2CD0A

Structure of human lambda-6 light chain dimer wil
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISGLKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAM
publication title Tertiary structure of human lambda 6 light chains.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cd0A00
5TF1H 2EH7L 1XZ0B 4PG9B 3V8OA 4IRZH 5DHVA 2FZ3B 2ADJA 1IVLA 2X4QB 5F89A 1RUQL 3JVGA 3DETC 3QFJB 3CC5A 5T3XL 1UB6B 4WWKA 5MEOA 3HMXH 4G6ML 1YECL 5D2NA 1A6AA 1BP3B 4PJ7B 3IDNB 2FD6H 3LHPL 1KSRA 4FP8L 1S7XA 4PJFF 1LO0L 1QACA 4UINH 4WTZG 3FFCE 3QDMA 5EC2A 2VXQH 3WO4B 4NKOA 1MCPL 3BE1H 2XWJA 3NACH 4Q9QL 1VFBB 4HFUH 4KZDH 2LABA 4XT1C 3FQXA 1RIHH 4WO4D 5I18H 4U49A 3STZA 1G7PA 4X80L 3WHE0 2ADFH 2Q87A 5IW1B 3U36B 1T1ZB 4ORGA 5KW9H 4J3XA 1AGEA 1Y6NR 4HWBH 1P4IH 3MRGA 3SGDH 4JKKA 1CE6A 3EO0A 3NZ8A 4H20H 5C0IB 3BZEB 3QR2A 5E8PA 4MDIA 2X4SA 4ZUTB 2P5WE 4MAUH 4ZD3H 3MRKA 2VC2L 3SQBA 5IV2B 5KSVB 3MV8B 1AXTL 4GW5B 5IP4A 5FUZH 1F90L 1BZ9A 1I1FB 1OCWL 4D2NA 1Z9OA 1JRHL 1AKJD 4MJ6B 1EUUA 1BLNA 2VL4A 3MLXL 2ADIA 3PP3H 4L8BA 5A43C 1Z3GH 4FXLA 5E6IA 4XCNA 1W0VB 3ZKNC 5GGTH 4UT6L 4TULH 4H25B 4F3FB 5I1HH 5KSAC 4PJ9C 3L5JA 1YEKH 1FFPB 1LO5B 5F88B 2RCSH 4WRLA 1I1YA 2BX5A 1VB9A 4ZODA 3HE7D 1M4KA 5J12B 2CMRH 2NY4D 4JKPH 1AO7A 3SGKA 4FFYH 4H5SA 2VXVH 4YR6A 4XCFH 2IFGA 4Q9RL 4NNYA 1PD6A 3TBVA 4DGIL 3MCKB 1UJ3C 4XHQA 4NQCD 2J6EA 4WEBH 5TH2B 2GTWB 5DRWB 1DBKH 3QXWA 4MNHA 3QEQB 1WBXA 2DI8A 2FHFA 2I60H 1NGWB 3PABB 2N4IA 4K3JL 5GGUB 1MFNA 3BMVA 3IAQA 4EVNB 4JFPA 1JWMB 4G9FA 1PX3A 1AGDA 2HT4C 3VG0L 3LN4A 1FAIH 5K59F 1KULA 3OGOE 1F58L 4XBPA 2ICWB 3SDCD 1AXSA 4GAFB 1GCFA 1DVFA 4XX1G 5HI3D 1MREL 3RJDA 2R1YB 1QLEL 5BJTA 4X9GA 2YD2A 1I9EA 3FT4A 4OZFG 2AK4B 3Q5YA 5TGBB 1K4DB 1QHOA 2NY2D 5I74B 3PQYA 2D7OA 4L4TB 4OD2B 3JWOH 2HFGL 1Y0LA 2J6EL 3WMSA 5BZDA 2Y5EA 4LOUD 1QPPA 4R6UA 1YQVL 4Z7NF 2LAGB 1R3HA 3OG6B 4X6CB 1DFBL 4HGWB 2JIXB 3AREB 2OXGA 1FFOA 3FFCD 4RMQA 5IVXE 1WAAA 5BVPH 4JDZA 1LK3L 3PNWA 4N68A 2OJZH 1MVFA 5I2IB 2QBWA 3NA4A 3OAYK 5DGQA 2B4CL 3UPRB 3WDIA 1G7QB 4QRRA 1NFDB 2NZ9D 5CJBA 3WUZA 3F7VB 5DR5H 5D1XA 2MCPL 5ITBL 4HQQH 1F11B 5C7XL 4R4BB 4V1DE 4AMKH 1MFCL 3KNBA 5I6XB 3OXRB 4UILL 5JPNB 1FNSH 2NTFB 3HNVH 3HUJB 1F5WA 5IVNA 4KQ4L 3HN3A 3CVHH 1MJ7L 1YUHB 1VPOL 2AEPH 3QHZH 4KKCD 2I9TB 1NBYA 5IJVA 4YZFE 4PB0L 2Q76B 3OKOB 1YN7A 1JUFB 5FA4A 1DP0A 4YDVB 3EJYC 1PYWB 2VLRB 4N0UA 1CL7L 4WY7H 1HSBB 4MQXD 2XZAH 3GSOA 4YFDB 3TYGL 1Q72L 2R56L 3VXSE 2XNAB 3VGAC 1F3DJ 3S5LA 3KXFB 5KS9A 3OQ3B 3QZWA 5SWSB 3VDAA 5C0JA 1Z5LA 1QFUL 2D4DA 4JFEB 4LLDA 2NYYC 3D5OF 3RIAK 4RMSA 1L6ZA 3GHEL 4LU5H 2W60A 4NC1E 2HKFL 1LEGA 5DQJA 3O45B 1I9IH 2NY6D 3VXQA 3BUTA 3HB3D 5T5FH 4BYHA 2WINB 1HHKA 3BIKA 3SGEI 5C3LD 3VFGL 4OT1L 1WEJH 4Y19E 5LXGL 2Q8BH 3BI9X 1HXMA 1G7MB 1U3HA 5D93C 3F12B 1RK0B 4NRZA 1PZ5A 3ZL4H 2W9EH 4X5XB 2KH2B 3R4DA 2XQYG 4PJ8B 2OLDA 1DQQB 5FM5M 3O11B 2FEDD 3DOSA 4IM8A 2Z31D 4P46D 4CW1B 2HMID 1YEFH 4Y4FD 4U05A 4QXUH 5EO0B 1AQKL 1RK1A 2X89A 2YPVL 1A4JB 1JE6A 2GQHA 3WEXB 1LO2H 2BRQA 3JWOC 2WW8A 4LSPL 1J1OL 3ZHLA 1OAYL 4XPFH 3QT2A 1ZOXA 4LKCB 1P5UA 3BEVB 3WUWB 4UNUA 4R0LC 5EN2B 2MOVA 1DQLH 3WSQH 3MYJA 1KG0B 2IBZY 1EO8L 4LHUD 1KLGB 5GJSL 2EYSA 4JB9L 1CICB 1OSPH 3B3IB 5IG7B 1NGYB 4CADA 4WV1C 4YJZL 5FYKH 1SY6L 2IH1B 4I2XA 4QOKE 4Y2DC 3L3KA 2R2BB 3RWJB 3NA9L 3TN0C 2F5AH 5IHZA 4OB5H 1H5BB 1MRFL 3AU1A 1XF2A 3GI9L 3M17B 1OAXL 1TCRA 1JGVH 3L9RA 4NKDB 2GSIA 1OGAD 5IKCA 4Y7MA 3QDJA 3S4SG 3U30B 3KYNB 3N9GH 4DN4L 5C8JA 2HRLA 1KC5L 1N4XL 1JYXA 2YMXH 4QKXB 4YGVA 4UNVA 1KIRB 1TJIL 3MNVB 1BD2E 4YK4C 4V1DD 1ZHKA 5DRXA 4N8PA 1D5ZA 5KVFH 4KDVA 1A22B 3VXME 3PWJB 4AK1A 1QFPA 2YWZA 3V6FB 1Y6KR 5T1MA 3T77A 3QIUC 5DHVB 3CDGA 2ADJB 4C58B 4DWHA 1RZ7H 4CU7A 5F89B 2DS4A 3CC5B 4H8WH 2XKUA 4WWKB 4RFEB 4LP5A 3IXAA 2IPUK 5D2NB 1A6AB 1MH5A 1QA9A 5AYUL 3NABH 5I8KL 3I50H 1OQXA 2F53D 4P5KA 3VXSD 3H9HA 2C1PB 1FVCA 1S7XB 4QF1B 5HDLA 4HJGB 3QDMB 5EC2B 1P4LA 3R8QA 1BJ1J 2XWJB 1HKFA 4ODVL 5E2JA 3V0AC 1EO5A 1MCBA 4OIIH 3NZHL 4GAYA 2UZIH 3FQXB 3RTQB 1G7PB 1CGTA 4QNPE 5EWIH 4ORGB 2C5DC 4Z7VE 3ZO0A 2IALA 3MRGB 1CE6B 3EO0B 3NZ8B 1UJTA 1UZ8A 4KK8D 1GSMA 1OAKH 4Y19D 4J2XA 3L3IA 4LCUB 5E8PB 1K3ZA 3BN3B 5HJ3A 2BSRA 2H41A 4UBDD 3MRKB 3ALWA 1I1CA 1MCQA 5C0DB 3CU1A 5E6YA 3A6BL 4DFIA 4DZBA 1AR2A 1BZ9B 1KUMA 2Y36L 4OZHA 3GMOA 1JNNL 1EERB 2BOBA 1BLNB 4G6FB 4TTGA 3O8XD 1KLFA 3SDXF 2ADIB 4L8BB 3RP1A 2FHBA 5E6IB 5DFWH 1GZPB 1VESA 2XXMB 3A67L 5CEXA 1BWWA 4QRPB 3QDGA 5EH1A 3I3BA 5H37G 3PWPA 5CWSB 1D5IH 1PFCA 2PTTA 4KJQD 2DKUA 4D9LL 4YQXL 1I1YB 4GG6E 5I19L 2EDBA 2FIRT 4XC3H 4XB8A 4YHMH 3QAZB 1DBBL 1W0WA 5H35A 4F9PA 4A6YH 1S8DB 4HUNB 1AO7B 5DJZA 1FL5A 1JTTA 4H5SB 4X7TA 4YR6B 5GZND 3BAEH 3EYQC 3CU7A 3Q3GA 4NNYB 1T2XA 3O0RL 3TBVB 4QOKD 4DZ8A 3B9EA 2DBJA 5D7JA 3VFVA 1O7SA 1TZIA 4HJJH 5C0CE 3F58H 4UT9L 4MNHB 3WXWH 4HW6A 1WBXB 1IEHA 3EHBD 4R97B 2XRAL 4GXVL 1MIMH 4NN7B 1AY1H 4HK3J 4JFPB 4G9FB 5D1ZB 1AGDB 3KWWB 3WKMH 3LN4B 1JGUL 1S7RA 3X13A 4NUGH 4HXAH 2KL6A 4M7LH 4OFPA 1YJDC 3EW3B 1BD2D 3L5XL 1WV7T 1MFDL 1AXSB 3SY0A 5D71H 3VXMD 4FQLH 5F9AC 5BJTB 3Q6FB 5EBLB 1IQWL 4ZTPH 5DD5L 4PJDA 1MFEL 3PQYB 4RX4A 3C5ZC 5GSRA 4HK3N 1Y0LB 5BZDB 3V4PH 1P4BH 5LAXA 1R3HB 3FO0L 3E3QE 1RVFH 2ICCA 1FFOB 1N0XH 2ED7A 3LDBC 4GQ9H 4K55A 4P2OA 4JDZB 3PNWB 3QCUH 5DD3L 4LGPB 4Y8AA 4P59H 1UM4H 3O2DL 1IGMH 4NZUL 1ZGLB 3T1WA 5D5MA 3UTPE 4EUPH 3CMOL 1GGBH 4PGBA 4QHKJ 2FO1A 4IDJL 3RAJH 3G5VA 1I4FA 1I7RA 4I48A 2AABL 2LE9A 1VGKA 1WZLA 3IFNL 3O4LE 4YBHA 1RHFA 3BP5A 3CNKA 1A5FH 4XP6L 4RIRA 3BDYH 1OD9A 3B5GA 2HLFD 4KDWA 4MD4A 1NBYB 4OBRA 5IJVB 1D3CA 5INDA 2V9QA 1YN7B 4FZ8H 5FA4B 2C3GA 4L9DA 3STLA 3QWQB 4N0UB 1P5VA 3VXPB 1SM3L 1RJCA 1VFOA 3GSOB 3LKRA 3MOBL 3O4OC 1HILB 3W9DA 1JWSA 4M4RA 1SJHA 1RUML 4FXKA 4BFBD 5KS9B 3CFKA 1T2JA 3QZWB 1A6WH 1VERA 2R69L 3TH3T 1YC8A 4QXGL 2X70A 4LLDB 1RZJC 5KSBF 1IGCL 4JFFA 3FO9B 3QEUA 4E41D 2YD1A 2WWKT 4GRLA 1LEGB 3DI2B 3SE8H 5DQJB 3DVGB 1IMHC 3VXQB 5ENWB 1WITA 1HHKB 3BIKB 1H3UA 2QSCH 1PAMA 2PNDA 2CKBH 5K33A 1IC7H 4CGTA 5K59E 1CDCA 1HXMB 1U3HB 5I1DA 3U1SL 4NRZB 1PZ5B 4G8GB 2UWEE 4YXLL 4JO3L 3GO1H 3W82A 5LGHL 1C5BL 2DKSA 2QTEA 4AG4L 4P4KC 1OAUH 2D7PA 1RK1B 2VDOH 2H1PH 4C4KO 4OM1H 5JHLL 4EOWL 1SHMA 2WBJA 1DEEA 1TTUA 2CGRH 5T3ZL 2Q8AL 4U33A 5CCKL 2ZCHH 1ERNA 1HN1A 2VDLH 3TVMC 2GJZA 3ESVF 1MPAL 4U2YA 1RHHB 3T65A 4OIBA 2ZSVA 4L1DA 3V4VH 3MYJB 4KTDL 1RMFH 5BOZG 3ZDZF 4CADB 2RJMA 2PYEB 5E2UH 4I2XB 3ES6B 4KVNH 3SCMD 3L3KB 5IHZB 2DWDA 1XF2B 2ZUVA 1TCRB 2P4AB 3WJJA 2M26A 1OSZA 3DJ9A 3L9RB 2GSIB 1F45A 1KTKE 5J13C 5DT1H 3QDJB 3T3ME 1ADQA 3T0DA 5C8JB 3UTPD 5TDNB 5I8CA 4JZJA 5F7KC 4X6DF 1EEYB 1UKSA 4DQOL 2OI9B 4YGVB 5C0EA 2ZNWA 1CLYL 3OXSA 3ISWA 3LQMA 1ZHKB 3MJ6A 5DRXB 5GS0L 3VWKD 1D5ZB 3O4LD 4PUBH 5C86A 4KPHH 4YXKL 3CLFL 4PRIA 1WCQA 2AJVL 5T1MB 3VFOA 4U6YB 2R1XA 2CO6B 3CDGB 5CILH 3QDAA 2CJUH 4EEEA 2APWA 4OLUH 3V4UL 4FNLH 1DQJB 4I0PC 3IXAB 3B2VL 1MH5B 3BZFA 1QA9B 4LPUA 4K7PH 1MY5A 3T2NH 3H9HB 4O5LL 1FVCB 4RNRB 4LRIA 1RFDH 5KN5A 1P4LB 2HTLC 5GGQL 4RQQA 5C92A 2YWYA 1G1YA 4YDKH 4GAYB 5D7SL 5T33H 3AS3A 3C5JA 3H42H 1A0QL 2VXUL 1P9MA 4K8RH 4JPVH 4Z9KB 2D0HA 4WFFE 3UPAA 4O9HL 2QQNH 4KKBD 4DKEL 2IALB 3DETD 4P9ML 5E5UB 5AZ2L 4E5XA 4XX1E 1N8ZA 1UZ8B 2XPGA 3RFZC 4JQVC 1BVZA 5GRYA 3L3IB 4WI7A 2BSED 3ARSA 3SKMA 1BFVH 5HJ3B 2BSRB 4XHJD 4HF5L 2XT1B 3QUZC 3A6CH 3ARFC 4DZBB 3QQ4A 3P40A 4NO3B 3BIAX 1I7UA 1YY8A 1MF2L 4OZHB 5AAWA 3GMOB 1S7WB 4Y4KC 2V5YA 12E8L 1YQ2A 3AM8A 4HWEL 5HHXL 1SBSH 5DZOA 2Z8WC 5HHME 1WZ1H 1K4CA 5CEXB 4RAVA 1BQUA 3QDGB 5I8EA 1T5WA 1SMAA 1RJYA 3PWPB 5JDSA 4LSQL 1QFWH 5DO2D 2PTTB 2GAZA 4OD3L 3SGDI 5KANI 1TJHH 3GRWA 3ARDC 1G6RH 1UXSA 3SKJL 2BVOA 4JM2B 1FHGA 2DLGA 4K94L 4NZTH 1BIIA 1UYWL 5H35B 3QCTL 1RZ8A 2A38A 1ZKAA 3IDIA 4JRYA 5DJZB 2HRPH 4HLJA 4HS8L 1VDGA 3Q3GB 4CKVX 3KR3L 3LKSA 4FFVC 4X4ME 4DZ8B 2DQTH 4ZO9A 3VFVB 5D4QA 1TZIB 4LASH 4CVZA 1BMGA 4XRCB 1MCHA 2Z9TA 3PF2A 5DC0A 4AM0B 1IFHL 1T66D 5KSAD 3DVFA 3GZKA 3QI9A 2NPLX 3TO2B 2V5RA 1Q94A 3F5WA 3P0VH 4C56A 1FL6A 3G6AA 5C08E 4HKBA 2D7TH 3ARZA 4UI2A 1CIDA 1HYSC 2K3TA 1S7RB 3X13B 4ONHA 1G84A 4G42A 3VFSA 4NP4L 3FRPA 3CXHJ 3HS0A 3SY0B 5FOJA 4BFIA 3RRQA 3O81A 3TT1L 3GK8L 1EVTC 2R0LH 3QNZB 4PJDB 4PS4L 4LPYA 4NWTL 4BJLA 4OCWH 1YYLL 1HYRC 5GSRB 2E5EA 3TNNA 1WBYA 1NUDA 4KMTL 4QRQA 2HT4D 4HPYL 2A83A 3EYVA 4HK0A 1MI5E 5CIPH 3SJVA 5F8RC 4ODTL 4Z78A 3CFEA 1X5JA 5LBSL 2CDFB 4P2OB 3MX0A 5IVZA 3U46A 2Y6SC 3KPRE 1F97A 1MCOH 1HOCA 1MFAH 3DTXA 2DMKA 4ONOA 1KB9J 1RJLA 4XPGH 2P5WA 4XXCC 3VCLA 3MODL 4HIIB 5D5MB 1TJGH 1PVHA 2EXYC 4PJIA 3G6DL 4OLZH 3RVTD 3F7YA 4PGBB 3QHFL 3T4AA 2BNRE 3G5VB 1I7RB 3BDBA 4I48B 2VTFA 1BECA 3S97C 3D3VE 1AJ7L 3N1MC 2E8YA 4PYGA 2WUBH 4KZEH 3ELAT 4HZAA 4XPHL 1I8LC 3BP5B 2X9WA 4OLYH 2AQ3A 5BQ7A 4D9RE 4MD4B 1BX2A 4QRSA 4I0KA 3IFOA 3RY6C 5INDB 2Q1EA 3MRRA 1JCKA 3STLB 4JANB 3LKNA 1KCKA 4JREC 1CK0L 3LKRB 4PRDA 4BKLA 3W9DB 1Q0YL 1QSEE 1SJHB 4FXKB 3CFKB 2CO7B 5CP3A 3RZCD 1IC4H 5FO7A 4MQSB 2R2HA 5DVKA 2X70B 3GI8H 1BJ8A 1JPTL 1CXHA 1CXKA 2ERJB 4JFFB 4MX7A 3QEUB 3WIIH 2GJ6A 4GRLB 3C8DA 1G7IA 4S0SD 5JXEA 3V0WH 5E00A 2E9WA 3NAAL 2KDGA 1JZ4A 4WI5A 4XCYA 5B8CA 5K9JH 4FS0A 1U6AL 3F7QA 1O0VA 2DQJH 3BD3A 4R4NC 3PV6B 4XB7A 5IFAL 3NCYS 5HDBF 1LEKA 4X5WA 5BS0A 2QEJA 4YXHL 4LVEA 5GGVL 5C1MB 3QCVL 3WFEH 5C08D 5EBMA 2ORBL 1IM3A 5ESVA 4YDIL 5KTEH 2ITCA 1PKQA 1DEEB 1HQRB 2DQEH 4N0YL 5DA4A 3VXUE 1DTUA 5CEZE 4K3EH 3BGFB 1TZGL 1GPOH 5AD0A 4P2CG 2GJZB 4JG0L 4LVHC 5FGCB 3T65B 3N06B 3VFTA 5C6PB 2ZSVB 1TVDA 2R4RL 3OKNB 4D94A 3TWCL 5IVXA 1A7RH 2F74A 1HZHH 2MQ0A 1YEEL 3IFLL 1FFNA 4TUJA 5IB4A 2V7NA 4PV9A 1BVKA 3BKCL 1ORQA 4OJFL 4NKIH 4OKVB 5C07E 2VZOA 2MHAA 2AI0L 3RUGA 1OSZB 3F8UB 4F15C 2UVEA 2VUOA 3KPRD 3NVQA 3TO4A 1Y18A 1YNKL 2X1OA 2XZQH 2GYSA 4NJ9H 5FM5O 3EOBA 5I8CB 1LP9F 2C26A 1MNUH 2BNRD 2FJGA 3QFDB 5IMKA 3OXSB 3PP4L 2ADGA 1M7XA 3D3VD 1SMOA 4KY1H 3DO7A 3RIFK 4Y2DD 4LHJB 3GIVB 4PRIB 4IJ3B 3VFOB 2V17H 3RVVC 3L1OH 1BPVA 4U1IA 4D9RD 3MRQA 1C5CH 1FGVL 3CSPA 2VYRE 1RUPL 5ADPL 5IROA 2P45B 4PJAF 5MERA 4C83A 1HKLL 2R23A 2BNUA 4WO4B 5I1EH 2L0DA 3BZFB 4JPIB 3P11L 5HGBA 2CR6A 4N1CA 1MRDH 1AR1C 5KN5B 5L88H 1DLFH 4GLRH 4RQQB 4MA7L 2VSDA 1YEJH 3C5JB 1NLBL 2DYPD 3ARYA 1U95A 4F9LA 1MVUA 3MJ9H 5DHYA 5F97E 4E5XB 4LHQB 1QPXA 1N8ZB 3INUL 2XPGB 4I8DA 1UFUA 1EEUA 1P69B 2FGWH 3DV6A 3TNMA 1BFTA 4U1KA 4XMPH 4ZPVB 3FCTA 3SKMB 1CDJA 1JGDA 1T03L 5GQBA 1JP5A 1ZSDB 1UXWA 3LRSA 1KCLA 1ZAGA 3ROOA 2HA1A 3QQ4B 4XI5C 4HLZH 3RA7L 2LVCA 3MRPA 5FGBA 1CGXA 1T7WA 4R3SA 1QSFA 1I7UB 1YY8B 4Y89A 5JDJA 4LIQH 2I27N 3CFCH 4JN1H 5CSZA 5IB3A 2P46B 2A73A 3OMZA 3HTLX 4CUCA 3T0XA 1U8MA 4CMHB 2IADA 2CXKA 1ZK9A 3QUXA 1JFQL 5E24E 4X99A 4HT1H 3VMOA 1K4CB 3VXUD 4RAVB 5I8EB 5CEZD 1T5WB 2D7MA 1ZEAL 5GHWH 2ED9A 3QQNA 2VSCA 4NRXA 2AS5M 5JDSB 2AEQL 4QTIL 3ZLQC 1AXIB 2GAZB 5DXWA 2F19H 2YA1A 2R9HC 1I3GL 4NQCB 3UC0L 3QWRA 2BVOB 3RWGA 2Y25A 1BIIB 5CJQL 2EZ0C 2VWEE 5D9SA 3RWFA 1RZ8B 3IDIB 4JRYB 1U8QA 3P0GB 4WIQA 4KXZH 1CGSH 3LKSB 1WC7A 5I74C 2W9DL 1ZLSH 2X10A 5H94A 5HGHB 3ILQC 2CK0H 4X6DE 4ODSH 4CVZB 4HPOL 5C07D 1QQDA 1S5IH 2MJWA 4FQCH 5IFJA 1DN0A 3ROLB 3GBNL 3OJMB 2DBLH 3SDCB 3QI9B 3FQNA 1U3JA 1Q94B 3L5HA 2BVQA 4C56B 3QUYA 1RZKH 3FHAA 3U7WH 2EH7H 4FFWD 4HKBB 3ARTA 1U92A 3JWDL 4JO2H 4PJCF 4ONHB 1MCWM 4OV5B 4G42B 3VFSB 3GBML 2G60L 5T3XH 1JNJA 3DPBA 4PRHA 3HS0B 3QJHB 4X98B 4XNYH 4BFIB 4UIKL 1A6ZA 2Z4QA 5HYSA 3CDFA 3F65A 4BSJA 4Z7UF 3P9MA 2FJFA 2WLYA 3T0EA 3FFCB 1T2QL 1NGPL 4JY5H 5DVMA 3OX8A 1XR8B 3G08A 3TNNB 3U0WL 3NTCH 4RFNB 4QRQB 4K23H 2A83B 2OZ4H 3EYVB 3A0OA 1CQYA 3SJVB 3LH2H 5FHAL 2C9AA 2ZOKA 3S36H 3TYFA 3ZHKA 4Z78B 3CFEB 4ZFOA 1R24A 2VDKL 4HXBL 1QYGL 1AIFA 1NCBL 1Q9WA 5IVZB 2NTSP 3U46B 3LOWA 3B43A 2J5LB 4L8SA 3H9SA 3DTXB 2QV2A 4JFYA 2ZUQC 3E6HB 5KZCD 4MJIE 2P5WB 3VCLB 2VC2H 4G7YL 5CGMA 1INDH 1I7ZA 5AUMA 1F90H 3LN9A 2DQCL 3F7YB 4KK6D 3U0PA 3T4AB 1QBBA 1FAKT 3C5ZD 1EHLL 2PUQT 1JRHH 1FCGA 3GSVA 3BESR 3WNNA 5I1KL 1RV6X 2VLJA 2VXSL 4L5FH 3MLXH 3KJ4C 4OZIF 4JFDE 4MDJA 4UT6H 2WP3O 5C0BE 2X1QA 1H3GA 2WWMD 5BQ7B 1BX2B 1KCUL 4ZQKA 4OKDA 3D48R 3RNQA 2M8XA 3MRRB 4U1NB 2G2RA 4OZGA 3LKNB 4S1RL 4ZFOL 4XPAL 3GUTA 4PRDB 3WXVL 4MAYC 3W0WA 4BKLB 4JFZH 3L3HA 4L3AA 3JTTA 2NY6B 3BJLA 4Q9RH 1HEZA 5J3HC 3PL6C 4XP9L 1IKNC 5FO7B 4D8PA 1EV2E 2R2HB 5AG8A 4TRPH 3OKKB 3HAEA 5C0CA 1CTOA 2BK8A 2YA2A 5CP7A 4MX7B 4TN9A 2AJ3B 3D18A 1NGZB 2GJ6B 1OP3K 2BY2A 1FZMA 1RZKC 1G7IB 1U58A 4OCYL 4GBXD 5EU4A 5EPMA 1WF5A 4ZAKA 4XCYB 5FUCE 4YX2H 1JN6A 5SX5K 3O6KL 1W72B 3SOBL 4YE4L 1HHGA 1LEKB 5BS0B 1H5BC 1FNGB 2IG2L 2OJEA 2XY2A 4L9LA 1QLEH 3HC3H 1L6XA 1IM3B 5ESVB 4PJFA 1A1MA 4M3JA 2ITCB 1PKQB 4JR9H 3U30C 1YNTA 2AAVA 4DCQA 4LDEB 2HFGH 4DOHE 5F3BA 1N6VA 5KG9A 1PDKA 1QFOA 4FOMA 1T83A 5CSBA 3TBTA 4APQC 3RJQB 4DEPB 5AD0B 4NM8L 1YQVH 1A2YA 3D85A 3OKLA 4M7JH 4N9OB 1N6UA 5J9PA 3VFTB 5DF0A 1GGTA 5ALBL 1DFBH 1QG3A 4UUJB 1IJ9A 5EDXA 5IVXB 1BGXL 2F74B 5B22A 1JTPA 4DW2L 1QNZH 2EDHA 3BXNA 3M8OL 1FFNB 2B4CH 5IB4B 1RU9H 1EFXA 4P4KD 1BVKB 3HE6A 1CLZH 3QP3A 4EDXA 2DI7A 3ZTJH 1LNUB 4KQ3L 4MXVE 4Y2OA 3MUZ1 5D2NC 1NCCL 2GEEA 5C7XH 4QHUA 3ZTNH 1SYVB 3IDYB 3IVKA 3RUGB 4ODXB 2ZCKH 1PEWA 1UT9A 1MFCH 3I6KA 3B5HA 1EZVX 3ZDXF 1Y18B 4MJID 3NPZB 2QHRL 5A2JH 3EOBB 1MJ7H 4XP5L 5DSCA 5T1DL 5GJTL 2FJGB 5IMKB 1B88A 2A2QT 4U31A 2ADGB 4OQTH 4K3DL 3LZFL 2NY3B 2QLVB 1J1PL 1OTUD 5LGKA 4PJGF 4ZFZA 1LO3H 4JFDD 4RGNC 1AGCA 1U8OA 1JPST 5C0BD 4OF0A 4XNMA 1J8HA 4U1IB 4FQXC 1IEBA 3MRQB 4GO6B 1CD9B 4R2GB 4FFZH 5F9WC 1MCSA 1EMTL 1PLGH 3FO1A 3C2SA 5MERB 4C83B 1U8HA 2R23B 2BNUB 4ZFFA 3ZKXC 3VWJA 1B3JA 4ODHL 5ADOL 3GHEH 5I73B 2HKFH 5ECJE 4PRPE 3H8NA 3REWA 4HCRA 1JK8A 4PP2A 4OT1H 4JG1L 3QPXL 5D1QC 5LXGH 3EZ8A 2PXYD 4UMGA 3UZQA 1JHKL 2ARJA 5HDBE 1BAFH 4K7PX 3T0VA 1U95B 1UA6H 3M45A 1MVUB 4L4VA 4IMLA 5DMGC 1QSVA 3IF1A 5DHYB 3UJJL 5A2IH 4JPKL 3SGKC 1FIEA 3DV6B 2R0WL 4U1KB 3I3EA 3FCTB 1AQKH 2CUHA 2Y06H 4PBXA 2YPVH 4ZXBD 1FLTX 1JGDB 2VDML 1CXIA 1UXWB 2I5YL 3LRSB 8FABA 1KXQE 4FZEL 3MRPB 2FJHA 5FEBA 4R3SB 1QSFB 4P9HL 1BZ7B 5CSZB 5EIVA 5IB3B 3D9AH 2A73B 3TGXA 4ELKB 1EA9C 2W91A 4X7CC 1ONQA 1U8MB 5T1KA 2HT3D 4HCRL 3FQTA 4NN7C 1EO8H 4X0KA 2IADB 1T04A 4UU9B 3ORJA 3QUXB 4ZNEA 4X99B 5IUSA 2RHEA 2AJZA 4NRXB 2GUOA 1L0QA 4QOKB 2DQIL 3PGFL 4EI5D 5IESL 1DVFC 1AP2A 3JXAA 4KV5F 3RWGB 3HI1B 3ARFD 2KZWA 3RWFB 5EZLB 4AIOA 2AK1H 1ZLUK 4JE4B 4PJ9A 4N8VA 5D7LE 2MMXA 1XGRA 2HJFA 2DQUL 5H94B 3SPVA 2RIKA 4RGOH 1X5IA 2Z91A 5HGAA 3PIQA 1Q38A 4XP1H 1TJIH 5IFJB 2QJDA 2F58L 1ES0A 2NZIA 2A6KB 3FQNB 3SDDA 2QADB 2FECL 1UJ3A 3UYRL 1C12A 1E4WL 2Z92A 3V7MA 2IGFL 1XF3B 1U92B 1FL3A 4EXKA 3FOLB 1PBYA 2ZKHL 4PJAE 5D1XC 3KYMA 4FFVD 4PRHB 5IOPB 1A3LL 1P1ZA 3GMRA 3DX8A 1A6ZB 2Z4QB 5HYSB 4QEGA 4HGMA 4HUMB 2DI9A 1BQHB 3P9MB 2FJFB 2AJSL 3T0EB 5EZJA 5J56B 3NIGF 3HMXA 4JAMB 1U91B 3BUYA 4Y0GA 3LS5L 3OX8B 3T3PF 3O6LL 2O61A 1RPQA 3G08B 1E27B 1ZA6A 3MYZA 3S5LG 4BUGA 1S3KH 2EDOA 4CAGA 3EOYG 1KJMA 3MJGX 5JW5A 1FG2A 4OGXL 5EU5A 5KJRL 5CZVL 1HYSD 2G9HA 4PRPD 1LILA 2ZOKB 3QEGL 3TYFB 1G1CA 4WUUD 4ZFOB 2ZUUA 1ZLVK 4BA8A 1K3IA 2YUZA 1F00I 4MNGA 2FB4H 2GHWB 4LSDA 1B90A 1Q9WB 3P4LA 1YEGL 1XEDA 1P2CA 5IMLA 4AYFA 4L8SB 3H9SB 2D31B 4HWBA 4JFYB 3ARGC 4QLRA 4FTVE 1I7ZB 2P5EA 3NIDF 5AUMB 4IIQC 5FYJL 2VL5A 2E9IA 3QRGL 3U0PB 1PQZA 5TF1L 3UTQB 4WEMB 1PGRB 1RURH 4IRZL 3GSVB 4IOSD 2NXYB 2VLJB 1TQCB 3QFJE 4OFIA 5I17A 3TBYA 5FO8A 1HH6A 3ESUF 1MFBH 2CUMA 1KIUA 3HG1E 1OTSC 2VOTA 3MA9H 4ZQKB 2Y6SD 3X11A 4UINL 3RNQB 4D9LH 5E56A 2VXQL 5GGTA 4LVNB 3BE1L 5I19H 3NACL 4KZDL 4HFUL 3Q5OA 4OZGB 1DBBH 1EJOH 3WS3B 1W8NA 3KYAA 5ACMA 3GJFH 4Y4HA 3W0WB 2ICEA 1KPUA 2ADFL 1U8KA 3L3HB 3JTTB 5I16A 1FORL 4JY6A 1TNMA 5JTWA 1BM3L 3RVUD 1HEZB 4WFGE 5KW9L 1XT5A 3O0RH 1OP5H 4HWBL 4KHTL 1YEIL 1IGYA 4H20L 1NMAH 1KBGH 4M4PA 4OFVA 5DD6A 4MQ7A 5IMOA 2CRIA 3HAEB 2BFVL 4UT9H 5C0CB 1UWXK 1CDGA 3S88L 3D18B 4ZD3L 1KGCE 3LEXA 4MAUL 4ZO6A 5BRZA 3MV8E 1FZMB 4MVBC 5D7LD 5A3IC 5EG6C 1U58B 4GXVH 3FT3A 1MCFA 4N0CC 4TPRH 1TPXC 5EU4B 2I07A 1AE6H 2XG5A 4ZAKB 3VGGA 4KRPB 1JN6B 4PJCE 2ICES 1S7TA 3UTTE 3WD5H 1PG7H 5CAYB 1HHGB 2JCCF 1Z3GL 4OTXH 5GGSA 5JNYA 5HVFB 1MEXH 1WIPA 2OJEB 3P9LB 3P3YA 4BQBA 4Z7UE 5I1HL 2W07A 1YEKL 4NGHL 2YPKA 1A1MB 4PJFB 1XH3A 5TE4L 1IQWH 1ED3B 3GSWA 1MFEH 4XCEB 3S3PA 4O02L 5CGYD 1YNTB 4GAJH 4DCQB 4ZUVA 5F3BB 5E4EC 3TBTB 4FFYL 1A7BA 2VXVL 3MNZA 4XCFL 4Z7OE 3D85B 1A2YB 3AROA 3PDOA 1GRWA 3ULVL 5J9PB 3BX7C 1MI5A 5DEZA 2DN7A 4R4ND 3K74B 3UJIH 4X4YA 2E7MA 1D6EA 4WEBL 4TUKH 5F6IC 5DMYA 3MBED 3LV3A 1N59B 1QKZL 1LMKA 3BXNB 5GS2D 1FBIH 2EDYA 4WGVB 2I60L 1EFXB 4NZUH 4ZS6D 4EDXB 1F6FB 3CMOH 3BZ4B 1R3IL 4ZMAT 4Q7DA 2BNRA 4JJ5A 3RQ3A 4QHUB 3U83A 3WBDA 1FAIL 2BVUA 3IVKB 3I6KB 5HHNA 3TLRA 3SDXA 3VFRA 1BOGA 2IANA 3RZWA 4OZIE 4Y2DA 3MQIA 1KOAA 4FTVD 3TN0A 4XP6H 5K9QI 3BPLC 5DSCB 2LV4A 4K2UL 3L6FA 2DB8A 3O6FA 4HIHA 2DQHH 5I75B 4NSKB 3CVHA 4XVJH 3QFJD 4XMLL 4ZFZB 3HZVA 4WJ5A 3MOBH 2Q3AA 4EN3A 1DQDH 1AGCB 1U8OB 1J8HB 1QSEA 2X05A 4AEHL 1IEBB 1DBJL 2MWCA 5TQ0L 5HVHB 2R69H 3FO1B 1X5KA 2OL3A 5BVPL 2HAZA 1U8HB 3WHXA 3GGWB 4ZFFB 3T09A 3QIUA 5DJ0A 3VWJB 2DYPA 3N1FC 4OCSL 4TUOA 3REWB 2YKLL 3GHBH 1WFNA 4WFGD 1YMHA 3U6RA 2YBRA 3DWTA 1JK8B 4HQQL 4PP2B 1INEL 1JZ2A 1CE1H 3MLRH 3KGRA 4FQHB 5JOFA 4U6XA 2AJXH 3QPQD 1UWGH 4YDJA 2NW2A 5HYJA 3PWNA 2ARJB 4HKJA 4Y5VC 3RVVD 4JHWH 4GT7A 4W6YB 3SEPA 1FNSL 4YXLH 4K07A 1KGCD 3HNVL 3HUJE 4JO3H 4L4VB 4M00A 4J3WA 3MV8D 4IMLB 1MLCA 2DQGH 2WQ8A 3CVHL 3IF1B 4NQEE 1C5BH 2AEPL 4F9PC 3RVWC 4PG2A 5E9DA 4AG4H 1XGUA 2OTPA 2YOCA 3GMPA 2AQ2A 5D7JC 1P6FA 4WY7L 2XZAL 4H1LH 4DUVA 4PJHF 3SKNA 3AVEA 4YPGA 2FJHB 3JUZA 1OD7A 1OW0A 2BCKB 3BWAB 3KXFE 5SWSE 2D03H 4GXUN 2VIRA 1NLDH 5F1NB 4Z5RA 1ONQB 3J7HA 4GLRI 4JFEE 5T1KB 3V52H 5TDPB 3FQTB 3GB7A 4X0KB 1T04B 4F58L 3VD5A 3FFDB 5JQHC 4O2CA 2AJZB 1IC1A 2H8PA 5I1CH 5DC4B 2GUOB 5C09E 1I9IL 1W2KT 1P7HL 5GRVL 3U4EA 2R0KL 4R4FL 5C07A 1AP2B 2Q8BL 5I1LB 1Y6MR 3ZL4L 1JPGA 5F7NC 2W9EL 5L6YL 3HA0A 3ZDXE 4PJ9B 4ZFGH 4L8CA 1XGRB 3ET9F 5B3JE 3FN3A 4LP4A 5J1AA 4M1CC 2HJFB 4G6AD 3SPVB 2IQ9H 5KBNC 4DQOH 3NFSL 1YEFL 5HGAB 3BIBX 4QXUL 4BSVA 2XKSA 1GGCH 5GS0H 1LO2L 1ES0B 1IEAB 1ULVA 3SDDB 3CLFH 3DI3B 1UJ3B 2QL1A 4NO2A 1C12B 3I6GB 2AJVH 4XPFL 2APXA 3FB8A 2EZ0D 5SWQA 5L2JA 3KPOA 3DX7A 1AQDA 1FL3B 4G43B 2P44B 5EZOH 4EIGB 1DQLL 4CVUA 2OR9H 2Y07H 3ARBA 3WSQL 3KYMB 1T4KA 3V4UH 1E4JA 2EH8H 1FZKB 4ZOEA 5KSBA 1P1ZB 1OSPL 5SWZE 3GMRB 3ILQD 3DX8B 3TH4T 5FYKL 4ODUA 43CAA 4P3DA 4ZDHA 3BN9D 2E8ZA 3JZ7A 4O00A 1KB5L 4EQ2A 3L7FA 5EZJB 4PGEA 2F5AL 3ARED 4OB5L 3MLVH 1XFPA 2O61B 1FZOA 1ZA6B 4WU7B 3B9DA 4WW2F 1KJMB 3OB8A 5JW5B 1FG2B 2R2CA 4UOW0 5EU5B 4K3HA 4HJ0D 1AHWA 2G9HB 4FABH 1MY7A 2DLFH 3N9GL 4HSQA 1C7SA 4P9MH 1FVDB 4MNGB 1PY4A 2YMXL 1WZMA 1P2CB 5IMLB 1U8JA 1HE7A 4G7VL 1IQDA 5C9KA 3AXLB 1A21A 4M61B 3KYOA 2D7QA 4NPYB 2P5EB 3S36X 3QUKA 3FQRA 3QA3A 1PQZB 4NQED 4IOIB 3WIFA 4DFHA 5HI5D 3DNKA 1RZ7L 3O41A 3MROB 12E8H 2C3XA 5HHXH 4Q97A 5I17B 3TBYB 5FO8B 1HH6B 4H8WL 3CK0H 2FNBA 5HHMB 5D2NE 1KLUA 1VEPA 1SVCP 4NC0B 5FGSA 2GW5A 3NABL 3I50L 4FQ2L 4XC1H 3RHWK 1NCTA 3WKNA 3SKOA 3KXFD 4LSQH 2YD7A 3QDME 5SWSD 4OD3H 1B6DA 5J6GA 1KIPA 4JFED 4OIIL 2UZIL 3QCTH 4UNTA 5EWIL 5I16B 4HS8H 4JY6B 3KR3H 2WBJC 5C09D 3UBXI 4A6YA 1IGYB 1F4HA 4X6DA 4OGAD 3BGFC 4MQ7B 1A14H 1EXUA 4GXUM 3RNKA 5GS0C 3VGAB 1IFHH 4C54A 1DL7H 4P23C 3LEXB 5BRZB 1IGJA 3OR6A 3WNLA 3DYPA 3R06A 3LSOA 4UAOC 2BY0A 2I07B 3U9UA 1IC5H 5C08B 4MAYD 1JJUA 4YIQA 4NP4H 1QZ1A 5E5MA 1ZHNA 1M7DA 4PRNA 3HR5A 4FQJH 5IGXH 2DTMH 1DR9A 1MCWW 4MZ2A 4NQVA 4U0RC 5D93B 4MJ5B 1D5IL 3C8KB 2YPKB 2X44D 1XH3B 3NIGE 1SBBA 1GGUA 2CRZA 4PS4H 2X42A 3GSWB 3EOTH 4NWTH 5DFVC 3T3PE 3ZDYF 2R29H 1A8JH 4JZJC 1CD0A 1YYLH 4WDIA 5C3TA 3FZUC 4ZUVB 4OFYD 1V3JA 4A6YL 4B0MM 1CICD 1AO7E 4HEPG 5SWZD 3W2DH 4Y5YC 3MNZB 3KS0J 4HPYH 3BAEL 5E6ZA 3PDOB 1WICA 4IDLA 3IKKA 1MI5B 4ODTH 1C8PA 4X4YB 1D6EB 4DN3L 3VRIB 4LAQL 3F58L 3LV3B 1ITCA 1J87A 2WAHA 4CN6A 3KPRB 3TVMA 2DM2A 4R0LB 3V9FA 1FJ1A 5EUOF 1MIML 4U1LA 4G9FE 3QHFH 2BNRB 4JJ5B 2XQYK 2QQKH 3WKML 3TA3C 1RJZA 1AJ7H 4NUGL 4HXAL 4M7LL 4EUPA 1WQVT 4LRIC 5HHNB 1KXVC 3SDXB 1BOGB 3ZKQD 1FPTL 2ENYA 4Y2DB 1U2CA 4XPHH 4WU5A 3MO1A 4QGTA 3TN0B 4JDVA 2E7LA 3U48A 1NC4A 3QNYA 3NFNA 2Y7QA 3L6FB 1IAII 2VKWA 5F1OB 2FX9H 3IXTA 4FQQA 4HIHB 5DTFB 4QT5A 4TVPE 3MUY1 4ZTPL 2G5RA 4K94C 3PQYE 4I3SH 1X6NA 3TZVC 1RUAH 4XMKH 3ZSTA 4D0CB 2VDNH 3HZVB 4WWKD 1CK0H 4PLOB 4EN3B 1C5DA 3V4PL 3MV11 1P4BL 2D2OA 2J8OA 3RX7A 2VDPH 1UCBH 2BERA 1QSEB 2AV7A 1U3ZA 3BP4A 1RVFL 4YK4B 5CJXA 1MJ8L 4EI6A 3QDMD 5HI4C 1N0XL 3S4SB 4RMTA 2XXCB 5I9QC 1D6VH 1WAAE 1EVUA 1CCZA 4GQ9L 2OL3B 1JPTH 3WHXB 3QCUL 3QIUB 5DJ0B 2RGSA 1UM4L 2DYPB 1CI5A 4QRRE 1IGML 5E4IA 5E1AA 3GMNA 3AM8C 4TUOB 3U0TA 4X6BA 1YMHB 3U6RB 2YBRB 2YRZA 4BUHA 1S9YA 2XICA 4I0PA 3IU4L 3MNWA 5JOFB 1U6AH 4YDJB 2NW2B 3PWNB 4HKJB 2BMKA 5IFAH 1DLHA 4JCLA 2CKBA 3DGGA 3NOIA 4WCYH 4YXHH 5GGSY 1A5FL 4NUJA 5GGVH 3BDYL 3IT8D 3QCVH 3QULB 1ZHBA 2ORBH 1GOHA 1XGYH 1XGUB 3EYFA 4FZ8L 4HWZB 5E0QA 1T1WA 3GMPB 3BJ91 4MXQD 3MZTA 5FKPA 5E6ID 3SKNB 3VXUB 1MAKA 1QO3B 4YPGB 1KXTB 4QHNA 25C8H 1NFKA 4JQVA 1J05A 1TZGH 4NN5C 4JG0H 5KS9E 3MRMB 2R4SL 3JTSA 4J6RL 3FRPG 4KJWC 3WFCH 1UKTA 2VIRB 2R4RH 3QUZA 4Z5RB 1F13A 2JJUA 3GB7B 3TWCH 1A6TA 4M9PA 4KK9C 3QXAA 4O2CB 4G6KL 1AO7D 4LLAA 3SE8L 2H8PB 5KVGL 4Y4KA 4NQTA 4ZSOA 2CDGA 3MLZL 2QSCL 3U4EB 2CKBL 5DEFA 5C07B 4I18C 4J3UA 1IC7L 1CGYA 5TQ2H 1JPGB 3UEZA 3MOAH 5E2WL 4KUCD 4L8CB 5HPMA 4M03A 5J1AB 3GO1L 3ARDA 1VACA 4HULB 3T8XA 2GI7A 3D69A 3QQ9D 4G9FD 4GKZB 2FRGP 1OAUL 5JHDA 1I3UA 4BSVB 2VDOL 2H1PL 4GRWH 3OR7A 4P0DA 2CGRL 2QHLA 5F9DC 2ZCHL 1DVFD 3G5ZA 4NO2B 2JJWA 1CFSA 2VDLL 1NMBH 4XAWH 3FB8B 4RWYH 4OFDA 5SWQB 3KPOB 3DX7B 1AQDB 1VFMA 5BXFA 4TVPD 1RUPH 3V4VL 4L3EA 5ADPH 3VFPA 4V2CB 2E3VA 2EEDA 3PQYD 4NZRL 1HKLH 1RMFL 5KSBB 1IZJA 2DLIA 5SV4A 4ODUB 1KCRL 3BDXA 1I75A 4I2XE 5TJWK 2J4WH 4DGVL 4ZDHB 4KVNL 3GSNL 3L7FB 4C4KT 4PGEB 3NPSB 2VITB 4FXGB 1FZOB 5C0RH 3TM6A 1DBMH 4D0DA 1NLBH 3ZE1F 1AHWB 3QDJE 4QRRD 5DT1L 3SQOL 4PJXF 1D5MA 3HNTL 5D1XD 5ESQB 4P4RB 3SGEH 2IEPA 4RMWA 1PKOA 2NMSA 4Y16C 1U8JB 4ORZC 4PGDB 1IQDB 2V2TA 2X4PA 3RGVA 3KYOB 1EGJH 4KPHL 4QCIA 3FQRB 3QA3B 3RA7H 1A7OH 3WIFB 3S34H 3DMMA 3QG7H 2NX5A 3CX5K 3MLUL 3O41B 5CILL 1Z9MA 4JO1H 4CL7A 2CJUL 5JXEC 4Z95H 4FNLL 2CXGA 3NCBB 2EXWD 1ZVYA 5GZOC 1KLUB 1NBVH 1SEQH 5B8CC 1MWAL 2W1NA 3DARA 3OHXA 4MD0A 4K7PL 3SKOB 4QTIH 4OCXH 1OGTB 1FG9C 5HVGB 3GMMA 5J6GB 2Y1VA 3ALPA 1D9KC 4YDKL 5I0DA 5CJQH 3TFKC 5T33L 3H42L 5IHUL 4K8RL 1H3WM 1F6AA 3C6SB 4JFOA 1NCDH 1G6RA 2QQNL 2W9DH 3MSPA 1WIOA 4BFGA 3WLWD 1X6LA 1LP9A 4X6DB 4ESKA 5FB8A 3F62A 4DEPC 3IKCA 3O4OB 4KVCH 3X14A 4OI9A 2PTUA 3VFWA 1U3HD 5SX4H 3RNKB 1P7QA 1BFVL 3GBNH 1TQBC 5C9JA 2XKNB 4LEXH 3UTSA 3A6CL 1IGJB 2PYFA 1UWEH 3OL2A 2QQLH 3MJ7A 4PJIF 3R06B 2PKDA 4QHLA 4OZHE 3U9UB 2FL5A 1IM9A 3JWDH 1WBZA 2H2PC 4W6XB 1FYTA 1YDPA 4Z8FH 2X89D 4N5EC 4YIQB 5E5MB 4PJAA 1ZHNB 3GBMH 5E5RB 4PRNB 1DANT 4UIKH 4NQVB 2EYTA 4MQTB 2VJXA 3E8UL 4ZOBA 1ND0A 3PWPE 3K8MA 5TPWL 1QFWL 4JZOB 3TO4C 1FIGL 1PEZA 1TJHL 3V6OC 1G6RL 1NGPH 2HKHH 2OX5A 1I8MB 1PG7X 4MVBD 1NGQL 4WDIB 2AP2A 2XA3A 5CJOH 3B2UD 2AJUH 2HRPL 4G5ZH 1Z9LA 4HDIA 4FRWA 3MLTA 1NL0H 1RD6A 2BSTA 4LASL 1H8OA 5TDOA 1EHXA 4PTUA 4AIZA 2KUTA 4NHCL 1HI6A 3TVMB 3UMTA 4NT6A 1OHQA 4G7YH 2X2YA 3QDJD 3RBSA 2ATKB 1FJ1B 1BF8A 4U1LB 2WQRA 3WO3B 2QR0A 1RJZB 3WIHL 2K7PA 2VLME 1NSNL 2RFXA 5CZXC 1A7NH 4WU5B 1H0DA 1YY9D 4YGAB 3DX6B 3VH8A 4JFDB 3HG1A 4JDVB 1NC4B 5FDWA 3NFNB 1OT1A 2Y7QB 4J3TA 3VJ6A 2D0FA 1KCUH 5I15L 3IXTB 4P2QA 4FQQB 4KMQA 2ATPA 4QT5B 4F9LC 4CMMA 5J13B 1HHJA 4S1RH 4XPAH 5DMKA 3WXVH 1C5DB 5F7FA 3V7AG 1LEIA 5IBUG 1OP9A 3PWVB 1R3LA 4E42B 2AV7B 1NEZA 4GRWF 1K2DA 3BP4B 4PB9H 1QUNA 4ALAH 4XP9H 2AGJH 1CFTB 3SE4C 1RIUL 5FGBC 2MPAH 2WV3A 5B38A 5JR1L 1MHCA 4JHBA 1T0PB 1XCTA 1KNOA 2DQDL 2YUXA 5EB9A 3ZT7A 1MFAL 5E1AB 3GMNB 4XPGL 3AB0C 3U0TB 1TJGL 4X6BB 3QUXC 4OLZL 4R7DB 1S9YB 4RMRA 3X12A 4I0PB 3JWDC 1R5VB 3MNWB 1CFQA 5GRUH 4PJCA 4YHNA 3UTTA 5JUEH 4M5ZH 2BMKB 2WUBL 1DLHB 1FNEB 4YE4H 1CG9A 1CD1A 3DGGB 1C08A 4WENB 1YPZF 4NUJB 4Z7UA 1ZHBB 3QUML 5CMAA 3PDDA 2A1WH 4ELMF 3EYFB 3ZDYE 4QTHA 1REIA 4NNPH 3OGCA 2YHGA 3OKYA 4KROC 4P3CH 5FKPB 5EIIB 4B5EA 3LKQA 2VB5A 1NDMA 1J05B 2GIYA 3MA7A 3QDGD 5FYLD 3ME0A 5DC9B 3PWPD 1OL0A 3JTSB 5T3ZE 3PGDA 1IC4L 3QUZB 3QB7C 4O58L 3QUYC 4DW2H 3NFPA 3NCEB 3QXAB 4JFFE 3RKDD 2E6PA 3MRLB 5F3HB 5HD8D 3RVWD 2P8LB 3VGDA 3M8OH 3WIIL 2XN9A 4GRMA 1JI2A 2A6DA 2HTKC 5TFSH 4Y4KB 1DEDA 3ULUE 3MFGB 4PY8J 4HKZA 3V0WL 1OQOA 4ZSOB 1T5XB 2JKXA 3KHOA 3QQ3A 4KQ3H 1B2WH 5D7JD 2HH0H 3WL9A 5DEFB 1NUFA 3THMH 4N90E 5K9JL 4XVUC 2DQJL 4FN0A 5H8DA 3ZKMC 5J6HA 5HPMB 4JHAL 5FO9A 4OZIA 3ARDB 5F72S 1VACB 1C7TA 1U3YA 4XP5H 1G9NH 3T8XB 3D69B 5FCUH 3MFFA 4CVWA 5GJTH 3WFEL 5JHDB 1R3KA 5KTEL 4K3DH 3LZFH 3OR7B 2DQEL 3TF7C 1UM6L 3K4AA 3G5ZB 5GRZA 4L8DA 1CFSB 5IK3A 4QXTB 2CKNA 4L8SC 5FGCE 2D4FA 5IJKC 1NCNA 1UZ6F 3QXVA 5BXFB 5C70A 3W5MA 4ODBD 2VUYA 2MNUA 3IJHA 3K8LA 5E95B 3VFPB 1A7RL 1HZHL 4RX4D 5IB5B 5ADOH 1YYMH 3GSRA 4PRPB 4NKIL 2NR6C 4N1EA 3QPXH 4X7SH 4OF3A 4P2OD 3VD3A 2VNCA 3DYOA 2APVA 4D0DB 4LCWE 5CBAA 3U7AA 4LVNC 4P48A 2XZQL 4OGZA 4XH2A 1D5MB 5IT2L 3UJJH 3HAEG 1CFNB 1MNUL 4JGJA 3O3AA 5AZEL 2VDMH 2V2TB 2X4PB 2VKXA 3RGVB 1H3TA 3UAJC 4M1DL 5JXAL 4PRIE 2A9MH 4QCIB 4K9EH 1Q9LA 1J5OL 1GHFH 3EIFA 2V17L 3L1OL 1T7ZA 3TCLA 3DMMB 2NX5B 3W5NA 3TJHC 5FIEA 5ISZA 4F7PA 3K0WA 5JOPE 4ZAKC 5I1EL 4Z7QF 5DRNA 5AWNL 4LBEB 4MD0B 4EZMA 3OHXB 3HMWH 1MRDL 4KC3B 4I13B 5E8NA 2FR4A 5T3ZD 1DLFL 5A16A 3GMMB 3TP4A 5IESH 1TXKA 4L9LC 5D8JL 1RULH 1EZVY 4JFQA 5B39A 1T0NA 4I3RL 1CWVA 4JFFD 1U8PA 2ITDA 5FV1L 5T1LA 1F6AB 1NBZA 5D7LB 3MJ9L 2DQUH 3ULUD 2RB8A 2VQUA 1B9ZA 1KJ2A 3B8SA 5BVJB 1LP9B 2FGWL 3X14B 4XMPL 4PJEF 4N90D 3VFWB 4F7TB 1P7QB 2MSPA 5D72L 5C9JB 3PL6A 3UTSB 4PJGA 2PYFB 5KOMC 2DIAA 3C60A 3FB7A 3UYRH 1YEHL 1AD0B 4QHLB 3K1DA 5J06A 4N0FA 2FL5B 5ILTH 4JN1L 1IM9B 1WBZB 3HE6C 1FYTB 5ELIA 1YDPB 2ZKHH 3C6LA 1MHHA 4PJAB 2P7TA 2WBJD 2VXTL 2W38A 3H7BA 4HT1L 2DLEA 5CFHA 3QEHA 2CSPA 2ESVE 3NBNA 3QO0A 5TE6H 2YUVA 2CLVA 1KYOJ 2EDDA 4HUWB 1EFQA 3NCJL 2F19L 3MTRA 1ZT1A 3LS5H 3O6LH 4HS6A 4JRYE 4K7PY 3ZE1E 1W8OA 2LU7A 3MUJA 5DUML 4OGXH 1CGSL 4HDIB 2P24A 4M3KB 3MLTB 1NCAH 4PJXE 5LWYL 5JQ6H 4M8QA 1ODAA 5FYLH 2BSTB 3N1PC 4ODSL 1YEGH 5TDOB 4RDQF 3ZYJA 4AIZB 1S5IL 1HI6B 4APQA 3KPSA 5DZLA 1DCLA 4LVHB 4WW1B 5GRJH 1F2QA 2D9CA 4NT6B 5D7KE 3RWCA 4C56E 4P9HC 4L29A 3BP6A 2BVEA 4XCCL 4ZS7H 2V9TA 5E70A 2BJMH 2H2SD 5H2BB 2QR0B 2GKIA 4JO2L 3BT2L 2BVPA 4PYHA 5CS7A 3DYMA 1TVHA 5FK9A 2RFXB 1H0DB 3CSGA 3HG1B 4XNYL 5K9KA 4PRID 5FDWB 4D9QE 3VJ6B 4P2QB 4OLXH 4F15B 4KRNA 2J3SA 4CMMB 3GNMH 3BFOA 3P77B 4JY5L 1HHJB 1CDYA 4U6HB 3UPCA 1G9MH 5DMKB 4HEME 5JOPD 3NTCL 3MRFA 3EZJB 4K23L 1LEIB 5ANMA 2OZ4L 3CCHB 3ZT6A 1FORH 1BM3H 3SJVE 1SJXA 1K2DB 3EYSH 3LH2L 3S36L 4WHCA 2D0GA 3LRGA 1VFAA 2CQVA 1HHIB 4KHTH 1YEIH 5CJ8A 1UH3A 5B38B 4HIXL 2Q6WA 1MHCB 2BFVH 1KNOB 2E6JA 3MLYH 3HCVA 4HUVB 1J8KA 4FQXA 3DLQR 3FONA 4J4PA 3S88H 5LQBL 2H3NB 1INDL 1ZV5A 5F7MC 2BHYA 4PJIE 2EIZA 3ABZA 4KDTA 3L3GA 1CFQB 1EEZA 5I1JH 4PJCB 4N8VG 4YHNB 4H0GA 3UTTB 2VN7A 4L5FL 1CG9B 3W9EB 3LD8C 1C08B 3UXFA 1DDHA 3DUUA 2VZVA 5HI4D 5D1QA 5F7WC 1VFUA 2ICWI 3P0YL 4MA3A 4QHKI 4JM4L 4Z7UB 4JRXA 5CMAB 4NGHH 4AH2A 5TE4H 4R8WH 3OGCB 4O02H 1E4KA 4C55A 4GW1A 3O3UN 3LKQB 2C4XA 4MS8D 4UDTB 4JFZL 1T3FA 4CJ1A 3ULVH 3PGDB 1EPFA 3SDDC 5JW4R 3C08H 4TRPL 2WBWB 4JRWA 3NFPB 4WHYH 1MQ8A 4NOBA 5CEYB 1QKZH 5CGTA 1O5DT 2WP3T 4MA1C 4JRYD 2GJ6E 2XN9B 4PJBF 3B9KC 4HUXA 1MCLA 2LU3A 3Q48A 5F7DB 4HKZB 5KVDL 3QQ3B 1R3IH 4M6AA 4URTB 1X5XA 4YX2L 3VWJC 1A7QH 3OJVC 2VR9A 5E1HB 1N64L 4YHIA 5J6HB 5FO9B 3N0PB 2SEBA 3QI9D 5BS0E 5I1IH 4OZIB 4KJWD 4ZUWA 3BPNC 5D7KD 1HCFX 4C56D 2NCMA 3GMQA 4K2UH 3MFFB 3FO2A 3HC3L 4ZG1A 3HLAA 1OLZA 5KANG 1R3KB 1PKQE 4I0CC 3A6OA 4JR9L 4NN6C 4XMLH 1JGLH 1EBPA 3ZE0E 5E99H 1MELA 4L8DB 5IK3B 1N0LA 1Z0MA 4D9QD 4M7JL 4AEHH 1DBJH 3RI5F 1BQSA 5TQ0H 2NY1C 2GK2A 2PO6A 3E6FB 3IJHB 1R0AH 1QNZL 1U8NA 5AYQA 3VD9A 5IVOA 3MBXH 5JPMB 3GSRB 1RU9L 3EOAA 4OCSH 2YKLH 1CLZL 3EJZC 3FOMB 5CJ5A 3SJVD 3QXUA 1OLLA 1S9WA 2BNQE 3O2WH 4CNIA 1FNAA 3HR6A 1INEH 4HIJB 3KDMB 3ZTNL 3HRPA 6CGTA 3RUGE 4NFCA 4DKFH 1FH5L 2PETA 4GQPH 2ZCKL 2BZDA 1JPFA 1G0DA 5CBAB 2JCCA 2X4UA 1SQ2N 2P5WD 3V6OE 1YPZE 3QIWC 4NQEB 4Y4HC 4RMVA 3X3GH 1F8TH 3O3AB 4HC1L 4OQTL 2YEZA 4NKQB 3PUCA 4IRSC 4QWWC 5C0FA 3MOQA 5HY9A 3BYYA 3KPNB 1NCWL 2V9RA 4NM4H 1LO3L 2VMFA 1Q9LB 1CLOH 4IOFD 4DKAA 3ULVC 1P7KB 2Y5TA 3TCLB 1ADQH 3OJDA 3RDTC 4FFZL 4M7KH 3T4YA 2ZUQB 4F2MB 5ISZB 3ARGA 1PLGL 4Q0XL 4F7PB 2YS4A 4UQ2A 3I6LE 2C7UA 4IIQA 2WUCH 4F58H 2AV1A 5DRNB 1QRNA 2GTZA 5D7IF 3R1GH 5C09B 1QRKA 2FR4B 5A16B 3KJ4B 2C4FT 2R0KH 4XBGA 4R4FH 1JNLH 1SY6A 3QBTB 4P5TA 4JFQB 1T0NB 1D5BA 5IW6A 1U8PB 2ITDB 5T1LB 5L6YH 1BAFL 1NBZB 2GJ6D 3MRIA 1A9BB 2OQJA 1UA6L 2VZSA 2WK2A 4G6JH 5E03A 1ZT7A 5JXED 1KJ2B 1I85C 5GZOD 4MAYB 3NFSH 2XTLA 5J4MA 4MNQA 2Y06L 1Q9KA 2K9UA 1J11A 3X17A 1K8IA 3PL6B 1BHGA 2A6JA 4PJGB 3MRJB 1A1OA 3O3EA 5BS0D 3C60B 3PG2A 5JW4N 3MGOA 4XNZB 1QSFE 1JV5A 3LAFA 3V7AE 3TPKA 5LKNA 3D9AL 1G7HA 3C6LB 1MHHB 5GSVA 4LDLB 2P7TB 4O2FA 3H7BB 3HPLA 3V5DA 5SWZB 3QEHB 2E27H 4U7MA 3QO0B 2DL9A 4YBQD 4CVXA 5GISH 1KB5H 4H88H 1ZT1B 4JKMA 2XTJC 1FNHA 1F4XH 2MQCA 2R15A 5SX4I 3MR9A 1T89A 3O6FC 1A3RH 2AK1L 4NKMA 3S37H 2VDRL 2P24B 1LK2A 4OCMC 5ACZA 3QXDB 4O51B 4EN3C 4RGOL 4PJ5A 1VHPA 2FLBT 2VLLA 3BP7A 5LCVH 2XFXA 3REVA 4XP1L 4APQB 1BOYA 3KPSB 3LMJH 1MJUH 4G7VH 4TNVF 3ULVF 1QR1B 2AKRA 1M05A 1V3MA 3TO4D 3RWCB 3LKPB 3VI3F 4PJHA 3LQZA 5BV7L 2NY0C 4LPWA 2W65A 4H0HB 4L29B 3BP6B 1I1AA 3EO1A 2DIJA 2O5XH 2P49B 2EDRA 4NCC2 8CGTA 2BVPB 1CIUA 1TTFA 3GKWH 4OCNC 1TVHB 2NY3D 4PRHE 4HBCH 5HHQA 5MEOB 1T1XA 4Z7QE 4UT7H 1E4XI 3BISA 2HP4A 5K9KB 3K1KC 3ARQA 4AIXA 4FQ2H 4W4NA 4X9HA 1MRCL 4P2RA 4R2GD 3T0EE 4I3GA 1JPSH 3O9WA 4WEUD 4NKOB 3WDJA 4PG2C 5KVMC 3I6LD 3STZB 1S3KL 5ANMB 5DYOA 3NIFE 4UQ3A 4R90H 3LKOA 2LTQC 1AGEB 3CH1A 1VFAB 4N0RA 1JYVA 3B5TA 5CZXD 4MLSA 3VXTA 2FB4L 2J8UF 1OW0C 1A02N 5DJXA 4JLRA 3GM8A 4RGNB 3WFBL 4MDIB 3H9SE 3HCVB 4E0RA 2X4SB 4FQXB 1CVRA 4U4BA 1ZWIA 1U0QA 4RISL 5F9WB 1N7ML 1X3DA 2EIZB 3L3GB 1EDQA 1RURL 2EIEA 3ZKXB 1P84K 4GH7B 2VLJE 1MFBL 4XCNB 2I9LA 3DUUB 1V7ML 4GAGL 4TSAH 2E7HA 4LLYA 5D1QB 3MA9L 1NC2A 1QSFD 4MA3B 3M07A 4Y5VA 4AH2B 3D39E 4G3YH 2XQBL 3VRJA 4HAFA 2F9BT 4OZGE 4GW1B 3S3JA 1EJOL 3QUXD 3W0WE 4WW2A 3K2MC 3HE7C 2CRYA 2FCBA 1DQTA 2UVFA 2NY4C 2GY7B 5JW4M 7CGTA 3CXHK 3BHBA 1NMAL 1KBGL 3T2QA 3QWRD 4MSWA 1MLBA 4DN3H 4LAQH 4WHDA 1KN4H 2VAJA 5ICXA 1QBLH 4FG6D 3ARBC 2LQRA 4GSDH 4MB3A 5JIKA 3V6ZA 1OP3H 4TPRL 3OAZK 4KROD 1HH9A 1AE6L 5L2KA 3O2DA 3IAGC 3WD5L 5EOTA 4PV8A 4H8WC 2UV3A 3C87A 1PG7L 4XBPB 4YHIB 3NPSC 1FPTH 2SEBB 4OQ1A 1CFBA 4LPXA 4OTXL 4ZUWB 2QADD 1MEXL 2F8XC 4M62L 1DVFB 1CF8L 3GMQB 3QUYD 5L0QC 3N85H 1XCQA 1H3VA 4OCRH 3HLAB 4PJFE 3FT4B 1AHWC 1KB9K 5JW3H 2HTKD 3HNSL 1ZLWK 3K2UH 4GAJL 4PRHD 3MLPA 1FQ9C 1W72H 2VZ3A 4LK4A 1QFWM 2B39A 4XVUD 3OZ9H 4NBXB 5E2VH 1MJ8H 3T0ED 3UJIL 1CXEA 1W0YT 2PO6B 1J0JA 4HHAA 4TUKL 5F71A 1BEYL 3LEYL 4Y1AA 1U8NB 3SBWC 1XIWA 3MCLL 3CFJA 3VG9B 2Q7YA 1FBIL 4TSCL 3BYTA 3EOAB 4QRRB 2N7AA 2BY3A 1R5IA 2L7UA 5BW7C 3FQUA 5D1XB 1S9WB 4CNIB 2NZ9C 2PCPA 1I9JL 5EFIA 3IU4H 1EBAA 3QWOA 3CXDL 4Z18A 1VA9A 2BVTA 1JPFB 1T0MA 3KNBB 3H9SD 1WUNT 2JCCB 2X4UB 4WVRA 5L8JB 2N7BA 3K3QA 1INQA 4GS7C 1UEMA 1R3JA 1JYWA 4WFEE 2DQHL 2V2WA 2NXYD 2YEZB 2IF7A 2VLJD 5C0FB 4XVJL 4A2LA 1KN2L 3F7RA 1E6OL 3MV7E 2NR6D 1DQDL 1UEYA 1AFVL 4Z7WF 4BH7A 1J8HE 3S5LB 4GKOA 2R4SH 4J6RH 3OJDB 1LWRA 5C0JB 1X4ZA 4H1LA 5I1AA 1Z5LB 3ARGB 5DFTA 3BH8A 3VGBA 1M71A 1KTRL 4UQ2B 5JO5A 2C7UB 4IIQB 1CQKA 3JUYA 4G6KH 4PJBE 3W0WD 2W60B 3KLAA 4NHUA 1PX4A 2GTZB 3D25A 3WFHA 5KVGH 1TTGA 4NNXA 3GHBL 3DUHA 2YA0A 5EUOA 3E2HC 3VD7A 1IAKA 3MLZH 5IFHH 2EDJA 4XBGB 3UAJD 1CE1L 3MLRL 4P5TB 2AJXL 1UWGL 1BBJA 4K3GA 3OKDA 2PTVA 3C2AH 5C0CD 5IW6B 1JZ8A 1NANH 5E2WH 4JHWL 4MWFA 1YN6A 3MRIB 2OQJB 4L4VE 3QYCA 4FQPA 2DQGL 1ZT7B 5IBLC 4LEOA 5E8EA 3LY6A 4NO0A 4ZAKD 4KRPD 4MNQB 1Q9KB 2OK0H 1VEMA 1UVQA 4PIRF 1K8IB 2A6JB 3QIBA 1A1OB 3O3EB 2XZZA 1WWCA 1IT9L 3MGOB 4BQCA 4TOYL 4LHUG 1JV5B 4Z7NE 4F7MA 4EUPG 1CLCA 2D03L 4P23A 1G7HB 1NLDL 5CD5C 5GSVB 3V52L 4O2FB 1G6VK 4NZRH 3HPLB 3TCXA 4ZNEE 2EYSB 5F9OH 3V5DB 1TPXB 1MHEA 1KCRH 4DGVH 5I1CL 1J88A 1Q0XH 3D85D 3KPQA 4CVXB 3GSNH 4ONFH 5HHPA 2NNAA 4YO0A 4BZ2H 4KAQH 2E7LC 2H32H 4U6VL 1CDHA 3AU1B 3LIZH 4IEFB 3MR9B 4Z77A 5DD1L 4NKMB 2CIKA 4LCWA 4ZFGL 5IKCB 3CSYA 1EFXD 3WYRA 3HE6D 3NCCB 3TV3L 1ZLUH 2BHUA 3SQOH 5MI0C 2KKQA 3HNTH 4PJ5B 2IQ9L 4LQFH 3SDAA 2VLLB 3BP7B 1M6OA 2XFXB 5E4EB 3REVB 4DAGL 5MHSE 3BKYL 4OSUH 4Y5YA 4XWOD 5CJXC 2XWBA 4Y5XA 1GGCL 5F9JA 4OLEA 2AKRB 1M05B 2XWTA 3GSQA 4PJHB 3LQZB 3S9DB 3VXOA 2W65B 5F6IB 2PR4H 3T77B 3EO1B 4PLNC 4W81A 4M1GL 4WFED 4J3SA 5EZOL 3MLUH 2OR9L 2Y07L 5FYJE 4KH2A 3GKZA 1C1EH 2EH8L 5HHQB 1GC1L 3H0TA 1HK6A 1NAMH 1QOKA 1MWAH 3MV7D 2FBOJ 4YH6A 4P5KB 4X6FA 3DXAA 5D7IE 3TA3A 1J8HD 4XVSH 4XVTH 1FYHB 5EORL 1IZKA 4HMEA 4DUWA 3MLVL 1LGVA 1OT2A 4XNQA 4O2EA 3BPLB 1KF9B 1K9TA 3VWJD 5DMIH 5IHUH 3OAUL 5DYOB 1C16A 4UQ3B 2MFNA 3LKOB 4FABL 1XZ0A 2DLFL 3CH1B 2FZ3A 3TZVA 4MNGE 5FECA 2YD9A 3VXTB 2X4QA 2G5BA 1JMZA 1FO0L 4JLRB 2QQQA 1X44A 4LQ1A 4E0RB 4OFKA 1ZWIB 4R26H 1U9KA 1LD9A 1TZHA 2P5EE 4L4VD 4UBDC 2JJSA 3CJJA 2QSQA 4GW4A 2BRRL 4U3CA 3AFLA 5I30L 1II4E 1VFBA 1U8IA 2BOBB 4EQ3A 1A6VL 1NEUA 3CK0L 3DUSA 1OP5K 5FDYA 2X6MA 3O8XC 2GSGA 4X7FC 3FJTA 4LLYB 3HKFA 4POUB 4XC1L 5DEGA 2ESVA 4X5LA 3E8UH 4BELD 1A1NA 1QVOA 3PDGA 5TPWH 2YD6A 4HUKB 5LG1A 4S11A 4Y5VB 4HG4J 1FIGH 1BBDL 4PLJC 1O7VA 4JPWH 4PBVC 1NUNB 3VRJB 43C9A 5T1KD 1NGQH 1W0WB 1CS6A 3H3PL 5IV2A 3OKMA 4WW2B 1FL5B 1P84J 4X7TB 4PD4J 5GZNC 4PJXA 3FT2A 3QDHA 5D7JB 4KJPC 3BHBB 2DM4A 2IQAA 4MSWB 1MLBB 1IGIH 3ZKND 4AJ0A 1A14L 1G7JA 4NHCH 3V5HA 1DL7L 1FLRL 1W0VA 1RZFH 2BHZA 4WUKH 5IBTL 5ICXB 5BRZE 4PJ9D 4H25A 1UWXH 2Q7NA 1GGIH 3V6ZB 3EHBC 1NKRA 1LDPL 4YZFF 1HH9B 3GEWB 5JLZA 5L2KB 1IC5L 2DKMA 2V2XA 2C4FU 3LS4H 1KIQA 2GFBA 3HRZA 3WIHH 5EOTB 2YPLA 5MHSD 2HVJA 1NSNH 4FQJL 3SDDD 5IGXL 2DTML 4I18A 4LPCA 5I15H 1XCQB 3RVXC 4NYLA 2GTWA 2PF6A 3R0NA 3EOTL 3QEQA 5EU6A 2R29L 5FYJD 1F4WL 3BSZL 4R96A 4ODWA 4U3HA 3PABA 4K8RC 3RWHA 3W2DL 2ZJSL 3NGBB 3OPZH 1JWMA 5LAXB 3RGVC 4EIZC 1G9EA 3FN9A 3K80A 3MLWH 3TEUA 1RIUH 4NOFA 1KELL 4M6NH 3SKUD 5JR1H 3PGCA 3DURA 4Y1AB 4F7CA 3DMMC 3CFJB 2Q7YB 2DQDH 3IDJA 2FDBP 2NY5L 1R5IB 3FQUB 5L7XH 4WFFD 3AY4A 1X5YA 2AK4A 2PCPB 2VAAA 4OCLC 5TGBA 1GJIA 5EFIB 1I4FB 2QQKL 4BQ6A 4DUXA 1VGKB 3JV4A 3QWOB 2DJSA 3T08A 3I9GH 4F80A 3SDXE 4LFHG 3MUHL 3GJEA 3D2UA 2IANE 1UH2A 3ZT5A 1IGFL 1BQLH 2NY1D 5CLTA 1INQB 2XTJE 2P5ED 4RIRB 4X6CA 4DGYH 2JIXA 1R3JB 2FX9L 2I24N 4HBQA 5GPRA 3QUMH 2HLFC 4YHLL 2B7DT 2V2WB 4U0QB 5I2IA 4YHKH 2ED8A 1T7VA 4WI6A 4I3SL 1RUAL 4XMKL 3UPRA 1WTGT 2VDNL 1NFDA 2LU4A 5HHMD 3KHQA 3O6MH 5F44A 1MIEL 2FO4A 4BH7B 1JWSB 1UCBL 2VDPL 4Y16A 2EICA 5FHBL 1F11A 1GVIA 3Q5TA 4R4BA 3FMGL 1S78C 4H1LB 5I1AB 2EYRA 1N6QH 4X7EC 1D6VL 4O58H 3BH8B 1M71B 2J7LA 3OXRA 5JO5B 3MV9A 3MGAA 2K7QA 2JB6A 4Y4HD 2EEAA 1X7QA 4NNXB 5DLMH 5EA0H 3T1FA 4OV6F 5EBGA 5EUOB 3SO3C 3EJYD 1IAKB 4QWWD 2CLRA 5IWLC 1JUFA 2VLRA 4HUUA 5I1DB 1HSBA 3OKDB 5HYJE 2JELH 3PJSA 3S98A 4MWFB 1YN6B 3QHTC 4JHAH 5BRZD 4WCYL 1CZ8H 4NFBA 4M5YH 1WTLA 5E9DE 1D9KA 4LEOB 2NYYD 5E8EB 4NO0B 5HDOA 1XGYL 4LGRB 1UVQB 3IAPA 2WBJB 2EDKA 4JO4L 5HHOA 4J3OC 1UM6H 4LSVL 3O45A 1RIVH 25C8L 4M9OA 1XF5A 1MSPA 2ZOLA 2A77L 2IWGA 1X4YA 4P23B 3WFCL 3FB5A 4TVSa 3F12A 1RK0A 3VH8G 5IQ9A 2N1KA 4NQDA 4UAOB 1MHEB 1PSKH 3VXRE 1DQQA 2W59A 4Z7VF 4KMLB 3KPQB 1MAJA 4W68A 1JMXA 3BEWA 1MI5D 2NNAB 4YO0B 2LFGA 1E6JH 2BNQA 2DWDB 5FYKE 3SCMC 3E3QC 4KGLA 4HMCA 5TQ2L 3LN5A 4U0RB 2VH5H 3MOAL 4Z77B 1NEZG 2CIKB 4LCWB 1NDGA 3CSYB 3V6OA 1YPZA 5B38G 5IT2H 4JZJB 3D6GA 3SDAB 1JWUA 3U2SA 5HDQL 5C0EB 1M6OB 5EO1A 4X8JA 1KLGA 4Y5YB 1PW3A 1KFAL 4ELMA 5AZEH 4XPTH 2XWBB 4Y5XB 1NGYA 5C2BH 5I76A 3S37X 2IAND 2XWTB 3GSQB 4M1DH 5JXAH 2OM5A 2YSSA 4UTAH 1QBMH 2CH8A 3TN0D 3VXOB 1J5OH 4WI2A 1SYSA 1NMBL 4XAWL 2R2BA 4RWYL 4YHPA 2R1XB 2X7LA 3UYOD 4GG6F 3O6FD 5EO9A 2VZ1A 5D70H 4RFOH 2DLTA 4HD9A 1H3PH 5KSBE 3Q6GH 2J2ZA 3H0TB 4EN3D 5AWNH 3KYNA 2J4WL 3TA3B 4KFZC 2ARJQ 3V5KA 1QSED 2X4NA 1K5NA 2OXHA 2ENSA 1T20A 3LQAL 3OJ2C 5D8JH 3RWIA 5C0RL 4I3RH 4JFXA 1DBML 3C9NA 3HZMA 3QIUD 4D3CL 2UZYB 1HXYA 5K9QG 3E0GA 3P73A 3TZVB 4N1HB 4UB0L 5FECB 4KKBC 5EOQH 5HYIA 2G5BB 1XF4A 4RFEA 5HYJD 1CXFA 5D72H 5F7LB 2OS7A 1EGJL 2ZUYA 1LD9B 4XHJC 1TZHB 5DJYA 6FABL 1X4XA 3FL7A 5I9QB 3SE4A 2C1PA 1N3NA 1YEHH 2FH8A 4QF1A 3G6JF 1A7OL 4HJGA 5E9DD 4GW4B 3X3FH 1ZHLA 4LVOC 3P4MA 3S34L 3QG7L 3KJ6H 1U8IB 1H15A 4JO1L 1ETZA 3RTQA 3GDBA 3EFFA 3DUSB 4Z95L 2VXTH 3ZDZE 5B4MC 2DIBA 2GSGB 1NBVL 1SEQL 4MHHG 5DEGB 1I7TA 4OZFH 2ESVB 5HGGS 5IMMA 1A1NB 1QVOB 3B9VA 1RJYB 1JVKA 3ETBF 4DTGH 4OCXL 1WVZA 3UO1H 2IMNA 4LCUA 3NCJH 4GKSA 1UXSB 43C9B 3H3BC 5DO2C 1UH4A 5C0DA 4X7DC 3KLSA 3OKMB 4OLVH 5KVEL 5DUMH 4XNXH 3VXRD 1NCDL 4D0BA 5D2LF 4PJXB 4OUUA 5LWYH 4XPBL 5L9DL 3FT2B 1BWMA 4AL8H 1MCRA 2IQAB 3DHJA 3N50A 5E08L 5FYKD 4KVCL 1G7JB 2O5YH 5D6DC 1H8NA 4GMTL 3V5HB 4NN5B 3WFDH 1GZPA 1MCEA 5ICYA 4QRPA 4LEXL 1T66C 3F5WB 1UWEL 2ZPKH 5CWSA 2QQLL 1FL6B 3G6AB 4BZ1L 1J0YA 4XCCH 3CFDA 5JLZB 2V2XB 3L95A 2VRAA 3WE6A 1OB1A 1KIQB 2GFBB 3HRZB 3TBSA 2YPLB 5DA0B 4Z8FL 3BT2H 1S8DA 2HVJB 3EYQD 3L3JA 3B9AA 5A1AA 2O93L 1QEWA 4I18B 3AMLA 2R0ZH 2OTWA 5ACLA 3FN0L 3MZGB 4NYLB 3DBXA 5J11C 2E6QA 2HKHL 3CLEL 2FIKA 4S2SA 2X1PA 3ARBD 3DV4A 4J1UA 5EU6B 4B7IA 3N1QC 4R96B 4ODWB 1E4XL 1WBYB 5CJOL 3RWHB 2AJUL 4KK5C 4G5ZL 4HK0B 5D1ZA 2R8SH 3KWWA 2VZUA 1GH7A 3D0LA 1OOAA 1NL0L 4HLZG 1OAQL 3UZVB 3PGCB 4HIXH 3DURB 4PJEA 4F7CB 2UWEF 4FQIH 3IDJB 1HOCB 1RJLB 5IJKA 5LQBH 3OKEA 4HH8A 3Q6FA 5EBLA 3WNPA 4PJIB 2GT9A 2VABA 2XA8H 1NCUA 2VAAB 3IGAA 5B39G 15C8H 3BQUA 3BRDA 1RZIA 1I1RA 3B6SA 3RVTC 3JV4B 3D87B 3P2TA 3D2UB 3GJEB 4RCAA 1A7NL 2AEIT 3MACL 4XGZA 5J1SC 2ZCLL 4LARH 5C6TH 1JBJA 3P0YH 4QRSB 2Y9RT 1KPVA 3V0VA 4JM4H 5IEHA 3IFOB 1KENH 1MQKH 1OGAE 3D39A 4GG8A 2B5IB 1PY9A 1RUKL 4KKLC 5DJ6A 1ZGLA 1YEDA 5F93C 1XR9A 2FO4B 1OAZL 4HV8A 2YXMA 4Y16B 2XACC 4PB9L 4ALAL 1EK3A 5MP6L 3PHQA 4W4OA 2AGJL 3C60C 2EYRB 2GITA 4MMZC 2IAMA 2MPAL 4XNZC 3RZCC 4BZYA 3MV9B 2JB6B 4TVPL 2YUWA 3T3MF 2B0SL 3CFBA 1X7QB 4U1JA 3C6LC 5ID1A 4MGXA 3OB0H 4X9IA 3T1FB 3BKMH 1TETL 5KVDH 5E00B 2CLRB 2BDNH 1ACYH 1T22A 4HUUB 5B8CB 5GRUL 3VXPA 1ZTXH 3BH9A 3PJSB 1Z6JT 5JUEL 4M5ZL 3ZHDA 1HILA 1N64H 2OL3H 2F53E 4ETQA 1JF6A 5E7FA 4X5WB 4YFEA 3EFDH 3IJSA 4RRPA 1D9KB 3OF6A 3U82B 4CN4A 5EBMB 1F3JA 2A1WL 3WV0A 5EBWA 4Q9CA 2GY5A 4NNPL 3WNKA 4P3CL 3FO9A 5HHOB 4WFHE 3ARPA 3DVGA 4OIAA 5MEPA 2DJ4A 1XF5B 5ENWA 1UACL 2ZOLB 3WJLC 1IAIH 3G5XA 1LDSA 2VN4A 3MXVH 4GRWB 3IDXL 4K71C 1TQBB 1YNLH 2VZTA 3FB5B 3FAXA 3UBXG 1CR9H 3QRFM 4G8GA 5IQ9B 1L0XA 4ZOCA 4NQDB 5IBLD 4OGYH 1CDBA 4O4YL 1NANI 4TUJB 2V7NB 5C6WH 1S9XA 4PV9B 5TFSL 1N5YL 2X4TA 1ORQB 3BEWB 4ZSOE 3KAAA 1FN4A 5CEZH 1B2WL 2BNQB 2HH0L 3E1F1 2MHAB 3THML 3ARWA 1FH5H 3LN5B 4M6MH 3RHWF 3TVMD 4TNWF 1NDGB 1LE5A 3TO4B 1Z9SA 1YPZB 1RHHA 4G8EA 4NWUL 5IW3A 5CD5D 2EDXA 1G9NL 5FCUL 1JWUB 3U2SB 1YA5A 4UDUA 5JHDE 5EO1B 4X8JB 2A9NH 1CGWA 4ELMB 4HC1H 1L7TH 3WHE1 3LPFA 5I76B 2PYEA 3DO7B 1ZS8A 5GGVY 1NCWH 3ES6A 2YSSB 3TIEA 3MV7A 3RBGA 4UOJA 3RU8H 1NC4D 3TESA 1SYSB 4YHPB 3S35H 2X7LB 4J4PC 5EO9B 5F70A 4L3EE 4OLWH 4Q0XH 4KDTC 5EOCH 2YR3A 3SE9L 5H37H 3DRTA 2RQ8A 1YYML 4PJBA 3WCYA 3MUGA 5HGBB 5TDNA 5F8QC 3V5KB 3DROA 2NLJA 2X4NB 1EEYA 1K5NB 4YBLC 3HHRB 2YZ1A 1JHTA 1T20B 2IC2A 4JQIL 2KPNA 4X7SL 1DQMH 4XBEL 2B2XH 3RWIB 5CUSH 4F7EA 4JFXB 5B3NA 3C9NB 3HZMB 2C3WA 4F8QA 4GMSL 4U6YA 1E4KC 1HXYB 4X9FA 3P73B 4I0PD 3HI6H 3TNMB 1XF4B 1YJDH 1DQJA 1FNLA 1FDLL 2CD0A 3UDWC 1OWWA 4A2MA 5DJYB 1LVEA 3ROOB 2HTLD 2A9ML 1NH6A 4K9EL 2W0PA 1N3NB 4LSRH 2KQNA 4RNRA 1GHFL 2UYLA 1ZHLB 3EO9H 1FCCA 3ARRA 3MLSL 2NX5E 3P4MB 1JZ7A 3ZTJG 5IBUB 5EU7C 1H15B 2IFFH 4QO1A 1ETZB 4F33A 3AB0B 2AJYH 4N5UA 2ILLA 3EFFB 1KCSL 2B4CC 3BGMA 4WFHD 1I7TB 2HJLA 5IMMB 3HMWL 2EDWA 4LCCC 4GKSB 3QUZD 3AAZA 1RULL 5D9SB 3M1BA 3KLDA 3QSKB 1U8QB 2HG5A 4NO3A 4P49A 5C0AA 1WC7B 2VDRH 2EIBA 2YRLA 4Y4KD 4D0BB 4OUUB 4W70A 4KROB 1LP9E 1S7WA 3FHQA 1T1YA 5TE7H 4G8FA 1QQDB 5GRXG 1DN0B 4TSBL 3DGCR 1VADA 4Q9BA 3UTSE 5ICYB 2PO6C 4TTDC 2HFFA 4PLJD 2BVQB 5BV7H 3ARDD 3QUYB 4Q74A 3NMEA 1MHPL 3S96A 5JIPA 3CFDB 3VG9C 1NUGA 2LAAA 5ILTL 3L95B 4JM2A 3WE6B 1OB1B 4LSSH 3TBSB 1FYTE 5JHDD 4FFWC 5IIEA 3B9KA 2ARWA 3VI4F 4E41E 3L3JB 4RAUA 2ZSWA 5DQDL 5F7UA 4KJPD 3L3OA 2KZ1B 4IMKC 1QEWB 5TE6L 5BMFH 2OTWB 1CDUA 5D7IA 1MRCH 3CGTA 4XRCA 3DBXB 5F7HA 5DRZA 1RZJH 2FIKB 3DV4B 4J1UB 1I8KA 4L3ED 4S2SB 4AM0A 2DTSA 3C09C 2P8PA 3TO2A 1TFHA 5C0GA 3L7EA 1NCAL 4KHXL