA 4OZFA 1A3RL 5EZJA 4W4OA 1QSEB 1T20B 2I25N 1FJ1B 1L0YA 4JVPA 5DR5H 4AK1A 4I77H 4HUVB 5FO7B 1UA6H 3OGCA 2ITDA 2YD4A 4HLJA 2EYTA 1F2QA 5DJ6A 1NGQL 3VFUA 3SQBA 2J8UE 5D71H 2H2PD 4FFVC 1H5BA 2IBGA 4OAWB 3G5ZB 4X5WB 2Q1EA 8CGTA 1KCRL 3TN0A 4JO3H 5EOTA 2DRUA 5C0EA 4PRNB 5C7XL 1EJ6A 1UH3A 4Y88A 4M1DH 5F1IA 3J7HA 1CIDA 3CVHB 2AJZA 4P3DB 1LE5A 4HUWA 5C0IA 2HFGH 4TVSa 1YEHL 2ATKA 1XFPA 3BGAA 4DKFL 5D6CA 1U8MA 5I19L 1DFBL 1OSZA 2MSPA 3L5WB 4GMSL 5C0CE 5KJRH 3GHEL 2ADIA 3E0GA 1C5DA 4IS6B 2YA1A 2R8SH 3DXAD 2XFXA 3GUTA 1XGUA 3OAZK 1XR8B 4PJXB 4X7SL 5GIRB 2X4PA 5DHVB 3LH2H 5DUPL 3KPRA 3C5ZA 5CGTA 5M7QA 1JZ6A 3OG6B 4WFHE 5DRNB 3MSPA 4ZDHB 4X6EA 3M1BB 3SGDH 1ZA6A 2AJ3B 4Z7VE 1PLGL 3HAEB 3LRSA 2IBBA 1VEOA 4XNYH 4ONHB 1ZLSL 4JRWA 4KV5E 5T3ZL 3OGCB 4TTDC 4LLWA 5C09A 7FABH 3BN9D 3SDCA 5JXEA 5L8LB 4C57C 4U6YB 3GGWA 1FNSL 1NFDA 5FYKU 4HH9B 3V4UH 4F7TA 2QQQA 4ODTL 1ZTXL 3O2DA 4X99A 3I75B 4Y2DC 4FQLH 2GJJA 4LASH 5F71A 3HI6H 5CMAB 5CGYC 4K7FB 2CR3A 4TOYH 5HGDB 2CD0A 5FGBA 4LDLB 4PY8I 2E3VA 4AH2B 1N26A 3WD5H 4QXTB 5ESAB 3IDYB 3U4BH 4PGDA 4PJHA 3C6LD 4ZAKB 5HHQA 1KXQE 4YHOL 1Z2KA 3DUSA 5BXFB 3EO9L 1A21A 1C7TA 1MCNA 2BNQE 4XVTH 3RVTC 3VWKB 5ABDE 1GCFA 5E99L 3ARVA 4G5ZH 4TNVK 3K2UH 3IDGB 5DJ8B 3SE4C 5IF0A 4XPFL 3I2CL 1IGFH 3LKRA 5HGHA 1RV6X 4QWWD 4CMHB 1NGWB 4LLWB 5GSVB 1RHHB 1BP3B 5DWUL 3C9NB 3X12B 3NZ8A 4JO2H 4PRID 2F74A 2YWZA 4ZS7L 4V1DB 3UTQA 3ZDXF 4D0BA 5EWIL 2Y6SD 4LSTH 3B5GA 4JQVA 4ZPTB 3SE9H 3QPQD 3A67H 3BKCH 3MRDB 2PYEE 3VU2A 2WBJC 3U36A 4YDJA 1XF4B 3OKEA 2ADJA 4OD1H 4FZ8H 5D7KD 4Q9RL 4ELME 2BNRB 4Y2DA 4ALAL 1CFTA 3C09B 4XP5L 4BH7B 2V5YA 4I3RH 4PP1C 1RZFH 1L0XA 3LMJH 3Q1SH 1UZ6F 4XC3H 3QUZA 1KJ2B 3TZVD 4F37F 4X9FA 4Q9QL 3PQYD 1LEIA 4KTEH 4JREB 2E7LC 2N56A 1Z5LA 1Q9KB 4I4WA 3U1SH 1X4YA 2EDFA 1CDGA 1NFDF 4M7LT 1ZVSA 2OL3B 4U0QB 3UJTH 1T83A 1UZ8B 3AUVA 1TJHL 1KV3A 1FN4A 5D93B 3GSVB 3BQUD 5T1KD 4XNZC 5FF6B 5H8DA 4MA1C 4MXQC 1KXVC 4G6FB 5GGQL 3SE4A 2AJYH 3TA3C 5GS1B 5E6ZA 1S7VB 4TSBH 5DQ9B 5SWZB 4KTDL 2JK5A 3TCXA 4DQOH 2BNRA 5D5MF 2PW2A 4NNXB 3EYVB 3MRGA 3WNPA 1YMHA 4CKVX 2FIKB 5L7XL 4K94L 3RGVB 4RRPG 3MYZA 5KVFH 2Q3AA 4RAUB 3KYMA 1JZ3A 5FYLH 1MVUB 5KW9L 2WBJB 5FUOL 2F53A 5CEZL 1LNUA 1H15A 3VXUD 4JFQB 1LE9A 4GAGL 5C1MB 5A2IH 2R56L 2LU4A 2X89D 3DROA 3G6AB 4HS3B 4N1HB 1JL8A 3CX5J 3HLAB 3IJSB 4HK0B 1HH9B 2DWDB 1CK0L 1OW0C 4YDVB 5DF0A 4LBEA 5D96B 3T0EA 4RFEA 1X6LA 2X44D 1G7LA 2X1WL 3PHSA 4YXKH 3VFMA 1UXSA 1Y18B 3RDTD 4ZFFA 1RZKL 5DEGB 1OWRM 1MREH 5D70H 3HPJA 2CO7B 4YIQA 4M8VA 1QFPA 4UV4L 1J05B 2VIRB 2VLRD 4M7JL 1PZUB 2O61A 1EJOL 3HZKA 2X4SB 2AK4E 1PBYA 2ZCHH 1BQHB 1EEUA 3QDGA 3OKLA 4X4XB 3ROLB 4D3CH 1GPOL 4S1SL 3ULUL 1UACL 4GJTB 2C26A 3TA3A 2P5EB 1JPTL 4GXUN 4OF7A 4DWHA 1Y6MR 1CG9B 3KYNB 4MNHA 3SDYH 4MB4A 1S7VA 4PJXE 3PJSA 4YBHA 3MRBA 1F4WL 1MFEL 3T4AA 4PJHF 2ID5A 2PYEB 5DHYB 4JEGB 5I2IB 5AEAA 5EN2B 4Y2DB 3EYSH 3SE8H 1LEGB 4HEPG 4HKXB 1DQLH 4QTHB 1NAMB 1N5YL 1MLCB 5DFWH 5DHVA 5T1LD 3IJSA 2P7TA 4RA3A 2NXYB 3MO1A 1MVUA 4KJWD 3AU1A 2JKXA 1OT2A 3WIHA 3FRUB 4MJIB 1EIBA 4YEFA 3FJTA 2VH5H 1ZA6B 4P2RB 1Z6JT 3VXSA 2QSTA 1YEGL 2VLRE 4H0GA 2GJ6D 4CMMB 1TCRB 3EDEA 3FAXA 1NL0H 1T80A 4I18A 1RZGB 5A2FA 4HK0A 2CK0L 5I1EH 5FK9A 1FLTX 2BSSB 2C1OB 2VL5B 4X7EC 4NO2A 5JDSB 2WNGA 4E9LA 4OSUH 1QYGH 5HI5D 1Z0MA 2E9IA 1OB1B 4F7TB 4BSWA 1B4JH 3F5WB 3D18B 5FF6A 2BXZA 3B2VL 5HHMB 3ZYIA 1EFXB 3MYJB 5DD0H 4NO3B 2EDLA 3RWIB 2X05A 3NGBB 2OP4H 1UB6A 1MHPH 3DIFB 15C8L 1ITCA 3L9RA 3BDYH 3TBWB 2D4DA 2XXCB 1MLBB 3GK8L 4ZAKA 2XWBB 3PL6B 4QRRD 2EH8L 4HC1A 3W9EA 2ZKHL 1I9JH 1NBZB 2W9EH 3EO0B 1ZGLP 1CG9A 1Z0NA 4KK5D 1FSKC 1OWWA 4PLKC 5AZ2H 1YEJH 3MJGX 2CUMA 3IVKB 4HDIA 3IETB 3GMMA 3VD4A 2YRLA 2MQ0A 1S3KL 5HHXH 1VGEL 4JFQA 4CN4A 1I9RH 4MCYB 1Y0LB 3MRIB 2VXVH 2XXMB 2R0KH 4PV8A 5DQJA 2EIBA 4M93B 4PJ9C 5B22A 1NC4A 2PCPA 4XWGH 5E94B 3KYKL 3T0XA 2IANE 5IB4B 1IQWL 3CLFL 3CX2A 5C9JB 4CUCA 5IOPA 3LEVL 3RL1B 3S96A 3DX7B 3MR9B 4DVRL 3C2AH 3B5TA 1P4IH 1RZ7L 2JB5L 4JFDA 3EOBA 4CADB 2OLDA 5T33L 1FFQA 1I85C 4WI8A 3FQWA 3WNOA 2VZUA 3UCRA 1DQML 4KAQL 4EDXB 1TXKA 4JY6A 1D5MA 5ID0A 3B9VA 4KWUA 4PRBB 5MEQA 2PW1B 2X4TA 3QJHA 2LU3A 4OCYH 1HYSD 4U6VH 1KYOJ 4DK3A 1CFSB 1O0VA 1GIGH 4NQCE 4PGEB 1GOFA 4NJAL 3Q3GA 3ULVC 3KPQB 1FIGL 1E6OL 1IAKA 4N0FB 3RJDA 3SN6N 3H9SD 5AAMA 1TVDA 1N2RB 4DFIA 3MA9L 3NIFE 3KR3L 1NGPL 3IFPA 4NZUH 3QUMB 1A1MB 3T3PF 4ORGB 1G7HA 3BISA 2A2QT 3H3PH 4NCC1 5HPOA 1MPAH 4HG4K 3IKCB 3X14A 1AY1L 3MRJA 3GI8L 1QFWM 4YHMH 4G9FE 4HS8H 2VLLB 5TH2A 1OAXH 3SJVA 1PD6A 3KPTA 5DRWB 5KSAA 4X6CF 1NCBH 4PG2C 1KLFA 1ZLUH 8FABB 3OXSB 2XRAL 4IRJA 3V6BR 3UBXA 4XPGH 3WIIH 4F33A 3X11B 5IOPB 2CXKA 3WJLC 1UWGH 4WWID 4N8PA 2GT9A 4KRLB 5IR1B 3BH9B 1MWAL 2XWTB 3RVUC 1BFOA 3U7AA 3FO0H 2QQLH 3KPRD 4LARL 2C5DC 1AH1A 3DHMA 3CFJB 4L3ED 2VDOH 4OFYA 3LKQA 4UIKL 5GGRB 3L3HB 3BD3A 4HWZB 4PJEF 4KRPB 1FLRH 1YQVL 2NZ9D 4XZUB 4RFNC 1QUNA 2JIXA 5DHXB 1CQKA 3U9UA 2ZZUT 4RMWA 4L1DA 2VLKD 3DX8A 5EO1B 3TCLA 1I1RA 4P3WA 4P3CL 4QT5A 3I6GA 4JFEB 4LLQB 1AHWA 5I0DA 4ODUB 5MEOA 1H3VA 4G9FA 3O45A 1JJUA 2V2WA 3GEWB 1W8OA 3KPMB 1ED3B 2V2XB 3H7LA 5HSFA 4CVZB 3K8KA 4PJBE 5D7KE 3UTSA 2YZ1A 4QRQA 2ILLA 4UNVA 4OQTL 2BSED 1RJYB 1TENA 1P2CA 4KV5F 5T3ZE 8FABA 3BGMB 1F2XK 5C6PB 2IQAA 1QSFD 3X11A 1FFOB 3OR6B 4K3DH 3KJ4C 5F7EL 4OLWL 3WLWC 2VZVA 4L3EB 1BZ7A 3KLAB 5CJXC 3BIKB 3QFJD 3U0TA 2YMXH 4MNHB 1EFXD 1KB9K 2UZIH 1P4LB 1G7IA 5HHVL 3DTXB 2R0LL 3TO4B 5IG7B 1H3PH 3IGAB 4MA7H 4HUVA 5C2BL 3QCTH 1XIWA 5J6HA 1CFNA 5HDBE 1FL6A 4D0DA 1A9BA 1HEZB 2ADGA 2ZUTA 3SKOA 3U82B 4Y5XA 3CFDA 3KPQA 3SDXF 1UWXH 1TCMA 2QEJA 4X5WA 3D39D 1JWMB 1JN6A 3I84A 2NY3C 3WDIA 1KLUA 3DVIA 2BERA 3V0WH 1BFTA 4J6RL 5HJ3A 5D2NC 5JOPE 3VWJA 3T2OA 1GZQA 5F7UA 1EEZB 1XT5A 1RJYA 1SYSB 1CLYH 3OB8A 2W65B 3PWUB 4X7SH 2PTUA 2DJ4A 4QLRA 2G60L 3F7PC 5F44A 5JIHA 4ODVL 2F58L 3O8XB 5E8NB 4YQXH 5F1NB 2HT3C 4ONOA 4MNGA 4OZ4B 3VFWB 4PG9B 1S9XA 3H42L 5K33A 2ARJQ 3MJ7A 5FGRA 1WFOA 5DK0A 4H1LA 1FRGL 3QIWD 5I1GL 3TBSB 3O4LD 1TMCB 3L3KB 4KU1A 2B4CC 3FFDA 1TJIH 1KCSH 3DXAB 2XZQL 5F88B 3BZEA 4XCYB 3IDMA 3F12B 3LIZH 3JZ7A 5F9DC 7FABL 5KSUA 3ARGC 4WI5A 3SKNA 5I8CA 3NFPA 5I74B 2LU7A 3RWCA 1OAKH 2D03H 3DO7A 1FGVL 3V4UL 3VWJC 5H35B 1HI6A 4WFEE 5HVHB 3HR5B 4NN7B 2DTSA 2BOCB 5F6IC 1IAIM 1FV1B 4LP5A 2Z93A 5DYOA 1CFBA 1D5ZA 1ROWA 1HHIB 4HLZH 2ORBL 3FMGL 2CKBL 4M6MH 4P46C 1K8IA 1XIWC 2R69H 4YZFF 5DFVC 2EXYC 3QDJD 3WD5L 2P44B 5E08L 2MJWA 2R29L 3V52H 1JYNA 1BLNA 2K7PA 5CZVH 3V7AE 4YHOH 1MRCH 1RK0A 3JBG7 5F1OB 4KK8D 3RIAK 3KXFD 1X5GA 4Z7WE 3ZSTA 3ORJA 4XH2A 4NRXB 4E41E 5E99H 5ITFB 3MBEA 2R1XB 4LOUC 3GB7B 3UTSD 2CQVA 1AO7D 3DVNA 3QCUL 2HVKB 4RQQA 3MJ8B 5E8EA 3MV7D 4EBQL 2N4IA 2NYYD 4PRBA 5F3BA 3F12A 2BVQB 5DSCA 3KLHC 2LE9A 4JG1H 1QSFA 1OGAE 1T83C 1A3RH 5INDB 2FECI 2Y5EA 5JHLL 5JO5B 2A6DA 5DR5L 4R4ND 1ZLUK 4BELD 2B20A 4XCYA 5IMMA 3QNXA 4WDIA 1KENL 4R8WH 4X6BB 5E2TL 1NGQH 1CLCA 3FQRA 2NY2C 3BWAB 5TDPA 2FD6L 1RIVH 4GXUM 4UV7L 5FECB 4HIHA 4Y8AA 4N0RA 1QPPA 2BSRA 2P1YA 3OL2A 4I3RL 2UWEA 3HG1E 4ZO9A 2HKFH 3SJVE 3U48A 5I1IL 4TVPH 1FNAA 3HZMA 3U36B 1S9VA 4NYLA 3E6FA 4NFBA 4NOFA 5HPMA 3D3VE 1F90L 1N5AB 4YWGH 4U1KB 3QHFH 3GSWB 4GBXB 5DJXB 4JDZB 3UX9B 1P1ZB 5SX4I 3V0VB 3QH3A 2R23A 4YZFE 2WP3T 3CSYA 3S34L 2OI9B 3T2QA 5BCAA 5LQBL 2CRZA 4QNPF 5IEHA 5FYKE 5KJRL 3LKSA 4L1HA 4NO5B 5T1LA 5CEXB 2C7UB 2B8OT 5KOMC 2EC9T 1WIPA 4OBRA 1NKRA 1DCLA 5GS1C 4PG9A 5B39B 3O2DH 4LLMA 1BZ9B 1KJVB 1F11B 5GGQH 3HB3C 3B9KD 3FQUB 3QXVA 1ZE3C 5IQ7H 3QWRD 4Y4FA 1FZMB 5I75B 1NLDL 1HNFA 4FTVE 3PWNA 3BP4B 5ISZD 1EXUB 3A6CL 1HH6B 1JHLH 3H3BC 1SJVA 1X3DA 1NC2B 3BSZH 4LHJB 1FV1A 4QF1B 1E4XL 1LO3L 3TNNB 4G6ML 3QDME 3L1OL 4JRXD 3U2SA 3EOAB 3O3EA 3OKNB 3QZWG 3KAAA 4HWUA 5GGTA 1NKOA 1YYLL 5IBLC 4QOKA 2EEBA 1IVLA 1MJUH 1UWXK 1XAUA 3MRPB 2Q7NA 1DLFH 4RGNC 2P47B 4UUJA 3VE0A 1F3RB 3EIFA 1LGVA 4CNIB 1RZKH 1MREL 5D70L 3ARGD 3QUYB 3MNVB 4X80L 3NFSH 5D7IF 1A4KA 2AP2A 1A64A 4KI5D 1JPST 5J12C 2JJTC 3CU1A 4LHUD 1EHXA 2VDKL 4FQXB 4EN3B 2GEEA 2FJFA 5EZIH 2IG2L 4YPGB 4CMHC 4NC0B 2NTFB 4Z9KB 2OR9L 1XMWA 1F3JB 43CAA 4JZOB 4QHUB 2Y4SA 1DEDA 3D1MC 1ZHNA 2R9HD 2GTZB 5E2UL 2W60A 5MEPA 1F4WH 1MFEH 3JVGC 4JFHE 3RWDA 4OZHF 3RIFK 4NUJB 2B4CL 1P7KA 2OJZL 3QIUB 3CIQA 1LP9E 2P5WB 4F7EA 1GVIA 2IALB 3HTLX 3HA0A 1NAMH 4HBCH 3BRDA 1SYVA 4QXTA 4FZ8L 4Q9RH 3I3BA 3MRNB 2MKLC 1U58A 3N1FC 5DEZA 4U1KA 3H3KA 3X17A 2YXMA 5DGQA 1E0OB 5IROC 4BH7A 3S4SA 3MRQB 4WJ5A 5DMGD 4ZTPL 3O3BB 3BQUB 3G08A 5T1KB 3AU1B 3PNWB 4XC3L 4O4YL 1I1YA 1I8IA 2BNQB 3OV6A 3QHTC 1T0MB 5I6XC 3HR6A 4J23A 2CPCA 1JUFA 4Z0XA 5AG9A 5SWZD 1ND0B 5IKCB 1QR1A 5IIEB 1V8HA 2LVCA 1AKJD 3QG7L 4PJCB 3O4OB 1EO7A 3QFDA 3U7YH 4LGSB 1TJHH 5FV1L 2CRMA 3DV4B 3L7FA 3S4SG 4U1LB 1UADC 4OGZA 3SQOL 1CDBA 1W72L 4HAFA 5ISZA 1HCVA 3JUYA 3RWIA 2UZXB 5BV7B 4XPTH 4TNWK 2E6JA 2Y5TB 3FB5A 1M6OB 2GTZA 4D94A 3BH8A 2HJFA 3MREA 1CLOH 4YDJB 1A6TA 2ZNXA 5HHNA 2VZTA 1VGEH 3K8MA 5CHNA 5D1XB 3S5LA 3H9HA 2R0KL 4K94H 3GJFB 3EO0A 2FECL 1UM4H 1Q1JL 4OT1H 1U8KA 2G5BB 1IC5L 4DCQB 1E6JL 3ARBA 1YNTB 5EH1A 1N59A 1QFUH 3JWOH 4QRPD 5E2JA 4L8CA 3B5HA 1T0NA 1UCBH 3M17A 3C2AL 5C92A 4U7KA 1CK0H 4ZXBC 3OHXB 4UNUA 3JUZA 3D69B 1EGJA 5C9KA 4WTZG 4MXVE 4PJFA 1EO5A 2A77H 2YUZA 3AY4A 4N1CA 1EHLL 4L9LC 3RVVD 1FH5L 3VI3F 4GG8B 4OCYL 3WXWL 4M7JH 4FABH 3CK0L 4X8JB 4JPIB 1R3KB 1E6OH 4YHIB 1PY9A 2KPNA 2GIYA 4KJWC 3DRTB 4S1SH 4DZ8B 1F6FB 5FHBH 3JV4B 1IGYB 2F19L 1MAMH 4ETQB 1ORQB 4NZUL 1KLGA 1YEHH 3NCBB 1Q0XH 4IRSA 3WUWB 2BNRE 2YK1H 4Z78B 5I19H 3CFKA 3VWKA 2EE3A 4XBPA 3RTQC 4POYA 1QACA 3GI8H 4S1RL 5CBEA 2H6PB 4NKIH 4LLMB 4JB9H 1YA5A 3VD9A 2WSKA 2ZUXA 3KPSB 3LCYA 4PRHD 1PJ9A 4U6XB 4N0UA 3PIQB 5DUPH 3BQUA 3G08B 4MVBC 5T1KA 2XTLA 4C56A 1MFBL 1QFOA 1ZOXA 4RFEB 3EW3B 4X9IA 1KIPB 2VXUL 5C08B 3STLA 2LTQC 3BP5A 5GZOC 1V7NL 3QUZC 3VGGA 3HRZB 3IXTA 3ZLQC 4PRIE 4BQ6A 3MLWH 1PLGH 1NL0L 1EUUA 1J88A 3FO0L 2MCPL 5L2JA 1K8DB 3OHXA 1WWWX 4OZFG 1ZT1A 4MXVF 3MRDA 5ALBL 3DGCR 4ELKA 1S7RB 2I9LB 1XF1A 1S5HA 1FLRL 4DN4H 3IJHB 1NFKA 4GRMB 2VDML 5EZLA 2EE9A 1HWHB 4W4NA 3MRRA 3VFPA 5AZEH 1VEMA 4QYOB 1KFAL 3VGEA 5ANMB 5EU4B 1LO4H 1MCJA 3CFKB 3GJFK 1T21A 3PJSB 1EPFA 1XCTB 5IW6B 5BVPL 4D0CA 2Z9TA 4RIRA 3RHWK 4H26A 5CP7A 3NCYP 3NAAH 1LO0L 2F5AL 4PJIB 2P46B 2W9EL 2R0WH 5DD3L 1U8LA 3EO9H 1A0QL 3PWLA 4APQB 5FYJD 2NNAB 3BUYB 1YECH 4IOIA 1RMFH 2CGRH 3TT1H 1ES0B 2YN3A 2IANB 5EC2B 1M05A 3HRZA 3IXTB 4UILL 2CIIA 2P24B 1NEUA 2ZSVB 3KYOB 2MCG1 4OLWH 1KYOK 1IGFL 4TVPD 1NMAL 1H8NA 4TSCH 4S1DD 2ENSA 2K1MA 4HUXB 4XWGL 1CTNA 1D5XB 2YMXL 5I6XB 1ZHNB 2A1WL 3ALXA 4NNPL 5C0AD 4PJBA 3GM0A 1H3PL 1OARL 4P2QE 3LEVH 1MQKL 3VCLB 3DX9A 3MXVL 2ZUQB 3DYMA 3IJYA 1MAKA 2HP4A 4J8RB 1IC4H 1L7IH 1A7RH 5ANMA 5IMOB 1EAPB 3SE9L 1I7TA 3DGGB 3MMEB 3TJEH 4E41B 2GYSA 3BW9A 1RZ8A 4OJFL 4PREB 5F1IB 2EDBA 2DQTL 4NWUH 4OKVB 1DUYA 3GO1L 5DJCB 4HWBL 1QNZH 1KCKA 3I85A 3MV9B 4PJ5E 2FH8A 2RFXA 1F3DJ 3CPLA 2AGJH 1FIGH 1KB5A 1EFQA 1P6FA 4M5ZL 2NY1D 2W9DH 1KEMH 4N5UA 3TWCL 3N9GH 3NCMA 4OCXL 4RNRA 3LKNB 4ODVH 1U95B 4P0DA 3WUWG 1XGUB 4JDVB 4M93C 2VQ1B 3QUMA 4PJ9B 2WINB 1FZKB 1I8KA 4WI6A 4FFVD 3LQMA 3UJTL 3MGTB 3ARRA 2Y72A 4M02A 3C5ZC 4X6EB 1JK8A 1TJIL 3SPVB 5IFHL 4U1LA 4ONHA 2FEDC 2FLBT 5J1TC 3HAEA 1J1OL 3HC0B 5FYLE 5E8NA 1EA9C 1EK3A 4OZHE 3O11A 2EDJA 4F2MA 5C8JA 5JZ7D 1W0WB 2ZUSA 4QCIB 3AS3A 1WZLA 4JPKL 1SJEB 1NGXB 4A2MA 4R7DB 2UY6A 3VW3H 1NFDB 5E5RB 2Y1VA 1UWGL 4Y4KD 1RJLB 1EVTC 4X6FB 3TIDB 3MLTA 2R69L 2Y07H 1YEEH 4CJ0A 3BZ4A 4Z95L 5E08H 2DI9A 2R29H 3V52L 1AKJB 2AK1L 5EU4A 4HWBA 4UIKH 5EO9B 3F8UB 5CZVL 1G7QB 4LFHD 1NGZA 5CD3A 1M71B 4U3HA 3TGXA 4I0PA 4NQDE 3LS5H 3L5IA 2GJ6E 4X6DF 3BEVA 4Z7UE 2JB6B 2LAGB 4EI5B 2D31A 2G9HA 3QDHA 4GKSA 5CSZA 1XF2A 1IEHA 4GKNB 2VITB 5DJAB 2HLAB 5GGUB 4P2OC 3BN9C 1SY6A 1YN7A 5ITFA 3BE1L 4LRNH 5DEFB 4UV4H 4HPOL 3T0EC 3PP3K 4FTVD 4XPAH 1YMME 4YBLB 3DVNB 3ARXA 1KEGL 3W39A 4K3DL 4KDVA 4XCCH 1QLEH 2Y9RT 5FKAB 4EUPA 1IGTA 1KELL 1UACH 5E9DD 3V0AC 3S36X 5C0NC 3WYRA 4R96A 5IUSA 3CZFB 1PFCA 1KSRA 3VXQB 3C6LC 5JO5A 4PJFF 4L4JA 2VO5A 2FD6H 3WS3A 2M8XA 2Q76A 1ZT7B 4JRYB 4GUPB 1DUYB 3DARA 1J18A 4WUUD 5I18H 4OCLC 4EQ3A 1BX2A 2X4RB 1WVZA 1T1WA 5ALCL 5FDYA 3AY4C 3ARYA 2HT3D 4RAVA 4Z7UB 5K9KB 4B7LA 3FL7A 4LKCA 3QXDB 3S34H 5LQBH 1R5WA 3I3DA 4XAWL 3RL1A 5CEZD 5HJ3B 5DDHB 4KK9C 1T0PB 5IEKB 1MCSA 1WZ1L 2IPKB 4HMCA 4TPRH 1JPSH 5EO0A 1VENA 3BXNB 2NXZC 1DDHA 5D9SA 5IB1B 1J11A 5CD5D 1IC7L 1N8ZB 1C5BL 5I1LB 1NLDH 2P8LA 3H42H 3IS1X 3AS2A 3LHPH 3V2AR 2SEBB 4I8DA 5DFVD 3SDXB 2CLVA 3QYCA 4ONFL 2BFVH 4GT7A 2AK4B 1T66D 3DIFA 1MHPL 3FFDB 3VGAB 4QHLB 3MCLL 1FL5A 4JFPB 3BDYL 4KGLA 5I1DB 4PP1D 3GHBL 3PWJB 2EDNA 4NKQB 2J8UF 2UZYB 1V3LA 4XRCA 5EU7C 1HEZA 3ARFB 5AZ2L 4UTAL 1VGKA 3B3IA 5E56A 1HDMA 2DTML 3Q48A 5L8KB 1JVKA 3GMMB 2BY2A 3MRJB 3TYFA 5HHXL 3HN3A 4I2XB 2P24A 1BM3H 1PG7H 2ORBH 4M6ML 4I0PB 1ZS8B 2AABH 4KKBD 1A1MA 3VWJB 3JSSA 2ZOKA 4MMXC 4O2CA 5I74C 3MV7B 3DVGB 5GZND 4GG6A 4ZQKB 3UBXB 3VGDA 3SY0A 3BXNA 5D9SB 1PX3A 3VCLA 1JNLL 3L5XL 3IJYB 2ZOLA 4DVRH 3HPJB 4YIQB 4YC2C 1FYTA 2VDKH 4B41A 3VH8B 1S5IL 1WEJL 2IG2H 5JORA 3OGOE 2HTLC 1WAAE 1ZA3A 4J3SA 5DVOA 1G6RA 5L6YH 4LLDA 4AY0A 2X4QA 4KXZH 3BZDA 4G43A 3K8LA 2FR4B 4NP4L 2XWTA 1CFVH 3T1WA 1IKNA 2JJVA 4Q7DA 3O9WC 3O41B 1VFOA 5FGBC 1S7XA 1XH3B 1PEWA 4YDIL 3GSOB 4ODUA 2E8ZA 3QG6B 4I2XA 4GUPA 3QRFM 1MJ7H 4Q6IA 1PDKA 5ERWA 1AHWC 4IIQB 4NQVB 5E2TH 3AGVA 2X41A 5JW3H 5HGAB 3BX7C 4WI7A 5DI8A 1HNGA 5AWNL 2FYYA 4LDEB 4AT6B 4JFOA 5J57B 1U8JA 2A6JA 1QVOA 3P4OB 1AY1H 4Y16A 3G5YB 1GXEA 1AGDA 3QQ3B 4Z8FH 1K5NA 5I1IH 3HS0B 4NWTH 1I85A 4O4YH 5JLZB 2CH8A 2Y06L 5IBTL 3GSRB 5D7JD 4ZUVA 2JLLA 1FQ9C 1SEBB 1G9MC 1K6QH 5ANME 4K9EH 4QTIL 5JDSA 4OM1H 5TDNB 4WU7A 4ODHL 3OZ9H 4B53A 2AJUH 1NANI 3EJZC 2R1YB 4OD3H 3W82A 2UYLA 4LARH 1UXWB 3O2DL 3QQ9C 3MLPA 4L4TE 5TQ0H 1W72H 2QLVB 5JOEA 4WI2A 4QHNA 4OTXH 5HYJA 3FFCE 4KZEH 4Z5RB 4J3WA 4JO4L 4C56E 1JGUH 4N8CL 2FYYB 3H0TA 3V6ZB 1UEYA 2C3GA 5K9OA 1JHLL 3I6GB 4JFEA 2Z0BA 3MTRA 4XMLL 4KRPC 4OT1L 3QDMA 1Z5LB 5FB8A 3L1OH 3PQYE 1CD1A 2EZ0C 1U8IB 2EEDA 4KI1A 4KI5C 4KJPC 1HHGB 3RA7H 1QFUL 1T5XA 3DI2B 1QD0A 4HZAA 3LQAC 3MQIA 1LILA 4WHTB 3NTCL 1UCBL 1U91B 1UC6A 3SBWA 1QOKA 3IAQA 1WICA 4DCQA 4NM4H 1BMGA 3G6JB 2R2BA 5E6IB 5T1LB 1T66C 5L2KE 3KLAA 2BSTA 1NCUA 1FO0A 4LPUA 2V7NB 2YSSA 3QWRA 4Y4FD 4OCSH 2FL5B 3DTXA 1T0NB 4XCFL 2R0LH 1FH5H 4JY6B 4Y1AE 3RVXD 3TO4A 4H0IA 3NFSL 5C2BH 4WU5B 3CK0H 3VRIA 2WBKA 2NY5L 1RZJL 3DLQR 3LD8C 4M6NL 3TN0C 5D2NA 4EDWL 4K07A 3VG0H 2ICEB 3FCTB 5GGTL 1A9EA 3AS1A 2IFFH 4Z7QF 3HUJE 4Z6AT 1JHTA 1EERB 1MAML 1C12A 3OWEA 4Q6YA 1Q0XL 3IFPB 4Y5VA 1R3KA 4WO4C 3HLAA 3DSNA 4ONGH 1YEDA 1CLYL 2AJZB 1XCQB 2B4CH 2OJZH 2C3VA 1U6AH 2Z35A 5FIEA 1ORQA 5DD5L 5I76B 4HT1H 3GRWH 3NZHH 4PB9L 2F58H 4MQSB 1LO2L 1YNKH 3ZKSD 4YQXL 4WY7H 2VXUH 4NKDB 1HHGA 2SEBA 3S88H 2IAMD 4ORZC 1FRGH 3Q5OA 1OPGH 2XQYG 4ZTPH 1F3DH 2DQCH 5HVWA 5A2KH 3KPRB 5AUMB 4G6AC 4FHBD 2B1AL 5HD8C 1DZBA 32C2B 3P9MA 4PB0H 1UVQB 1KNOB 4MX7A 5ICZB 2G2RB 3ARFA 5C08E 1A9EB 1D9KC 3B2UC 1FGVH 2YEZA 1JGLH 2FBJH 4CW1A 2VDMH 5I30H 3TYFB 2H8PA 1OF2A 5AZEL 2C4FU 3QG7H 1Q9WB 1XF3A 3VRIB 4EZMA 1I9IL 2C1PB 2PTTA 2KQNA 1J87A 5SV3A 5CCKL 3GGWB 1KTLA 5BVPH 1MFCH 1IE5A 1KPVA 3H0TB 3V6ZA 4G9FB 3SDAC 3VJ6A 5F7HA 5B39G 2GKIA 4G3YH 5F9JA 5F8RC 3EDJA 2ATKB 4JKMA 4M61A 4XPTL 1H9VA 4HQQH 2BMKB 5HYSA 2EEAA 3QEHA 3O9WB 3QUKB 4R2GD 2CGRL 1CXHA 3TT1L 3DV6A 5DFTA 1UYWH 3VXTB 1NMAH 1R5IA 4GQ9H 2O26U 4WJ5B 1MEXL 2R15A 2X89A 4NO3A 3RVVC 3GJEB 3VXOB 1FZMA 2WV3A 2H41A 5CEXA 3SDDA 5I1HL 3FT3A 1KNOA 3G5VB 3JWOL 2VXSH 2BSTB 1VPOH 3AXLB 4G7YH 5DJ8A 5ECJE 1JMXA 3GSOA 1L4IA 5B8CA 3LN9A 5JPMA 1BPVA 2DLTA 3LB6D 5GJTH 4PJ8D 2PYFA 3ILQC 4JZJB 3DETD 1A7RL 4GLRI 1RHHA 4BZ1H 1KN2L 4AMKL 4ODWB 4R8WL 1HHJA 3RPIA 3U6RB 4MGXA 2DQTH 4NWUL 2H32H 4Y5XC 1EHLH 4HWBH 4RRPA 1RIVL 3WXWH 2PO6B 1OAUH 5FECA 3BRGC 4MQTB 3ARPA 1MCBA 4QO1A 3GNMH 4TVPL 4JFFA 1B0WA 4M5ZH 2VDPL 4UU9B 3EHBD 4PUBH 2VABB 1F90H 3TWCH 4F57L 4OCXH 5FHBL 3QHFL 2X1OA 1ZK9A 3GM8A 3O3EB 1CFQA 3OKNA 5T3XH 5GZOD 4RSVA 5IK3A 1OGTB 3REVA 5B3JE 3A0OA 3D2UB 3X3FL 1CICD 1V3KA 4RMTA 4PJHE 3SO5A 4YHZH 5DT1H 4P9ML 4P9HC 4YNYB 5EZJB 5EB9A 2X10A 3P77A 3STZB 2JJSC 4UUJB 4S1RH 1JV5B 3AMKA 5C71A 5KN5A 1CDJA 2Y36H 4DVBB 4YHPA 2Q8AL 5LAXA 2VQ1A 4MAYB 3IAGC 2Z92B 2YN5A 4A6YB 1MFBH 4JPKH 3MZGB 3H9ZA 3FB8A 5DO2C 3WNMA 1J8HB 2VZ3A 3MRFB 5A16B 1DQDL 3FQXA 3EFDH 4FQPA 3VRLF 5HYJD 2NY3D 4NQCD 2G2RA 3ULUD 1F4YH 4O2FA 4EIGB 1F3JA 4K3EH 3SGEH 4PRAB 5D1QB 2MCPH 1NC2A 3QDJB 1UJTA 1YDPA 1CGUA 4XXCC 4EKXA 5JNYB 5ESVB 4XHJC 1LO3H 2C1PA 2P5ED 1GGUA 2YZ8A 3RWDB 2L7JA 3CVHA 3RVTD 3TBVB 1RK0B 5KVMC 4Q9BA 1RUAH 1P7KB 3JV4A 3CUPA 5CEZE 1G7MB 5C0BE 5FO8A 1I9EA 4LVHC 3KYMB 1MJUL 1U9KA 4QWWC 5LKNA 4S1DC 4IRJD 5FAAA 2XFXB 3GBNH 3GUTB 1SBBA 3P3YA 1NSNL 1U42A 2V7NA 1TFHA 1R3LB 3RJQB 2F5AH 4F33B 4Z0XB 2B7DT 1E4JA 1ZLVK 4NQEB 3MRCB 1DJSA 4LVHB 4OV5A 2GJ6B 4LRNL 1WUNT 1I7ZB 2Z4QA 2DYPD 2J8UB 1GC1H 3UC0H 1I1YB 2IMNA 3B2UD 5CSZB 5KVGH 25C8L 1IBGL 3M1BA 4HH8A 3NCJL 5D2NE 2X6MA 2MQ3A 3GSNH 4GFTB 5DC0A 4LSQL 3T65B 1KELH 4U31A 5C6TH 4M7LH 3D85D 3RQ3A 1SEQH 4GH7B 3RP1A 5CFHA 2F8XC 2A1WH 5E7BA 4ZNEE 2RAMA 5LBSL 1WLHA 1EEQA 2Z91B 4NNPH 3GMOB 3BP7A 5E2UH 3VI4E 4LKXA 4FFZH 1TJGL 3KDMB 1VERA 2HN7B 1S9KC 2HJKB 3MXVH 4JM2C 4YBQC 4U2YA 4Y19D 3C09C 3ZL4L 1B6DA 1E4WL 3IF1B 3T0DA 1MELA 2FGZA 1AQKL 4V1DE 5KS9B 4GW1A 1I7TB 3DGGA 3MMEA 2OR8A 3I02B 1NAML 4HBCL 2DQIH 3OJMB 4HXAH 1TZGH 3H7BB 4LAJH 3QIBB 1LE9B 5E6YA 4PGDB 3FFCB 4JRYE 4OD2A 1F97A 3H9YA 5DJYA 5EU3A 1OP9A 3BI9X 1A22B 1AO7A 1WZKA 5DTFA 3MX0A 3WN5A 1H3UA 3ROOA 2J12B 3BIKA 1CICA 1CF8H 1KEML 2NNAA 3QXDA 4P48A 5IP4A 5IW1B 5GRWA 1BEYL 5IG7A 3IDIA 1T89A 1BZ9A 4PJ9A 3SE3C 3ZDXE 1NGWA 4M8QB 2G75B 5BZWB 2WBJD 5T1DL 5GSVA 3S36L 4A6YA 3DUUA 4P5KA 3VXUB 3U7YL 3CFEA 3CVHL 1RURH 4BFIA 3HZVA 3SKJH 3MCKA 3C08L 3MGOB 1MFDH 2VLKB 3IKKA 4O02H 2BMKA 4XNXH 5BZDA 5MENA 3RUGE 1WCQA 4E41A 1SHMA 4Y1AB 1S7SB 2AEPL 2DDQH 1RFDL 3V4VH 4PGBA 5BS0B 3NH7H 3ABZA 4NRZA 4R4BA 3SCMC 4BSVB 1S7UB 1YEEL 1EHAA 4XRCB 2AABL 1Q72H 1MCDA 1TITA 1FYTD 1RUPL 3PUCA 2H3NA 1UM4L 4X6DB 4OZGA 4PRHE 1CDIA 4QGTA 3SCMA 2E7MA 3C8KA 2DQDL 3UO1H 5I15H 1MCOL 5D6DC 2C3HA 3NIFF 2DM4A 2FO4B 4OFDA 1ZVYA 3L5XH 2HJLB 1T22A 3BEVB 3WHE0 1GJIA 5D4QA 2G75A 2J6EH 4NQEE 1AO7B 4PRPE 4G8GD 2E6QA 2OXGA 5IFJA 4L4TD 5L0QC 5DJAA 1MCWW 1KXTB 5L6YL 1T89C 1CCZA 5ADOH 4TN9A 1CFVL 1G1YA 3O3DB 4PRNA 4U2ZA 4Z7VF 3RAJH 1HINL 3OXRA 4UINH 3RWJB 1G9NL 4GG6F 2NMSA 4AJ0A 3HI5H 4QRRB 1XGYH 2D3VA 5IJVA 4HMDA 1C1EL 4YGVA 1RULL 2DIAA 4FMKA 4I48B 4DZ8A 5TJWK 3E2HC 5ACZA 4ZYKB 1T7VA 4UB0L 2E7CA 2NY0C 4F8QA 5DUBB 5JW3L 5ICYB 1A2YA 3MRNA 4HEME 4KK9D 5ID1B 1X7QA 1GAFL 1K9TA 4DVBA 2HVKA 3FFCA 5ALCH 2Y06H 4TQEL 3UTTA 4EI6A 1KG0B 1X5IA 4F7CB 5F8QC 1A6UL 4JAMA 2D31B 1QVOB 4OM1L 1KF9B 5HGGS 5IHUL 1OGAD 1F4AA 1UKQA 2FO4A 5F21B 2AJUL 4DKDC 5IJKC 5KS9F 5IIEA 2LTQB 1M7DA 1SJXA 3L3DA 4CJ1A 4FFWD 1SMAA 4JFDB 4OZIA 3FQRB 1IAOB 3B9KA 3TH4T 1N64H 4GSDH 5ALBH 3DYPA 5BRZE 3C87A 1JPSL 3LSOA 3SGKC 4Z7WB 1IZKA 3O6KH 1IC7H 3MACH 4IEFB 4KZEL 3AFLA 4XVUC 1P9MA 5ISZB 5EBWB 4M1GH 4FQCH 1JGUL 5HGDA 3VFGH 2ZNWA 1G0DA 5IB5A 2HJFB 3MREB 3WSQH 4YPJA 1LO4L 4X4ME 1KJ2L 2QSCL 3LN5A 1IGJA 1U8HB 4ZUTA 4DN3L 3D3VD 4I48A 4K2UL 4LGPB 3GJFA 4DW2H 4HKJA 4CU6A 2H9GB 3NAAL 1LO0H 1HIML 2X7LB 1UJ3C 1T1XB 2R0WL 5GQBA 3FT2B 4HFWA 4D9RD 3F62A 1QBLH 2Q86B 2V7HB 3P0YH 2VQUA 1YPZA 1YECL 2GAZB 5IF0B 1BECA 5FA4B 2O93L 5HVFB 4LL9A 1SJHB 1T7WA 4NM4L 1NUDA 4XVJH 4TSCL 4P4RA 4L8SC 4BK5A 3QQ4A 5ELIA 1QO3A 2IPKA 5AG8A 4U1HB 3BZFB 5SX5K 5C0JA 3CH8A 3OAYK 5K9JL 4Y89A 1NAKH 2BHUA 2NY5H 1UB6B 3D39B 1WEJH 2XKSA 4ISVA 2J88L 2XTJD 3VG0L 1P5VA 5GGTH 3JWDC 4NBZB 2Q3ZA 2IFFL 1MLBA 2KQMA 1ZLVH 2V2TA 4P3DA 4JRXE 1TIUA 1OD9A 2WWMD 1RPQA 4ETQA 4N0CD 1S7TB 1IAII 3DX8B 3T09A 4PRDB 4UTBL 2Q87A 4PP2A 5D7JC 1I3UA 3WLBA 5F7MC 4NM8L 3SDAA 5GRVL 4Y4HD 1JHTB 1Z9MA 2W9DL 1NGZB 3RU8H 2BX5A 5DD5H 4CVWA 3P0VL 1VFUA 1JI2A 3NPZB 3NZHL 4RFOH 5I1CH 5KSBE 2DM3A 3M07A 3ARUA 3G9VA 2Q7YB 4AQOA 3QSKB 3Q6GH 5IVXE 2D7PA 3EJZD 3F58H 4HFWB 3PE9A 4BFGA 4H8WL 5LGKA 3PDGA 1B9ZA 2BDNH 4HSQA 2XYCA 2VLKE 1X4ZA 3ARFC 2YD5A 4N0YH 5D1XD 4Z8FL 1HYSC 2QL1A 1Q0YL 4NC2B 2CR6A 1R3IH 5D7LA 3BJLA 1J1OH 3FOMA 1FFPA 1VSCA 4IRZL 3V5DB 5KZCD 5LVEA 1R24A 4K9EL 4MAYD 2IH1A 1JPGB 1K4CA 4UZGA 5B8CC 3R8QA 2XY2A 3VW3L 5JOFA 4D2NA 5ID0B 4LMQI 2VDNH 4TNVF 4LPXA 3MA7A 4OD3L 4HWEH 1QG3A 2QQNL 5EU6D 1J5OL 1MI5B 3EKCA 5E00B 3Q5YA 4X4YB 3VFTA 4I9WD 5F7DB 1OD7A 1WK0A 4X6DE 4LCWD 2H8PB 1HHHA 3HE7A 3LVEA 4HUMB 4HQQL 4KROC 1J8KA 1LEKA 4MCZB 3HFML 5MP6L 4HC1L 4PJGB 3IU4L 4WW2F 5C0CD 4P59L 4U1NB 3WLWD 1UZ6E 5EUKA 3KS0J 4I2XE 4LSRH 4Y19E 2LV4A 3Q6FB 1DBBL 4U7SA 1NDGA 2EIZB 1AE6L 1J12A 4FFWC 1MEXH 5FUCE 1U41A 4Q58C 4WV1C 3S35L 3RVXC 2AXFB 1LD9A 1YZZA 3N1QC 1U8IA 3IDXL 4KJQD 4OFVA 5FFLA 1BVLB 1ZHKB 4HPOH 4ZOBA 3MBEB 3HZKB 1VPOL 2XIDA 4XPAL 3TN0D 3UXFA 5IM7B 3CCHA 3QUYC 2PETA 3HNSL 3ROLA 4KK6C 4E5XB 1R5IB 1KEGH 2O5XH 4X6CA 3V95A 1QLEL 1IEAB 4BKLA 3EBAA 1ORSA 2JJWA 4FNLL 3KPPA 3CFJA 2W9LA 5D71L 4WFFD 2YSSB 1IMHC 4OCSL 3HI1A 4YBLC 4OKVA 4N9GB 2OBGA 2PYFB 5EN2A 5HBBA 4K8RC 3O8XD 5C0BD 1RHFA 1FNGB 2Z93B 5DYOB 3D0VA 5FV2A 5C7XH 2RFXB 5I18L 1OT1A 1BBJA 4L8DB 4M1DL 3C5SA 1T5WB 4EDWH 5J11B 1H5BC 4OGAD 3QZWA 1LDSA 2BK8A 4EI6B 3FRUA 1OQXA 1IEBA 5LXGL 3MOAH 4XTRD 2IAMC 1N0XH 1XGPA 4K9EC 4G8GB 4C56D 3OPZL 3QDMB 4XAWH 2BNQD 5ETUB 4P2QB 2X40A 4OFKA 4C83A 4F7PB 4RBPK 4ONGL 3GHEH 1URLA 1BVLA 1ZHKA 2JJTA 3FRPG 1Q9OB 4NO2B 2R8SL 2C1OA 2VL5A 2Y36L 3E6HB 1RZJC 3QDJE 2GITB 3ZDYF 2X4UA 3GBML 5EUOA 4TPRL 3QA3B 4GG8A 3D9AH 5IEHB 1YNKL 4U33A 5GRVK 3KPLB 2M2DA 4MNQE 2I9TA 5I1LA 1C5BH 5CGYD 5I73C 1A1NB 5DD6A 1P4LA 4MS8C 4JG0L 2XNAB 1YUHB 4ONFH 5B21A 4S1QL 5I73B 4LLUA 5IMKB 1F45A 3MCLH 1DANT 5CJXA 5IVOA 3UZVB 4N0CC 1WT5C 5DZOA 4YAQA 1IT9H 2IADA 2PYED 2WBJA 4LLAA 2IPUK 3VDCA 1XZ0B 4Q6IC 3IDNB 1G7QA 3JV6B 1RUML 4UTAH 4ODTH 2DTMH 1RUAL 3ULSB 3GRWA 4FQLL 1C12B 4LASL 3RY6C 5FA4A 1X4XA 4K94C 4UDTB 2D7MA 3RVWC 2OSLA 2FX8L 4ZUSB 3TBTA 1DP0A 1GHFH 4C4KO 4YX2H 4LBEB 2P5WD 1CQYA 2PCPB 1NSNH 2FEDD 1WBZA 1CDUA 3RWGB 5KSBB 4G3YL 1H5BB 4OGYH 3IFOA 3MRPA 5JZ7C 4ZOEA 3WBDA 4XVTL 4HAGA 3UC0L 2AAVA 2X4SA 2I26N 4OZ4A 2E9JA 3HG1D 4G5ZL 1KTDA 2VLJB 5HYQB 1A1NA 5DD6B 3NCJH 3QPQC 3FKUS 4H8WC 1AD9A 3ZZ1A 4P23A 4YLQT 3MJ9H 5BW7A 4AEIH 3IDMB 4M7LL 2ZSWA 5C0AB 4HIEB 4AIXA 1OAZH 5MERB 1BQLL 2B1HL 4O00A 1M7IA 2DKMA 1EXUA 1TPXC 2E5EA 4KK8C 3W0WB 4M48H 2AEQH 5EWIH 2BVTA 3DUSB 1AQKH 3F7RA 4FXKB 1HHIA 5ILTL 1MJ7L 4BZ1L 3UPRB 1G0YR 4JCLA 1CR9L 1DBKH 3V8CA 4MQ7B 4HXAL 1U2HA 1WT5A 3U2SB 5HDLA 4DK6A 5KSVB 4GO6B 1JWUA 1IZJA 3WJJC 5D2LF 2KKQA 1YY9D 4XP5H 1WBXB 4ZO8A 4Z7WF 3HG1B 3T0ED 1DR9A 3MLZH 3OR7A 3ZE2E 3GNML 1PGRB 2Q8BL 1JGDA 4QRSB 3T77A 4ERSH 3OXSA 1BEYH 4ZUUA 5AD0A 5HI3D 1WF5A 4MD0B 1DBAL 1P7QB 1QSVA 3D18A 5C0ND 3X3FH 3OZ9L 4HGWA 5ADPH 5IR1A 1IKNC 5F3BB 5DT1L 2NY2D 3MBEC 2OZ4L 4X8XA 4Z7UF 2AK4D 1P53A 3HKFA 3CVHH 1MI5A 3D25B 3W0WE 3DVFA 4X4YA 3O8XC 4AH2A 4D9LL 5JQ6L 5EBLA 1VACB 1JUFB 2VSDA 3FN9A 5TQ0L 4PJHB 3QJFB 1CFTB 4OTXL 1IC1A 3VGFA 2EIDA 5IBLD 5IV2A 4MJ6A 1QLFB 1WWCA 1PQZB 4LNRB 4TSBL 4JO4H 1FGNL 1QA9B 3LQAH 1DQDH 4LQ1A 4XTRC 4HK3N 4RGND 1BVKB 3BMVA 4P4KC 4IMKA 3T0EE 4G6KH 5D1QA 3KPMA 5F9AC 3RDTC 4LHUB 2IH3B 5KW9H 5FB8B 4HS6B 2DQDH 3UO1L 5C3LD 3CVIH 3V0VA 5I15L 5LG1A 2NXZD 4GAGH 4GBXA 5DJXA 2DMBA 2R56H 1CZ8H 3DPBA 1IGML 4Q74A 2UV3A 1J0IA 3GBNL 1FYTB 2R9HC 1G7JA 5J1AA 4WW1A 3OJ2C 4X7TA 2PNDA 2FDBP 2IBZX 3AREA 3VXME 4I0KA 2KL6A 4R3SB 3QBTB 4HIEA 5DA4A 1G9NH 2ICWB 4Y5YA 1RZJH 2ZCHL 3QO0A 4YHYB 2C4XA 5E5UB 3CFDB 1NC2D 5DURD 5C0GA 4BYHA 3L7FB 4OI9A 1JTTA 3S8WA 1GPOH 1BD2B 1BJ1H 4PR5B 1NCNA 3QP3A 2BVYA 2X9XA