2CD0A

Structure of human lambda-6 light chain dimer wil
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAM
publication title Tertiary structure of human lambda 6 light chains.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cd0A00
2JKXA 5ICXB 3NH7L 3F5WA 3QCUH 5EN2A 3HI6H 5E5RB 3PP4L 2V17L 1INEL 2X1XR 5D7JD 1KPVB 5EUOE 3I6LD 3TT3H 3QNYB 1R5IA 1GRWA 4LF3A 5IFAH 1HHGA 4Q9CA 4RSVA 5D1XC 5HDQL 5IVZB 3GMLA 1M7DA 1MVUB 1L9NA 1YMHA 4NPYA 3MXWL 3L5XL 3KPSE 1BD2E 3ROLB 3PHQB 3ZT7A 2Q86B 4ETQA 2JCCA 3SDXF 5IEKB 1JWSB 4GG6B 3OKDA 5ANMB 1ZWIA 4Y1AA 5E9DB 4JG0H 1TTFA 5DRZA 3GJFA 1LDSA 1BD2B 4YK4B 1KGCE 4RFEB 2PETA 4X7SH 3UTQA 3EUUA 5LCVH 4E41D 1U8NB 4JM4H 3MV7A 2V2XA 1S5IH 3U46A 2XKNA 2KZ1B 1CLOL 1NPUA 5D2NA 4JFHD 2M26A 2Q6WB 3BPLC 3LIZH 3LRSA 1RURL 4GRWE 3GMOA 3KPRB 5BVPH 2V6HA 4JRXE 3ZYOA 3STLB 2JB5L 4TOYH 5GS2D 3GIZH 3M1BB 4HJGA 4DK6A 5CJOH 3HE6B 3D87B 2VDOH 4YDJB 3DX7B 3OWEA 4JRXB 1FFPB 3KYAA 3WSQH 4DVRL 1I9RL 1TCRB 4UI2A 4X7DC 3LZFH 3RY4A 1G9EA 3CFDB 4JFYA 2I26N 1GAFH 1GGYA 2G5BB 4UT7H 1ZLSH 1H9VA 4ODBD 5HBBA 4HWBH 4RDQG 4P2OB 4AL8H 5CP7B 3G08B 4WUUE 1KEGL 5EZJA 1D5XB 1MRFH 1XEDA 4JPKL 2PW1A 3WO3B 2O61A 1IL1A 2EC9U 2WAHA 4G7YH 3OKKA 1CGSH 2R2EB 3O6FD 4IRJD 4NO3A 4QRTA 1A3RH 5ADOH 2NY1B 4GLRH 4RFNB 1TQCC 3G6JE 2VXTH 4K55A 3HMXH 4ZAKB 5L8KB 4F15B 4WUUB 4ZO9A 5ALBL 1U8OB 2A0LC 1KOAA 2RR3A 1LNUB 3FQTB 4I1NB 5FAAA 1H5BB 1MQ8A 5EU6E 3HCVB 3K8KA 3S97C 1HILB 1CU4L 4LCWE 3BP5B 1YC7A 4I9WD 1Q38A 5CS7A 4KHXH 3NPSC 1OOAA 1MI5B 2D7TH 4CU8A 3VXRA 4EN3A 5IBLD 5JIHA 3PGFH 3NCJL 3CJJA 5ETUB 4RIRB 4DGVL 4S2SB 4KAQH 3OKMA 4LCWB 1JYWA 4JM2F 2R0KL 1BREA 3LS4H 4Y5YA 1TENA 2V5RA 4GT7A 2CXKA 1ZHKA 4RAVB 1MHHA 4I8DA 5I74B 4F7MB 1MWAA 4AY0A 4FQHB 4DKEL 1MAJA 3B2VL 4H1LG 4HXBL 2DQUL 4NCC1 3MLTA 5BXFA 1FNSH 3HZYB 1YYMH 1M71B 4PJCA 4X4ME 2APFA 2A6DA 3FN0H 2CK2A 5DGRA 2C3HA 1AGCB 4ZFOL 4POYA 4JN1L 3O3BB 5EOCH 4Z7WA 3ARVA 1TETL 3O4LE 1GGBL 5C7XL 1Q0YL 2FZ3B 3VWKB 4Z18A 3FL7A 1HHIB 4KJWD 3EFDH 2CRIA 1QKZH 1GZQA 1JFQL 1IGJA 4YGVA 1W0WB 3BESR 1DL7H 5MEQB 2B1HH 1EMTH 3HPLA 5FYJE 4G8IB 4PGDA 4JO4L 3KHQA 4APQA 3O4LB 1FDLL 2GSIB 4YHOL 4QOKD 2KQMA 2YUZA 5DRWB 4QEGA 2PKDA 3QFJA 3STBA 3GSVA 5IB3B 5KW9L 4GXVH 5K9KB 1QSEB 2GY5A 1KSRA 2JB6A 2EC8A 4HF5L 1HHHA 1YZZA 1IFHL 1OP9A 3S4SA 5DLMH 3T77A 3ARDA 2BRRH 2C7UA 3K4ZA 3D1MC 2Y36L 4HWZB 1MCOL 2RJMA 2J8UA 5EZLB 2WWMC 4XVUD 1JYVA 3QXDA 4HUXB 3C8KA 4G5ZH 4Z0BH 3B3IA 5IIEA 3D25A 3O4OB 1B0GB 4H8WL 3GSXA 3ZE2E 2DLHA 4ZG1A 4MCZA 3L3DA 3L5IA 1C16B 3SDAB 5J6HB 2VLKA 5ESVA 1INQB 5DMGD 4F58L 4P4KB 1NEZA 5C08E 1EFXB 4N0YH 2PCPB 3OGOE 4N90E 1N2RB 1FG2A 3VXMD 2APBA 1VPOH 3GHEL 2ILLA 5FCUL 5J89A 5HPMB 1UXWB 2A6JA 3EO9H 4Y4FC 5AZEL 5F72S 1CGVA 1I1YA 1BJ1H 2P47B 1RUAL 4P9ML 5HYJE 2O5ZL 4LIQE 3X3GL 4MLSA 5FDYA 3BZEA 3RVVD 5HI5D 3K7UA 2Q8AL 2ZCLH 1NLDL 5MHSE 1NMCC 1A14H 4CADB 4EI5B 1BP3B 2UZXB 5DMKB 1YMME 1EZVX 5HYJB 2OLDA 1OD9A 5DDHA 4IRJC 1YY9C 1NAML 3C2AL 3VRJB 3VWJA 5D7LD 3KLAA 3C6SB 2WIIA 5GSVB 2VDML 4NQCE 4PY7B 4C55A 3FO2B 3DYMA 4DUWA 3O8XD 4JG1L 4IHOA 1QVOA 2DRUA 4ZQKB 4HCRH 1CVRA 2A9NL 4AG4L 4PRHE 4LDOB 1A3QA 4JRWA 3HNSL 4E9LA 1F8TH 3FQNB 1RHFA 5IBLC 4WY7L 4EDXA 3MNVB 1WBXB 3VFPB 3C60D 4U0RC 1UENA 3BVNB 3CU1A 4XI5C 5KN5B 3QB7C 3O6KL 2A83B 3GMRB 3M17A 4U6TA 5DK0A 1W0VB 2LU4A 1D5MB 4YBLB 5JQHC 4NRYA 15C8L 1HH6A 4M93B 4FQ1H 3WUZA 4P2RA 3P9LA 3IRPX 3RY6C 4IM8A 5CZVL 2DLTA 5KSBF 1SVZA 4YHNB 3VCLB 3IETB 4RBPH 1IAKB 1FCGA 3DVGB 1BFVH 2ED8A 1NKRA 1IGML 5JHDA 3BDBA 2WV3A 1A7PL 1I7UA 2EEBA 1IBGH 4ODHL 5JOFB 5SWQA 3KPPA 1VKXA 2LAGB 4OF0A 3DMMB 4YC2B 4UNUA 3TBTB 4NRXA 5E2TL 5FYJU 3ISWA 1BZ7B 2CLRB 2IMMA 2BMKA 5EIIA 4Z7VE 1AE6L 4PYHA 2E7BA 3MRMA 4KJWC 4YHLL 1IAIL 2AXJA 4JRYA 4X99A 1TJIL 2YZ1A 4Z7QE 1D9KB 1KFAH 3MUJA 5I16A 2RCSL 5B8CC 1S9WB 5CWSB 4NZRH 2AJ3A 1NANH 1ZSDA 5TJWK 4LCYA 1CDCA 1IT9H 1JHTB 1QEWB 1EEYA 1FNEB 4KK8D 5IK3A 4MNGE 2CKBA 2FD6H 3LSOB 4LBEA 3W2DH 1Z9SA 2MMXA 4M8QB 3O3AB 4OZIA 3T0AA 4GSDL 1U3YA 2EYRA 3T0EC 3P77A 4P5MB 3DRQB 1P4IL 3VGEA 2GW5A 2Z93B 4Y4KC 1AD0A 1CGWA 1U8IA 1CXIA 3Q6FB 1U8QA 1NC4A 3UTTA 3ULUE 5ICZB 1A9EB 2NZ9D 1GL4B 3OR6A 1WCQA 1U93A 1WFTA 1OAQL 4ZDHA 4XVUC 4KXZH 5FK9A 1O0VA 5F7HA 4ZFGL 1FYTE 3S96B 4M5ZL 5FF6B 5MENE 3MRKB 4JO1H 4J7RA 4K3EH 3WN5B 1DSFH 4JR9L 2F54A 2JLLA 4HD9A 1MF2H 3GNML 3GMQA 2BHZA 5DMGC 3FO9B 2PW2A 1T7WA 4IOSD 5EOQH 4C57C 4KVCL 4QHNB 5C6TL 3ARUA 1U8KB 3PL6D 4QT5B 5SX5K 1II4E 1OTSD 2YSSA 3MLVL 4X5WA 1NCAL 3PWLA 2AI0H 5EC1A 2CO6B 2ITDB 4CAGA 4K94H 2C3VB 3QYCA 1XIWD 4JJ5A 5ILTL 5IFJA 3U7YL 4HAFA 4YJZL 3VFGH 1QP1A 5HD8D 2Z9TA 4UV7H 3SJVD 4AH2B 4HS8L 3CLEH 3DNKA 2CSPA 3U9UB 1BQUA 5LXGL 4OZHF 5I71C 1UYWH 2JJVA 4Y4HA 1S5HB 2H6PA 4FNLH 3P4OA 5ICXA 2XKSA 4GBXB 4KROB 2OJZL 3DJ9A 3T2OA 5KVGL 1BFOB 4S1RH 5FOBB 4OF5A 1KPVA 2XWTB 2EXWD 3QNYA 3CXDL 4PJ5B 5DJ8B 2DDQH 4W4OA 2E27L 5JW4N 4GKOA 5J7CC 3SGJA 5IVZA 3C60C 4OLUH 1ES0B 4JVUA 2LTQB 3PHQA 5I1CL 1X4YA 3EYQD 5IEKA 1JWSA 4GG6A 5ANMA 3D3VA 3VA6A 5HHOA 1EHAA 1QA9A 1MREH 5E9DA 5KANI 5C0AB 5F7UA 5GGQL 2X44D 1X5ZA 4RA3A 1KF9B 3MRHB 4PJDF 4RFEA 4ZUUB 4JGUA 2D7QA 5A1AA 4ONFL 1U8NA 3MOQA 1ETZA 1LEGB 4CUCA 3V7AE 4OTXL 4Q58C 2Q6WA 1X5IA 3GO1H 2X5PA 5IROA 4XAWL 3LPWA 3QAZB 4OLWH 2IBZY 1OSPL 2UWEE 1MCDA 4HKXB 5C0IA 1IGTB 3KPRA 4KJQD 3STLA 1WAAA 2J6EA 1CDHA 5DC9B 1MCQA 3TN0B 5DD1H 4ENED 1FIEA 3JBG7 2I60H 2X7LB 1S7VB 2IAMB 2IG2H 5ECJE 5D96B 1NAMB 4GW5B 2NY7L 3K2MC 3DX7A 4YDJA 2W91A 3CMOL 2BNQD 4M6NL 3QUXB 5FA4B 1DN0B 1YNTB 2R1WB 2BRQA 2MKLC 1BEYH 3NAAL 3QDHA 4I77H 4PY8J 3V52H 4P2OA 5CP7A 3G08A 4KVNL 3EYSH 2ZNXA 1D5XA 2NZ9C 4Z0XB 4QHLB 3FFCD 4OKVB 5KZCD 4FG6D 2FX8H 4KKAD 2R2EA 2BZDA 5SX4H 4JHWH 4YE4H 1FHGA 4K23L 1CFTB 4GQ9H 4MHHI 3W11D 4ZAKA 5HGHA 4JM2A 4GJTB 4JFPB 1IJ9A 1LNUA 3FQTA 3R4DA 1H5BA 1KJVB 3HCVA 1HILA 5T33L 2VZUA 1P6FA 1DQMH 1KBGH 2YXFA 2EDRA 3CVHB 4G6JL 2EKJA 3FMGL 3BP5A 3SOBH 4QRRA 1YEIH 2DIAA 4KMLB 1MI5A 2QQKH 1RK1B 2FJFB 4GW1A 5EO1A 1DJSA 2DBJA 1XF4B 4MD4B 4OGXL 3BJ91 3PL6C 5DUBB 5ETUA 1OTSC 3QBTB 5D7IE 4YHMH 2IPKB 1DBJH 3UEZA 4N1CA 4BFGA 4Y1AD 3VDBA 4YHPB 3T1FB 4XCFL 3U0WH 2EEAA 1G7LA 1XIWC 1DQQB 4B0MM 4RAVA 4P2QB 4F8QA 3BDYH 4M9PA 4KQ4H 4F7MA 4S10A 5HD8C 4LAQH 2IJ0C 3MV7D 2BVPA 5DJDB 5JR1H 3C2SA 1A6VL 1K5NB 4ISVB 3GRWH 3HZYA 1M71A 3VW3H 4MJIB 2VITB 2PYFB 3QDJD 1H3GA 4HFUH 4PD4J 4YEFA 3EDEA 3MYJB 1AGCA 5K59E 3K4DA 4KTEH 4NZUL 4U1GC 3O3BA 1MSPA 2IPUK 5D8JH 4FP8L 5LQBL 5D4QA 1QYGH 1T0MB 2FZ3A 3VRLE 3VWKA 2EIDA 1FP5A 5I15H 1HHIA 4JFDE 2PF6A 1W0WA 5MEQA 5C07B 2VC2H 2BSSB 1TTUA 4G8IA 4IOIB 2F74B 3W9DB 4PRBB 3RHWF 3VXUB 4P5TB 3OMZA 2GJJA 4JFDB 1TZGH 4UNTA 5DRWA 1KPUA 3UTZB 3EYQC 5IB3A 3B2UC 2VDKH 1B4JH 3BKYL 1QSEA 1SVCP 2N1KA 3IYLW 3HUJF 3L3GB 4TSBH 2VDPL 2DQHL 1H8OA 4OUUB 5HGBB 4HWZA 3B9DA 5EZLA 5CSGA 4HUXA 5I1GL 1EBAA 4FMKA 1NAKL 1BQLH 5HYSA 2CUHA 3UJIH 4EOWH 3QWRA 4PJGE 1EH9A 2DQJL 3VXRD 5LBSH 2DQCL 4KJQC 3BN3B 2EKSB 4Z78B 3GGWA 1CTNA 4KJPD 3D0LB 4P4KA 4ENEC 3K80A 4LRNH 4PLKD 1OPGL 1T0PB 4NN5C 3SE9L 1U41A 5IKCB 3OB0K 3QUMB 4X0KB 2E7MA 3BUYB 5HPMA 1UXWA 4L3EE 1YQVH 1T04B 3UYOD 3EDKA 1NGWB 3L3KB 4KPHL 4TYUA 2VISB 5FUOH 3TJHD 1NCBH 2AJYL 2X4PA 2IF7A 3V8OA 3A6BL 3FZUD 2G9HA 4UQ3B 2MPAL 4CADA 5FHBL 3PWJB 4EI5A 3M8OH 3DHJA 5HHXH 5DMKA 4V1DB 4ODSL 4KKAC 1NFDA 3HNTL 3CU7A 3VRJA 2YUXA 3ARFB 3C6SA 1T2JA 1KJ2B 4HHAA 1N4XL 3WD5H 3FO2A 3KYMB 5DJXB 4F7CB 2DN7A 1PEZA 4MAYC 4IEFB 1EGJH 4AIXA 4ZQKA 3KLDA 1PX3A 4WEBL 4IDLA 2IQAB 1N3NB 3JWOC 4LSVL 1LP9E 2P24B 4APQD 1W72L 3FQNA 1A4KB 2C3XA 4DKFL 1YC8A 2K1MA 2D9CA 2WBWB 5LG1A 5GRZA 3MNVA 3QFJD 4N68A 1WBXA 3MRDB 2XQYK 5I19H 1MJ8H 4Q6IB 2UY7A 3VFPA 1TJGL 4AIZA 3V4VH 5I6XB 3BVNA 1YN7B 1PGRB 5KN5A 5FHAH 2FBOJ 1JTTA 1FVDB 2A83A 4DOHB 3CXHJ 1T7VA 4U1IB 3WYRA 3ARDD 1FZMB 5DJZB 3VXSA 2CRZA 1CGYA 4W6YB 3DO3A 4HPYH 1J05B 1KACB 1A2YB 3TBSB 3B9EA 4OCSH 1Z9LA 2IFFL 2VE6B 4WJ5B 2V5MA 4YHNA 4WGWB 5D70H 1KELL 1IAKA 1KENH 3DVGA 2XZCH 3WUWG 5FV2A 1H3VA 1WF5A 1F97A 2K7PA 5JOFA 3DMMA 2VLKD 5I18L 1U2CA 4NWUH 3TBTA 4J12A 4PR5B 1MY7A 4G9FB 1FH5H 2WLYA 5E7BA 2YK1L 2PTVA 4LSQH 2ZOLA 2OZ4A 4XBPB 1D9KA 1JZ5A 4G43B 3DECA 3IXAB 1S9WA 5CWSA 3ARGA 1FSKC 4DJMA 3QCTH 3CCHB 1JHTA 1F3JB 1FNEA 1YJDC 3SKJL 3LSOA 3ZDYF 1T0NB 4M8QA 3O3AA 3BE1H 2XY2A 1YNLL 4ODVL 1SEQL 5JOPD 4OZFH 2YRLA 3DRQA 2FHBA 1JNLL 3CFCH 1KTRL 3MO1A 3VWJD 4XBEH 4WU5B 3Q6FA 3OXSA 2FB4L 3AXLB 5ICZA 1A9EA 2G60H 4JPVL 3LMJL 1BX2B 4YX2H 3LD8C 4O00A 5F93C 4X6CB 4QY8B 1WGOA 3V6OE 3MRIB 3QUZB 4S1QH 3NTCL 2EE6A 5TF1L 4M6ML 3F7YB 3S96A 5HDBE 5FF6A 4JDZB 5E2WL 5L6YH 5JIKA 3QQ4B 2X89A 3WN5A 3QQ9D 5J56B 1UACH 2HFFA 1DP0A 4YFEA 4PLKC 3SCMA 1AXTH 4PLOB 3SE3A 4QHNA 3O6ML 4PJXB 3UBXI 3V0AC 1U8KA 1RUKL 1SY6A 3V8CA 3BP6B 1FL3B 3JWDH 5L2KB 3TIDB 4LASL 3A6CH 1EUTA 4P2RD 1QBAA 2ITDA 4QGTA 3BSZL 3RY5A 4LVEA 4DWHA 2XN9A 4YZFF 5CBEB 4K71C 1NFIB 2X4QB 3AMLA 3JSSA 3ORJA 4YHIB 1Q0XH 5JHDD 4J3XA 3MBEB 4AH2A 1KB5H 2H9GB 1N5YL 3ZSSA 1I8KB 4BZ1L 3U9UA 1ONQB 1EVTC 3PGCB 2A38A 1YJDH 3MLXL 3T0DA 1XR9A 2CGRL 5JPNB 5FKPA 3LCYA 4MD0A 4UV4H 5AWNL 4PRNB 2DBLH 5DXWA 1WSST 5TFSH 4HUUB 4P9HL 4JRYD 5AG9A 3N1QC 5FOBA 2ORBH 3VMPA 1KULA 2XWTA 1EPFA 1I85A 1U91A 3VMOA 1CGUA 2IGFL 4PJ5A 3MCG1 4KDTA 1OCWL 1TPXB 5DJ8A 4APQC 3JZ7A 5DHVB 3KPTA 5CJ8A 1MHPL 4KK9C 3QIBB 4JO3L 3T8XB 4JREC 4PJDA 1MJ7H 1MOEA 4OLVL 3DGCR 3HI5H 5BZDB 1N5AB 4DN3L 4BQCA 2N7AA 1YPZE 5T3ZD 1ES0A 1FL5B 4YWGL 5DK2B 1DLFL 2P48B 3ARDC 3UTTD 3ARYA 1OWWA 4OZ4B 4LLMB 4ELMF 1GIGL 4Y5VC 5C0AA 2SEBB 4H1LB 5CJBA 1ITBB 4BK5A 1RIVL 2B5IB 3MGOA 3MRHA 5E8PA 3TA3C 1ZS8A 4OSUL 1UG9A 1UKQA 4IBLT 1JF1B 2LU7A 4A6YH 1LEGA 1OW0A 1CDIA 5C0BB 1A3LH 4XP5H 3L5WB 4QRSA 3RDTA 3BPCB 2FEEL 5ALCH 3MFGB 1T7XA 4OZGB 4LSDA 1J10A 4QRPE 4U05A 4CVXA 3E3QC 1XCTA 1IGTA 4PV9A 1NANI 3KJ6H 5DO2D 5BV7B 4XAKE 3TN0A 3QJHB 1MPAH 3VFSB 1KEML 2NY3D 4Q0XH 2CJUH 2IAMA 1NAMA 3IDJB 4GW5A 4HC1A 1WFOA 1GGCL 4NKIH 3BIAX 5TPWL 4AT6B 1IGCL 5DQJB 3QUXA 1K3IA 3R0MA 5FA4A 3ARSA 1DN0A 1HKFA 5ID0B 4OCMC 3VH8G 1IEAB 4OCRL 1ZOXA 5E2UL 3H2WA 3NACH 3VWJC 4J4PC 2O5YH 5AZ2H 4KXZI 5HVFB 3DVFA 4F9PA 4Y4HD 4MJ2A 1W72B 4WV1B 3ES6B 3VD5A 3F65A 2NY2B 5INDA 4XWGL 4XC3H 2ESVB 4O2FB 1J86A 1A6UH 2DLFH 3LKPB 2DF3A 2WANA 4X7EC 4B5EA 2R23B 3OR7A 5K93A 3CFJB 1CI5A 1KJVA 3QQ9C 2P46B 1CN4A 4DW2H 3CVHA 3W9EB 4ORGA 4ZSOA 4MWFA 4Z5RA 5CILL 1OQOA 1ZV5A 5DYOB 4EBQH 3BT2L 4XH2B 4XZUA 1RK1A 1WC7B 2FJFA 2P8MA 4MD4A 1XF4A 3BH9B 4EVNB 4OQ1A 1VDGA 5I8OL 1G7QB 1VGEL 2GKIA 5JW3H 4WDIB 4LFHD 4X98B 4PJ7E 5FGCB 1OB1A 5GGSB 3D3VD 4HBCL 3UC0L 5FO7B 3WS3B 2N7BA 5E9DD 4YHPA 5BS0B 5EPMA 5GRVK 3QXAB 2JTDA 3CDGB 3D18A 3QXWA 5HJ3A 4P2QA 5FO8B 1IVLA 1QLFB 3KHOA 4PJ7B 3RZWA 4JEGB 1GGUA 3ARBC 2OK0L 1T20B 1DBBL 1EIBA 1JGEB 1U3HB 2J4WL 3RL2B 3H7BB 1ZT7B 4XVTH 1F3RB 4P3CL 4UT9L 4H25B 5DJDA 4KV5E 25C8L 5EUOF 1K5NA 3VFWB 5T1MB 4LP4A 2DYPA 4MJIA 4PB0H 3QISA 5DT1H 5IG7A 5SWSE 2VITA 3KPRD 2PYFA 4G8EB 1IKFH 4IRSB 3VGFA 5KSAA 3MYJA 4P59H 2VN4A 3BKJL 1KN4L 4YDLB 3P4NB 1DUYB 5FXCH 2ZJSH 3RVUC 5IFAL 3HE6D 1T0MA 3MRPB 5SWSB 1KIQB 5DMIL 3TGXA 1NMAL 5C07A 4N0FA 2BSSA 1YNKL 3P9WB 3W9DA 1MFCH 3AS3A 5CIPA 3VXUA 3RVWD 4YGAB 4XVSH 4P5TA 1QSFA 3KDMB 1LO4L 3O3DB 2OR7A 3O6LL 2R0LL 4P2OD 1MCSA 2JJSA 5E99H 3C8HA 1UCBH 4ZOBA 3KWWA 4WTZA 4TPRL 5INCB 1CFQB 1MCHA 4G6KH 5B21A 5DRNB 4AJ0A 5T1DL 1HIMH 3L3GA 3GJEB 1A4JB 2NY1D 2YPLA 4X7SL 2VDNH 1OP3H 5L8LB 4YFDB 4ZAKD 5EU4B 4G9DB 4OUUA 3QULB 1GC1C 3K1DA 1T1XB 4GRWF 5HGBA 2PR4L 2D0HA 3KPQA 3JTSB 4EUPG 1KLUA 4JFXB 4NM4H 1KB9K 1O7VA 4FQQA 4I48A 1DFBH 3CAFA 5FFLA 1KT2B 2K7QA 3LIZL 4QRRD 5F7DB 5L9DL 2FATH 1MI5D 4X9BA 4XNUH 1S7RB 5BVPL 4O58L 5F9OH 2OSLB 2JELL 3GIZL 4ZODA 2EKSA 5CCKH 5DO2C 4S11A 2A9ML 3D0LA 1F42A 5JMRA 2J5LB 1A7OH 5C2BH 2W59A 1F6LL 2NY3C 5IKCA 5E08L 3QUMA 3ARRA 4X0KA 1CWVA 1RIUL 3BO8B 4NQTA 5HHMB 3BUYA 1NUDA 2XWBB 5ERWA 1L7TL 2F5AH 1CK0L 1T04A 1JPTH 3L3KA 1DEEB 4XPFL 1D6EA 4HIXH 1QR4A 2VXSH 1UH3A 4HWBL 3T0WA 2MQCA 2YRPA 3V0WL 3G6JF 3MXVH 4KRMB 4UQ3A 4XP6H 3W5NA 1CL7I 1FGNH 3EYUH 1D6VL 3BXNB 5BMFL 4D0DB 1I9JH 4V1DA 3VXTB 2PXYC 5T3ZH 3FONB 3R1GH 3HFMH 4J3OC 2R4RH 3RX7A 1YY8B 3VXNA 1KJ2A 4FZEH 1HHJB 1S3KH 2MQ3A 2YKLL 4F7CA 2F5BL 3VWKD 1WBYB 2XTJB 2VDRL 2NY4B 4LCUA 4U6YA 2F53E 4HLZH 2HMID 5D1ZB 2IQAA 1C8PA 3RGVB 3SGJC 1T80A 3HAEH 1N3NA 3K1KC 1GC1H 2AS5M 2P24A 3O4LD 1QNZL 1A4KA 4L9DA 4HPOL 4KAQL 1IRAY 5E6YA 1Q1JL 3N50A 3MRDA 4URTB 1F4YH 2J88L 2R56H 3PDGA 4Q6IA 4XMPL 1QSED 3N06B 3A67H 3SDCB 2GK2A 4WEUD 4DZ8B 2WP3T 1YN7A 4HEPG 3PG2A 4X7CC 7CGTA 4OI8A 1UM6H 1FVDA 3DPBA 3HTLX 1FQ9C 4JHZA 4YK4C 5GZND 1HSAB 2HLAB 4M1DL 4F33B 4NOFA 5AYQA 2OP4L 4Q9RH 4WW2F 5FUCE 1J05A 5C0FB 4KI5E 1WCBB 5TQ2L 1A2YA 3TBSA 4Q6YA 3NCEB 3V7MA 2YD8A 2HFEB 4WJ5A 3CH8A 2H41A 4DN4H 1QFWI 3QWRD 1UA6H 3SGKA 5F9WB 1GZPB 2X9XA 3N9GH 4CNIB 4XVJL 3DX6B 3D0VB 3ZYJA 3CDCA 5F9JA 3WKNA 4P4KD 3WDHA 4L3AA 3PV7A 2N56A 3NN8B 3JV4B 1R3HB 2X4TB 3HE6C 1ZA3B 3FOMB 1XF2B 2HRPL 4XBPA 4KZDH 4PJEB 5EORH 4G43A 3IXAA 4JHAL 2B8OT 4X6BB 3DWTA 3CCHA 5EOTB 1F3JA 3RVWC 3AGVA 3BAEH 4GXVL 4NO2B 5T5FH 1T0NA 2X4OB 4P2OC 2OBGA 3GSUB 4EI5D 1J1OL 2EEDA 1C08B 2OTPA 4NN7B 5E7FA 1NH6A 4KFZC 5T3XL 1OAZH 2BNRE 2BRRL 4WU5A 2AJSH 2NY1C 3U0TB 4RFNC 4EXKA 4I0PC 3AXLA 4OM0H 4LDEB 1N6QH 5J9PB 4ZFFB 2J8HA 4Q9QH 3RWJB 4X6CA 5CUSH 3MRIA 4D94A 5CGMA 4C83B 4JY6A 1WQVT 1F4WH 3SY0B 2E9WA 3GM8A 5B4MD 1GHFL 4HULB 4RX4A 4U3XA 2GUOA 1YUHB 2BVUA 1BBDL 4C4KT 2IANB 5ICYB 3RX5A 2R4SH 1MJJB 3S36X 5BRZE 3QRFM 4M61B 3OZ9L 4PJXA 4ZOCA 2QQNL 5HHVH 5DSCB 2HKHL 3FTGB 2HKFL 1NCNA 2VRAA 5IMKB 1U36A 3BP6A 2F58H 1FL3A 1CR9L 2ZP0T 1X5FA 5I74C 5K33A 5L2KA 3SGDI 3TIDA 4JVPA 5C0CE 3HE7B 4NP4L 1F45A 4LLQB 4GRWH 3MLWH 3EOTL 1LD9B 2X4QA 1XMWA 4LSRL 3MBEA 2P42B 3WHXB 2UZYB 3V5DB 3DMMD 3PGCA 4BQBA 3EFFB 3U4BL 3RWHB 1LEKA 1U8JB 4Y16A 5I1JL 3RIAF 5JPNA 2V5YA 4TSCH 3PP3H 3WXVL 5KS9E 1ZTXL 1TZIB 1G84A 2FEDD 5JLZB 4LMQI 4HUUA 4ORZC 5DEGB 2QSCL 3L7EB 1D9KD 2E5EA 1JHKL 4U1NB 1WZ1H 4C4KO 3LQAC 1OGAE 4PBXA 4XPHL 4X5LA 3ZKSD 3QIBA 3T8XA 1A9BB 1QO3B 1X44A 5I1EL 1AD9B 4OI9A 4RMVA 3NABH 1QLEL 5BZDA 1N5AA 5HHPB 3MJ9L 4U1HA 2X4UA 5GXBB 2WWKT 1E27B 1FC2D 1FL5A 1KCUL 4AYFA 1NCWH 3TWCH 3DSFH 2EDOA 5F1SA 3FAXA 2D4DA 5GZNC 5E6ZA 3NCYP 1E4XI 4OCWL 4LLMA 1MCKA 1G7IB 2EC9T 2SEBA 2BC4A 2ZPKH 4H1LA 3CX2A 3OB8A 3O4OC 1DQLH 4ODXB 1JF1A 2LU3A 2QSQA 1Q9LA 4GAFB 4Z7VF 4ZS6C 3F7RA 2X42A 2Y4SA 1ZKAA 2ICCA 4KRPB 4QXGH 5C0BA 5KJRL 4OCLC 4OFVA 3SDAC 3G5VB 4Z7QF 3BPCA 4HJ0D 3G5XB 4P4KC 3GSNH 5BQ7A 4PJAE 4NQXB 4OZGA 4GMSH 5D9SB 3SCMD 3QPQD 4J3TA 1WEJL 2NLJB 2X4NA 5F3BB 4M4RA 3P0YL 3VRIB 5KAQF 3FO0H 3CXHK 5CMAB 2ZCHH 3QEHB 4M00A 3B5GA 4X8JB 3QJHA 3VFSA 5DJ2B 4PJAB 4FQXC 2VLJB 3MJGX 4HXAH 5GS3A 5KANG 2FD6L 5H94B 5MEOA 2XN9D 3RWGA 5JDSB 2WWKO 4JKKA 2BFVH 3PHOB 3ULUF 4AEEA 3U4AA 2W60B 1MCLA 5I1AB 1PKQE 3FB5B 5ID0A 1IEAA 3LQAH 2NW2B 5DD5L 2VABB 5KVEL 2A73B 2W65B 3IU4H 4L4TE 1U42A 4PGBB 4WV1A 1S9VA 5D2LE 4UINL 5CINL 2CRMA 5FYJH 3ES6A 3FB7B 3LQMA 4D3CH 5E00A 4GBXD 4KROD 1FO0L 4R97B 2ESVA 4J2XA 3WBDA 1JRHI 3LKPA 4L4TB 2EDBA 4PJ5D 1P2CA 1GGIL 5IHZA 3GI8H 4Y0GA 2VB5A 4XPGL 4HG4K 5EOQL 3W9EA 2PUQT 3U48A 1A6PA 3T4AB 2ZG1A 4I5BB 4XH2A 4MXQD 3SDYL 2YMXH 4EVNA 1RUQH 3DXAA 3HS0A 1G7QA 4QXUH 4G6FB 4WDIA 4X98A 5GGSA 3U9PH 4M93C 5FO7A 3WS3A 1X4XA 1RZFH 5BS0A 1JJUA 5C0AD 4LK4A 2EDYA 3QXAA 4RMSA 4UDTB 3VFGL 1M6OB 1NGQL 1MCPL 4CVZB 1CVSC 5FO8A 3BDXA 4D9RD 1QLFA 1P4BL 4YDKL 1T20A 1JGEA 4OCYL 2VR4A 3VD9A 4C59B 1DLHB 3DMMC 4PG2A 4YC2C 3PP4H 3RDTD 1UYWL 2V17H 1INEH 5M95B 1ACZA 5T1MA 2D0FA 1PG7X 1PSKL 5J13C 4N0UB 3KLSA 2ZSWB 2FEDC 5LGJB 4IRSA 4S1RL 3VG9B 1XGRA 1S9XB 5F1OB 1NFKA 3TN0D 4P4RB 1B0WA 5HDQH 1IAIM 1IAOB 2EXYD 2QQLL 1I4FB 3EDFA 4YPGA 4JKWA 2IAMD 1DUYA 3L5XH 3MRPA 5J1TC 5E8EB 2XWJB 3IS0X 3I85A 3QUXD 5A3ID 3A0OA 5IHUL 5FB8B 4MMXC 1WLHA 3FT2B 5J12B 4LNVA 1MRCL 2R1XB 1D3CA 3KDMA 1VSCA 2LFGA 3VFRB 1MREL 1CFQA 3KS0J 5DRNA 2AABL 3VI3E 3I6LE 4QXTB 4RNRB 3WUWB 1A4JA 5TH2B 2W0PA 4HUWB 5EU4A 3B8YA 4G9DA 4HUMB 2UWEF 4G42B 1T1XA 1RURH 1LILA 3QH3A 3ZKQD 3U0PA 3O11B 3WN5C 2CD0A 2JB5H 4WFHD 4JFXA 5D7JB 1ZHBB 5M94B 3MROB 2Y6SC 1CIDA 1FFQA 1KT2A 1EO7A 5DQDH 4HJ0C 4OD3L 1MCFA 3QEQA 2DD8L 5F7DA 1S7RA 1CFBA 4MNQE 1A7RH 2OSLA 3FO1B 4XPTL 4BSVB 1A02N 3WJJA 4DVRH 1I9RH 2FNBA 5DK3A 1AQDB 3T2QA 5D5ME 3TIEA 4MNQB 4W70A 5IJVB 4U1JB 1E4WL 3BO8A 5SX5H 1LDPL 3QO0B 2XWBA 4X7FC 4E41E 4P2QD 1KEGH 4JPKH 2E7HA 4M6AA 3RI5F 1DEEA 5D5MB 1IILE 1IM9A 4JFHE 3V52L 4MB3A 3Q3GA 4E41B 3V79C 3EYSL 1MHEA 4J1UB 5ALBH 4BH7B 4MJID 2FX8L 3BXNA 4HQQL 4D0DA 4JHWL 1MFEL 3FONA 1CU4H 1V7ML 4GBXC 4KROC 3KXFB 1YY8A 4TVPD 4YUEL 3VFUB 3MSPA 1CQYA 4XNQB 4EIGB 3NCJH 1WBYA 5DVKA 1KBGL 4XP9L 5FGBA 3AC0A 4UOJA 5D7IF 4DUXA 5TE6H 4DGVH 5FYLL 1UWXK 5D1ZA 5C07D 4XCCL 2R0KH 4MQSB 3VXUD 2H2SC 2R29L 4P5TD 4ZNEE 2LTQC 3DSNA 1F3DJ 4JFDD 5FECA 1N6VA 4O4YL 3ARQA 4H8WC 1YECL 3RUGE 5DJYB 4DKEH 1IGIL 3N1PC 3F7VB 1KLFA 3SDCA 4FFWD 5F7WC 4DZ8A 3TF7C 1MAML 4NNPL 3B2VH 4HXBH 1JGLH 1GSMA 4JGMA 4KQ4L 2YPLD 5EBGA 1HSAA 1BVLB 2F8VA 2DKMA 4NKDB 5DR5L 4R2GB 3SE4A 5C0FA 1Q9OB 1WCBA 1ZXQA 1YEJL 3BZ4B 3QR2A 4QYOB 2NTSP 3B5TA 4I9WE 5K59F 4JN1H 1FNAA 2HAZA 3MCLL 4X4XB 4FQIL 1JGDB 1R24B 1TETH 2GJ6B 4QLRA 4Z77B 1GGBH 1Q0YH 3VRLF 1EX0A 1GZPA 3LEXA 5F7NC 4M1CC 3RZCB 4L1HA 3DX6A 3D0VA 4BZYA 1JFQH 3T04D 1M7IB 3TN0C 2YN5A 1MVFA 4MA7L 2AQ3A 2HFGL 2EXYC 4JO4H 1TITA 4K7PX 5MI0B 3NN8A 1FDLH 3JV4A 2NY0B 3IJSB 4YHOH 5D1QB 1YYLL 3FOMA 5KW9H 4PJ8B 1XF2A 4R4FH 3GI9L 4PJEA 2M8XA 4GFTB 4NQSB 5E70A 1DBKL 1SMOA 4HF5H 4X6BA 1IFHH 4OB5L 4LL9A 5CBAB 4NO2A 3S35X 4UUJB 3T09A 4OQTL 2MHAB 2X4OA 4F9PC 5IB4B 3GSUA 2Y36H 1MCOH 1FYHB 1C08A 1P5UA 5CGYD 3IB4A 4V1DD 2JJTA 35C8L 3MUY1 2BSTB 1WTLA 4M9OA 4TSBL 1BQHG 1MFBL 4F8TA 3ARFD 4PJGF 3U0TA 4H8WH 3TO4A 4MA1C 4C56B 5J9PA 1BF8A 4ZFFA 3LHPL 1CYGA 3RWJA 1UKTA 2OQJB 4F58H 4C83A 1LE5A 3V6FB 2BERA 1F6AB 3SY0A 3U1SL 5LBSL 3GHEH 4O02L 5FCUH 4JPWL 1KLGB 5AZEH 1P7KB 1NCUA 1WIOA 2UYLB 1YUHA 3RRQA 4GUPB 2IANA 5ICYA 1CXKA 1MJJA 1RUAH 1UWGL 2FCBA 3NA4A 3PF2A 4KDWA 2KBGA 4WI6A 3X3GH 5DSCA 3TZVA 5D7SH 3FTGA 1TNMA 5IMKA 2EO1A 3OKYA 2Q8AH 1NLDH 2AXFB 3MGAA 4LLYB 4AENB 1X7QB 3VH8B 4PJIE 1KXQE 3HE7A 1MNUL 3AB0C 4FQCL 4IS6B 4XGZB 4LLQA 1M7XA 3EO1A 3C2AH 1NAMH 4N1HB 3BPOC 4G8FB 4PS4H 2MJWA 3QQ3B 4M8VA 3M8OL 1LD9A 2VDMH 4OD1L 4XXCC 4F80A 4L1DA 4PGCB 4JFOB 1OF2A 4JG1H 1Q9WB 5JDJA 3EIFA 3V5DA 3EFFA 2A9NH 3QDGA 5AAMA 5FYKL 2NPLX 3RWHA 3VXME 1DQDL 3WD5L 3GKWL 1U8JA 4R96B 1LP9F 3HNSH 4Q2ZA 4G9FD 5IBUG 3GDBA 2IC2A 2VKXA 1EGJL 3UBXG 4WY7H 5JLZA 3WDIA 2DLEA 4QWWD 3H7LA 5CHNB 4C54A 1FRGL 4U1NA 2Z35B 3LPFA 3O6KH 1UWEL 3EGSA 4P5TC 1S8DA 15C8H 1AD9A 2FDBP 2XZZA 4U6HB 5HHPA 3BW9B 4Z7VA 5CZVH 1GPOL 1E27A 4HH8A 1RVFL 4FFWC 5D7LE 2BNUB 3G5ZB 4LOUD 4KQ3L 1LMKA 2K9UA 3CD4A 4W6WB 3O2DL 1MLBB 3NCMA 3TVMB 1IGMH 5B38G 3DYPA 3EOYG 1A7PH 3FQRA 4ODHH 1G7IA 5D70L 3QUZD 2DQIL 4OF8A 1MFAL 4XT1C 2XZCL 5DD3L 4MJ5B 4CJ1A 4RQQB 3QWQB 1MELA 4ZOAA 4LLDB 1OAUL 1AE6H 1WZMA 3BGMB 4RX4D 3CFKB 4YHLH 1IAIH 2VERN 4HMDA 4NQEB 3G5VA 1TJIH 5CEZD 5FA3B 3G5XA 5T1KB 5J06A 4NQXA 5D9SA 1XF5B 4F37K 1UFUA 4LNRB 5F3BA 4LSQL 3VRIA 4U1LA 5EU5A 1HCFX 3S37X 1VFAA 1J18A 2LQRA 2E7LC 4HIHB 3QEHA 3IFPB 5L2KD 4GSDH 2P7TB 4PJBE 5DJ2A 3W0WA 1D5ZB 2VLJA 2VH5L 4H5SB 1B6UA 1P4IH 5H94A 5FYLE 3V5KB 5JDSA 4Z76B 4GKZB 1ORSB 1RHHB 3MRFB 1XAUA 3PHOA 1BZ9B 5HXMA 4UU9B 3VFMA 3JWOL 2OTUB 2W60A 2PO6B 3MBED 5EBLB 5F44A 3N0PB 4ZUTB 3FB5A 5I1AA 2NW2A 2VABA 5AUMB 3WHE0 2A73A 1NSNL 3DX9B 4ZFGH 2X6MA 2HJFB 1R5VB 4XCNB 4OFIA 3ARFC 4M5ZH 5HDBF 3QXUA 1I3GL 5D72L 1S7WB 4EUPB 1N59A 2VSDA 1SQ2N 4JR9H 1FAKT 3FB7A 1T6VN 4N0CD 2DWDB 3GNMH 2FIKA 4ZMAT 3C8DA 3QUYB 4KVCH 5C6TH 2HYMA 3TH2T 4HKJB 3K0WA 1CICB 5I75C 3QIBD 1C5BL 2ADJB 3IFLL 5EOCJ 4HIJB 5CJQL 3MLVH 3EOAB 3LN4B 4FQ2L 4KH2A 1HQ4B 3T4AA 4I5BA 3KPNB 5ILTH 2FX7L 5I6XC 4GG8B 4HX1B 4N8CL 3U7YH 1N26A 3FN3A 1ZT4B 1AR1C 1AGBB 4HS8H 3D85B 1I1CA 5EO0A 3GM0A 3REVB 3QUMH 3ZHLA 4M62H 4UDTA 5LXGH 1A6ZB 4JDVA 32C2A 4CVZA 1PYWB 1UVQB 4M7LH 5E5MB 3UTPD 3WL9B 5DD0L 4YXLL 3L95B 5C0BD 3P9MB 4PJFE 4OF7A 4S1SL 2OJZH 3QZWG 1DLHA 5D93B 3KNBB 5A2JH 2BP3A 5CJXA 3CXDH 4PGEA 4N0UA 1QZ1A 4MYWB 4BJLA 2E27H 4PJFB 4OIAA 1WUNT 1XF1A 2VWEC 2ORBL 1S9XA 4P4RA 4XWOD 1IAOA 4I3SL 1I4FA 4PY8I 1KJ2H 3BRGC 1G6RB 1L9MA 1YPZF 2VZ1A 2X1WL 5EB9A 3TCXA 1T21B 1N6UA 1ZT1B 5IT2L 1MJ7L 5I1CH 3MLZH 4M03A 5E8EA 2XWJA 3SJVE 2RFXB 2A77L 5IMOB 2EDNA 2PYEB 5GGQH 5EIVA 3PWVA 5F8QC 4LOUC 1DBMH 4LCCB 5ENWB 3ZKNC 1BJ1J 2E6PA 2ICEB 3CLFL 3I84A 3K46A 4L4JA 1P53A 1WISA 2NCMA 5DEZA 4ONFH 3VFRA 2PNDA 1A5FL 3ZYZA 4CRPA 4QNPE 1KG0B 3VXPA 3B8SA 2AKRB 2NY2D 3QUZC 5HYSG 4C58B 4OF6A 2ESVD 4RNRA 3WUWA 5TH2A 1MWAL 2XZQL 4XAWH 1VFOA 1OSPH 1TFHA 2W9EL 4G42A 3HRZB 3O11A 5IP4A 4JB9L 5JIIA 5C8JB 4N8PA 3O3EB 1ZHBA 5ALCL 3ILPB 3MROA 3QNXB 3MV8E 4Z7UA 5FYKE 2NY7H 3KJ6L 3UROR 3FO1A 5L88L 1K8IB 4BSVA 4M6NH 5FGSA 3FOLB 3RKPA 4N5ED 1KYOK 3MV9E 5TQ0L 1D5BA 2B4CL 3JUYA 4R3SB 1SEBA 3DV6B 5BS0D 1S7UB 3MV8B 5DHXB 3S35L 3NAAH 1INDL 3QO0A 3DETD 4KVNH 2DM2A 3MV9B 3OKEB 1EZVY 3MBEC 1H8NA 3NACL 4K23H 3ZKXB 5AZ2L 1KJ3L 4PG9B 4J1UA 3L3OB 2RHEA 1A1MB 1UEYA 4NSKB 3ROOA 4IRSD 4N0CC 1RSFA 4G6JH 3FMGH 3C6LB 3BQUC 4NKOB 3EKCA 1J5OL 1OAKL 1IEBA 2BNQE 4XNQA 1TPXC 4OGXH 4JDTL 3QIBC 1GGTA 4FTVA 2DMCA 4G6ML 2XICA 4XCFH 2AJUL 2VJXA 2Q8BL 3X14A 2ARJB 3WFDL 1E6JH 4XB7A 3FFCE 4L8DB 5DJYA 5GGVY 2HP4A 1U3JA 4WVRA 4LVNB 3F7VA 3KYNB 5ID1B 3MOAL 1QBMH 3MA9L 1KCVL 2D7NA 4OM1L 4N5UA 2X4SB 4KV5F 5TDOB 1SJXA 2IEPA 3T0VA 1A6VH 3H0TB 1BVLA 2B5IC 3GB7B 3VGGA 1FC1A 2VDQL 1L0XA 1W2KT 4XC1H 3LKNB 3BZ4A 2VXQH 1ADQA 1HSBA 3X12B 4NZUH 1T1ZA 5B39G 2GCYA 4X4XA 5GJTL 1JGDA 1R24A 2GJ6A 4LF3B 4FP8H 5LQBH 2JCCE 4ZO6A 3K8MA 3RNQB 1P6AB 2ED9A 2FO4A 3RZCA 4W6XB 4Y1AE 5BV7C 1CLZL 4P5KB 1NUGA 1M7IA 4Z9KB 4XWOC 1YMHB 4GRMB 1BHGA 1JNJA 2NXYC 3LV3A 4HIIB 3N1MC 3IJSA 4NYLB 3CC5B 5HHMD 5D1QA 4E5XA 5CD5D 1OWRM 5GGVH 1BZQK 3BISA 1Z5LA 5CZKA 1RZJL 3MV7E 4G6AD 3BKYH 4NQSA 3T3PF 5IHLB 3BWUC 2NY6B 5D2NE 3QWOB 3DURB 2WIMA 4FFYL 5DHVH 3ZSTA 2V7NA 5HHQA 3D39B 1UCBL 1UKSA 2VDPH 4UUJA 2DQHH 2MHAA 3MUGB 3QDJE 3WKML 1K4DB 3C5ZB 1LK3L 2FYYB 5I1GH 1NAKH 5D2NB 5BO1L 5IGXH 2NY2C 4U1SB 1UH2A 2VQ1B 4BSJA 1RJYB 2DQJH 3GMOB 5FYKU 4C56A 4I2XB 2DQCH 3F12A 4OGAC 1IE5A 2XTJD 4NM8L 1KXTB 2OQJA 4H1LH 1T4KB 2NYYD 2NY4D 1F6AA 1AGDB 5D1ZD 1OPGH 3SE9H 3RGVD 3S37L 5A16A 2IFGA 1P7KA 4I18B 2UYLA 3QQNA 1A7OL 4GUPA 4OGZA 4KPHH 1FNFA 4JFYB 4N5EC 4LGSB 3SDCD 1OTUC 4F7PB 5IVXB 5EU3B 4KK5C 2AJYH 4YPJA 4MA3B 1T3FB 5EZJB 3A6BH 2JJWA 5BV7H 3DETC 2MPAH 2AXFA 1IL1B 2GQHA 2LVEA 4LPTA 5FHBH 4LLYA 4AENA 3PNWA 4NO3B 4U6XB 2XQBL 1X7QA 3VH8A 3F8UB 4OLXL 1YN6B 4ODSH 4TULL 1U3HC 2V5TA 4XGZA 1X6LA 3HNTH 43C9A 2CKBL 2Q87A 4G8FA 4PG2C 3UJTL 3QQ3A 2OL3B 1A6WL 3VXRE 3MOBL 4PRIB 1N4XH 1I9JL 4BFIB 4NQDB 1P84J 4JFOA 4KI5D 3R1GL 5GGSY 1U8MA 4IRSC 3RTQB 3QO1B 3P40A 4WEBH 3GSQB 3VXRB 4R96A 1MHCB 4EN3B 3KJ4B 4YDLC 4RMTA 1W72H 4UQ2B 3BP4B 3RWEB 1OLZA 4DKFH 5E1AA 1P9MA 4OIBA 4UIKL 1GC1L 1TJGH 4NJAL 5CHNA 3S5LA 4FQLL 3OF6A 4PJCE 4BH8A 1JMZA 1MWAB 1F4YL 4JO2L 2NW3A 4NUGH 1BWMA 4XNZC 3LY6A 4U6HA 4GRLA 1NCDL 4KI5F 3K8LA 1QHOA 5L7XL 1BAFL 1UM6L 2IFFH 3MLTB 3SBWA 4HJJH 1XZ0B 4B41A 1KELH 4Z7WE 8CGTA 3EJZD 1MLBA 3TVMA 3TO4D 1W8OA 3QJFA 5K9JL 4R6UA 4KKNA 4OLEA 4PRAB 5I18H 1U92B 4MJ5A 4Z7WB 1UEMA 1V3LA 1RK0B 4B50A 2YK1H 4LLDA 3QFJE 2FO1A 4GKNB 1C5DB 3K81A 1GZQB 4YGVB 3BGMA 3CFKA 3MPCA 3WJJC 4NQEA 4ZUSA 1G9NL 2IAND 5FA3A 5GHWL 2J5LC 5DMJB 2ZSVB 4PV8B 3V6OA 3BJLA 1CXLA 4IMKA 2HVJB 4LNRA 5J3HD 3QFJB 2VL4A 3SKJH 3T1WA 2YD4A 4WTXA 2R69L 4HIHA 2JB6B 3IFPA 1UM4L 1RMFL 4L4VA 2ICES 4M7ZC 3RP1A 1YNLH 1D5ZA 4ODVH 4XHJD 1G0XA 4H5SA 1A47A 3HE7D 1JNLH 4P9HC 4BQ9A 3LAFA 3SE8L 4KMQA 1RHHA 3LKOB 3MRFA 5HYQB 1BZ9A 4JPVH 2J8UB 3LMJH 4UU9A 4XP4L 3B9KA 3MBXH 2OTUA 2VLKE 4WIQA 2PO6A 2HLFD 3MLPA 4ZUTA 3IDYC 5IIEB 3NTCH 5TF1H 1XGUA 3QDGD 2GY7B 3GSXB 2HJFA 4OM0L 1DTUA 3E3QE 4MCZB 2VR5A 2AEQL 5EZOL 2NXZC 3MR9A 5E2WH 3L3DB 1S7WA 4EUPA 3C08L 2XTJC 5JQ6L 1FLRH 3NVQA 5FGBC 1ZK9A 2DWDA 5A2FA 1F4WL 2NYYC 3QPXL 2NY4C 3QUYA 4GOSA 4PP2B 1S7TB 5D1ZC 1E4KC 3RGVC 1HYRC 1RD6A 1DQTA 3O6MH 2LVCA 4HKJA 1CICA 3S6CA 3CDYA 1RUKH 1PJ9A 2ADJA 4OZFG 4HIJA 1OTTD 1IC4L 2XNAA 5JOPE 3EOAA 3LN4A 4LASH 1HQ4A 4JANB 3KPNA 1NGXB 3BSZH 5IW6B 3BZEB 4OV5B 2J6EL 4HX1A 5JHLL 5GRJL 2R0WH 4L9LB 1ZT4A 3QP3A 1AGBA 1N5YH 3D85A 3OGCB 3SE4C 3REVA 2WIIB 1U3ZA 2CGRH 1RU9L 1PYWA 3QRGL 5KS9F 1UVQA 4WWKB 3SDDA 3WL9A 3OBAA 5AWNH 1G0DA 2W0KA 1QVOB 5F9WC 3L95A 5E0QA 4PUBL 4KI5C 3P9MA 4KRPD 4P9HH 3MFFB 4QTHB 3KNBA 4HK0B 2IGFH 4LVHC 1OCWH 2A6KA 1MHPH 4JO3H 1J9CT 4JLRB 4OLVH 4P2RE 4KU1A 3MGTB 4DN3H 1EEUA 2VLJD 1TZHB 5E2VL 1G6RA 5I1HL 4YWGH 4NRYB 2FJGA 5JHDE 43CAA 1DLFH 5JXAL 1ACYH 3JVGC 3O9WB 1FFNA 2DIJA 1GIGH 2PYEA 4OFDA 4QRQB 4NN7C 3RIFK 4I4WA 5ENWA 4DTGL 1RIVH 3EJZC 2ICEA 3CZJA 1NUNB 2B1AH 3W82A 4ZFZA 4OSUH 1I7UB 1KTLA 4CBPA 5SWQB 4JRYE 1KG0A 2ZPKL 4NRXB 4U7MA 2ZKHL 2AKRA 2UVFA 3TYFB 2NZIA 2Q20A 5IM7A 3L3JA 2BMKB 2GEEA 4QRUB 1NLBL 4XHQA 5ITFA 4HEME 5JXEC 1S9YA 2AK4B 4RGNB 5JTWA 1VACB 3HRZA 4IIQA 4RISH 4OZIE 3O3EA 4WO4A 3ILPA 4FQJL 3KLHC 1FVCA 1ZSDB 3MRGB 5T3ZE 3QNXA 5I17B 1L7IL 1KEMH 3ULVD 4EJ1C 1EEYB 1QRNB 4LQFL 5J3HC 3UTTE 1GGCH 5TPWH 1IGCH 3MRQB 4OZIB 3HZMB 4G6FD 5F88B 5GSRA 4IDJL 3U4EB 3DV6A 2CIIB 1S7UA 1AD0B 4NNXB 5E2UH 2YD2A 1MH5A 2B2XH 2QJDA 1U8QB 1NC4B 3LS5L 3PWPB 2E3VA 1JVKA 1U93B 3OKEA 3L3IB 4RA0C 2C4XA 2H1PL 4ZDHB 5D2LF 4L3CB 4XNXL 2NX5A 2HLFC 1BQHB 4XWGH 5HY9A 5F7KC 1UQSB 1BF2A 4PG9A 3OX8B 5FM5M 1QBLL 1TQCB 2XOTA 4RWHA 2CMRL 2F54B 2LE9A 3L3OA 5HHNB 4D3CL 3S7GA 4X6DB 2VYRE 1A1MA 4NSKA 1KCRL 5FCSH 4DGYL 4OLZL 1R3KB 4CL7A 5CILH 3U30B 3WXWL 3BT2H 3ILQC 5EWIL 3RKDD 2ADIB 2YSSB 5T3XD 2Y23A 1SJEB 1VGEH 3O2VL 2E8ZA 5I8OH 4KC3B 5J0BA 1OTTC 3T3ME 1WZKA 3RA7L 4HBCH 3UC0H 1T03H 1B90A 1K2DA 5IFJB 4TNVF 5H2BB 1R3IL 5MP6H 1J11A 3UTSB 3RVTC 1RY7B 4L8DA 5KTEL 3IDIB 1MCJA 2OK0H 1DBBH 2J4WH 3HMWH 1I8IA 2WINB 4P3CH 4UT9H 2VLMD 2X4SA 3HRPA 5TDOA 25C8H 2W0FB 3H0TA 2H6PB 3P4OB 2E8YA 3DUSA 3INUH 3LKNA 4OFYA 5F96L 3X12A 3BKJH 1KN4H 5JOEA 5HDOA 5IBUB 2DI8A 4JFFB 1KCSL 3UBXB 1H3XA 1RZKC 4GG6E 3RNQA 3RPKA 5DMIH 3D3VE 5ANME 5HHOE 5GISH 4MXVE 4P5KA 2Q7NA 5E9DE 1NMAH 1YNKH 4GRMA 5GJSH 1UB5B 2DLIA 3WDJA 2XA8L 4MNQD 4B7LA 4HIIA 4NYLA 3CC5A 1PFCA 4NUJA 1LO4H 2P43B 1JYXA 3O6LH 3D3VB 2R0LH 5HHOB 4XMKL 1QA9B 4WHTA 4JY5L 4Y88A 3FQXB 5IR1A 5D6DA 4TPRH 4KHTL 4R0LA 3U82B 5EU7C 5T1DH 3VI3F 4D9QD 3QWOA 3DURA 3D39A 5B38B 4U3HA 1ETZB 3MUGA 2CKNA 1U8HB 3KPRE 4BUGA 1OY3B 4YHYB 2PR4H 1WAAE 1K4DA 4ZPTB 4HZLB 1I9IL 2E6JA 3C5ZA 2HT2D 3NIGE 2FYYA 2GIYA 1LO5B 1YEEH 4U1SA 2VQ1A 3KXFD 4R97C 4PJHA 2IPTH 5L9DH 3IXTB 5C0IB 1RJYA 1XGTA 4O58H 1CL7L 4I2XA 3V4UH 4FA8A 2JELH 5CD3B 1CE1L 1N0LA 1RJCA 1BBJB 3V0VB 1A6TB 1PDKA 5DQDL 4YXHL 1T4KA 2A9MH 1EO5A 1C12B 4FTVD 4EQ3A 1AGDA 3AVEA 1J0JA 1A7RL 3ULVC 5E08H 2HG5A 1RIUH 1MLCB 4DGIL 3H9ZA 4OJFL 5H37G 5JW4M 1F5WA 5TGBB 3QCVH 1L7TH 1AIFB 1CK0H 3GMMA 4I18A 2YR3A 4TNWF 3CPLB 4JQXA 5I1LA 4XXDB 1IZKA 4G7VH 4XPFH 4F7PA 5IVXA 5EU3A 4MJ4A 3SN6N 4KTYA 4MA3A 3V0WH 1T3FA 2OZ4L 1X5GA 4LLUB 3Q2CA 1JPGB 1YEHL 1DE4B 2RQ8A 3GMPB 1D6VH 1WWCA 4U6XA 5BMFH 4R2GD 1RUPL 1YN6A 2QTEA 5DVLA 3ZMRA 4QRRE 4ELKA 3OG4B 5HGHB 4JM2B 1MI5E 2XY1A 4IOFD 2OL3A 3D9AL 2HH0L 2C4FU 1V8HA 4PRIA 2GJ6D 1FZKB 2YKLH 4BFIA 2F5BH 4NQDA 4V2CB 1FN4A 2H3NA 3MREB 2VDRH 3E8UL 3RZCD 3VG9C 4QRRB 3I6KB 3RTQA 1QFWL 1SJHA 3QO1A 3GSQA 2FWOB 4GW1B 5EO1B 1MHCA 1G7JB 3X13B 4S0SD 5EA0L 4DEPB 1QNZH 2NY0D 4POZD 4UQ2A 3ZTJH 4LEXH 3BP4A 2WMPA 5D1QD 5TE6L 3RWEA 4HPOH 5IWLC 3P11L 5DGQA 1Q1JH 3RUGF 4PJ8D 4D0BB 2J88H 4NT6A 5SWZB 3EHBC 4XMPH 5JW5B 1JZ2A 1DN2A 1H15A 2KPNA 1G7LB 2ZNWA 4Y19B 5DA0B 1Y6MR 4PPTA 5J12C 1D7FA 4NZDA 4M1DH 1Z0MA 3H3PL 5DZLA 2OP4H 2WQRA 3MLUH 2BVPB 5TQ2H 2VO5A 4RBPK 4U7SA 4K2UL 4NGHL 1CXFA 1JGLL 2PTTB 4UAOB 4ONGL 3OAZH 1SY6L 3KG5A 1XZ0A 4EKXA 4Z95L 1AHWC 4C56D 4HLZG 1UCTA 4K3HA 3QZWB 3HAEG 2XA3A 4XVJH 4PRAA 3MACH 3QHZL 5D7JC 1U92A 1UJ3C 3AY4A 4Q74A 1VADB 3TYGL 1BM3L 2YN3A 3N1GC 1RK0A 3MTRA 1DZBA 4GKNA 1C5DA 2PN5A 4MJ6B 2MCG1 1TJHL 5HGAA 1AO7B 4KUCD 1QSEE 2HRPH 3B83A 5FUZL 4JQVA 5IQ9B 1LO2L 1FAIL 4L29B 2ZSVA 4JHAH 4BM7A 4PV8A 4FFVD 1I1FA 2HVJA 1KPUB 4UILL 1OVZA 4R4FL 2WUCL 2Y72A 5C3TA 1J1OH 1Z9MA 3JXAA 5DJ0B 5H8DA 3TT1L 2A2QT 1YEFH 5T3XH 2YRZA 1JF5A 5FV1L 5I76A 4XBGA 3LKOA 5HYQA 5E24E 4MD5B 4O5LL 5F70A 3BMWA 4X6FB 2VAJA 5E4EB 4X4YA 3SO5A 5KVMC 5HYSB 4LRIA 3RBGA 1EBPA 2JF1A 4YHKL 4NBZB 3WLWD 1LWRA 3L1OL 1GHFH 4ODWB 3GGWB 3EDDA 3IF1B 5F9AC 5C0EB 3P0GB 4ALAL 4BZ2L 3T4YB 3P3YA 1BBDH 1EA9C 4PP2A 9CGTA 1S7TA 3OZ9H 2QQNH 2XZAL 2HKHH 4FRWA 2HKFH 1UC6A 7FABL 4Z8FL 1CR9H 1PAMA 4GRLD 1NFDE 2X4PB 4PJIF 4GS7C 2E9IA 4JANA 4NP4H 1NGXA 5IW6A 3AM8C 5D7SL 4OV5A 2G9HB 4EEEA 5DRXB 3TVMD 3EOTH 4KDVA 4LSRH 4L9LA 3O6FC 1NFDB 4R2GC 3OGCA 4MQXD 3VDAA 4HC1L 4PS4L 3U4BH 1X3DA 4HHAB 1CD8A 4UT6L 4IOFC 3MNZB 1E4XL 5I1JH 3M07A 3WXVH 1A22B 4WWKA 3FCTB 1AGEB 1ZTXH 2GTZB 1JL8A 4PJ9B 5I71B 2IQ9L 4JCLA 1A7BA 4J3WA 3RFZC 1ND0B 3MFFA 2QSCH 4NQED 4X6EB 4QTHA 1TNNA 5KSBB 1I1AB 4HK0A 1ZGLM 1JHKH 4O51B 5T1KD 3CX5K 1J7VR 5MI0C 4XPHH 4I3GA 2NY0C 5GQBA 3WFCH 4JLRA 3BHBB 1EHLH 1JCKA 4OLYL 4QTIH 3AS1A 5I1EH 1QLEH 4PJ8C 4AIZB 3MGTA 4L4VD 3MJ9H 5KSUA 1TZHA 1BVKA 3LKRB 1KCUH 5E8DL 1NCCL 3R06B 5J4MA 5GS2H 3VXSB 3B6SB 4OCWH 2D7PA 4WCYL 3CVHL 4M6OL 1IGFL 3UX9B 2Z8VC 2YD6A 3HMXA 3O9WA 2PO6D 4N1EA 4QRQA 2EYTB 3NCBB 3ARZA 4PGZA 5FYLD 3GZKA 4KGJA 4FABL 3WJLA 4WUKL 4WHCA 5FM4A 5GS0D 5HSFA 4N9OB 4TSAL 3FFDA 5KJRH 2C3WA 3TYFA 2P44B 2CR3A 3Q6GL 2DTSA 4QRUA 1V3KA 3CVIL 3QUYD 5CSBA 1PKQA 2AK4A 4OFKA 3TV3L 1WEJH 3TBWB 1VA9A 2HTLD 2UV3A 1VACA 1LK2B 3TFKD 3P0YH 2ZOLB 1J0YA 5J57B 1CICD 3RU8L 1AI1L 1A21A 1J1XL 3ARGB 2HTKD 4EDWL 3MRGA 1JRHL 4PJBF 1C7TA 3DV4B 5I17A 3PQYB 3LN5B 4FFVC 1QRNA 4DUVA 2VQUA 2Y7QA 4ZPVA 3NZHL 2EIBA 1DBAH 3MRQA 3HZMA 1QRKA 5F88A 4LU5L 4TVPL 4XMLH 3WIIL 1FE8L 3WFZA 3D85D 5DD5H 3U4EA 3IDUA 3MO1B 2CIIA 4NNXA 5KVEH 1H3PL 4LHJB 3SGEH 5F7EH 3OXSB 4LGPB 1NDMB 3PWPA 4R8WL 3DOSA 4HKBB 1IKNC 3L3IA 5I73C 1JE6A 4UINH 5CINH 1AC6A 4L3CA 3MRCB 2UZIL 1CQKA 4NC2B 1BQHA 1OSZB 1FO0H 2I9TB 2AV1A 1RUML 1UQSA 3RWFB 4LP5A 2ZUUA 3OX8A 2P5WB 2XKUA 5C9KA 1GGIH 3WLWC 1EV2E 5HHNA 2HFFB 4X6DA 2DB8A 2EZ0D 3P73A 4OKDA 3RPIB 1CLYL 4K7FA 4XPGH 3LKQA 1EJOL 2GJZB 1YEDB 3SCMB 2H8PB 2P1YA 1X5LA 1R3KA 3GEWB 3T2NL 2FRGP 2XN9E 3SDYH 2ADIA 4NFDA 3FHQA 4AIOA 4XPAL 3VFOA 1SJEA 2AJVL 3CGTA 3BZFA 2R2CA 3LEYL 3BH8B 4WI3A 5DD6B 4M1GL 1TIUA 3I3EA 2PYED 2XN9B 4NFBA 4LPUA 3RVVC 5H2BA 1NGQH 4JN2B 5HI5C 1MCPH 1J12A 3UTSA 3TVMC 3V4PH 3ARPA 1P4BH 3IDIA 2W1NA 3QUKB 3HG1B 4YDKH 4OCYH 4NHUB 3QUML 4M62L 3CSBA 2WINA 4MQXC 1XR9B 5E4IA 2KH2B 3S98A 3B9AA 2R9HD 2W0FA 5FKPB 4PJ5E 4M7LL 3KVQA 4MD0B 4D9LL 3VXOB 1PSKH 3G04B 3O8XC 1BLNB 4PJDE 1AXSB 4LPWA 3SDXA 3FB6A 4GH7B 4LKCA 4WO4D 1U91B 2D4FA 4AMKL 5ADPL 1JBJA 2QQLH 2H45A 4JFFA 3UBXA 3UYPA 4PJDB 3WS6A 3IDGA 1JNHB 4U6VL 1MUJB 3MJ6A 3Q5TA 2XYCA 1UT9A 1KJ2L 5C0AE 5C70A 2V2TA 5IHUH 1UB5A 3MV8D 1MRCH 3MLZL 5FYKD 4D9RE 4K8RD 4RRPG 3G6DL 4ERSL 3VJ6A 3TM6A 3MV9D 4X9FA 3FQXA 4QNPF 3ARWA 2PO6C 3FT3A 4LMQE 2H2PD 1DBML 4YBHA 2AABH 3MGOB 5E8PB 3RGHA 5DURB 4F57H 1VFUA 5LJYH 1ZS8B 2P5EB 2GSGB 2VXVL 3GKZA 5B38A 4HCRA 1F4XH 1U8HA 1A0QL 5GS0C 2OXGA 3IFOB 4QRSB 4ZPTA 3RDTB 1LEIA 4HZLA 3MRJB 1LO5A 4WI8A 5FM5O 5C71A 4ODTL 1WIPA 4OD3H 1BJ8A 2DD8H 3C6LD 3QUYC 4CVXB 3IXTA 1XCTB 4PV9B 3NIFE 4NQUA 4EIZC 5TF0A 4K07A 2HTLC 5CD3A 3TFKC 5DS8B 3I6GA 4XPTH 1BBJA 4H20L 3V0VA 4UDUB 1J8HB 4HUVA 1A6TA 2VOTA 2Z92B 4G8GB 2W38A 3LDBC 4LHUG 1C12A 2HTKC 3K2UL 1HQRA 4MSWB 1CZ8L 1E4WH 1MLCA 4KK8C 3KYOB 1T6WA 3TH4T 1K3ZA 1LDPH 4OCNC 5TGBA 1AIFA 3ZDXE 3CPLA 4HIEB 1T89A 4Y4FA 3MLRH 4XXDA 3RNKB 1H3UA 1SM3L 5DJCA 1AP2B 2KKQA 3OAUL 2BY2A 5D7KD 5E8NB 4B7IA 4LLUA 1JPGA 3EJYD 1DE4A 1S7XA 2YD9A 3GMPA 3BN9D 4WFHE 4HQQH 3PWNA 5IESL 1MFEH 5INDB 5GRXG 2FBJL 4MVBD 3QIWB 1V7MH 4OFYD 4ZSOE 1KNOB 4U0QB 5D93C 2WZPD 2CR6A 2AQ1A 3OR7B 4NZTL 4JZOB 4YUEH 1FZKA 5ACZA 4XP9H 3MREA 2EZ0C 3S36H 4ORGB 4MAYB 4ZSOB 4MWFB 3I6KA 3O45A 5FYLH 4Z5RB 2XPGB 3IGAA 1J0HA 4M5YL 4XZUB 2NR6D 2FWOA 4XCCH 4YO0B 2P8MB 1UGNA 1G7JA 4MS8D 3X13A 2WBKA 1C5CH 2R29H 4P2QE 3NFPB 5JA8B 4JFEB 1RJZB 3FQWB 1OB1B 4O4YH 4HWNA 1YECH 4D0BA 1IGIH 5SWZA 5JW5A 1H0DB 5EPMB 1K8DA 2CDEA 3ZE0E 3BKML 1MAMH 4Y19A 4MA8L 3D18B 2NY6D 4NNPH 5HJ3B 1E6JL 5F21B 1NDGA 4LCCC 4MJIE 2EO9A 3D39D 5DR5H 5CEZL 3MV01 4QXWA 3HPJB 4PLNC 1QBML 1RV6X 5KAQG 3IAQA 1YEJH 4HS6B 3C5ZD 5F9DC 3ZKMD 2Z91B 2PTTA 3RY6A 4TVPE 4LHQB 4F2MB 2DYPB 3UZEA 3MCLH 4FQIH 5IG7B 5C6WH 1JI1A 2JCCF 4XC1L 2VXQL 2VLRB 5KSAB 3D48R 3QZWA 4Z7NE 2IMNA 5C07E 3IKKA 2EXWC 4MA7H 1VADA 2HFGH 3ARXA 4OD2B 3VXUE 3HUJB 1MIML 1QSFE 2DQDH 3CMGA 1F4HA 12E8L 1UZ8A 5GRUL 4MJ6A 1YYLH 1AO7A 4Y8DC 2OR8A 4FN0A 1YDPA 4N0FB 1C1EL 3GI9H 2FJHB 5IQ9A 1T22B 5CIPB 5F1KC 4L29A 1DBKH 3CZFA 1QSFB 2B0SL 5B8CA 5H35A 2YPLE 1OM3L 5GGVL 1KB5B 3EYFB 4OB5H 3X11B 4HGMA 4PRPB 5DVOA 1J0ZA 1IC5L 3KWWB 4OQTH 4QOKA 5I1DB 5DJ0A 35C8H 1G6RH 2H2PC 2YPLB 3T0EA 4MQTB 4UIMB 1MFBH 4J8RB 2XRAL 4Y4KA 4HKZB 2AXHA 4JCMA 4PRID 2DTML 2AK1L 1IM3A 3KPQB 4MD5A 4CGTA 3LHPH 1KLUB 4X6FA 4LPVA 4NQDD 2G75B 5I30L 3OQ3B 4I48B 4FQQB 5IGXL 3VD3A 2ERJB 4J23A 2ZUQB 4MZ3A 2X4RA 2VUOA 4X80L 1SHMA 3RTQD 1WTGT 4XX1E 1JGUH 3U1SH 3C6LC 4PJIA 4EN3D 1B6DA 1Y18B 4O02H 2CK0H 3RHWK 4JPWH 4ODWA 5C92A 5C0EA 3IF1A 1KUMA 3GBLA 3T4YA 1SBSL 1LVEA 4NBXB 3TP4A 4WI2A 4RWYL 2Y5TA 4DK3A 1UWGH 4LEOA 2EE2A 3HI1A 5ERWB 1B88A 4P2CG 4WTWA 4IRZL 3HC4L 3BRDA 4RFOL 2RIKA 3IDMB 8FABB 3V6BR 5JW4R 1D6EB 4V1DE 4LVNC 5EULV 1MNUH 2C9AA 4FQCH 5BW7A 4G80B 4A6YB 3BKCL 2W92A 4X83A 5BV7L 3VD4A 3HZVB 1JGVL 1HNGA 2Y07L 5DRXA 3QDMA 5IOPB 4GLRI 4O2EB 4OD1H 5GRVL 1A6AB 4FG6C 4K71B 3WFEL 3BN9C 3AUVA 4NOBA 1EHNA 5CJ5A 1T66D 3W11C 4MVBC 5FYKH 3VXNB 1DQDH 3GKWH 1ZE3C 3MNZA 3MCKA 4U1MB 3FCTA 1AGEA 2GTZA 4PJ9A 5TE7L 1I3UA 1EUUA 5IJKA 5DUML 4LCUB 2OS7A 4U6YB 1IMHC 1ND0A 4X6EA 2CDGA 4BA8A 3C5JB 3ZZ1A 5KSBA 3H9SB 2VSCA 1FRGH 1I1AA 3V7AG 4O51A 2NR6C 4DOHE 2GFBB 4MS8C 4JPIA 1UWEH 4PJCF 2Q76A 2AAVA 2AXGA 3BHBA 1HK6A 4KZEL 1IARB 5DZOA 4JREB 3ALXA 3EW3B 1G9ML 1GPOH 1KCLA 1RVFH 1CG9B 3LKRA 5GGUB 3R06A 2NY6C 1A1OB 4KQ3H 4Z7WF 3HZKB 3O2DH 4NUGL 4GAJL 3B6SA 3NPZB 3S88L 1TVBB 1JNNL 1FFRA 3P30L 3ZDYE 4HJJL 2DQIH 2EYTA 3C5ZC 4NNYB 1MFAH 5DD3H 3ZKMC 5GGRB 3ESUF 5D2NC 1J87A 5E03A 2OTWB 4G9FE 5D71L 3L5JA 1FNGB 1UXSB 3TBYB 4G3YL 5A2IH 3TA3B 2HT3D 1LO3H 3OKNA 2YS4A 1OAUH 2VWEE 4XCYA 2Z8RA 5BZWB 5F9JB 4Y2OA 4LLAA 5B39A 1B9ZA 2GAZB 3U36B 3SPVB 3JUZA 3TBWA 1LK2A 1R3LB 4ODUB 4M48L 5DFTA 5GS1B 4I18C 4ONHA 1HYSD 4JQXC 2WBJB 3EZ8A 4WNQB 2YPVL 3DV4A 2VH5H 1S7SB 3PQYA 4TTGA 3LN5A 4YQXL 4O2CA 4AEIL 4WI5A 5F3HB 1A7NL 3TJEL 1FPTL 4X6CE 2DQEL 4CDGC 3JWOH 5DHYB 2BCKB 3GRWA 4HMCA 3VG0H 3W39B 3L7FB 1NSNH 2KUTA 3AREB 3L5HA 1NDMA 3MBXL 4HKBA 1I3GH 4WWKD 5DI8B 3CFIC 5D72H 2R39A 4FHBD 3MRCA 3GJFH 1NGYA 5CEZE 4JY6B 1OSZA 1LO0L 2I9TA 2PTUA 3RWFA 1DUZB 3RTQC 1JTPA 2P5WA 4PJXE 4EN3C 4L8BB 1NJ9A 2GUOB 1FLRL 1MRDL 4CMHB 1C5BH 3IFLH 4KJPC 3TEUA 5L2KE 3RPIA 1QFHA 5CJQH 2GJZA 1YEDA 4P57B 2H8PA 4FQ2H 4Y5YC 5JZ7D 1WJ3A 4ETYA 4HH9B 2FX7H 4EXPX 4OZHA 4LPXA 4N8CH 3OV6A 3HN3A 4CN6A 1TCMA 3PL6A 4XRCB 3TJHC 1MJUL 5KG9B 3BH8A 5DD6A 3O9WD 1JI2A 1I7TB 2W0LA 2KQNA 3TCLB 3FZUC 2R0WL 4JN2A 3IFNL 1XIWA 5IVOA 4TQEH 4FFZL 3QUKA 5DD0H 3HG1A 4LCIL 4YXLH 4NHUA 3P2TA 1ZANL 2X09A 3ARBB 3SJVA 4S1SH 1LEKB 1MFNA 4Y16B 4O9HL 5C0GA 2B4CC 3OJMB 2A1WH 3VXOA 2AK4D 4RGND 3G04A 2HN7A 2EE9A 5J1AB 1BLNA 3QG6A 1AXSA 3WFHB 2Z31B 1BIIB 3MRLB 1NUFA 2AJXL 1HINL 3KYKL 1FZOA 2ATPA 4I3SH 4K7PY 4RMRA 5I8CB 5IBTL 1QRND 3I3BA 3BIBX 5IT2H 1OARL 1VENA 1JNHA 2B20A 1G6VK 1MUJA 4U1HB 2X4UB 2A77H 2WQ8A 1DVFB 5GGTA 3GUTA 1JIBA 2Y1VA 2YUWA 1L6ZA 4YDVB 1NC4D 3CLFH 3UTPE 4HAGA 3PWPD 1ACYL 1KTDB 5C0BE 3U6RB 3CSYA 1A5FH 2BC4B 3DHMA 2FLRT 4FXGA 2ICWJ 4WI4A 1VEPA 4PLJD 5C86A 2B1AL 4OZGE 1B2WL 3HNVL 4NRZB 4WENB 5IF0B 1MWAH 2P5EA 2GSGA 2XZQH 4NC1C 4XNMA 1Q9LB 1F2QA 2W9EH 5JMOC 2F54D 2HT3C 3IJYB 4OT1L 3IFOA 4JB9H 1HH9B 4UTAH 3HAEB 3NZ8A 1HWGB 5IMLA 2A0LD 3MRJA 3MUHL 4M7KL 5IMMB 4MDJB 3FJTA 5BQ7B 4LLWA 4YR6B 2DMKA 1SYVA 2X4NB 1F13A 1JHLL 4RISL 3HC3L 5L88H 5DS8A 4JJHA 4UDUA 2Z0BA 1J8HA 4U49A 5CZXD 2Z92A 4G8GA 4BFBD 1HYSC 5TQ0H 2B4CH 3E0GA 3PABB 5MEOB 4MSWA 3RWGB 5C3LD 3H9YA 4U1KB 3S35H 3D2UB 2ENSA 1JP5A 3KYOA 1INDH 1Z3GL 4Y7MA 3UTSD 3P4LA 3UMTA 3NIDE 4HIEA 3RNKA 3WLBB 1DCLA 4L9LC 2B2XL 5C0JB 1AP2A 2ESVE 2QEJA 5ISZB 5E8NA 1KJ3H 1D5IL 4I3RL 1ZVYA 3DIFA 1AFVH 1DEDA 1S9VB 5AYUL 4WWKC 5T1LB 5E00B 3R8BB 4LARL 4Y2DB 3QIWA 5BOZG 2XXCB 4X5XB 1RZJC 1KNOA 1KJMA 1MAKA 2PXYB 1CFSA 1P2CB 4CVWA 1OAXL 3VFVA 2P49B 5IHZB 3VGAC 1J5OH 1OAKH 4JZOA 3DXAE 4JFFD 3DLQR 5CAYB 4JDTH 5FGCE 2EH8H 4RMWA 4MAYA 2EDDA 1TQBB 3S5LG 3T3MF 2XPGA 5BS0E 4LIQL 4YO0A 4G6MH 4HFWB 3VDCA 4JZJB 2QSTA 2AJUH 5JZ7C 4U31A 4F3FA 1Z2KA 3DXAB 1NBZA 3HS0B 3QNZB 2Q8BH 5EUOB 1Z9OA 3NFPA 3GBML 3WFDH 4JFEA 1RJZA 3FQWA 4OZFA 5HHOD 3QT2A 1T03L 5DTFB 1BVZA 2ADGB 1H0DA 3DTXB 2FGWL 3O9WC 3MOAH 3MA9H 4OM1H 1KCVH 2ZOKB 5MP6L 1OD7A 5DJ6B 1AQKL 2F8OA 2MSPA 3B5HA 4OCXL 2VDQH 2VL5B 3KPSB 3WJLC 5C09A 2QADB 3HMWL 1NL0L 5GIRB 3HPJA 1EERB 4HS6A 2Z91A 5HYIA 2WWMD 4F2MA 1ZEAL 1YEGL 4JFZH 4TUKL 5GJTH 2I5YH 3MRBA 4PBVC 1ZVSB 3INUL 4RGNC 1AKJA 5I1IH 2VLRA 3MRRB 4GG6F 1XGRB 5HPOA 4RGOL 4H88H 4RAUB 5DZNA 1OAYH 1CLZH 4MXVF 2NMSA 3QDJA 4YPGB 1I75A 4OD2A 1QFUH 2EECA 3HUJA 4H0HB 4WI9A 3QA3A 2CRYA 5GISL 3Q5YA 5E94B 1RZJH 4GRWB 4Y4FD 5GJSL 2AEWA 2FJHA 4HBQA 5FKAB 1T22A 4E42A 1M1SA 2X1QA 2FLBT 2P4AB 2QL1A 3EYFA 1KB5A 4FFYH 3DI2B 5LGKA 3X11A 1XGYH 4PRPA 3WO4B 2BDNL 5I1DA 5GPRA 3BRFA 3WKMH 1NMBL 1WAAF 5EZIL 2ATKB 1LK3H 3NIGF 5BO1H 3OAYH 1RZIA 2WUBL 3QEQE 2K3TA 4PLJC 4UIMA 4J8RA 4JM2D 1YY9D 3QH3B 4HKZA 2C3GA 5DJAB 3U0PB 3WIHL 5BOPA 4WW1A 3VI4E 4ZUWB 4I0PB 2G75A 1YEEL 2ZWLT 4NM8H 3TLRA 3IRZA 2IPTL 3QEQB 1EO8L 3V4UL 5HHME 3U30C 3S37H 1Y18A 3CH1A 3G6JB 3THML 5CGTA 1JV5A 5CZXC 1VGKB 1ORQA 3FAWA 5SWZD 3RAJL 5EU6B 3H9HB 5LGHL 3TIEB 1JYNA 1CDJA 4Y19D 3QCVL 3S34L 4XI5D 3ULUL 3ZL4L 3QXTA 3IDMA 2YHGA 8FABA 4G7VL 4CVUA 2XQBH 4HSQA 1IM9B 2FECI 4OLXH 4XNYL 5BVJA 1HDMB 4TULH 3NBNA 3Q3GB 1RZKL 4G80A 4A6YA 2CKBH 5SX4I 1MHEB 5F6HJ 3HZVA 5F1NB 3UJTH 3ZE1E 2FGZA 1G9NC 2UUDH 1A6WH 3FN9A 3MOBH 4O2EA 4Y4HC 4BK4A 5IOPA 1S78D 1A6AA 1FFOB 1BFSA 2XTJE 3S9DB 1ROWA 1PX4A 3GSNB 2E7CA 2VAAA 1P7HL 1RJLB 5E6IB 3PP3K 4JAMB 2WNGA 2WLZA 2FL5B 3SQOL 4P46B 5DWUL 4AM0B 4U1MA 4W4OC 1N0XL 1PBYA 1LE9A 3WS6C 1AO7D 3WNPA 4WW2B 5EFIB 3C5JA 4ZD3L 4UIKH 2R0ZL 4NJAH 3SKOB 3H9SA 4FQLH 2VUYA 4LEXL 1IC1A 2GFBA 5FECB 4XP1L 1FV1A 1IGYA 4JO2H 1IQWL 3HKFA 4YH6A 1NCDH 1BGXH 4R90L 2VXUL 5L7XH 4DFIA 1I7ZB 1CG9A 1BAFH 1LGVA 3T0ED 5GGUA 3JWNC 1A1OA 4W4NA 3HZKA 1L0YA 5CEXB 4YDIL 5TDNB 3MLUL 5IEHB 4Y4KD 2D03L 1TVBA 3ULVL 4NQVB 5K9JH 4YHYC 1T1WB 4NNYA 1GOHA 1CT8B 1ZLWK 4KJYB 4Y5VA 5GGRA 2CDFA 5IROC 2OTWA 1FNGA 1UXSA 1KN2L 3TBYA 3U7AA 5I8EB 3TA3A 4CMMB 3MNWB 3LEXB 4TRPL 2AEIT 3MACL 1OT1A 5BZWA 4PJEE 2APVA 2H26B 1G9NH 1WT5A 1J1PL 5GHWH 5HVWA 2GAZA 4RMUA 3U36A 3SPVA 3N1FC 4QHUB 4V2BA 3BOVA 1R3LA 4ODUA 3NMEA 2DJUA 2MOVA 2R69H 5GS1A 1UM4H 1RMFH 1T89C 2WBJA 1JF6A 3BMVA 4WNQA 1S7SA 2V9QA 4ZS7L 4HWEL 5C08B 4FQXB 4Y5XB 1VERA 3SE8H 3IJHB 2R8SL 3QDMD 5F3HA 3SKUD 4NDMB 3QG7H 4XP4H 5DHYA 3PHSA 2BCKA 3W39A 4PD4K 3L7FA 1YEFL 3TO4B 5AEAA 3AREA 4ZAKC 3ZE2F 4F15C 4BFEA 4JM2C 1MEXL 5HVHB 2AEQH 3FRUB 5EZOH 4YHZL 4J4PA 5K9QG 2AV7A 5DI8A 5KVFL 4PJ9D 4PP1D 2QKIB 1H5BC 4N8VG 2IANE 3C08H 1LE5B 5JQ6H 1BOYA 1YMMB 2Q1EA 3FT4A 3TNMB 3QPXH 1DUZA 1I1AD 1AXIB 3BEVB 1F4AA 1QFWM 3U83A 4L8BA 4DEPC 2CIKA 4KUZL 4JGJA 4NQCB 4RZCB 4CW1A 4LHUB 1IC4H 4RGMB 4P57A 1R5WB 1NFDF 3WNMA 3TZVB 1F90L 4MAUL 4PRHB 4HH9A 2J6EH 5CKAA 1G7HA 3QXVA 5JHLH 2V2WB 1UH4A 5GRJH 3VXSD 4P2YA 1HEZB 5C0RL 4XRCA 5KG9A 3EO1B 3QDGE 1I7TA 1FZJA 4DVBA 3OJ2C 3TCLA 4UAOC 3MJ7A 1RU9H 1MIEL 2FH6A 3QRGH 1OF2B 3E6FB 1S78C 1FIGL 1N7ML 4PUBH 3QDGB 3ARBA 1HXMB 3Q5OA 3ZDZE 1HXYA 4Q2ZB 3BFOA 1OL0A 1I7RB 2DMBA 3Q1SL 4H26B 3VWKC 5J1AA 5ESQB 3WFHA 5J13B 2Z31A 1BIIA 1CXEA 2QLVB 3MRLA 4K94C 2RGSA 2HMIC 2YA1A 3ARGD 4ELMA 4WFFD 5I8CA 3DVIA 4TUJB 5E2VH 1R0AL 3PQYD 3EGSB 3WFCL 5I1HH 1S8DB 1EHLL 4QTIL 5L0QB 4ZYKA 5KVDL 5JXAH 1K85A 2HWZL 4Z7VB 2VQTA 3VGBA 1EDQA 1T2QL 2DQTL 1RULL 1DVFA 4WEMB 2ADFH 1G0YR 2DI7A 4DTGH 4YDVA 4D8PA 5DQ9A 3FKUS 3MODL 4GXUN 1KTDA 3UJJL 1EEZA 3FQRB 3RIAK 3U6RA 1NGPL 1DR9A 4MNGB 3Q48A 2ZKHH 5I2IB 5E4EC 3CUPA 2YXMA 4WFGD 1I9EA 4UB0L 2EDFA 4NRZA 3F58L 1U95A 1JWMB 1NLBH 4PTUB 2WSKA 4YAQB 5IF0A 4BELD 2P5WD 2X89D 5F7LB 4CN4A 2C4FT 3IJYA 4WWID 1HH9A 4FOMA 3HAEA 5GZOD 1K6QL 4KI1A 5IMMA 4MDJA 3W0WE 2VLJE 3OHXB 4FQJH 4YR6A 4IMLB