2CD0A

Structure of human lambda-6 light chain dimer wil
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAM
publication title Tertiary structure of human lambda 6 light chains.
pubmed rcsb
source organism Homo sapiens
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cd0A00
4EVNA 1TTGA 4RIRA 2QSCL 4HK0B 3L3KA 5D1ZC 5IESH 3CDCA 4JZNA 4U05A 5AEAA 3IGAA 3TT3H 4HIHA 3LHPH 1RZJL 3DMMB 4PJAE 4JFEE 4MQ7B 4WWKB 4PRDB 3OF6A 4HEME 1X5JA 2VZ1A 1X6NA 1T0NB 2UVEA 3K2UL 3JBG7 4WW1B 1F58L 5T3ZL 1D3CA 3BP7A 3MV9D 1NC4A 4LASH 1P7KA 4NQDA 1U8IA 2CLZB 3SKJH 5L9DL 2AQ1A 3MLYL 5TDNB 2VLLB 1CDIA 2JJVA 5D7KD 1GYAA 4JPKH 4U3CA 1T1ZB 4HS3B 4CADB 2YSSB 2F8OA 2IBBA 3HHRB 4OF8A 3GI9L 4OZGA 3F7YA 2Z93A 3QEUB 3M07A 4YX2L 3M8OL 4JG0H 4DW2L 1JYNA 1T1YA 4MWFA 4X7DC 5D5MF 4BQ6A 3OWEA 3QWRD 3WNNA 1T89C 4PRPA 3MV9B 3UC0L 4L4TE 3QHTC 3VFSB 3DMMC 3PP3K 4IJ3B 3EOYG 3OL2A 4LRNL 5D2LA 3HA0A 4XCCL 4UINH 3IRZA 1B0GB 4YDKH 4WEMB 2EECA 4XP6H 4QHLB 3MCKA 3ZL4L 2ZJSL 2BJML 2AW2A 1BQLH 4Q9BA 1D5BA 4QRTA 4POYA 3X14A 5MENA 2B20A 1IGYA 2LABA 3CFKB 4M6OL 1JP5A 4HZLB 5CP3A 2E8ZA 2JB5L 4MD5B 5KS9E 2P5EA 1G0DA 4YFLF 3SGJC 3TNNB 3V4UH 2IPTH 4WFED 2MWCA 4MJIA 4E41A 3B2VL 3JV4B 4S0SD 1AGFA 3GMQB 5J6GA 3MLZL 1QBAA 5I8EA 1RSFA 4MB5A 1R6VA 3MZGB 3MLSH 3ZKXB 5BZWA 3RA7H 2VB5A 4OZIE 1HHKB 1ITCA 1DANT 2H45A 1H0DA 1F11A 3SDXE 3PWNB 4RGMC 3P4LA 3MPCA 4MCYA 4LCYA 4Y0GA 2HJKA 1JZ8A 5AYQA 3ROLB 2DM3A 1ZHNA 4NGHH 3GFUA 1T5WA 4ZSOE 4R4BA 4BUGA 3HC3H 1T2QH 5EC2A 2GJ6D 3I85A 3RWFA 4BSWA 4R4NC 3SGDI 2QHLA 4YWGH 4G6AC 4X6CA 1ZHLA 4Z5RA 4X4YB 4XBEH 1YA5A 4U6HB 2IAMA 2FO4A 2JIXA 3H9SE 3IFLH 4OZ4B 5ICXB 3IAQA 3ZKXC 2BVOB 3FN0L 3G5VB 3QUKB 1IE5A 3QDJD 2GJ6B 4GKOA 5HHOE 1KLUB 4M6MH 4OI7A 4N0RA 3MLUL 4F58L 5GJSH 1QYGH 4PJBE 4E9LA 3UMTA 3KJ6L 3RTQA 4R0LC 3HC0B 4ZFOL 4NQXB 4YDLC 3ET9F 3N9GH 4L8CB 3GSNA 5B38A 2PW1B 3U83A 4Z78A 1EDQA 3WYRA 2VSDA 4ZXBA 4X99A 3QDJB 4TVPL 3VXNB 5EUKA 1IM3B 1K3ZA 3WKNA 3ARGD 5ANMA 2XZZA 2OX5A 4YZFF 2HFEB 3IJSB 3VXRD 5SWQB 1O7VA 3S37X 3RWCB 3PDOA 1KULA 1LK3H 1A3LL 1EGJH 1FNSH 4K2UH 5DC0A 3VWJA 4BYHA 4HUVA 5DD0H 3QNYA 3BD4A 5FB8B 1E28B 5GHWL 3TBWB 5C07A 2OBGA 3ARGB 2R0WL 4XAWH 3F5WB 3VXRB 5KTEH 1WV7T 4M7LL 3LRGA 2P7TA 1F3RB 1PLGH 4G42B 5KW9H 4TSBH 2R69H 4QRRE 3S4SA 1BZQK 1ZWIB 4L1DA 4F9LA 5ALBH 4PV8A 2C3XA 4TTDC 1CFSA 5ICZA 3S6CA 1UB5A 2XZAL 1YYLH 3QFJA 4L29B 1GIGH 5TE6L 4IOFD 4P59L 3IVKB 2RB8A 4GG6F 5ACLA 5IW1A 3MODH 4DFHA 3HFML 3MRLA 4JGUA 4HPYH 4ODWB 5TDOA 5I73C 5IIEB 5T1KA 1VHPA 1NCNA 2LAGB 5EN2B 3U79A 4UB0L 4OT1L 3ARGC 1K5NB 2IANA 4KUCD 4DGVH 3ARDD 4H25B 3WJJA 4LU5H 1X4ZA 3B6SA 5FK9A 3WS6C 5DK0A 3RNKB 3SO3B 2BOBA 5FYKH 5CIPH 1KN2H 4CN4A 1XGYL 2A6DB 4MAYA 1HWGB 2R0KH 5DRNA 1BZ9B 5AD0A 3ULSA 1UEMA 4ZPVB 1I1RA 3ARDB 1FP5A 3D0VB 4ZAKA 1A7OL 4Y4HA 4RWHA 5JXAL 1YY9D 3MRKB 3O0RH 1FVEB 3DV6B 4HKXB 3MRDA 4JM2D 5B8CC 5CBEA 3QEQA 1TLKA 2AXHA 5F1IB 5GRWA 3NIGF 1N4XH 1D5ZA 2WBKA 4OBSA 3PWUA 4XTRD 1JN6A 2KBGA 3W0WE 3QCUL 3K2UH 4X6DB 4HHAB 5ABDE 2DYPB 5E5RB 1FZMB 2HRLA 4U6XB 5C6WH 2F74A 3EYUL 5LGHL 5IVNA 3KYMA 3FRPG 2P5WA 3MLYH 1FL3A 5IFJB 4GW1B 2F9BT 4JM2B 5I30L 3FO1B 4TUOB 2CLRB 3GI9H 3EYSL 4LVNB 5C0BD 5CHNB 1ZT7B 3M8OH 4D8PB 4F15C 5FDWB 5FA3A 5I9QC 1H3PL 3RNQB 2R29L 4S10A 3BPOC 2I60H 4LRNH 1ZV5A 4DKEL 4APQD 1HXMB 1CXLA 3R4DA 1F90H 4JFFA 4ODXA 3QEHA 4G6ML 4ZQKA 1DVFD 2RAMA 2BJMH 4WFFE 1YEIH 4M3JA 2HFFB 5C0BB 2ARWA 2EICA 4ZD3H 4K94C 3BSZL 1OT2A 2EYSB 3MRQB 3L7EA 3QJHA 4EOWH 2AK4E 4P46A 3V5HB 3UJIL 4Y2DC 5D9SA 1I8LA 1O5DT 1W72B 3DVGA 2BC4A 4APQB 25C8H 4WI4A 3BKCL 1G1YA 4M5YL 5GGUB 2VITB 1T80A 1DVFB 2Y25A 1KCUL 2UY7A 4LVNC 5MEQA 3S96B 1U2HA 2G9HB 4JGMA 2BNRE 4ZFGL 5IBLC 1CR9L 5JQ6L 3QIWA 4EI5C 3TESA 2Y72A 1I9IL 2W60B 5CP7A 1YPZF 4LNRA 3WUWG 5JW4Q 3O9WA 4UV7L 4J4PA 3BGFC 3HR5B 4IMKC 4LAQH 5DJZA 3DUUB 2IPKA 3SKUD 5SV4A 3V5DA 2NXZD 5FHBH 4QXTA 4Z76A 4XCEB 5E94B 3SCMA 1P4LA 4APQC 3QO0B 1U0QA 3T2NL 4NKMA 3Q5OA 3SBWC 1Y0LB 3KAAA 3JV5A 1QTYT 5CWSB 4XPHL 1JNNL 1MPAL 5J12C 4KVNL 4JPIB 1S8DA 4ZFOA 1MI5A 4U6YB 4YHNA 3VFNA 1QSFA 4NZRL 5T5NF 2EYTA 3D3VD 4WU5B 5DHVA 4FQ1L 3B8SA 4XBGB 4F58H 1MFDL 3GSQA 3QP3A 2VLKE 2AJVH 3RWIB 1KJ2B 1KCKA 5I1LB 3UJJL 3LOWA 5D7IE 1X5IA 3JWOH 3QFDA 4ZFFA 2EEAA 2ZUYA 3D3VB 4Z7OE 3V7AE 4PJEB 5C08E 2O5ZH 1QPXA 3DLQR 3BPLB 2AEPL 4NJAL 3MV11 3HKFA 4HG4J 4PGEA 4U1SB 4XPBH 1CLZL 2AGJL 3N85H 5HHVH 4KKAC 2X70B 5F7LB 2V2WA 3DX9B 4L9LC 3T1WA 4NBXB 2R0WH 1CL7L 3V9FA 4Q2ZA 4GH7B 5E6IC 5E8OB 5EBLB 4QNPF 5IP4A 3VW3L 5E8EB 2AKRA 1PD6A 3V6OA 1U91B 4Z7UB 4D0DA 3C5ZD 5CEYA 3LEXB 4OD1L 1V5JA 5D72L 5KANG 1BX2B 2GTWB 5AYUL 3O45B 2Y7QB 1OAKH 2MKLC 4PJXA 2CIIB 5HGHB 4E42B 3P4OA 2VXUH 3BP4B 3RQ3A 3BPLC 2IH1A 4HJGB 3QIBD 5EU6B 4GSDH 2NLJB 2VLRD 3QH3B 5MEPB 1F3JB 3T4YA 4G3YL 2FDBP 4JFXB 3C5ZB 1BM3H 1U8OB 4M1CD 3RU8L 4KV5F 4UB0H 1C8PA 4NO0A 2WUCL 5IMOA 2I07A 4P4KC 2NW2B 5BV7L 5DJDA 3QIBB 2CKBB 3ZTJH 1DQTA 2X4OB 3IB4A 4J8RA 1JIBA 2VLRB 5HHPA 5JQHC 4H1LA 3QXUA 3FAWA 1R3IH 4HZAA 5FYLD 4JFOB 1XGYH 2Q76B 1G7QA 1TJHH 5DRWB 5JHDE 3WSQL 5I17B 1VFMA 1S78D 3PHSA 2E7LC 4N8VA 1N64H 1A7OH 3DRQA 2MCPL 1F6AA 5ETUB 5JXAH 1QFWH 3VD4A 3N1FC 4K3DL 3QSKB 1IGJB 5BO1H 5E00B 3MA7B 1RZKH 4BK4A 1ETZA 1G9ML 3C5ZC 2YEZB 1A6UL 3B3IA 4OKDA 5C0RL 3F7RA 2UZXB 1KC5H 3A6CL 3QCUH 1VFBB 2H1PL 4KGJA 1MCHA 2QSQA 4G8EB 2XXCB 1M4KA 2BY1A 3ZDZE 3GK8H 5F9AC 2Q6WA 1S7WB 4OD2B 5F9DC 4U0RB 4JANA 1G6VK 3OJDA 4J7RA 4KROD 4RX4A 3EYSH 5FM5M 2E27L 4QLRA 5EO9A 1D5XA 3NA4A 1DQLL 4LSPH 4PY8J 3S5LA 2XZQH 4S2SB 3D69B 4JG1H 4KPHL 3QWOB 2NY0D 1L7IL 2FHCA 5DTFB 5CGYD 5BOPA 4QY8A 3NZ8A 1Y18B 1H5BA 2GJZB 4GXUN 4MD4A 3CDGB 5IW6B 5KVDH 5I1JH 3GSOB 4FXKB 1EBAA 1LE5A 1JE6A 4GKSB 3PABA 1XCTB 1MLCB 1A6WH 4LLQB 2HVJA 4DZ8B 4X4ZA 3RX7A 4B0MM 1C5CH 4ELME 3PJSB 2NY0B 1CDUA 1GL4B 4Y5VA 4KI5D 3WO3B 5ESVB 5BZDB 3HG1E 3SKMB 2APXA 1QEWA 5DGRA 5EUOA 3BKCH 3DROA 4OV5B 4PJFA 3KYKH 4RAUA 4RMUA 2V2XA 1KCUH 1RUAH 5IVXB 4Y5XA 4PJIE 5E8NB 1NCBL 1TITA 4ZFGH 4ZOBA 2CGRH 5JQ6H 1EXUB 3FFCE 1J0HA 2X4NA 1I9IH 5EULV 5LVEA 4XPAH 4UV7H 4ZUUB 1A6AB 3OXRA 2EE6A 1OP3H 3DGGA 3HMXL 1FVDA 1A1OB 43C9B 1RJYA 4HWBL 4WO4A 5E8PB 4GAYB 4MGXA 2FO1A 4A6YH 1KPVA 3QZWA 2NY0C 4MDJA 5CGYC 1OAYL 4JN2A 1NFDF 4L8SB 3RGVD 4NUJA 3SKOB 1MUJA 2OR9L 2UVFA 4GRWH 5IBUG 4U4BA 3UEZA 3DVNB 3QB7C 5I1DA 3Q5TA 5HHQB 3GBML 3LKPB 1FYTD 1JNNH 4AIZB 4M7JH 1DBAL 3TT1H 3QUYD 4QRQA 4YHOH 1FLTX 5D7SH 1T7XA 1DBJH 4H26B 4NZRH 4DQOH 3RGVB 3TBSB 4FQ1H 2A9MH 1S3KL 3HUJE 1Q0XL 1MFDH 3UPRA 2HWZL 3OX8A 1LO2L 2VDPL 3UXFA 3MFFA 1KTDB 3H9HA 5HHNB 3UJJH 5GSVB 3MLWL 2EIEA 1FYTB 2ZSVA 2DQEL 3NPSB 1AKJA 4P2QB 4YBLC 2UUDH 1S7RA 3QUYB 4ZTOH 5T5FL 3P40A 2CRYA 3MGAA 1R5WB 2YA2A 4Y4FC 2W59A 1U8HA 1M6OB 2YPLE 2PTUA 5ADOL 4HBCL 2K9UA 2VL5A 1QR1B 4YHLL 5HI3C 5GJTL 5D1XD 1ADQA 4AIXA 6CGTA 1CLZH 4G43A 3CVHB 1GGBH 3KDMA 3EJYC 3HR6A 5IQ7L 3QUZC 2VIRA 1RUQH 3RI5K 3VMPA 2X6MA 3FB8B 3ZT6A 4BH8B 3BKYL 5IEKB 4C56E 1GGTA 4FABH 1ZE3C 1CL7H 5F6IC 2XN9A 4L4TA 4NN7B 1AXTH 4XAKE 2BNQB 1RZIA 3NN8B 2VDNL 3T3MF 2VDRL 4KK9D 4DKFL 3C5SA 4TULH 5D1XB 5SWZE 2VERN 1CLOL 3BX7C 1U8QA 3FQWA 3QUMH 3KPPA 4JDVA 4WFGD 2ZUSA 4YHKH 2XNAB 4Q6YA 4I2XA 3MREB 1LEGA 3CSBA 5D72H 5GGRB 5AYUH 5T1DL 3QDAA 2MCG1 4CDGC 3DOSA 1K8IA 2I9LB 5AG9A 3CUPB 3NCBB 4G3YH 3UTTD 3ZHLA 5E99L 3RU8H 4P5TA 1HIMH 4JO3H 1T5XB 4GRWF 2E7CA 5DRZA 2QHRH 2RCSL 2WUCH 3ULVC 2NYYC 1I9RH 3KYAA 4N90E 4G80A 1MWAA 2A77L 4ORZC 2WBJD 5IFAL 3AM8A 1J5OH 2FR4B 5D1XC 1IGMH 1T22A 4LDEB 1MNUH 3VRJA 2ADGB 4M5ZL 4JFZL 2FBOJ 3UTTB 1A3QA 3L3JB 3ZE2F 4M6NL 4HD9A 4ZSOA 1BBJA 3WSQH 5EO1A 1DP0A 3PL6C 2DWDB 3TPUA 2JCCA 1MIEH 1PQZA 1HN1A 2WBJB 2Z91A 3NMEA 5F7NC 2YPKB 5EDXA 4MD0A 4EDXA 4RMSA 3LPFA 5FOBB 3PF2A 1ZVSB 2HVKB 1ZA3A 3FN3A 3ZHKA 3NFNB 3QHZL 1C08B 3GSXB 1EHAA 1X5GA 3SE3C 5J6HB 2WK2A 5FYJD 5C0AA 1IKFL 4GLRH 3TO2A 2H1PH 2WUBL 4HFWA 4ONOA 5HDQH 1IGIL 2WWKO 2YUZA 4F7EA 5L8LB 5EU6E 5F3BA 1VGKA 4I3SL 1MJ7H 3PE9A 4N8PA 5KVMC 4KTEL 4MX7A 1Q9OA 5K9KB 1FZKA 1BVKB 3L95B 4JB9H 5GRVK 4MB4A 3SEPA 2E27H 4I77L 3ZKMC 4OCXH 3DX8A 5CBAB 1S7XA 4JFYA 3SDCA 3DUHA 3IXAB 1JK8B 1WWAX 4KPHH 5IG7B 4H0HB 1A4KB 2IQ9H 1I8IA 4PJ7F 1LK2A 5C6PB 5A16B 5KAQF 5DEFA 3LKSB 1UXSA 1IQWH 2NY4B 5DYOA 1X7QA 1UM4L 3LV3B 2NXYC 4JQVC 4OLYH 1TMCB 3SDDA 2XKUA 1SJHA 3HRZA 5T3XE 3OKMA 4DEPC 7FABH 4P5KB 4RRPA 3WFEH 3HB3D 4P2OA 4YR6B 4QRRA 3KLHC 1V7ML 4LPVA 2FZ3A 3O8XD 3HMXA 4CVXB 2XACC 3C8DA 4FTVD 4DKAA 2VDOL 2CR6A 5T33H 1Z5LA 4NQED 2HTKD 5K59F 1KLGB 2NY4C 1F8TH 3CC5A 3L1OL 1FSKC 3FT4A 3D85D 2LTQB 1MHCA 4HWBH 1ROWA 4ZUWB 1NBZA 1XF5B 2AP2A 4HKZB 2DLEA 3O8XB 1GAFL 3LKNB 2E6QA 5I1EL 1T7ZA 3PWPD 4CDHA 4FTVB 1XF4A 1AGCA 3MLPA 3C6LA 4NQEB 5C0CE 4Q0XH 3NFPA 1FG2B 2VH5L 4ZO9A 2VLMD 3VGBA 5CZVL 3DO7B 3D85B 4WU7A 4K9EH 1AY1L 1RZGA 4U1KA 1UWEH 3DYOA 1U93B 2YA0A 1MCIA 3O3BB 3C9NA 2NY6D 3FCTB 3X3GL 4UNTA 3PWPB 1G9EA 4JLRA 4LP4A 1S3KH 1RK0A 1Q0XH 3RUGF 4PGBB 4UOW1 3V4VH 3H9ZA 4KRPD 1A1NA 1T21A 5IBUB 4UIMB 1LO2H 2ITDA 2KDGA 4OAWB 3AXLA 3GUTA 5C1MB 4QCIA 5HGAB 5KN5A 3DYPA 5IB3B 3CXHK 5IR1B 3IXTB 4C58B 1FPTH 5T5FH 3O8XC 4KJPD 5DQ9B 5KOMC 3UYPA 3WFCL 4DFIA 2NY6B 4Y19D 3VFGH 4DGYH 1L6XA 3MRFA 3DUSA 1HDMB 5JHLH 4KRPB 1MVUA 2HTKC 1KJVB 1B2WH 3BVNB 4YHLH 4YHIB 5GJTH 2XY1A 3GM8A 1QA9B 3KYNA 2FWOB 3IDIA 4FXLA 4Q9QH 4WY7L 4Y19B 4P49A 2ZG1A 3BKYH 5IJVB 5J56B 5F89B 4P5MA 5IHUL 4OFPA 4Y1AD 5CUSL 2DB8A 4MNQE 5TQ0L 3OPZH 5JR1L 2EE9A 4YPGB 2A6KB 3LPGA 4XMPL 1HILB 1D9KD 4GKNB 1K4DA 5FM8A 2VXTL 4LKCA 5FYJU 5E4EB 1A14H 4ISVA 5FA4A 1PKQA 5F97E 5ID0B 3VXMD 4HK0A 1JWMB 4JHBA 3MBEC 4PFEA 4KY1L 3EYQD 4Y1AB 1N6QL 1T89A 4CMMB 1AFVL 4KI1A 3DMMA 4JFDD 5TE4L 4OLEA 5ITBH 4LHJB 4MQ7A 1D9KB 4WWKA 1CGUA 2DN7A 3O2WL 5E99H 3WJLC 1GGCL 1NEZG 1G7LA 1MFNA 3BHBB 4P2QE 3NFSL 4LGPB 5DMKB 2RCSH 1JNLL 3BWUC 4EBQL 1J12A 3QBTB 1BWWA 4WW1A 2VDLH 5IFAH 2VO5A 4JCMA 2CLZA 1T4KA 3ARFC 1A7RH 5TDNA 2VLLA 5GS2D 2GFBA 3DI2B 3SGJA 1T1ZA 3G6JE 4HS3A 1OM3L 2YSSA 4WDIA 4X9BA 5TJWK 4HUNB 3FB7B 3S35X 3QEUA 4YHMH 5C09E 3KPLB 2UUDK 3QQ4B 5GISL 2OL3H 1MOEA 1TZGH 1BIIB 4OM1L 1Q9LB 3ULVE 1FRGH 3FO2B 3QG6B 3VFSA 1AE6L 2BNQE 5BVJB 3WL9B 1T3FB 4GUPA 1D9KC 1B0GA 3KPRE 1FG9C 5BRZE 4QHLA 4O02H 1V3LA 3TJHD 2VISB 3C6SA 5DJCB 2ZUVA 4NQCE 2F54D 1AD0B 3EYQC 3QWRA 5CEZH 1MFEH 1GC1H 3CFKA 4OLWL 4HZLA 4KUZL 1IGIH 1UKQA 5BMFH 4JAMA 2J88L 4MD5A 1A22B 3X11A 2VLKA 1F13A 2HLAB 4I3SH 3H3KA 3TNNA 4KTEH 1B0RA 5DJ2B 4FQLH 4PB9H 5T1LD 3P4NA 2DF3A 3JV4A 3Q48A 4K7PL 4RGOL 3GMQA 3BP5B 2F54B 4YXKL 1OAZL 3UTSE 1W72L 5C7XH 1HHKA 1GOGA 3MRCB 3KLDA 1GZQB 2CJUH 1NBYB 1QRND 3LQZB 3PWNA 5T1LB 1RFDL 3LIZL 5JPNA 1WC7B 2VNCA 5CD3A 4PP1D 4J6RL 2DI8A 4JY5H 1YQ2A 2J8HA 2P8PB 1UM4H 4D0CB 3OG4B 2E7HA 5K9OB 4RZCA 3ALXA 3U4BL 3WIHL 1W0VB 1NSNH 2HT2D 3C09B 4WV1B 5DR5H 1QRNB 3FMGL 1BJ1H 2ADFL 4X4YA 3RVXC 2OZ4L 1ZGLB 2QLVB 4KK5C 3FO0H 4O5LH 3OKKB 3F8UB 4AEIL 4OZ4A 5D7JC 5ICXA 4B5EA 1V7MH 1R0AL 5I1GL 4HIIB 1VADB 3IFNL 4FQJH 2GJ6A 5IJKA 2HP4A 1BF2A 1KLUA 1EZVY 4BQCA 3L3GB 5EA0H 4JKLA 2IG2L 5LWYL 3V8OA 1NFIB 4M02A 5IVOA 3E8UL 5IOPA 4G8FB 2VRAA 3O41B 4NQXA 3O3AA 2PW1A 1ONQB 2D7TL 5I75C 4RFOL 2R1XB 4X6BB 3QDJA 2YWZA 3MBXH 3DSFH 4ORGB 3VXNA 4PS4H 3NH7H 1LO5B 3C09C 2EO9A 3GSWB 3QI9C 5DJAA 3TLRA 3IJSA 5SWQA 2VH5H 4UTAL 1JGUL 4KVCL 3HI1B 4QOKE 2X05A 1ACYL 1CGVA 3GMRB 5FB8A 3D9AH 4Z7QF 1E28A 4B7LA 3GBLA 1FH5L 3TBWA 1PFCA 3P0YL 3GDBA 2HH0H 1AO7D 3HMWL 4HCRL 3U4EB 3ARGA 1F4HA 4PD4K 4OCYL 1KCVL 3VXRA 3MOAL 3VFRB 3GB7A 3GSUA 3LZFH 4GQ9H 3R0NA 3RJDA 4M62L 4WEBL 5E1HB 4G42A 4D9QE 4X6EA 1ZWIA 4U2YA 4K71B 12E8H 1U8PB 3ZMRA 1AO7B 4KXZI 4YBQC 4UT9H 5JW4N 5E9DE 3FOLA 1F6FB 3RP1A 4NN6C 5FGBC 5IHZB 1SJVA 4U1JB 4YDJB 3AAZA 4RDQG 1IKNA 1JGLL 4Z7WB 4I9WE 4DAGL 2KZWA 3UBXG 2H32B 1N0XH 4ODWA 2R23B 4JFHE 2Q3AA 4XZUB 5IIEA 5B8CA 4F80A 5EN2A 3LQAC 4HS8L 3Q3GB 5BJTB 1K5NA 5IHUH 5E2UL 1RHFA 1IEAA 4H25A 4D3CL 5I71B 3EO9L 4YC2C 2DIBA 4I48B 3VXOB 1QSED 4KJYA 5C9KA 2FEEI 4P0DA 5D7LE 4MA7L 2VUOA 5D2LF 2A6DA 4LCWE 1BZ9A 2CKBL 1A7PL 3T3PE 4ELMA 4PPTA 4LCCB 4ZPVA 3ZYZA 2ORBL 4LCIL 3D0VA 4TTGA 5HDBE 3EFDL 3I6GB 1IL1B 4PTTB 3MRKA 2W38A 1QSEB 5TE4H 3CFDB 1FVEA 3DV6A 3I50H 4HKXA 3FJTA 1DL7H 5I66B 2BNUB 3MCLL 3U7WL 5INCA 4OGYH 3CFJB 3U9UA 3WFZA 2PTTB 4WUUD 1GGCH 5F1IA 1A3RL 1QZ1A 1F02I 1RURL 3O6KL 5E24E 3NFSH 2DQTH 3C2SA 4XMLL 5KSUB 4K8RH 2IFGA 5F1NB 1NKRA 2YWYA 4HHAA 3ILQD 5I71C 2DYPA 1FZMA 5FYLL 4U6XA 4IDLA 1KN4L 2X4TB 2ZNWA 4Y2DA 1KELH 1YMMD 2PXYD 4GW1A 3TBTB 4JM2A 4WUUB 8FABA 4J3UA 1OM3H 1MREL 5B22A 2FJGB 2EDDA 4TUOA 2CLRA 5F7MC 4WW2C 5SWSE 2WW8A 3QO1B 5DVNA 4PGJA 5FO7B 4MHHG 1ZT7A 4XWGH 1P69B 5FDWA 5D70H 1BREA 3RNQA 3K0WA 1MHEB 5F7EL 3H42H 5JORB 4HIXH 1YMMB 2PXYB 5DQJB 1HXMA 1IGFL 4N8CH 2X44D 1A6PA 5EZLB 2HFFA 5C0BA 1FHGA 4Q6IC 4IMKA 1QSZA 2NX5E 4HMDA 2EYSA 3NABH 3T1FB 1FGVH 5GRUH 1EIBA 5KSVA 4G8IB 4APQA 4L9DA 2WINB 4OCNC 5TFSL 2HT4C 3SBWA 4Y8AA 1DVFA 1RPQA 4N5UA 4TNWK 3QR2A 2ZCLH 5DD5L 1LEKB 4RSVA 3P30L 2A1WL 3S96A 2G9HA 3FHQA 3SQBA 5FAAA 4V1DE 2IFFL 2B4CL 3CX2A 2PXYC 1SYVB 2W60A 1FNFA 1CS6A 1J0ZA 1BD2D 4GG8A 4C57C 2JJUA 3LMJL 2ICWJ 1RZ7H 4GRMB 3HR5A 4J6RH 3AFLA 2D7MA 5BQ7A 3U0PB 3RDTC 3X17A 4C56A 5J11C 4Z8FH 3HPJB 2VLJD 3SJVE 3BO8B 5C0ND 1LNUB 1G7MA 4XCEA 5E94A 2BMKB 4Y16B 4LAJH 3F58L 4JRXD 5H94B 2OZ4H 4E0RB 1G1CA 1Y0LA 1NANH 1NUGA 1BOGA 1QPPA 2MQ0A 3BDBA 5CWSA 4NC0B 4FNLL 5I1GH 3D2UD 2LQRA 3EOAB 4JPIA 2EE2A 4AQOA 5GZND 2VLJB 4U6YA 1NBVL 3MRPB 3WXWH 4HKBB 2Q20A 4XBGA 4JRXB 4YUEH 1G6RB 2R0LL 5E6IA 3RWIA 1HYRC 5DK3A 1KJ2A 4PJCB 1NCTA 1UH3A 4LQFL 5I1LA 1NBQA 1QFOA 2AI0L 3D2UB 2M1KA 3RZWA 3ULUH 4O00A 3G08B 3OAZH 2BZDA 2A2QT 3D3VA 3ISWA 3TPKA 1U3YA 4PJEA 2HLFD 4Y16C 1T0MB 1NGWB 4Z95H 4J3XA 1B6DA 4YIQB 1ACYH 5TPWL 3V6FB 2FYYB 2NY1D 3U30B 4G6KL 2OTPA 2X70A 1QNZH 3DVFA 3MXVL 4HCRH 2BVEA 5L88L 2IPUK 1KCVH 4P4KA 4NHUA 2ESVE 4Z7VB 5E8OA 4WEBH 5EBLA 3TO4C 4FZEL 2HTLD 1UA6H 1XIWC 4YEFA 2NY1B 1FFOA 5E8EA 1YEKH 4YNYB 4HC1H 1U91A 5ICYB 4LCUB 3BKJL 4Z7UA 4FA8A 3UZEA 3LEXA 1MCDA 2VZVA 1HI6B 2IADB 1AGEB 3O45A 2Y7QA 1GHFL 2CIIA 5HGHA 4OM0L 4E42A 3BP4A 2QV2A 3KLSA 4HJGA 5EU6A 3A6OA 5SV3A 2NLJA 3QH3A 5MEPA 1F3JA 4NQUA 3ESUF 4EZMA 1TQBB 1UZ6E 3C5ZA 5GS0D 4RMRA 1U8OA 4PTUB 4HS8H 3NA9L 1EEYB 2HLFC 4PB0L 3MUZ1 3A0OA 3V6ZB 2Z35B 1E4XI 2NW2A 4LPTA 1AGBB 2CKBA 4D3CH 3EO9H 2X4OA 4FXGB 4L3CB 1KEML 4HAGA 3IF1B 4U1HB 2XQYK 2NY1C 2ICEB 5FM5O 1MCNA 2ZCKL 5GGTL 5JOFB 3UBXB 4MA7H 1IM9A 4JFOA 3LB6C 3QA3A 2Q76A 1QBMH 3O4LE 5DRWA 3KPMB 5I1IL 4QTIH 3MNZB 1RQ5A 1U36A 1YNLL 3KXFE 3VFWA 3ZTNH 5I17A 2EE3A 2ORBH 3L9RB 5FO8B 5ETUA 4KTDH 4OIIL 2QQKH 3RWEB 3ULUF 1FNLA 1IGJA 2ZOKB 5E00A 3MA7A 4GXUM 1TQBC 2DKSA 4LSTH 2YEZA 3P9WB 4YDIH 5E7FA 1RURH 1ZEAH 2X7LB 3WD5H 4QKXB 5I18L 2EIDA 2V7NA 5AAWA 1M7IB 1VFBA 5EOQH 4N5ED 1TPXC 4KKBD 1IAII 4U1NA 1ZGLP 4XVSH 3FRUB 4G8EA 1P7QD 4RMWA 4KDWA 3BZFB 1PYWB 1KN4H 1C7SA 3WO4C 1CBVL 5HJ3A 2VE6A 1I7ZA 4OD2A 3RKPA 1MCSA 2XYCA 4HW6A 5GS0C 5GGVL 4CU8A 3KPNB 1A6TB 4LMQI 1LO4L 1FO0H 5GS3A 2K7PA 2J1KA 4S1RL 3QCVL 5F7WC 4XNXH 1HH6B 3CCHA 3MOBH 5HHXL 3LN9A 3QWOA 2RGSA 3QQNA 4Z77B 2BY0A 4I5BB 1CICD 2FLRT 2J8UB 1DQDL 3CFIC 1MQKL 1OGAD 2GJZA 3ZLQC 1TFHA 3CDGA 5IW6A 3MMEB 3G5XB 5EU3B 4OIAA 3GSOA 4FXKA 1PSKH 3OR6B 4U1MB 4TSAH 4GKSA 5KVGL 1ZS8B 1XCTA 1MLCA 4LLQA 4DZ8A 1CLCA 2AQ2A 4MDIB 2NY7L 3OKOB 3I75B 3PJSA 1JF5A 3C08H 4H1LH 1CICB 5HVHB 5I76B 3RIFF 1ZHBB 3BYTA 5BZDA 3SKMA 1OGAB 3I6KB 4N0UE 5HYIA 4HX1B 4Q74A 4N0CD 1LP9B 1X3DA 3NIFE 2B39A 4F2MB 4PG2C 2DQUH 4YFEA 9CGTA 2G60L 5E8NA 2Q7NA 2L7JA 4EIGB 2C4FT 1RIUH 1YJDL 3T0EC 3QQ9C 2ENSA 1EXUA 3VI3E 1IFHH 1WSST 4WGWB 4JDTL 3DXAD 1YEDB 1A6AA 1A1OA 5EOTB 43C9A 1IC1A 2BVYA 1KUMA 5E8PA 3NCYS 4GAYA 4KJQD 3O2DL 3QPQC 4RAVB 1T7VA 3HCVB 4ONGL 5JA9A 4L8SA 5GGQL 1K6QL 4PP2A 5FKPB 3SKOA 4PBWD 3BT2H 1I1AC 3DXAB 4JKWA 4TSCL 3DVNA 3WN5C 4S11A 4F3FA 5HHQA 1HSAB 1CIDA 5D5MB 3U1SH 3UBXI 4K07A 2A9NL 3LKPA 4AIZA 2VQ1B 4NO5B 2X89A 3TBSA 2A0LC 4MA1B 3QUXD 1R3JB 3S37H 1KTDA 4LQFH 4PRID 5GSVA 3ECBB 1FYTA 4YXLH 1UM5L 2AI0H 4PLNC 2AJUL 4MQXC 2LU7A 4P2QA 4BH7B 1IAMA 2FJFB 4PJGF 4S0TD 4OB5L 3TVMD 3L3OA 5JW5B 1M6OA 5FKAB 1H3TA 3QUXB 1CT8B 5DSCB 4NNYB 2DMCA 3CLEH 2N1KA 5FIEA 5CMAA 2GYSA 3CVHA 1MFAL 4PJDE 3DV4B 3LPWA 4S1DD 3F12B 4QHNB 2XPGB 2PO6D 3FB8A 2NZIA 5IEKA 2Q7YA 2DWEA 3TVMB 3WFHB 5EORH 1JPST 4MA1C 4KHXH 5IK3B 1URLA 4KMQA 1I8KB 2BVUA 2BNQA 3X12B 1IAIM 2XFXB 1DQML 4EI6B 5D1XA 3EHBC 1QKZL 1YEHL 3GIVB 5T5NG 4MJ4A 2DDQL 3BKJH 3KR3H 1KGCD 1UWGL 4WI9A 2PO6B 2B8OT 4P9HC 3TCXA 1H15B 2D4FA 2V9TA 4KHTL 1DR9A 3MREA 5GGRA 3U6RB 4EUPH 3QUXC 1OD9A 1GHFH 4XWOC 1JF1B 1YN6B 2JELL 1QQDB 4OM0H 3F6IA 3WDIA 1U41A 5JOPD 1SEBB 5AZ2H 3I6LD 3CUPA 3MV8E 4WJ5B 4HWEH 1RK1B 4HKJB 4LLDA 1KFAL 3C8KB 3E6HA 1WZ1H 4NN5B 1NCDL 3SE3A 4M00A 5HYQB 2UWEF 1MJUL 5GGTA 5IVZB 2CKNA 4HJJL 1CU4L 1QO3B 5A2FA 3F6LA 2UZIH 2FGWL 2JJSC 4NQVB 2AEQL 2FR4A 1KEMH 3C2AH 3ARTA 1EAPB 2ERJB 4HLJA 4S1DC 3H3PL 32C2B 3UTTA 3LS4H 2NW3B 3L3JA 4EN3D 4LGRB 3LVEA 5I1IH 2W9EL 5IBTL 2ZUTA 2DWDA 3VXSD 4NBZB 5LKNA 3CD4A 1NLDL 2YPKA 3STZA 3MQIA 4AH2B 2ZG3A 4PLJD 5FOBA 5C2BL 1S5IL 2EDFA 1JI2A 1ZVSA 2HVKA 1ACZA 3B9EA 1Q9KB 5JZ7D 3AGVA 3NFNA 5DLML 3GSXA 4EN3B 3F62A 1UCTA 4Y88A 3F7PC 4PJHF 5F1SA 1K9TA 2WWMC 3IDMB 3VXSB 4JQVA 5CD5D 1CFVH 3S36X 3BIKA 1MRDH 4L3EE 3MRBB 5GS1B 5C70A 2CPCA 1CDYA 3VWKD 2X1PA 4NYLB 5K9KA 3QNXA 1BVKA 3VRLE 3DX7B 5GGRY 4U1IB 1LO4H 4K3JL 4S1RH 5E2TL 4GO6B 1J1OH 5CBAA 4GG6B 4QGYA 5DQDL 5INDA 4YFLI 3IU3B 4AL8L 5IT2H 3IXAA 4KKCC 2FNBA 2J8OA 5IG7A 1HCFX 3SDAD 3CFEA 3KS0J 1A4KA 4XGZB 2JK5B 1DQDH 3VWKB 3UYRL 1MQKH 2AJZA 5LGKA 3G9VA 3TJEL 1WEJL 2GT9A 5SX4I 4JHWL 3PGCB 3LKSA 1A4JB 1SQ2N 4OZFH 3RIFK 4XNMB 1MWAH 3ZSSA 2FEEL 3SDAB 4KK8C 5DUPH 3MLXH 2Z92B 4TVSa 5I19L 3AY4A 5JPMB 5I8KL 2DJSA 4YR6A 5CZXD 4JRYD 2QSTA 1KCSH 1QFUH 2A38A 1IILE 3ZKNC 2V17L 3BGAA 4HGKC 4PJAF 4X7TB 2G60H 1Z9SA 2X9YA 4X9HA 4U1LB 3V8CA 4M8VA 5LBSL 4CVXA 1UZ8B 4HDIB 1J0YA 1I9JL 2R2HB 1HHGB 2R2EB 4RNRB 5C6TL 4NZUL 3OXSB 1U8MB 4UILL 3FFDA 4X7SL 2AV1B 2BFVL 4JRYB 5ISZD 1KLGA 4LSRL 5EU5A 1AD9B 4OLZL 2FX7L 4ZUWA 4YGAB 1XF5A 3O8XA 3CLFH 3O2DH 1BLNB 3ZKQD 4L8BB 3V7MA 2IAMC 5E8DH 3T0BA 5GGQH 5L0QC 2W9DH 3T0EE 1I7UB 5ACZB 5HPMA 1A5FH 1K6QH 3LS5H 1JHKH 4NQEA 2DD8L 5ISZB 4MB3A 1FG2A 3DO7A 4FQXD 1KLFA 2FBJL 2KQMA 1U93A 5IEHA 3TA3D 3O3BA 3OKNB 3FCTA 5D93B 2HG5B 4FQCH 3SDYH 4DVRL 3PWPA 2GCYB 4PGBA 5CZXC 4UIMA 5TE7L 2DBLL 1INEL 4POZD 4FQXB 4X7EC 1F4XL 1IT9H 1SYSB 4OAWA 5KS9F 3MXWL 4JVWA 2ZCHL 3CH8A 5FYKD 4MXWL 5HGAA 2YUXA 2AJUH 5IB3A 4H0GA 5IR1A 3IXTA 2VR4A 3TA3B 1ND0B 3W81A 5BVPL 1AHWB 1WGOA 2L0DA 3ZDYE 4ALAL 4AZ8A 4TPRL 2DLFH 3VWJC 3DIFA 4JPWL 1D5IH 2IF7A 1TETL 1WFNA 4OZIF 1HHIA 1EEQA 1UXWB 3BVNA 4WCYL 4YHIA 3C5JB 4XVJH 1MFAH 3WIIL 5CIPB 2DMBA 2FWOA 2HFGL 3SDXF 5DURD 3PXJA 5SWSA 4G6JL 3V4PL 3WJLA 2UYLB 3TFKC 4XX1G 2E6JA 1YPZB 4UU9B 5D93C 5IJVA 3EDEA 1GCFA 1EERB 5GRJL 1EFXD 5F89A 3TYGH 3GJFH 4LVHC 1UYWH 4GAGL 3VE0B 1DQMH 5EOCL 4FQXC 4XPFH 2BVQB 5IF0A 1QKZH 5DFVC 1ZLUK 4YO0A 1HILA 1GZPB 1SJEA 3EW3B 1X6LA 5DURB 1MCOH 4JKMA 5L6YL 4GKNA 5CILH 1UWGH 4N9OB 3N1PC 4X6FA 5JXED 1AQKL 1WAAA 2P46B 1EFXB 3FZUD 5ID0A 4NZTL 2R56H 1JWSB 1JWMA 2D2OA 5IFHH 1S7TA 3EO1A 5JDJA 2D0HA 2PUQT 4CMMA 4POZC 3FB5B 3FQNB 3MGOB 1KG0B 4R6UA 4KC3B 4UDTB 3SE4C 3WKML 4D9RE 1D9KA 2W0LA 4AY0A 4P3CL 1G9NC 1HK6A 1NGPH 4PJBF 4HT1H 3BHBA 1MJUH 1CFNB 4P2RE 5DMKA 4NWTL 2Z31D 3PWVB 1CU4H 4PJ5E 1UADC 1YY8B 3UJTL 2AV7B 4HMCA 1DLHB 3NCYP 1RZJC 1DCLA 5DA4A 5EPMB 4Z7NE 5DMYA 3T09A 2AJXL 2B1AL 3DYMA 1A6ZB 3ARPA 3PDGA 3CMOH 4W4OC 2F53E 1KTLB 1INQB 1J0KA 5IBTH 2Z31B 5ALCL 2DM7A 1U3ZA 3KPLA 1CFQB 2B0SL 2F8VA 2VYRE 5EBWB 1NLDH 1BIIA 2OK0L 1Q9LA 3FO2A 3QG6A 2DQJL 2E7BA 2LU4A 5C2BH 5BVJA 3WL9A 4I0CC 4TOYH 1FAIH 1T3FA 1MCPH 2F5AH 4KKNA 2EH7L 4GAJL 4A2MA 5JXEC 5DJCA 1N7MH 1VACB 1CGSL 4FFYL 3GM0A 3Q1SH 4LKXB 1AD0A 2PETA 4JM4H 3P73A 3TEUA 4AEHH 3NIDF 1RULL 4XP5L 2DQDL 1G7IB 2HLAA 2ICCA 2XWJB 1TZIB 5DJ2A 2GITB 4Q58C 1ZANL 3UO1L 2ZKHL 4XP4L 3MROB 3BP5A 2F54A 4ETQB 5IB2B 5EU4B 2R2CA 4JO2H 5DQDH 3MNVA 3MTRA 4AL8H 3TCLB 4JHAL 2CDEB 3MRCA 5HYEA 2UY6A 1GSMA 1Q9WB 4NQDE 1GZQA 5H37H 2H26A 4PUBL 1MF2L 1NBYA 3LQZA 1EEZB 2GI7A 2OI9B 2Y6SD 5T1LA 1UB6B 1WEJH 3ZSTA 1WC7A 4OZGE 1I7RB 4LDOB 4P46C 3C8HA 4M7ZB 1DE4B 1I8LC 5I74B 2C1PB 4D0CA 4ZOAA 4IS6B 2FECI 2EKJA 3VXUD 2N4IA 3JTSB 1L7TH 3QI9A 3MSPA 1ZGLA 4LVOB 1I9EA 5I8OL 4LRIC 5LXGH 5J1SC 3ARQA 3HPLB 2ADIB 2GSIB 5FYKU 1AQDA 4WTZG 1X5ZA 5MENE 4G7YL 4IDJL 2FIKB 3X13A 1VADA 1XF3B 4FP8L 3I3DA 5A2LH 1KIUA 1AXSB 1BFTA 4GW4B 4LSSH 5DRXB 3VXUB 2HKFL 2P5EE 5D96B 4NFCA 5EBMB 2YPVH 3EZJB 1V7NL 4E41E 1VCAA 1NFIA 4LSRH 1N5AB 3O41A 1IAIL 3QPXH 1ORQB 2FX7H 1SY6A 4O4YL 2DRUA 2R1XA 3TH3T 2W07A 3OAYH 4X6BA 4OLXH 4ORGA 3EGSA 5KAQG 3P4MA 1A0QL 3MRHB 5JW4M 1LO5A 3C60B 1BVZA 4JJ5B 5FGBA 1X5AA 1JZ4A 4NNXB 4LVOC 3NCCB 3HI1A 3GMRA 4HS6B 5GQBA 4GAFB 5C92A 2XTJD 1LHZA 4KKLD 3CFBB 4DVRH 3U4EA 4NHCH 4X6CE 1QFHA 1PZUB 3GIZL 2XKNA 4U3XA 3A6BH 4OGAD 3P9LB 5A3IC 4K55A 2ZCHH 4MXWH 4RQQB 4DCQB 4EIZC 3GNML 4ZTPL 3IKCB 2XQBL 1U8PA 2EDOA 2XTJB 5BVPH 1L6ZA 1JZ2A 1PW3A 3U7YL 1AR1D 2HAZA 4GS7C 4F37F 3C60C 4YDJA 4NUGH 4PV9A 1NCWL 4WCYH 3MRGB 4Z7WA 4WHCA 2H32A 2R23A 4K3HA 4MCZB 1KACB 2FEDC 3IU4H 1FBIH 3QG7H 4M6AA 1FC1A 1RMFH 3Q3GA 4HIEA 2NTFB 5EC1B 3EOTH 2EXYC 4M61B 1NLBL 3PP4H 2DI7A 1JGVL 1I3GL 5EOCH 1F4AA 4I48A 3VXOA 2DJ4A 3GMOB 4C83B 1UH2A 2OQJA 1NFDB 3VH8G 4FQ2H 4D9LL 2XTJC 4KKLC 5C07E 4HK3N 1YNKH 2EDHA 4QRPD 1UKSA 1P4IH 4WW2A 3HC4L 4Z9KB 2YXMA 2XTLA 3RY4A 4OCMC 4PLOB 1DBBH 4QGTA 1IL1A 4PTTA 2J7LA 3MJ7B 1LMKA 1VFAB 5GS0L 1RUPL 3MC0A 3WKMH 4ZYKA 1OT1A 5I66A 2BNUA 3W9EB 5BS0D 3CFJA 4DZBB 4P3CH 2PTTA 5BW7C 2P44B 3S35L 1KT2B 3LN4B 2NNAB 1DN2A 4QRPB 3WLWC 4NZJA 3ZE1E 4DOHE 4B41A 5KSUA 3OGCA 1MRCH 4HUKB 5D7IF 3ARWA 1U8LB 4LHQB 4Y4KB 4Z7OF 5CSGA 5I0ZA 5BS0B 5FV1L 3TBTA 1BFVH 2AJXH 3U2SA 4FRWA 4WUUA 3RBSA 2VC2L 3E6FB 2IANE 3QO1A 2P8MB 3MJGX 2EDJA 5FO7A 1QBLH 3ARVA 3FT3A 2B0SH 2F15A 2NZ9C 1Z2KA 3OZ9H 3PWJB 3DWTA 1I1YB 2D03H 5JORA 2DQJH 5FHAH 5TF1L 2WZPD 1YMMA 2PXYA 5DQJA 2X4SB 1HKLL 5EZLA 2EKSB 3KPSD 4BZ2H 2CK0H 1MCQA 1CGSH 4FFYH 3RVVC 1TQCC 2E9IA 2F58L 4ZUTA 4ONHA 3RDTA 2QQQA 5IB1A 1VGEL 2AXGA 2YK1H 4IRJD 3FB6A 4Y4KC 3AS2A 5GIRA 5T3ZE 1F45A 1CZ8L 4G8IA 2Q8AL 3VCLB 4MXQC 3GJFK 5JO5A 2WINA 4XI5C 1LDSA 3KPSB 2ZKHH 4XP4H 1WTLA 1LEKA 2DIAA 4LPUA 5GZOC 4XHJC 1L0XA 4LSVH 4PJ8D 1EPFA 1S7SA 1RVFH 2ZUXA 4R90L 4JHAH 4A6YB 2JJWA 4IRJB 4PREB 2D7QA 4X98B 1P5VA 1X5FA 1N8ZB 1XH3B 4Y5YB 1TDQA 1OTSD 4DN3L 1SYVA 1DQQB 3RWDB 4OQTL 1YEFH 3I84A 4GRWB 4NO3B 4PJDA 2PYED 3I02B 4GRMA 1K85A 3WHE1 4UOW0 1E4WH 1R3KB 4OI9A 3JVGC 1FAKT 1G7PB 4PJ8B 3RVWC 2CR3A 4K94H 3WNPA 4RFNB 3HPJA 3BO8A 1LNUA 4YHYC 2H9GB 1EMTL 2FD6L 4QHUA 4Y16A 4DK3A 3K1DA 4JFFE 2PR4L 1J8HD 5H94A 3WNKA 1QFWI 2PYEB 4NIKB 4L4VE 1PDKA 5I8OH 4OFYD 4XNYL 4HG4K 1G0XA 4IEFB 1T1XA 3EOAA 3ES6B 3OAUL 2VLJA 5DMIL 3MRPA 3BWAA 3NCJL 4Y5YC 4HKBA 2HKFH 1ULVA 1Z0NA 1FFRA 1J8HB 3CZJA 1V7NH 5F44A 1G6RA 3ZDXE 1MJ8H 4FFVC 4WO4C 3L5JA 3ZDZF 2G75B 4OLVH 3ALPA 1PEZA 1XIWA 3F7VB 5JDSA 3D2UA 4O4YH 4WFHE 3G08A 2FX9L 3J7HA 1WIUA 4QYOB 4RFNC 1KB5H 5FGSA 2Y1VA 1V05A 4OGZA 3MGTB 4N0FB 2H6PB 1OTSC 3AUVA 5HD8C 5J13B 2ZNXA 2AJYH 3SQOH 1IQDB 4EDWH 3I2CL 3W9DB 1T0MA 4LOUD 1NGWA 3S7GA 1D5MB 4QHKJ 3O4OC 1DBMH 2FSEB 5JIKA 1AIFA 2GTZB 3D6GA 3QUMB 3V6FA 2FYYA 5HI4C 2IH3B 4PG9B 1JMXA 5AZEL 4PJ7B 3MR9B 3QRGL 3KJ4C 3HNVH 2YRLA 5MI0B 1KOAA 5TDPB 4ELMF 4P57B 4OF0A 5DUMH 4Z7VA 1B90A 5F9WC 4ZFZB 5ENWA 3GNMH 5ICYA 1NCCH 3INUL 4LCUA 3VXTB 3CSPA 4NCC2 2B1HL 1HI6A 5ESQB 5IESL 5HI5D 4AEEA 4O58H 3TT3L 1FL6B 3LHPL 1Q1JH 3DBXB 4TVPE 1NDMB 4PJIF 5ILTH 1LEIB 2DQHL 3K4ZA 2P43B 4YGVB 1UH4A 1XF1A 2Q1EA 5IMLB 4LPWA 3WHXA 4PTUA 4ZDHB 4UQ2B 2GAZB 4FN0A 4YE4H 3V6ZA 5MI0C 3EJZD 2Z35A 3MLVH 4LASL 3SKJL 1AGBA 2CXKA 4JPKL 5HYJD 4FXGA 1JGVH 1I3GH 3K7UA 4L3CA 1LILA 3IF1A 4U1HA 4DJMA 5JOFA 3UBXA 4LSQH 4JG0L 1WLHA 5KVEL 1TJGH 3DO3A 4OLUH 3KPMA 4MMZC 5KSBE 2AEIT 4UV4H 3HC4H 2IPUG 4R4FH 5FO8A 2YD6A 5BV7C 3HZMB 5HYJB 4UINL 4YDKL 5DUBA 4XC3H 3CPLB 5HYSA 3RWEA 1RUPH 5KBNC 2ZOKA 4V2BA 3V6OE 1KENL 2C3WA 3HUJF 3P11L 4LLYB 2YMXH 4JFQB 2CDGB 4AEFA 2HJLB 3ETBF 3VH8B 1JZ3A 1KEGH 5HI5C 1JZ7A 2X7LA 4JQIL 4JR9L 5D6DC 1M7IA 3OKEA 5E5MB 2OTUB 3FRUA 3RFZC 2IPTL 3D39D 4G9FD 3AMLA 1PYWA 3B5GA 3REVB 4KRLB 3DX6A 4ODUB 4OZHF 5HYFA 1G9MC 2OTWB 3VFPB 4KH2A 4PG2A 4F7PA 4BQBA 2BSSB 3MV01 3RA7L 2VC2H 1QFWM 3MUGB 3UZVB 5H8DA 5FGCB 1T20B 4ACPA 5HTSA 1HH6A 3SN6N 4HUWB 3OV6A 4J1UB 3D39B 2P1YA 4G9FB 2ZWLT 2YD7A 1CL7I 3P9MB 4XT1C 4Z77A 4I5BA 5CEXB 5TF1H 2J8UA 1GRWA 1M7DB 4NGHL 3MMEA 2J6EA 3G5XA 1HKLH 5EU3A 2FX8L 1UG9A 1TNNA 4X8JB 5JLZB 5LGJB 5D2NB 4F7TB 3OR6A 1T2QL 4U1MA 2Q86B 5CCKL 1XR9B 1ZA6A 1ZS8A 3VGGA 3LH2H 3KHQA 4MDIA 4YWGL 3OKOA 1NGQH 1R3HB 4XPTL 4R3SA 4XBEL 3PUCA 5I76A 1NGYB 4IRZH 1OGAA 5C0FB 4HX1A 1LP9A 5B4MD 5MHSE 1RZ8B 3PQYD 3WFBH 3WFDH 4F2MA 2CIKB 1FJ1B 3OHXB 3SDCC 4F9PC 3L3HB 1E4JA 3B9KD 2VJXA 4NDMB 4NZDA 4UOJA 5T3XH 2YRZA 1H3WM 1JHTB 1IBGH 4YDVB 3Q6GH 3D18A 1EHXA 1VPOH 4KMTH 1C12B 4OIBA 1QYGL 4UT7H 3RL1B 1AP2B 1K8DB 1U3JA 4OQTH 3PQYB 1MELA 1OD7A 1XMWA 1YEDA 5D2NC 1KPRB 3B9KB 2VDMH 3BW9B 3UTZA 3U0TB 3D25B 4DGIL 2H3NA 1F4YH 1R24B 3OKLB 4PLKC 3DURB 3HCVA 4YH6A 4I18B 1JNHB 2PN5A 1LK3L 4R7NB 1FNSL 1K2DA 2PR4H 2WWKT 1LE9A 3VMOA 4ZS6D 5DK2B 2EZ0D 3DXAA 1HSAA 5D5MA 1FFNB 2VQ1A 2ZPKL 5J57B 4XAWL 3OAUH 1J05B 2YD1A 4GLRI 5KTEL 3CXDL 4NKQB 4NC1C 5EUOE 3DARA 1R3JA 3RZCD 4PJFE 1PLGL 4TSBL 1PY9A 3UTPE 4OQ1A 4KZDH 3B9KC 1TTFA 2AQ3A 3ECBA 4WRLA 5ALBL 3NCFB 5B38G 4KRMB 2AK1H 3R8QA 4BH7A 2KKQA 4NO2B 1JYXA 2FJFA 1YYLL 1HQ4B 4ZODA 1GIGL 3C6LC 1HOCB 3QXTA 3O6FD 4I18C 5JW5A 1HYSD 3QUXA 1CT8A 3RVUD 3VFUB 3RZCB 3I2CH 2AXFB 4NNYA 3L3DB 4HPYL 1GVIA 1FZOB 2EO1A 1WTGT 3DV4A 3BXNB 2XPGA 1UWXK 3WUZA 3O6FB 3WFHA 4LU5L 1FVCB 2X4PB 1X5HA 5A40E 5FYKL 1HKFA 4ZS6C 1KN2L 2EZ0C 3MJ9A 1YZZA 3X12A 4XCYB 3BPCB 4LQ1A 4CMHB 3IDXL 2R0KL 1RHHB 3S4SG 3GIVA 1QRKA 1I3RB 2FECL 2GQHA 3INUH 3LKQB 2PO6A 4LLMB 2B1HH 1H15A 3EYFA 1R5VB 3BESR 3ILPB 3RZCC 2IJ0C 3O0RL 4BZ1H 1YN6A 1QQDA 3WMSA 4HQQH 1MVFA 2DQHH 5GGSB 4O2FB 1U58B 1WZLA 1SEBA 1PEWA 2FJHA 1RK1A 3HAEH 4HKJA 2VDQL 1N4XL 1CD1A 3QISA 3G9AB 4M3KB 1HZHH 4Z0XB 2CUHA 5IVZA 3EKCA 3ROOB 2W65B 4R97B 1YEGH 1N2RB 3HNTL 1JYVA 1IARB 1QO3A 2OL3B 3QXDB 5CEZD 2W0PA 3BAEL 4NQVA 4GQPH 2YOCA 1LWRA 5DVMA 4QXUH 4CMHC 4CJ1A 1EAPA 1N59B 2R8SH 3RHWF 4QEGA 3TNMB 1FDLH 2DBJA 4HWUA 2NW3A 3S88H 4H8WL 5KVEH 5M94B 1RU9H 5LAXB 5JUEH 5HBBA 2XN9E 2I60L 5HY9B 1NUDA 4WWKC 4AH2A 1F90L 4X5WB 3FKUS 2DL2A 2ZUWA 2H2PD 3R06B 1KENH 1YEIL 3P11H 1Q9KA 4ZD3L 1MEXH 2DQIH 4I2XE 3NGBB 3RX8A 4JQIH 1XZ0A 4JR9H 4R97C 3ULVH 3IDMA 4EOWL 3VXSA 4LBEB 3IGAB 25C8L 2VXVL 1BZ7B 5GS1A 3QNZB 4IRSD 4NYLA 2XZCL 1U3HD 5HHMD 1KJ3L 3G5ZB 4GG6A 4IJ3C 2UZYB 4XCNB 5K59E 4PRPD 4JPVL 4HGWB 5J7CC 1M1SA 4XGZA 2JK5A 4IRSB 2Y06L 5KZCD 3JUYA 1JV5B 3QXAA 1U3HB 2FX8H 4GW5B 4LAQL 1A4JA 5HHMB 5E08H 2AABL 3MRRB 5CCKH 1S7QB 5FHBL 1T1YB 2JCCE 3Q5YA 4CU7A 1MQ8A 4XNMA 4PRPB 4XPTH 1UJ3B 2WM0A 2Z92A 1JRHH 4U1GB 5D2LB 1CGTA 4XNUH 3K4DA 5KZCB 3BQUD 4MJID 5C0AE 3OR7B 1PG7H 4C55A 1J86A 4IHOA 4QRTB 2KZ1B 1CGXA 4X7TA 3RUGE 3HS0A 1VDGA 3GRWL 5HGBB 3ZT5A 1UZ8A 2MQCA 4WUKH 4HULB 2R2HA 2X4RA 2BY3A 2AJVL 5JW4R 1HHGA 2R2EA 1WBXB 4IRSC 3H7LA 1KTRL 4RNRA 5F88B 3OXSA 1U8MA 3BQUB 3NCMA 2AV1A 1U3HC 4JRYA 4MJIB 3JWOL 1BMGA 1EGJA 1AD9A 3PGDB 2NPLX 2X4QB 1F5WA 4DGIH 4KQ4H 4M7KH 2O5ZL 3G6JF 1BLNA 1MCKA 4L8BA 1UJ3C 2R0ZL 5MERB 4XPBL 1I7UA 5ACZA 1CVSC 3N85L 5HHVL 5ISZA 3WS3B 1VB9A 5I6XB 3ULVF 4LPYA 2HJKB 3V0VA 4YAQB 5IJKC 2VZ3A 3L5WB 3LD8B 3LEYH 5D2NE 2ZPKH 4L3AA 4R4BB 3RWJB 3T77B 4CL7A 3P0VL 3RWFB 3CXDH 4BSWB 3H6JA 3DTXB 3DETD 2X10A 2FLBT 2GCYA 3IDGB 5GRVL 5A2KH 4FQXA 5FUZL 1SYSA 3HE7D 3D0LB 3E1F1 1OAKL 3TA3A 2VXUL 4HH9B 4GSDL 4X80H 1TXKA 2R1YB 1NCAH 2MNUA 1JUFB 3GJEB 4R26H 4NC1E 4KK6D 2R9HD 5IMKB 2I27N 3UDWC 1BM3L 3C5JA 3SE4A 3HE7B 4LLVB 5CIPA 5B38B 4MJ6B 1YECL 3BH9B 5JOEA 3TZVD 2EDXA 4JDZB 3I9GL 1ZK9A 2UYLA 4UU9A 3VFTA 1M05A 5D6CA 4OCSH 4K8RD 3NPZB 1R3IL 4PRHE 3VE0A 3PDOB 1JGEB 5EFIB 1EVUA 2BVQA 1KIQB 3IDXH 1TJHL 1A7BA 1GZPA 3V0WL 1YQVH 4JO4H 3TZVB 2GEEA 4W4OA 5L2KD 1N64L 5ID1B 3S3SA 1EFXA 2FB4H 4NRZA 1IKNC 1QFWL 5E7BA 5C86A 2FL5B 4RFEB 3QFJD 5BO1L 4B53A 1RZKL 4UAOB 4L1HA 3MGOA 3FQNA 4UMGA 1KG0A 3BIBX 2P7TB 4UDTA 1IEBB 4N1HB 3HE7C 1H8OA 2VDQH 3S4SB 5DMJB 1KC5L 3UPAA 4L5FH 5JXEA 5T1KD 2XG4A 5L2KB 3NCEB 3LKOB 1OAUH 1CFSB 1CFNA 1YEJH 4IOFC 1H3XA 3HNTH 3SO3C 5H35A 3GK8L 1UC6A 1II4E 1YY8A 3F65A 1P4BH 2AV7A 3HZKB 3BAEH 4H1LG 3RHWK 1DLHA 1T03H 5IW1B 2QR0A 5EPMA 1S5HB 2GJJA 2V5YA 1A6ZA 1NEUA 1GH7A 4H8WH 3ARDC 4LSPL 4MAYD 5DJYB 2A83A 2XZQL 3WE6B 1KTLA 1INQA 3BRFA 4JG1L 5AUMB 4OF3A 6FABH 4D0BB 1Y6MR 1I4FB 4FFZH 4WHYH 5I1KH 4RISL 1B4RA 4YHPB 2VZTA 3CK0H 4NCDA 5KVDL 5I1JL 4L4VA 4HAFA 3CMGA 4LFHG 4YBHA 3FONB 2YA1A 1RY7B 4QO1A 4MAYB 1A6WL 3QEQD 1EX0A 1PKQE 1C5CL 3ULSB 1B0WA 1YY9C 4LKXA 5DFWH 2OXHA 5L8JB 3FTGB 3KPQB 5J8OA 4JM2C 2VXVH 4X9GA 3KYKL 1G7IA 2P5WD 1QG3A 5DD1H 1B3JA 2ADJA 3MRDB 4XTRC 1RUAL 5DI8B 1TZIA 2XZCH 1AC0A 2GITA 1F97A 5DT1L 5FUCC 4LRIA 1KJ3H 1D5ZB 4MMXC 3MROA 4ETQA 5IB2A 3VRIA 4OKVB 1FL5A 2CGRL 3S5LG 1WITA 3KPOA 2JB6B 3GGWA 4MVBD 2CDEA 4LPCA 4JPVH 5KVFH 1Q9WA 2FHFA 5GSRB 3BH8A 4XPAL 2F74B 2W92A 3KYMB 2YZ8A 4LSUH 2P5WB 5JTWA 1TNMA 1FL3B 2LE9A 4DUWA 2Y06H 1EEZA 1UB6A 2HRPL 1AJ7L 2AABH 1E6OH 4A6YL 1I7RA 3EOBB 3JUZA 3WIFB 4AJ0A 3ULUD 1DE4A 3MV9E 2FRGP 4IS6A 2D4DA 4BKLA 5D7KE 1SBSL 1DVFC 1H8SA 3T3PF 4HFUH 3JTSA 1CK0L 2BVPA 1P84J 1I3VA 5CJQL 5CJ5A 5F9OH 3PNWB 5HDBF 3QEHB 4M7JL 4ZQKB 3TT1L 2DLHA 2ADIA 2VZOA 4M43H 4YHOL 4CUCA 5D7SL 2NXZB 1DBJL 3BFOA 4DQOL 2FIKA 1UJTA 3GRWH 1MLBB 1TIUA 2A9ML 2ZUUA 5DMGD 4JY4B 4GW4A 3EO0B 3QIWD 5DRXA 1X9QA 3VXUA 4RWYL 1JHLH 3DVGB 1F00I 4V2CB 4GFTB 2OP4H 4J4PD 4TYUA 4ZTOL 1N5AA 4HF5H 2E9JA 5MEQB 2EXWD 4UZGA 3QIWB 4EUPG 2R0ZH 3MRHA 3SCMD 1ZHKA 4WFEE 4LNRB 1JBJA 3C60A 3TBVB 2F19H 1GGBL 4NNXA 2OJEA 2O5YL 5FCSH 4LF3B 1RUQL 2NXZC 5KSBA 4FABL 3DECA 5ECJE 1PX4A 4HS6A 4CVZB 3IDYB 3RI5F 3V5DB 1MI5D 1DN0B 4OF7A 4QXTB 1AXTL 5LQBL 3P0VH 3CFBA 1QSFD 3SCMB 4TULL 3QUML 4YHKL 4BFIA 2EDRA 4XNZB 5TGBB 5FUZH 3TM6A 3P9LA 3B5TA 4RQQA 5IGXH 2GJ6E 4H20L 3IKCA 1MI5B 2RHEA 2LVEA 4XVUD 1QSFB 2P24B 2EYTB 4S1QH 3IKKA 4OGXL 5DO2D 3GSQB 3B83A 3EFFB 4U7MA 5DWUH 4JN1L 5IWLC 2XWTB 1XGPB 2BSRB 3MRGA 2D0FA 2X1OA 1HIML 3ZO0A 1YECH 4JO3L 4MXVE 2QHRL 1O0VA 3QDJE 4MCZA 4MNGB 5BW7A 3IDYC 3I9GH 3MJ8B 1I9RL 2CK2A 1J5OL 4C4KO 3NTCH 1IGML 2NTFA 5EC1A 2JE8A 1MNUL 1VERA 4URTB 1K4CA 2Y36L 2VAJA 4M61A 5FCUL 1VEOA 4PGEB 3QIUD 3RL2B 3QXWA 1DEEB 1UCBL 3VG0L 4CGTA 3V0WH 1SY6H 3GMOA 4C83A 5A2JH 1NANI 1WT5C 1NFDA 3O11B 3QAZB 3H7BB 1MIEL 4KWUA 3WEXB 4GOSA 1KSRA 3VXRE 1A21A 1A8JH 4Q9RH 2WIIB 2EH8H 4YK4B 3QIUB 1RJZB 2ARJA 1GGIL 3MJ7A 1VFAA 3JXAA 4KDTA 2DQCH 1NMCB 5LG1A 3K8KA 2HT3D 1CQKA 4DZBA 4D0DB 3LN4A 4QRPA 4XVUC 3QIBC 3QDMD 1FO0B 3LQAH 5AWNH 5HDQL 4OZFG 1MHHA 3P4OB 2LU3A 3MUHL 2EDNA 4JVPA 1MJ7L 4HSQA 3BPNB 1U8LA 3BMVA 3BJLA 3L5XH 1BQSA 4M1CC 4Y4KA 3CZFA 4JB9L 4PJGB 2Y23A 5BS0A 3L5IA 2QQLL 3LQMA 3TWCH 4OCXL 2Z9TA 3P77A 3QDMB 3E6FA 3S97C 2P8MA 2XXMB 4HGMA 4PGDA 5IMOB 1ERNA 3S36H 2IQ9L 5DJDB 4RISH 3PWJA 1I1YA 4H1LB 4NKOB 1NMCC 3T65A 1IQWL 4KROB 4K23H 3BZ4A 2X4SA 3V52L 1S78C 2WLZA 3O6ML 2EKSA 1FN4B 4OLYL 5HSFA 1CQYA 4G8GD 3CX5J 7FABL 3JVGA 4P2YA 1S9WB 4KGLA 3BPNC 2Z0BA 1F6AB 3WFEL 4U0RC 3A67L 3VCLA 2VSCA 1KIPB 1WBYB 1CD0A 2IWGA 3VGAB 4CN1A 5DT1H 1A7QH 4G8GB 4ODSH 4X6DE 2DQGH 1UZ6F 5T33L 4HJ0D 4IRJA 4NQSA 4PREA 4X98A 1XH3A 4Y5YA 1N8ZA 1LO0L 4KROC 1J1PL 2Y07H 1F8TL 3MV7D 5DVOA 1DQQA 2UWEB 3RWDA 2ITCB 2HRPH 1AJ7H 3WV0A 1R3KA 1ZKAA 3B8YA 4AMKH 5FUCE 4PJ8A 3S5LB 2HKHL 5B3JE 1HWHB 3ALWA 3QDGD 1MAMH 1XGQA 1EZVX 4Q0XL 3WUWB 4RRPG 2B4CC 1SBSH 3GMNB 3MV7B 1ZTXH 1CK0H 3ARBD 4P9MH 4K9EL 5CJQH 3VGAC 2VXQH 1N26A 2PYEA 1UWEL 4R2GD 4N68A 4NP4H 2V5RA 5C0BE 2YC1B 1E0OB 3RRQA 2HVJB 4KI5C 1OTTD 43CAB 4X5XA 2QADD 3BP6A 3W11D 2R15A 3V4VL 5F9JB 3OQ3B 3QDGB 4PRBA 3PGFH 4RWYH 1A6VL 3ARBB 1EO8H 1J8HA 4IMLB 3BDXA 4PJHB 2MKWA 5EBGA 2D0GA 1VEMA 4OFYA 1FPTL 1T66D 4ZPTB 2G75A 3F7VA 2NY3D 3VFGL 4DGYL 4WTZA 4L8SC 1AXIB 4QYOA 4L8DB 5JHLL 2VN7A 4RGND 1BBDH 1EJOH 2H6PA 2XOTA 1B2WL 3B2UD 2BRRH 3KS0H 4FHBD 2Y5EA 4MZ2A 1IQDA 3BYYA 3W9DA 1JPSH 4OCRH 2O5YH 1D5MA 1EUUA 3OXRB 2VKXA 2ED8A 2FSEA 3DJ9A 3G04B 4Q9QL 1CXFA 2GTZA 4BK5A 1RJYB 2IH3A 4PG9A 4PR5A 3RGVC 1S9YA 1CCZA 4PJ7A 4BUHA 4RGNB 5LQBH 4JN2B 5I1CH 4EUPB 3OPZL 3H9YA 4WW2F 5TDPA 3NPSC 3FO9A 3QUYC 4CKVX 4JFED 1FCCA 4ZFZA 1S9VA 1A14L 1OTTC 1AKJD 3NIFF 1BJMA 4QRQB 3VXTA 3W11C 2AERT 2OSLB 4H20H 4IOIA 1GGUA 1A47A 1XCQB 5ESQA 4U7SA 4I0KA 3HTLX 1FL6A 3BD5A 1ODAA 4XH2B 4OGXH 3DBXA 1NDMA 3L6FB 4JN1H 2I26N 3KLAB 4PJAB 5ITBL 1LEIA 3UZQA 4JFEB 1T66C 2YHGA 3KPTA 5EIIB 2DJUA 3DRTB 1XGTB 2ZSVB 4GMTH 4YGVA 1P5UA 3VI3F 3K81A 1AKJB 3IDNB 5FUOL 1ZOXA 3KYOA 2H2SD 1S9XB 2JJTA 1FZJB 4RGNC 4NN7C 1P53A 3D3VE 3IDUA 4ZDHA 4UQ2A 4PJEE 2VDLL 2GAZA 3BD3A 3B2UC 5D6DA 3VG9B 1OCWH 2GUOB 5E03A 4M48H 4L4TD 1NAMH 5J13C 1A7RL 2Y36H 2VL5B 4N0YH 1OSPH 5FCUH 2P8LB 1UCBH 1NMBL 3VG0H 2VAAA 3LDBB 4YHML 2VIRB 4BQ8A 1V8HA 2OL3L 3HNSH 5CSBA 1TZGL 1ORSB 2BXYA 4KK9C 1EVTC 1FRGL 5A43C 1P1ZB 3G6AB 4L4TB 5FDYA 3HZMA 5HYJA 5EIQA 1UKTA 1EFQA 3C5SB 5H37G 3W2DH 1GGIH 3CPLA 2NY2D 1I3UA 4O02L 1KXVC 4Z7UE 4JFQA 2CDGA 2HJLA 2L4OA 1JWUB 4P5TD 3VH8A 3RUGA 5CEZL 1MFEL 1LEGB 1GC1L 2J4WL 4HBQA 5BMFL 5E5MA 1KBGL 2GY5A 5KS9B 1K8IB 4FQLL 4PB9L 2RIKA 3REVA 1EO5A 1ZLSH 1NGZB 4ODUA 2QQLH 1OQXA 1F2QA 1DSFL 1DLFL 2OTWA 3VFPA 2BSSA 4GBXD 1KPUB 4ZS7H 3STLB 2WBJC 4F9PA 1N6UA 5C7XL 4OZIB 3BUYB 4PJDF 1T20A 3SHSA 4EXKA 3VD9A 4K3EH 2AXJA 2V5SA 4OZFB 2CJUL 1SM3L 4HUWA 1W2KT 1MWAB 4J1UA 1JPGB 1DDHB 2VLRE 3D39A 4G9FA 3SDXB 1I7TB 3P9MA 5CEXA 3VRJB 3VD5A 1M7DA 1CGWA 3H9SD 15C8H 4QHMB 3V52H 1TVDA 4HV8A 4JY5L 3IDJB 3O6MH 4GBXB 5JLZA 1MHPL 1WWBX 5LGJA 5D2NA 4F7TA 5J9PB 4ZSOB 1BBJB 2Q86A 5CAYB 4M8QA 4M1GH 1UVQA 5HHOD 3TPUB 1NSNL 4CBPA 4XHQA 5DR5L 4XVTH 1TJIH 1R3HA 3EDKA 3DSNA 3A67H 3STBA 2W0KA 2ID5A 2I5YH 1R5IB 1NGYA 4OD3L 4W4NA 1UACH 3FO0L 4O5LL 4QWWD 3H9SB 2GKIA 1H3UA 5FYLE 5F7DB 1RZ8A 3UROR 2CIKA 2RFXB 3TBYB 3FQUB 3GKWL 3GSRA 1MIML 3L3HA 2CO7B 3OMZA 4FQJL 4NDMA 1KCRH 3TO2B 3IYLW 3O3DB 4HWBA 5IV2B 3V7AG 5HHOB 2PW2B 1JHTA 4YDVA 1C5DB 3ZHDA 5EA0L 4F7EB 1C12A 4I0PD 3R8BB 4LVEA 1AP2A 1K8DA 1LO0H 4PJBB 1J1PH 5M95B 3OG6B 3OKYA 3FAXA 3PQYA 4G6FD 4MX7B 1PJ9A 1FZKB 1KPRA 1U8KB 4JKPH 1U6AL 2AJSH 4E5XB 3B9KA 3BW9A 3MBXL 3DSFL 4PS4L 5KANI 3DX8B 3NH7L 2FIRT 2CMRL 3L7FB 2XA8H 2HKHH 1FLRL 3OKLA 4QXGL 4GMSH 1YJDC 3AY4C 2X9WA 3BZEB 4I0PB 4I18A 4PRHA 2VDKH 4R7NA 1C1EH 1N5YH 2OM5A 4G6FB 1H8NA 4P2OD 2MHAB 4FZ8H 3D9AL 3ZKSD 4QRRD 1UM6H 5DYOB 2VN4A 2HH0L 2E9WA 1FFNA 3TV3L 4KAQH 2EIZA 1SJHB 3LSOB 3HB3C 5L7XL 3OKMB 3FQXB 3LZFL 4GQ9L 1S9KC 4QWWC 1KYOJ 2X4UB 1A6VH 35C8L 2LTQC 3MCG1 2J6EH 4P2OB 1TENA 4QRRB 2C7UA 1A02N 5IVXE 5E95B 2YD3A 12E8L 1TTUA 4F57H 1IC7H 1OLLA 2FZ3B 4NO2A 4UT9L 4R8WL 1HQ4A 3E0GA 3VRLF 1HOCA 4I0PC 1JL8A 4KI5E 1NDGB 1MJJA 3HZYB 3VFUA 1YUHB 3RZCA 4I1NB 2AXFA 3GJFB 1AGDA 1Z5LB 1SMAA 2YUWA 3L3DA 1N0XL 3S98A 3MJ6A 1FZOA 3QWQB 5FF6B 3SY0A 1RIVL 3BXNA 1NBZB 1DANU 1WK0A 1OL0A 4YHZL 1FVCA 4XBPB 1AGCB 1QP1A 2YXFA 4HXAH 4XCYA 3BPCA 2AVGA 2NY6C 4WU7B 5ESAA 3GEWB 3B9DA 4U7KA 4LLWB 3W82A 4LLMA 3MRNB 4KRPC 3L3IB 3W0WD 1R5VA 3ILPA 1J1XL 5K9QG 1RK0B 1Z9OA 3MLRH 1TZHB 5D1ZD 1QLEL 3I50L 1T21B 1DL7L 5GGSA 2ITDB 4OGYL 4PRDA 4KJPC 3TN0D 3AXLB 1FYTE 5DC4B 4QCIB 3DHJA 5FUOH 2DQTL 4LEXH 3VXMB 1T0NA 4K8RL 3VI4E 2GY7B 3W0WB 3QEGH 2V6HA 2X40A 1YMHB 2W65A 3K74B 1N2RA 4JFDB 5D1ZB 2OL3A 1KELL 1AR2A 3HLAB 1NC2D 3TN0B 4WENB 3GHEL 4CADA 3SO5A 4F7CB 1NMBH 2B2XH 3LN5B 5E4EC 3TNMA 1NPUA 4WFFD 1U92B 3O2VH 4XWGL 5F3HB 3NBNA 1NJ9B 1CXKA 5DF0A 1CWVA 3MV9A 5D70L 5F93C 5LAXA 5I1AB 3HI6H 1DFBH 2YZ1A 3H42L 4HIXL 1Z9LA 2AK4D 1NC2B 5HY9A 3FHAA 4OSUL 4N8CL 5IKCB 4X5WA 5CJOH 5SX4H 2W0FB 3CAFA 4H88L 3R06A 1CGYA 1K4DB 1TCRB 4LKCB 1IJ9A 5ITFB 2NCMA 1Z0MA 2CXGA 3NABL 2J4WH 4LGSB 2BNRD 2QTEA 1FGVL 2RJMA 2W91A 5GRUL 5DEZA 3ARRA 1KBGH 4LBEA 2AK4B 3WHE0 3MJ9H 2MOVA 4YXHH 3TN0C 2E9BA 1BZ7A 4WFGE 3QNZA 4NC2B 1EHLH 3ZDYF 1ZT4B 4GXVL 1H3VA 1IC4L 2ZCLL 1DSFH 2P42B 1DLFH 1G7LB 1MFCH 1P9MA 4TNWF 3AU1B 4MNHB 3BRDA 2BNRB 4AQ1B 1REIA 3G5ZA 1SM3H 5GGSY 4XCNA 4WWID 4HGWA 1EAJA 1CYGA 1T4KB 3BN9D 4AYFA 5KJRH 1RZ7L 4IRSA 2GFBB 3UTTE 3ROLA 1JV5A 1I85C 1U3HA 4GW5A 1MHPH 4WDIB 4Z8FL 3MRRA 1S7QA 4ZUVB 4WNQB 3MRJB 5F1KC 1UJ3A 5MP6L 4U6HA 1HINL 4R4ND 3TJHC 4OD3H 3ZE0E 2VLKD 1N0LA 2OXGA 4G6AD 4GUPB 5I16B 4P2CG 4RGMB 4J2XA 3SGKA 1OAQL 2MSPA 1N6VA 2BVOA 3G5VA 3C6SB 3OR7A 3QUKA 5DS8B 3GKWH 4LHUG 1MIMH 4AG4H 3BZDA 3BUTA 4KU1A 3WXWL 2C3VB 2Z4QB 3RBGA 5C08D 3N1MC 5HGBA 2GSGB 4ENED 4YUEL 5EG6C 1GGYA 4JAMB 1A2YB 1WBXA 2VLKB 3X11B 5F88A 2APFA 3HC0A 5EB9A 1GOFA 1B0RB 3BQUA 4L8CA 3P4NB 5FYJE 1IGCH 1C5BL 3ULUL 1JTOA 1U6AH 5D7IB 5DC9B 1PGRB 1T1WB 4X4MA 3PGDA 5CP3H 2X4QA 5E2WH 2CMRH 1IM3A 4Z7NF 4WV1C 4QTHB 1FLRH 4QXGH 5C08B 3K8LA 5I1HL 4IBLT 5F8RC 4X9FA 2HFEA 2OMBA 2R2BB 3BN9C 3RWCA 3BKMH 4Z95L 4PP1C 5MERA 2BSED 4NBYB 3VMNA 5JNYB 4MSWB 2QQNH 2HFTA 5JPNB 3WS3A 5CD3B 4PBVC 3UDWA 1QNZL 4R0LB 4NM8L 4YAQA 5DD3H 2KQNA 4YDLB 3L5WA 3MZTA 5GPRA 2HT2C 2DICA 3TV3H 5IHBA 3MA9H 4N9GB 3RWJA 4X7FC 3F5WA 3T77A 5L7XH 1YC8A 4RZCB 1SEQH 1WFUA 3DTXA 1QD0A 2HYMA 2IQAB 3IDGA 3ORJA 1UA6L 35C8H 3TH2T 2HA1A 5CJ8A 2N7AA 1LO3H 1INDL 1YEKL 4HC1L 1FE8H 5F96H 2V7HB 2EIBA 3D0LA 2WQ8A 2H41A 4FOMA 2OS7A 4WI3A 2C1OB 4L29A 4R8WH 4ENEC 5I2IB 4HH9A 4TTDD 5L8KB 3G5YB 3IVKA 1CDCA 2R1YA 5ADPL 1NL0H 2EDWA 3OJMB 1JUFA 3GJEA 5IMKA 5D8JH 4KZEH 5IOPB 3HE7A 3Q6FB 3O3AB 4LLVA 4MJ6A 1RIVH 3BH9A 5JHDD 4JDZA 2DM4A 2VZSA 4OZGF 4YHZH 5DDHB 1PZ5B 4MJ2A 1OW0C 5EO0B 4FTVE 4LSDA 3U36B 2B7DT 1CD9B 1WZKA 3RNKA 5IROC 4NQEE 5DJAB 1NMAL 3LEVH 3GSNH 2Q8BH 3EBAA 1T83C 3FQRB 1JGEA 3QJFB 5EFIA 1MCFA 4NOBA 1KIQA 4K71C 2C26A 1QBML 3GBNH 4DK6A 4QTIL 5JHDB 3TZVA 2JF1A 5I73B 4MA3B 4ODTH 3ZTNL 1ZXQA 3ARDA 4RMQA 5I15H 2CRMA 3PWPE 5ID1A 5J4MA 1D6VL 4KTDL 1J1XH 4CW1B 4ODHH 2P48B 2QQKL 4Z0BL 2FL5A 4RFEA 2LFGA 1QLEH 3V79C 3GB7B 3GSUB 2VLME 4CNIB 1FNGB 4C59B 4LSTL 1IEBA 3KGRA 4YDIL 4J3SA 2QEJA 1ZEAL 3WD5L 4ERSL 4OTXH 4X6EB 3QULB 1OF2B 4O51B 4X6DA 5EOQL 3NIDE 3VXQB 4NRXB 5L2KA 3LKOA 5C0DB 4BQ9A 4XVSL 3JWDL 3FOLB 4PY8I 3ESVF 5F7HA 4W6WB 3T2PA 3HZKA 5IFJA 3AAZB 1IZJA 3GHEH 3FO1A 5K9JL 1RUMH 1NEZB 1KB9J 1FO0L 1S5HA 3X3FH 2ATPB 4LCCC 4MYWB 5B8CB 5CHNA 4Y19E 4XNXL 1RIHH 5DJYA 5E0QA 3VA2C 3WE6A 4D8PA 5D71L 3MOBL 5AUMA 4XRCB 1P2CB 4D0BA 3AB0B 1IEAB 1I4FA 4M4RA 4NJ9H 4YHPA 3HG1D 4IIQB 2X9XA 3LKRB 4OSUH 5GRXG 4DWHA 3EYVB 4KJYB 4H88H 1PSKL 4X6CF 3FONA 3SOBH 4TSAL 1G9NH 3TF7C 4J3OC 3GO1H 1WAAE 2IGFL 2IC2A 5EZOH 4ELMB 3MRQA 3C08L 2QSCH 1UT9A 4Y1AE 3V5HA 4F15B 3FFCD 5J89A 1W72A 3FTGA 3HG1B 2DYPD 5I9QB 3KPQA 5GGUA 2VITA 3BPOB 1ES0B 1RZJH 2DQUL 4Y2DD 4GXVH 3W5NA 1IC4H 1T04B 5INCB 5DI8A 3U9UB 2NY5L 3CGTA 4PGCB 3ILQC 1JPFB 2BCKB 4XMKL 4PJIB 3VXME 1RIUL 2WAHA 3FQTB 4OKVA 3AB0C 2JB6A 3N1QC 3FFCB 5T3ZH 1F58H 1HXYB 1YYML 1IFHL 4IIQC 5IB4B 4JFDE 5GSRA 5IBLD 5GRZA 5L9DH 4EI5D 4RMVA 3WIHA 4Y2DB 4G7VL 1OAXL 3BEWB 3K2MC 4M9OA 2OZ4A 1PG7X 8FABB 1WBZB 3DUUA 2G2RB 2IBZY 3BDYL 3EOBA 3WIFA 4YX2H 4DW2H 3MYZA 2GIYA 3UC0H 3EUUA 3QO0A 1BD2B 1IEHA 5MP6H 4ZNEE 3BT2L 1JCKA 5GRYA 1HINH 3BMWA 4EI5B 3CSYB 2Y5TB 3OB0H 1X44A 4XCCH 1IGTB 3U1SL 1OAQH 3PNWA 1YNTB 3ZL4H 3BGFB 2ZJSH 5CSZB 1CVRA 4LHUD 3T0XA 3DI3B 1P7HL 2X1QA 4WU5A 3GMLB 1MLBA 1KB5B 3S37L 4M6OH 4JY4A 2YPLD 3HUJB 4XNQB 1GPOL 3ZE1F 2JB5H 3EO0A 2EDTA 5KSVB 5T1MB 4NOFA 2VTFA 4HPOL 5HVGB 2AAVA 4ODVL 4Z18A 4YXLL 4K7PY 3B2VH 3E3QC 1C5BH 5CGTA 2F54E 4LHUB 3P3YA 3MLZH 5J12B 4LL9A 4LIQE 4C56D 4KFZC 1ZSDB 4HEPG 3OB8A 5I1HH 1XGUB 1VFOA 2YPLB 4OZHB 1YDPB 4HCRA 4XAKD 3CLEL 5K9QI 1RAMA 4DUVA 4U1SA 4JQXA 4NSKB 3TBVA 5SWZD 2DLIA 4GG8B 5IWLA 4TUJB 5C0GB 4ZOEA 1QVOB 3HAEG 4LF3A 4NM8H 3DX9A 5C0NC 5BQ7B 2F8XC 1GXEA 5EORL 4KKAD 4C56B 1PBYA 4HC1A 4M03A 1J9CT 4KHXL 4CVZA 1CXIA 3NOIA 4BSVB 1DN0A 1G7MB 1LD9B 1QRNE 1QACA 1J10A 5SWZB 4WEUD 4P3DB 4X9IA 3VU2A 1DQJB 1INDH 5E6ID 3R0MA 3RX5A 1BOGB 5TGBA 3KR3L 3AC0A 5GZNC 3I3EA 5IM7B 1BX2A 2GTWA 2X09A 3FN0H 1WT5A 3ZYIA 4L9LB 1VA9A 2EEBA 3SKNB 2P24A 3MRMB 4N90D 1MCJA 1U8NB 3MLUH 5AZ2L 5ADPH 4HWEL 3EFFA 3U30C 5E6IB 2XWTA 3LRSB 1XGPA 4JFXA 2BSRA 3KJ6H 3WDHA 1ZVHA 1WZ1L 5E1AB 2N56A 2MQ3A 1MH5B 5DHVH 4MNGA 3RWHB 5F7YC 3MJ8A 2UZIL 4TVPH 3QIBA 2VLRA 3UTQB 3C2AL 2A6IB 2O93L 4AIOA 1HSBB 4P4KD 1NMAH 3RL2A 1A3LH 3LS4L 1F42A 1DEEA 4GKZB 5GHWH 3CH1B 3O11A 2DMKA 1A1MB 3H7BA 1D6VH 2C5DC 1MY5A 2HTLC 3WEXA 1ADQL 4Z0BH 4P4KB 4HMEA 4NHUB 2WIIA 5EU6D 3QIUA 1RJZA 4M7LH 4LPXA 3RY6C 1ED3B 4MS8D 2ICES 1FFOB 4ERSH 3VDAA 3ZDXF