2CDFA

Structure and binding kinetics of three different human cd1d-alpha- galactosylceramide-specific t cell receptors (tcr 5e)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
191
structure length
191
Chain Sequence
NQVEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGADRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR 5E
publication title Structrue and Binding Kinetics of Three Different Human Cd1D-Alpha-Galactosylceramide-Specific T Cell Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell receptor
total genus 34
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2006-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdfA02
1L6ZA 1AD0B 2ICEA 4DKEL 4JRYE 4M7ZC 1TQBB 2YHGA 3P4MB 5C9JA 5KTEH 4MB3A 3VG0L 1DBMH 2MKLC 4I18B 1FORL 1J11A 4LKCB 1YEHL 1SBBA 3MLRH 1MREH 1H8OA 2ERJB 5IB2B 1S7QA 1TZHB 4KJPD 1Z9OA 3RUGA 5KBNC 1MWAL 4HG4J 1CDGA 5KVMC 1S7UB 3CSYB 2R2BA 3EJYD 1QSEA 1CGYA 2A77H 4XVJH 1FH5H 5I8CA 4Z7UE 4HSQA 3TFKC 1UWEH 5EOTB 2BMKA 2H2PC 4RFEB 3QG7H 3QFJA 1MUJB 4DGYL 1Y6KR 2F5BH 2FGWL 2VOTA 3BW9B 4HS6A 4PRNA 1KEGL 1UFUA 4G8EA 5MHSE 4U1JB 4KHXH 4RDQG 1UZ8A 5IM7B 5HHPB 1IC5L 5CS7A 1NH6A 4PRPE 3P4OA 4X6CF 1RIUL 1BM3H 1IC7L 1OSZA 1M71B 4YIQA 4QRPE 2E9IA 4RAUA 4OZFG 3LKRA 4F58H 4CW1A 3ARDC 1RUQH 4BUGA 4U0RC 4KJYB 3O45B 1OLZA 1R5VB 1QA9B 4KV5F 1IGTA 4HIEB 4ZUSB 5GIRB 3NA9H 1KJMA 3ZE0F 5GSVA 4YBHA 2P5EE 3AAZA 4N68A 1MCQA 4PJFA 2HMIC 3OKMB 1RV6X 35C8L 4LL9A 1KCUL 2OSLA 4FQXA 3BT2H 1JNLH 4HWEL 3MXVH 1A14L 1J8HE 1S7XB 1AJ7L 3JV6A 4BFEA 3U4AA 3LMJL 4NJ9H 4WCYL 1F4AA 1A4JB 1HKFA 2F19H 4NO2B 3WFHA 2VDKH 3B6SA 5MEOA 1CL7L 2YA1A 3DMMA 3PWJB 1U3YA 2BXZA 3EYOA 4WFGE 1G7PA 2EIZA 3TO4D 3QXAA 4LVEA 3CK0H 2J6EA 3WDIA 5EPMA 2VITA 2GUOB 4PGJA 4YHYB 5ADPL 2Q3ZA 1SQ2N 1N5YL 3GM8A 4MNQB 2C4XA 4FFYH 3U7YL 4D0BB 4O2CA 2W07A 1LO0H 3IFNL 2IANB 2AK1L 4OFKA 4EOWH 4JZJB 3IXTB 1KIRB 4KK9D 1JF1B 3MLVH 3W0WB 4HAFA 3SY0A 4P2RB 4R4BB 4JM4H 4OLZL 4IIQB 2P8LA 2F58L 1T89A 5JIIA 3QEHA 3UBXG 1F3DH 3O8XC 5DQJA 4F37F 1HDMB 5C6PB 2CKBA 3AMLA 1NMBH 1YPZE 1VACA 2DLGA 2AJUL 3SKMA 4IHOB 4WWKD 3EAKA 3TCLA 1BZ7B 1FO0H 2OTPA 4FQ2L 4JFFD 2VUOA 5L7XL 1FYTE 2NY2D 1H5BC 1JNNH 3QDAA 1G0DA 1KPUB 3QNXB 1YNKH 12E8L 1II4E 1NC2A 2LABA 2IWGA 1AXIB 4E5XB 3CMGA 4I77L 4OZHE 3DI2B 3TEUA 4NNYA 5DQDH 2HT3C 1JPTH 3A6BL 4F37K 3VI4E 4KK5D 2OI9C 4F7MA 1MRCH 2VL5B 4G9FA 3ARGC 3ULSA 5GS1B 5I1GH 1S9WB 1Q9WA 1TJHL 3T3PF 5FKAA 4Y4HC 1OOAA 5CIPA 3VCLB 3SO3B 1NFKA 4GKZB 4ODUA 4JHWL 2HRPL 2QHRL 1BBJA 3GZKA 3IXAB 2YPVL 2XNAA 4X80L 2KH2B 2DQFA 4QRRD 1CFSA 5DGRA 1CDHA 2O93L 2FEEL 3LEVL 3MYJA 1HE7A 4NP4H 3SBWC 3GNMH 4LEXH 4PGDB 1XMWA 1QOKA 4CU8A 3G6JF 3MV01 5I17B 5HDBE 5EG6C 4JZOA 3L3GA 1PY4A 3AREA 3IT8D 1KCVH 4Y89A 1WZ1L 4JKWA 4PRHD 2VLJD 2ZCKL 4M6ML 3SE9L 2I5YL 2Z35B 1RHFA 2J6EH 1QZ1A 4LGRB 2A0LC 3DRTA 1GXEA 4G9DA 5DJXA 4WDIB 3HC3H 2EDLA 1SBSH 3UP1A 4ZDHA 5C0AE 3OKDA 5F93C 5DURD 5IB1B 1RJCA 2X7LB 4FQ1L 4JN1H 4WUUE 4JRXD 5EDXA 3NACH 2YR3A 3FQTB 4MDIA 2LU3A 4PJHF 1V05A 5F9OH 4URTB 2ED8A 4UAOC 2APXA 1FCCA 4WI3A 4IM8A 4L4VA 4PRBB 4GLRI 3X11A 3MRRA 5ANMA 1MPAH 1FC1A 1ZA6A 2MQ0A 3P30L 2CKBH 1TIUA 2DL2A 2AJSH 3BN9D 3JTSB 4KRLB 1F45A 2G2RB 4P2OA 2CJUL 4H5SB 3ROOA 3CCHA 1JPGB 1P7QA 3WUZA 1I1AB 1VEOA 4GW5B 3TBYB 1RZKL 2OLDA 1Q94B 1S9VB 3WIHH 3RZCB 4JG0H 4XP6L 3GJEB 1PLGL 2FJHA 2HVKA 2I60H 2NY5L 1I8LA 3LQAH 4TUJA 1IAMA 3UTSD 5ID1B 4N8VB 3SGEH 2DM2A 1NBYB 2FHCA 3HAEB 1M1SA 5GRWA 3VXUA 1ETZB 4KZEL 3L5WA 5CCKL 1RFDL 1TDQA 1Y0LA 1XCQB 2C1PA 2YD7A 5DJ0B 1BBDH 1X4YA 2X4TB 1HHIA 3W9EB 1KXVC 1CICB 3FT4B 3TPUB 1I8KA 5T3ZH 1N0LA 4OBRA 1N8ZA 2VABA 2HTLC 5HYJB 3DMMC 4R2GD 3SE3C 4PGEB 1MUJA 4JM2F 1E4JA 4QHKJ 4KAQH 3RVWD 2H3NA 2IBZY 4Z7QE 2UY6A 3WLWD 4JREB 3P9LA 1WWWX 5IM7A 2NNAA 4NWTH 2J8HA 5EZIH 4HGMA 1RK1B 2EC9U 5EUOB 1Q8MA 3U30C 4CN6A 3HMXA 1UC6A 2MNUA 4HKBA 4LLDB 5ICZA 1O5DT 5CWSB 5E8NB 4E0RA 2XACC 3N50A 5CEZL 2GSGB 4XX1G 1A64A 4NSKA 3O45A 5JZ7C 2Z8VC 1EPFA 1UVQB 3HFMH 3ALPA 5CILH 4RGND 3F58L 1P1ZA 4WNQB 2XTJD 1G7IB 5E8DH 1PG7W 2DM7A 4NUGH 3PL6B 3FOMB 5IB4B 4PY8J 1C5CH 3FQUA 4M1CD 1T89C 2PYEE 4CL7A 4MMZC 2FO4A 3PWLB 2AV7B 2DQJH 3PP3K 5J7CC 4AH2B 1T7VA 4KJWD 1VKXB 3N9GH 5IHZB 3KS0H 1JHKH 5FV2A 3MBED 3MLYH 4MNQE 3RGHA 2P46B 5FKPB 1XIWD 1EBPA 1YY9D 2YPKB 5HI3C 5GRVK 1CBVL 1JGLL 2O5YH 3NIDE 4LP5A 3NFSL 2NR6D 1NLDH 5EO9A 3BEVA 4MJIB 2ZKHH 3O6FA 3FQNA 5AUMB 5CZVH 3LQAC 4WHTB 5INCB 1DBKH 1XF5A 2YPLD 4DGIL 2IANA 1U3HC 3W5MA 3GHEH 1KEMH 4ETYA 1ACYH 4WEUD 3BXNA 2E8ZA 1JF1A 1OGAD 4Y5VB 3VG9B 1R6VA 3DVGB 3HNVH 1V7MH 4LSSH 1URLA 4NBXB 5D1ZC 4BZ2L 1I75A 1EVTC 5LGHH 4IIQA 1A7QH 3Q1SL 5FCUL 2Q7NA 1KTRL 1PAMA 4MA3A 1L7IH 1MNUL 4LPTA 3ARFA 4YO0A 4FRWA 2NXZB 5C0NC 1DFBH 4MA8L 1TETL 3LKQA 4QTIL 1KELL 3LVEA 4R97B 3QG6A 4YHZH 4UINH 5I19L 3RKDD 4HUVA 4R3SA 3K80A 1IAKB 4UDUA 1AGBA 2X44D 5DJYB 5JW5A 2VQ1A 1SYVB 1TZIB 2DL9A 5H37H 4UIMA 3SCMB 3HMXH 4PJ7F 2XY1A 1CF8H 3GBNL 3GMMB 3QNZA 1KN4H 1JZ8A 4XPTH 1MCIA 2AEPH 4YFEA 4N5UA 5EBLB 5K9OA 4FZ8L 5IR1A 1QTYT 3BN3B 4OUUA 1MI5D 5GS1A 4CMHB 1GGYA 3ZTJG 1DQDH 1RIVL 2R1YA 3ARYA 3BKJL 3VCLA 2A6DB 3VRIB 3BZDA 5HHQB 1W8NA 2J4WL 4GKZA 2BC4B 5FO7A 2PTUA 4CNIA 4OQ1A 3V4PL 3PNWB 4BSWA 1NMAL 3BE1H 3DYPA 2R39A 2F15A 5CBEB 3WE6B 1QEWA 1OTUD 3VFOB 1SHMA 3RBSA 1Q9OA 3B83A 3ZDZE 1EIBA 1F13A 4P23A 2CIKB 1NANI 1PVHA 2UWEB 4I0PD 4NO5B 5D1QA 4TOYL 4OLYL 4RMTA 1F58H 4OKDA 1QPPA 4Y1AB 2APTA 1CL7I 1KPVA 3BP4A 4ZPTB 4WRLA 3BGMA 5A2KH 4LHUD 1FIGH 3V4VL 4R96B 3TLRA 4LOUD 1TQBC 2XYCA 4K7FB 4ZS6D 4J8RA 1I8LC 4WEMB 2DQHL 4AG4L 3F7RA 4H1LA 4QHMB 4HF5L 1CTOA 5DD3L 1HSBA 1MQKH 3NIFF 3NTCH 1CLCA 1IFHH 3OJMB 1P9MC 4OT1H 4YC2C 3VH8G 4N9GB 4LQFL 1FNHA 5TGBB 2WP3O 3FB5A 3NCJH 1YNTA 2V2XB 4MHHG 3IRZA 1CD1A 3FCTB 4FQJL 5FA3B 1A7PL 4PJXB 4YDVA 4JFED 3C2AL 1U0QA 1JTOA 2YD3A 1JVKA 2AXHA 5D96C 15C8L 2G2RA 2Y36L 4OCWH 2VSDA 4UQ3A 4CAGA 4U49A 1UXWB 1WV7T 2IPKB 3TCXA 3VU2A 3DRQA 4UV7L 3P4LA 2IFFH 5I8EB 3P0YL 4YHLL 3CUPB 2A6KB 2R4SL 4WTXA 5EZOL 2I9TA 1Q94A 2P5WB 1S9VA 5ICYA 2WIMA 4I13B 4LSVH 1BMGA 5EOQL 1NDGA 5C0CE 4OI7A 1M6OB 4LF3B 5F6IB 4ZXBB 1UB6B 5DJCB 2ZNXA 4LLVB 4GJTB 5ID1A 4N8VA 3GUTB 4UUJB 1A21A 3SE8H 4JANA 5F88A 4ZPVB 1MCPL 3WS6C 3HAEA 3L3JB 1YN7A 4ZUTB 2G75A 1F3RB 3UZEA 4GKSA 3OKKA 3PIQB 1KFAL 1B2WH 5E9DB 2X4TA 2AV1A 4AL8L 4PREB 5IBLD 3GSRA 3TPUA 1QFUL 4K7PH 1KIQB 1KYOK 1AQDB 5T3XH 3MRMB 2Q76B 5FUCE 4TULH 4NZJA 3LB6D 4LSRL 4QCIA 2XZZA 2FEEI 4MZ3A 2MHAB 2X4RA 3DSFH 4LMQI 3U46A 4UTBL 4M48H 3RFZC 3MYZA 5L0QC 1UADC 1MFEL 1OAZH 5D72L 4YHYC 1LP9F 5M94B 4NZTH 3QEUA 2JB5H 2VDOH 3LIZH 2H2SD 3QH3A 4LHUG 1BGXL 3QWOA 1KUMA 4PJFF 5LQBL 1N26A 5JTWA 1CN4A 4M6OH 3KLAB 2EDOA 3FB7A 4H1LH 3OKOA 1HHJA 5KOMC 1GPOH 4ZO8A 2X9WA 2DM4A 1QFWM 3L7EA 3RWIA 1AKJA 4UIKL 4G8FA 4IIQC 3MXWH 4G8GD 2ZUUA 4IEFB 4RGMB 5IG7A 3IFPB 5TPWL 3R8BB 1NUNB 2XQYK 2IBBA 3NCYP 3V5KA 3MRPA 1QUNA 1VKXA 4MCYB 3KYKL 4TUKH 3U9PH 4JPVH 5A3ID 1A1OB 3CXHK 4DGVH 5F70A 5MENA 3PGDA 4WGWB 1EAJA 5AEAA 5LXGH 4Z18A 3H3KA 1A1MA 1T83A 3GSUB 4PJAE 3KLHC 1P6AB 1KB5B 4KRPD 5ESVB 4KHTL 5IVXB 3QDGE 5HVGB 2R23A 3GI9H 2FHBA 3IU3A 4X7TB 1YEFH 3INUH 1BVKB 5GS1C 3L5JA 3ESVF 1A3RH 2JJUA 2DI7A 3NCCB 2X4QB 3PWUB 3RGVB 3HPLB 3SO3C 1U8HB 1FFRA 1S7VA 4ZD3L 3QUMB 3DIFA 5DMIL 4BH7A 4NQCE 2VH5L 5HHXH 3WO4B 3HAEH 1G1YA 3IJYB 2Q6WA 5CEXB 4ODVH 3SQOL 4MWFA 3BPLB 3KXFB 5ACMA 4LSQH 2HAZA 4P23C 1IM9D 4EI5D 3PHQB 5D1QC 4IRSA 5FK9B 2EIDA 4N0YH 4OCRL 2BVQA 4MAUH 4CVXA 4OGXH 4RX4D 5IB3B 1R3IH 2Z0BA 1FFPB 3BQUD 4D3CH 5C07B 4ZFFA 4KK8D 3DV6A 4PJDB 3DX8A 1C5BL 2J8UA 4JDVA 5J06A 3NCYS 5MP6L 1S78C 1YEDB 1EJOL 4RNRA 4DVRH 1M4KA 4S1DC 4BUHA 3DUUA 4X9FA 2PF6A 3LKNA 1T21A 4OBSA 4U1LA 2BXYA 3MCLL 1JPST 4JDZB 4KK6C 4TSCL 3HE7B 5EBLA 3LZFL 4G43A 3DV4B 3FONB 3L5HA 1AXSA 3WHE1 1U95B 3VGBA 2AK4D 2FX7L 1OAXH 3WXWL 3BRFA 5EORH 2QKIA 1T2JA 3U0WH 3F8UB 2NXYD 3NZ8A 5K9JL 5I1HH 3PNWA 1YEJL 2AI0H 2W91A 5J0BA 1KENH 2BVYA 1JUFA 4TQEH 5CBEA 4Q7DA 1QRNA 5DVOA 5T1LD 5IIEA 3P9MA 1GRWA 2YXFA 1J5OH 2CJUH 4M7LH 4OGYL 3ULUL 4ZSOB 5HBBA 2CLZB 2EDTA 1TVBB 5BO1H 3EFDH 5ISZE 3GSOB 1IJ9A 1I1AC 2Q20A 3KJ4B 4ZO9A 3VXOB 4P3CH 1VGKA 3ARSA 2EICA 3RVXD 1A3LH 1CXKA 4HUXB 3R0MA 4GMTH 1XR8A 3JUZA 4PYHA 5D6CB 3RZCC 2HTKD 3BH8A 1RY7B 3U4BH 4HS3A 5A40E 2C1OA 3H3PL 4Y19E 1UYWL 3BPOC 5CCKH 1ZTXH 2EC8A 3QIBB 1MFCL 4DFIA 5DZOA 5E2WL 3LQZA 5D7KD 4ZUVA 3UROR 4XP5H 3IVKA 5T1MA 1N59A 1TJIL 2HFGH 1P7KA 4QNPF 1CICC 5E99L 1MJUL 4GBXB 5L6YL 1FVDA 2WINB 4QHLA 5JOFB 1A9EA 1EDQA 5IQ9A 3U82B 5IEHA 3ZE1E 3V52H 2Q3AA 2AERT 1OWRM 1KJVA 1DLFL 2RCSL 4JFDA 5D6DA 5C2BL 1V3MA 1IGFH 2WUCL 4JREC 3RWEB 2FL5A 4Y0GA 1JMXA 1KC5H 2EH8H 1YYML 1U6AL 3VI3E 2EE9A 4HW6A 4PBWD 2BY3A 3QJFA 3DSNA 2G5BB 5CEZH 4JPIA 1ZT4A 4Z0BH 5SWSA 4O58H 3GMNB 3O3BB 5EIVA 4Q97A 5EC2A 2FJGA 5JUEH 1A7OL 3GB7B 3I75B 3GSNB 2OJZH 2GSIA 1ROWA 1JZ7A 5DJCA 3S37H 1JF6A 2BCKB 2HN7B 4WHCA 2I07B 1ZANH 5D2LB 4ZUTA 3W82A 1A9BB 1D5XB 4X6DB 4AIZA 5EO1B 2DBLH 1WBZB 1T80A 2D0HA 3ES6A 4U6XB 4E41E 1KIQA 2I25N 2ZUWA 3O4LD 2E8YA 4RCAA 5CP3H 1YEKL 5BQ7B 4OLWH 4YUEH 4UB0L 2Q76A 1DP0A 4Q9BA 4CVZA 5HYQB 5E4EB 4Z0XB 2AJYL 1T83C 3BWAB 3MV9D 1X9QA 4ZAKB 1CG9B 2IALB 3PV7A 4WO4B 5AZEL 5KVEH 3MNWA 2XZAH 2CXGA 1Q0XH 5CINH 3CFEA 4XHQA 5BW7C 2C4FU 1KLGB 4GRMB 2BX5A 4MD5A 3VE0A 4F9PA 4X5XA 2ZP0T 4PJ5A 5DD0H 3WLBA 3EYQC 1MHHA 1NMCB 1SJVA 2VJXA 3IU4H 4Z8FH 2W1NA 2DN7A 4EUPA 1ZHNA 3KG5A 2V5SA 4AEFA 5IMOA 3K2UL 4Y5VC 5AG8A 5J1SC 5HHNA 1AXTL 5DJZB 5IFJB 3KPTA 3LRSB 3H9YA 5I1IL 1T7WA 3RWDA 1KYOJ 5CD3B 3IGAA 4IRSC 2NXZC 3CFJB 4G6JH 4OCXH 4XP1H 1OW0A 3I50H 4L3ED 4R97C 4N5ED 3V79C 2Y5EA 2AQ2A 5KSAD 4BFBD 1CFNA 3CH1B 1NGYB 2VKXA 2D7OA 2ORBL 2F8VA 4HT1H 4D9QD 4BZYA 3SKUD 1EEYA 3OPZL 4V1DA 5F1OB 4ZTPH 4FQLL 2FB4L 1EBAA 1MFDL 4EXPX 5SWZD 3C5SB 1PX4A 1MIML 4JZNB 1BAFL 1QSFA 4YHKL 3LKSA 4K8RD 1N5AA 3UJTH 3ZHLA 2D7NA 5FO9A 3B9KD 5T5NF 1IAIL 5EU6D 2BNQB 3KDMB 4CMHC 4YH6A 3I6GA 1V3KA 1D9KD 3QIWD 3D85D 4IRJD 1QO3A 1PKQB 5E8OA 5KZCB 5LVEA 1SJXA 3BD5A 1SEBA 1X4ZA 4PR5B 1Q9LB 3B2VL 4JHBA 1OM3H 3TWCL 3GSXB 4HULB 5C07E 1QBLH 4OJFH 1SM3H 4MA1B 1MHEA 4YAQB 4MVBC 4M6NL 3MLSH 4PB9L 4C59B 1F00I 4UQ2A 5GGTA 2NY1C 1F4XL 5KOVC 1T0NA 3VXQB 5TDNB 4FQHB 3AROA 2B1HH 5AWNL 4HWBA 3K8KA 3CPLB 4NZRH 2BZDA 4OF7A 3FQWA 3HKFA 1CZ8H 1JNHA 2YWYA 5ETUB 2WIIB 3PWPB 5EU4A 4HBCL 4XCEB 1QHPA 4YQXL 3C60B 5DD3H 4PJEE 3D87B 3QXWA 3IJHB 2ITDA 2R29L 1JI2A 3O9WB 5D5MB 1QHOA 5SWQA 3HE7A 2UZIL 3D2UD 4MXQC 4X7SH 4EUPH 1R3JA 2QSVA 3ZYJA 2FJFB 1AI1L 2Y6SD 5J56B 3VXSB 4GAFB 2MQCA 4ONHB 1M7DB 5CGYD 4ZYKA 3R1GL 3G5XB 4EJ1C 1S9KC 2BJML 4JY6B 2OZ4L 1FZKA 1OTSC 3TM6A 1AIFB 5D6DC 1RJYA 1HH6A 4GOSA 1FFOA 4KQ3H 1PZ5A 2GKIA 5IHUH 5IMKA 3UBXB 1MHPH 3GIZL 3RUGE 1TVBA 3H3BC 3B9DA 2EDWA 5DRNA 3HC4H 1UM5H 3RVVD 5GGVY 1QSEE 5F6HI 4AIOA 1XZ0B 3REVB 3L3HA 1EEZB 3S96A 3IETB 1OTTD 1KB5H 3ARWA 2NX5A 4ONGL 4QWWD 3QFJE 4BQ9A 2J7LA 5JW3L 1KTKE 1BQHG 1BOYA 3SDAB 3X12A 1OAKL 2K7PA 4EDWL 5I30L 1MEXH 4UOW1 2OTWB 1N2RA 3KAAA 3U4EB 3X17A 1KCSL 3QQ3B 3QUMH 4OTXH 3L7FA 4NQXA 4X7EC 3S5LB 1U91B 3BPCA 3MV8D 4XH2B 1YY8A 5JR1H 2X1XR 4MAYA 4XVSH 3IKCA 3ZZ1A 1LK3L 4C4KO 1EVUA 4XPFL 1UKQA 1GOFA 3SJVA 4M02A 3FT3B 4Q9RH 4X6FA 3U7AA 5GGTH 3IS1X 1UB5A 4NRYB 4PJFE 1MCSA 3FRPG 2GT9B 2WZPD 3DURA 2Y23A 1ZHLA 3IDJA 4P59H 4RGOH 3GHBH 1BD2D 4HWBH 1N6QH 4F9PC 2YMXH 3LH2H 2Y25A 1UM4L 3LKOB 3AC0A 3SPVB 5D2LE 4NCDA 5D8JL 5IEKA 3U0TA 2W9EL 1YDPB 2WW8A 5DA4A 4X6DE 3TO4B 5IV2B 2PXYA 3I75A 3GSNA 5JMRA 3AXLB 5KN5A 4KMLB 1T5XB 5TE4H 1A7BA 4HIHB 4YZFF 1HH9B 2BCKA 2EKJA 3U2SB 1RUPH 1HOCB 4HMEA 4KKLC 5IFHH 2XZQL 2R1WB 1MRDH 3G6AA 4EN3A 1Y18A 4J3OC 2EEDA 2XQBL 2NZ9D 1AGCB 5EO1A 4RSVA 2YN3A 3WJJA 4U6XA 4YFDB 1CDIA 4QT5A 1MFAH 1G1CA 1YMMA 5BQ7A 5EUOF 2P8PA 1ODAA 1IKFH 3M1BA 1EGJA 3C6LA 1UQSA 5E5MA 2UV3A 3K8LA 5TH2A 1OQXA 2VR5A 5GHWL 4Y4KD 2ADGB 5IMLB 4U1NB 3G6DL 2J3SA 1T1ZA 5ID0B 4ZAKA 4UDTA 4YWGL 4KVCL 1I7ZB 2Y1VA 3D18B 4NKDB 4LASH 2A6IB 4DQOH 2EDRA 1AH1A 3PHOB 1W0VB 4D0DB 3S35X 1K2DB 5BMFL 4WWKB 3QDHA 4X6EA 1DLHA 2NTFB 5J13B 1DL7L 1HQRB 2X1PA 4DW2H 1IKNA 3T0BA 3TN0B 4P2CG 1B0RA 3CFCH 3QDMB 4LCWD 3SQOH 4FZEL 3PXJA 4JGJA 3WO4C 4XTRC 5HDLA 4N0FB 2F9BT 5C09D 2Y4SA 1J0KA 2QQKH 4B7LA 4GRLB 3HN3A 2CMRL 4I4WB 1DANT 2BSSA 1A6TA 1QNZH 3T2PA 1YQVL 1XR9A 3L1OH 5TQ2L 2IPTH 3HG1A 4UZGA 2M8XA 5L2JA 3O6LL 1RJLA 4WFHE 1A7RL 3SN6N 1CWVA 3BH9A 2RB8A 1RZFL 4J4PC 2WANA 4LKXB 4F8QA 4U6HA 2N4IA 3QDJD 3MMEB 2NMSA 2QEJA 3HE7C 2VMFA 4NRXA 4OZFA 4H8WL 1R3KA 2NLJB 1FE8H 3GSNH 3PQYB 5J1AB 1XH3B 1PKQA 1NBQA 6FABL 3H9SE 4YHIB 2YD9A 5LWYL 4X98B 3BDBA 5EU7E 7FABH 3AM8A 5C8JB 1W0WA 3VXRB 5I1JL 5IHBA 3Q6GL 3VJ6A 4KZDH 4MS8C 5DRXB 2XG4A 3BP6B 2AVGA 3V0VB 4APQD 2J8UF 1F3JB 1JK8A 3MFGB 1ORQA 3WNPA 1EGJH 3KJ4C 2GJZA 4LU5L 3IDXL 2BVUA 2BRRL 5D5ME 4KTDH 3VXQA 1S3KL 5DFVC 5JHDA 3ULVL 3I2CH 3P4NB 2N7AA 3STLB 2BK8A 5D2NA 3MRKA 2FD6L 4I9WE 5JQ6L 1UZ6E 3DXAD 3M07A 1NGPL 4XCEA 3UC0L 2QLVB 1OSPH 3FFCD 2ZUQB 25C8L 3QWRA 2BY2A 32C2A 1EFXD 4WY7L 4QXGL 3QIBC 2XPGB 5IF0B 4PJBB 4XP9H 5GGVH 3MO1A 2Q8BL 4M4RA 2XN9A 4RFOH 3LV3A 3M8OH 4R0LB 3UPAA 4GBXC 4D9LL 2UWEF 2Q8AH 1GGIL 4BFIB 4JPKH 5MEQB 3T4AA 3O4OB 1WEJL 2AEIT 3UTSB 1JV5A 2APWA 2XICA 5HHVL 1EHLL 1CXLA 4XXDA 5FA4A 4XRCB 5IJVA 4PRIB 4YXKL 4B5EA 5C6TH 3UBXA 2L7JA 3K0WA 4JFOA 3VXUE 2E7LC 2NTSP 4Y4HD 2F53B 1MF2H 4PP2A 1U93A 5B8CB 4UBDC 1D5ZA 5IFAH 2HJKB 5C0RL 4HCRL 4GG6A 1OCWL 3WNOA 1CVSC 5ERWA 2LFGA 1XZ0A 4R2GB 4JJHA 4H25B 3CVHA 1CVRA 1EEZA 3IETA 3HLAA 4WFEE 1IGYB 2EDJA 5GS0D 4ZUUB 1KCKA 4MJ2A 3GMLB 3BIKB 4XP4L 2VDNH 1HXYA 5ICXA 1E4WL 3SKNA 4OZFH 1T4KA 3DX9B 2CLVB 2BY1A 4LCCB 1LO2H 4H0GA 1L7TL 3WUWG 1IEAA 3H42H 3LPWA 1QBML 1IAII 1RULL 4NQEB 3MOAL 3QQ3A 4PJXF 3RWJA 1KBGH 4EN3C 1Z5LB 2ICWB 4Y4FB 1N3NA 3K74B 1TVHB 2ZUSA 3LEYH 4TUOA 3GJFB 2Q86B 5A16A 1A6WL 3UDWC 1D5IL 3WJJC 2HVJB 4F7TB 5KVGH 3NCFB 1O7VA 1TMCB 2O5ZH 2XTJB 2HT2C 4LNVA 1MCFA 2R4RL 4I1NB 1V3JA 4OZGA 5EBWB 3C08L 2EE2A 4HKZA 1DBBL 2WLYA 2ADFH 1MCRA 4RZCA 3QUXD 1L0XA 4O2FB 4ZAKC 4WO4C 4JRYD 4P46D 3UO1H 2VDLL 4JB9L 5EU3A 4FA8A 5F1KC 1ZHKB 3I6KB 3VXMB 1EMTL 1OT1A 1K6QH 2IQAA 1DVFB 4WW2B 1JPFA 3MRBA 4LLQA 4MSWB 2V7NB 1GGUA 2J5LB 4KKAD 4LLUA 4P5MB 3TO4A 4C56E 2R2EB 3PDGA 3ZDXF 5BXFB 3EOTL 4OD3L 1YEEH 4OIBA 1NGQL 3MGTA 3BGAA 3QPQD 3BUYB 1E6OL 1HOCA 3KPPA 4MXWL 4FFZH 1JWSB 2YPLB 2R1WA 4I5BA 1BFSA 3STZB 4MQ7A 3PGCA 3DBXA 1X5FA 4NCC1 3FO2B 2H1PL 3MJ9H 8CGTA 2DQUH 3VXPB 1NGWB 3DUSA 4PRPD 4HS8L 2FR4B 1KTDB 2JKXA 4QRPD 5EZLA 5HPMB 1I7UB 4XBEH 2R0LL 4GRWE 1FZJA 4M4PA 1FP5A 3QDME 5EU5B 3FO1A 4GSDL 1FRGH 5IUSA 3MRLA 3HA0A 3PHOA 1P5UA 1GGBL 4WWKA 5GJSL 1U8IB 2P5ED 2VTFA 2GCYB 3AUVA 2HTLD 4JFFA 4MD0A 1AC0A 4WW1A 5DTFB 1CLYL 1HQRA 1TVDA 4ETQA 3TBWB 4U6YA 3IDYB 1HHKA 5F1IA 4FP8H 4ZOBA 1J8HD 1XGYH 4GT7A 2Y5TB 2DD8L 3QEQD 1SJEA 4HUWB 5DZNA 5HDQL 1DBAH 3G5VB 3AM8C 2WBJB 1KJ2B 5DI8B 5BCAA 4MA1C 2HKHH 4O51A 2EDBA 4WI6A 1PYWA 3KPSB 3WKMH 4AIXA 3ALWA 1T2QH 3K7UA 1WBXB 4W4NA 5FM5M 5JOPE 2DLIA 4I4WA 5JZ7D 1F8TH 5DJDB 1NEZB 4LEOB 3RX5A 3BIBX 3HR5A 3QEGL 1T0MA 4LIQL 1GAFH 1MIEL 3KWWB 5FGRA 4XCYB 1WITA 4YEEA 3VFVA 5FYKL 4QRRA 4PJ8D 1U8PB 1QLFB 4L8BB 2R69H 5FUOH 3BKYH 4IOSD 4I0PB 5IT2L 3UYRH 5LAXA 3AS2A 2CUHA 3BAEH 4NOFA 1UH3A 5DEFB 4XCFH 3MMEA 3O9WC 4LFHD 2WUBL 3S34L 5IW1B 5JIHA 4PRHA 2VLJA 1YYLL 5E2VH 3G08B 3NH7H 3UTOA 3AS3A 2VXUL 1VPOH 3RKPA 3KYMB 5E70A 1YEGL 4NM8H 1J1OH 4HWZB 3QZWG 1SYSA 4Z7WE 5KSVA 4EBQL 4Z5RA 1I1RA 4HIJB 5K93A 2MSPA 3A6CL 3NAAL 1E4KA 5D4QA 5DMKB 1INQB 3B2UC 1FYTD 3FRUB 4PJDF 4JRXA 4WENB 1AHWA 1U3HD 1A6AB 1F4WH 5E00B 1AGDB 1I1YB 3EJYC 3P3YA 3SDCB 4PJIB 5BZDA 1AGFB 4NJAH 4NNPH 4U4BA 5E6IB 1GC1H 5BRZB 4JO2H 4MXVE 2XQYG 3V4UL 4YHNB 3P4NA 4ELKB 4ONGH 5CMAA 5I15H 5JW3H 2P1YA 1HYSC 4ODHH 2HLAB 1IRAY 3B4NA 1OAKH 4U6VL 4K55A 1TTGA 3OR6A 1NCBH 4L8CA 4Z77B 1UA6H 2Y06H 3MC0A 2BERA 3NIGE 2A9MH 1BLNB 5JW4Q 1W0YT 1T0PB 5T1KB 1UCBH 4X83A 1B0GB 3CC5B 1KGCE 3W9DB 4BSVB 4I3RH 5KVDH 5CZXC 3FFDA 3K1DA 5AD0B 2A83B 1BP3B 2M1KA 4ISVA 3MA9L 3UTSA 5FYLH 2VXVL 2CIIB 4S1QL 2RJMA 1UJ3B 4Y5XA 1MRFL 3T2NH 1NAMA 5DVNA 4JN2A 3KPRB 4NZUH 2EYRB 5I73B 4PJGE 2DWDB 3L3KB 4RQQA 1FBIL 4HPOH 2X5PA 1A6VL 3P0VH 5D7LE 5D8JH 3BKMH 2PW1B 2P7TB 2Y07H 4NQEE 5B39G 3SGJA 4ZS7L 4YLQT 3TO4C 4RWYH 2Z4QA 3GIVB 4KI1A 1NCAH 3TBTA 4D8PB 3KLDA 1R3LA 1S5HA 4GW1A 1NEUA 4FXKB 3BZ4B 3ULVE 4LCCA 3EOBA 3KHOA 1ZS8B 2XKUA 4KTEL 3ZTNH 1C7TA 2FATH 3KPOA 1I7TA 5BJTA 1QVOA 4U3HA 1K3ZA 2P49B 4U1HB 3ZL4H 4NO0D 4TTDC 2FECL 2RAMA 3PGFL 4X4XA 4QEGA 5EBWA 1PFCA 2A73A 4ZFGH 5GGUA 5GGRA 3OV6A 4ZODA 1B0WA 4GUPB 4G8IA 1PEWA 2L4OA 1MCHA 4Z7OF 4C55A 3QO0B 5EOCH 1BQUA 4LPUA 3RIFK 2W9DL 2VAAA 4WWKC 3LS4H 3PV6B 2WSKA 3MBEA 4JFPB 1RMFL 5ITBL 5J13C 4P4KD 3MRNB 4XPGL 1XIWA 2OTUA 3BJLA 3TN0C 3QCUL 3UJJH 1N7ML 3EYFB 1MCOL 4KRPB 5EO0A 1RZIA 1HQ4A 3UZVB 5I8OH 2DTMH 1X5ZA 3C5JA 1FNAA 3QQ4B 2JJTA 5DS8A 5KSUB 3QA3A 4GRLC 1KF9B 3ZE2E 3VH8A 4XMLH 2EKSA 5GZOD 2UYLB 2LTQC 4ODXB 5CSBA 3MUJA 3VXPA 3GSWB 3MLTB 4NOBA 1OGAA 5J9PA 1KIPA 1JL8A 5L2KB 1QR1B 5D7SL 4YXLL 2E5EA 4PTUA 2GK0B 4LCYA 1NAMH 4X5LA 4J12A 1BOGA 4HH8A 5F7DB 3HZMA 4EI5B 5EU5A 4NNXA 5I75B 3BESR 1U3ZA 5H94A 5JDSA 4AT6B 3WNMA 4HJGA 4LSUH 5EIQA 2VXQL 1QP1A 4LARH 4XMPH 1E4XL 3P77A 1VADA 2PYED 3F5WA 1GGCH 3KYOA 3OKEB 2H8PA 2BDNL 1L0QA 4CN1A 1LDPH 3S8WA 3GK8H 4M1DH 2Y5TA 1H0DB 1HI6B 3DVNA 1FNEB 2A6JA 4UT6L 4MLIA 4X8JA 4MNQD 2R8SH 1INEL 3ZTJH 3GJFH 3PJSB 4PGZA 5CEYB 3T04D 1G9NL 1MI5A 4PJ9B 4RFNB 5T5FH 5I1DB 5I2IA 2D7TH 5C70A 3WHXB 3BFOA 4XI5D 1HHGB 2AABH 4QXUL 3W2DH 1B6UA 2FX9L 4RDQF 5M95B 1S5IL 4YFLF 4Y2OA 3W0WD 1QG3A 4QHNB 2R0WL 2DB8A 3QIUB 1DUZB 3V6ZA 4P2RD 3SGDH 2HH0L 4KVNH 3RNQA 1DQJB 2B1AL 4OZIB 1QRNE 5CUSL 2ZUQC 3GI8L 1FL5A 1ZLSL 1TCRA 4OGAC 3Q6FA 3I3DA 4NRZB 5ALBL 43CAA 2VXTH 1G7MB 3IDNB 2PR4H 5GXBB 4LHUA 2NY6B 3VFWA 2F54B 1MCDA 2HJLB 1T22B 1BHGA 1T3FB 4AM0B 3Q48A 4UTAL 2DLFH 4FXGB 2DQCL 4AMKH 3PDOB 4YPJA 5LGKA 3KLHD 4PJIE 1EXUB 1IM3B 1CD9B 2OS7A 3PDDA 5H37G 5E0QA 3V0WL 4XNXL 1XEDA 3DVIA 1F5WA 3OBAA 3TA3B 4LCUA 1Q72L 4KGJA 1INQA 1P4BL 1U8LA 4CVWA 1ZHBB 4ODWB 3RJDA 2XRAL 3O3EB 4C83B 1E28A 5B8CC 2ZPKH 3ILQD 4NPYB 4OI8A 2GTZA 4PV8A 5BVPH 2X1QA 4PLNC 4I3SH 4X7DC 1R0AH 4R2GC 1AE6L 3SGJC 1WAAE 3ARVA 3E3QC 2HFFB 3OTTA 4JFEA 4DTGH 3RVWC 2IQ9L 3AS1A 3O2DL 3O41B 1B88A 3IFOB 1J9CT 5KSBB 3ZKSD 4JVPA 4HDIA 1T5WB 3QRFM 2GAZA 4E42A 4K3DH 1E6JH 5ILTH 4HC1A 4LLWA 4IRZH 4LCCC 4LIQE 4LPYA 2ED7A 3T65B 2CRMA 3QJHB 5EIIB 2IC2A 5FYKE 2JIXB 1BZ9A 5EUKB 4YGVA 5FHAH 4Y4FC 1DQTA 3CC5A 3OHXB 5SWSE 5LCVL 1U92B 1X44A 2Z8RA 1KJ2H 1S78D 3B5HA 3UZQA 1Q9KA 2XTJC 4N0UA 4NQTA 3HB3D 1FQ9C 3WXVL 1D5MA 1FFNB 2MWCA 4GG6F 3MROB 1ES0B 4Z7VB 1V7NL 1UJ3A 1D6EB 4OIAA 4YXHL 5GRYA 1A7NL 3DYOA 3MRIB 5DJ8B 5IQ7L 2GQHA 3STBA 3BI9X 3BDYH 3O0RH 4KJWC 5DUPH 5TFSH 3WEXB 4HFUH 3BHBB 2BSRA 3MBEC 3OZ9H 1EV2E 4YHPB 1A5FH 1DVFC 3RWCB 9CGTA 5T5NG 4CGTA 5L88L 1S9YB 1YY9C 3QAZB 2V5TA 2J5LC 3RWFA 2FZ3B 2NR6C 2VISB 3GIVA 5TDOA 4KKBC 1JZ2A 5F7NC 1RZ7L 1HSAB 4ODSH 1WZLA 4G3YL 5J6HB 4X4ZA 1GOHA 2YUXA 3DYMA 1I1AD 5FHBH 4NC1E 2IMNA 5DK3A 5HYEA 3C5ZB 3BZEB 3H8NA 2V5YA 1NJ9B 5H8DA 3IDIA 1RURH 4IJ3B 1G6RB 1ZV5A 3NZHL 3L6FB 4TVPL 1U2CA 1DCLA 3EBAA 5H2BB 3RZCD 1GGTA 4PJ5E 4U1HA 4QGYA 4PIRF 1CDYA 3H0TB 2Q7YA 5F7UA 3CDGA 3LSOA 5EBMA 4HUUA 1TJGL 2BNUA 5GGSY 5F6HJ 5KJRL 4K2UL 5EZJA 2B4CL 1VGEH 2VWEE 4G8GA 5CSZB 4W68A 2GHWB 1H3PL 3VFMA 5F1NA 1WT5C 1B3JA 1AR1D 2O5XH 2HJFB 4MNGB 4GUPA 4OF6A 2ENYA 4WU5B 4OM1H 2X70B 4JO3L 2VIRA 3U1SH 2FX8L 3QO0A 1CICD 4PG2A 5C0CD 2PCPA 4FQCH 2LE9A 1MFBL 3MGOB 1LO4L 4L3EB 3T3MF 2CDEB 3BGFC 5HYJD 1ZT7A 2YRZA 1JFQH 2CGRH 2V2TA 3RKDC 2AJZB 2JTDA 3FO9B 3V5DB 2QQNH 2DWEA 5BZWB 3GMRA 4HC1H 3LDBB 5F3HA 4V1DE 4Y5YB 4DN4L 5L2KE 3O3DB 2OQJB 1ORSB 2X4OA 2JB6A 4GAGH 1P84J 3SKOA 3DX7A 3GSQB 2IBGA 3D25B 4L4JA 1QSFE 1DUYB 3DARA 4LLMB 4OCYH 2DIAA 3D85B 2A1WH 4ZQKA 2EH7L 3HPJA 5FYKU 1I9IL 4X6BB 5F89B 2YN5A 4KUZL 3PL6D 1OTUC 4LBEB 1BFTA 4LK4A 4GS7C 3TIEB 5BS0B 1IT9L 5F3BB 3MSPA 5DC4B 1XF4B 4I0PC 1IM9A 3H7BB 1K5NB 4EI5A 1NBVH 3TNNB 3CVHL 1VFUA 1W72L 1JGEB 2BSED 4ELMB 3CZJA 2FBOJ 2BVEA 4LPVA 2GJ6B 4RX4A 4JHAH 5C92A 1G7JB 3BQUA 5FDWB 4JQXC 3SOBH 1KXTB 1MVFA 2MFNA 1YEGH 1YEIH 4OD1H 4ZS6C 3S3PA 1KCLA 2DTSA 1H3GA 2BVOB 4WHYG 3GO1L 3QQ9C 3SDXB 1NSNH 2M2DA 5JXEC 4I48B 2YRLA 5B38B 1CLOL 3OJDB 1KJ3H 4WUKH 1AFVH 3KPNA 2H9GA 1DJSA 1B90A 1S9XA 2XKNA 3WHXA 2AK4A 4TYUA 5ENWB 1IVLA 1HHGA 8FABA 2FECI 4FQIH 4M1GH 5AZ2H 3O3AA 2DQGL 3JV0A 3QDGD 1FDLH 1MQ8A 3HRZB 4HXAL 4EQ3A 5C3TA 3HI5L 1CDUA 1WFTA 5E94A 5T1LA 2MKWA 3PWNB 1DQJA 5C08B 1RI8A 1L0YA 4PJCB 4QRUA 4OAWA 1G7HB 3V6OC 1C16A 2HFEA 4U33A 2NXZD 2H26B 4RISL 5GGSA 4XCCH 1MFNA 4WV1B 1D5BA 1YA5A 3ZKNC 2JK5A 4DCQA 3MLUL 2C5DC 2DJ4A 3GMPA 1WZMA 3DO7A 5IVZA 5TDPB 3MQIA 3FT2B 5CEZD 4CN4A 3SDDD 4EQ2A 3S36H 3LEXA 3SCMD 4U7KA 4XNYH 5DJAB 3EGSA 2E9BA 5HI5D 1RIHH 5T33H 4WTZG 1WWCA 2NX5E 1K3IA 5T1DL 4U1MA 1NFIB 2AP2A 1KT2A 3MCKA 4GMSH 4OUOA 1R24B 1UJ3C 4M62H 1FLRH 1A4KB 4UNTA 4NDMA 3K2MC 4FNLL 4OFYD 4JPWH 3U7WL 3C6SA 4OCMC 1E27A 4PLOB 3D39E 4X0KA 2FGZA 4HKXB 5IBLC 4OZ4A 1LEGA 3MOBH 4JAMB 5I18L 4HAGA 1HXMA 5I9QB 2VLKB 1JWUA 3BO8A 1J86A 3BKCL 3LB6C 3ME0A 1I3VA 4AY0A 2ZSVA 3VW3L 3QHFL 4YPGA 2ADIB 4PJBF 2JCCE 1N4XL 5CBAA 3NFPB 4MVBD 4R7NB 3PP4H 3QCTH 3SJVE 3TYGH 5DQ9A 3T0EB 5I1LB 3MNZA 3RVUC 4IMKA 4OLVL 1ZT1A 4HGWB 3OXRB 1EUTA 2H2SC 4KPHH 5DJ6A 1E4XI 4FOMA 2B39A 5EUKA 1KACB 4DZBB 3O6MH 4R4FL 1FAIH 3HUJB 1QQDA 1U92A 3H9ZA 3VWKD 1K8IA 2PYFB 4H26A 2ZG1A 1U8QA 3U6RA 1U2HA 5DMYA 1VFAB 3IFLH 4J6RH 2EYTA 1NGXA 3RL2B 5JW4N 5AYUL 1EH9A 4GG8B 1QFHA 1W8OA 5J89A 1I8MB 1A47A 3I9GH 2EDXA 1D6EA 1QYGH 1OP9A 3BWUC 4MXQD 5D9SA 5EFIA 1OAYL 5JPNA 5DF0A 1P53A 4EDXB 5IGXL 5GZND 4M61A 4R90L 3O4LA 4X6CA 3VFGL 4HX1B 4Q6IB 5DYOB 5A3IC 5B3JF 3FQRA 2RR3A 4A6YA 1CIDA 1EUUA 4XBGA 3UYOD 3D69B 1FN4A 3U9UA 2VZ3A 1YMME 4Y4KB 4TSAL 4MJ6A 1LD9B 1H9VA 3B43A 1F4YL 3MV9A 2W0FA 2AGJH 4YHOL 2VLRB 4KRPC 2DYPB 1W2KT 4JGMA 2ZCHL 3KYNB 2LVCA 4P5TA 1IC4H 1UXSA 3T1WA 2GY5A 4QTHA 4X4YA 1C08B 4ZO6A 4Q0XH 3FB6A 1KV3A 2QL1A 5C0GA 1DQML 1JWMB 2P5WD 5C71A 1A1NA 1RZJH 3C8KA 3KJ6L 3TT1L 5A2FA 1R5WA 1NBZB 4HMCA 4ZXBD 2HLFD 4ZMAT 5KAQG 1CGSL 2IJ0C 3HCVB 4NUJB 3GJFK 3WFBH 2XZCH 3FJTA 4XC3L 1PQZB 1P6FA 5DUBA 3MR9A 3QHZH 4NM4H 4EI5C 4F7EB 5E9DD 4ZOEA 3O2VH 3T77B 5I75C 2CDFA 4U1SB 5DRZA 2IH3B 3NPSB 4K3JL 4L3EA 3T1FA 3EYSL 1WTLA 2CDEA 4JR9H 3IS0X 3EO0B 4HXBH 4J1UB 1ZVSA 5KSAA 1WC7B 1Z3GH 4QY8B 3G04A 3HG1E 1X7QA 5ALCH 1BEYL 2VDMH 3E6FB 5BZWA 4GAJL 3ZKXC 4G42A 3IJSA 1BQHA 3UJIH 4NO3A 4PB0H 5EC1A 4ODTL 1RUKH 1OAUL 2UVEA 5SWZA 1A2YA 5IVOA 1ORSA 3QDJB 1ONQB 1HKLH 5DK2B 1EO7A 4L4TB 3UCRA 5BV7H 1BVLB 3B9KA 5BS0E 5EU6A 1KNOB 4AEIL 4GQ9H 1D9KA 3QIWA 3D3VB 4N0CD 4IRJA 4R8WL 4F57L 4ELME 3QIUC 3KPLA 3KR3L 3RHWK 3S98A 4X6BA 5F89A 1DBJH 2QR0A 4CADA 2EDEA 1J12A 1X5AA 2E7HA 2APVA 3QULA 1LO5B 2J88L 4TVPE 3CFBB 3ZMRA 3KNBB 3H7BA 4PLKD 4APQB 4DZ8A 2HA1A 2EXYC 1IAOB 2XWJA 4B7IA 4A6YH 1XGRB 1EERB 1N0XL 1XGTA 3VFUB 1F2XK 1HN1A 2DQDH 4S1RL 4O5LL 2NY6C 2Z31B 3E2HC 1TENA 4NQDB 4QOKB 3SDYH 4GW4B 4YNYA 3QHTC 5JHDE 1ZSDB 1GZQA 1T1XB 1U8NB 3KLSA 5D2NE 1DN0A 2BVOA 5ABDE 1YECH 3QO1B 5F7EH 1RZJC 1NCDH 1MCEA 3C09B 4A2LA 3V8OA 4XBPA 4Y16B 4CU6A 3B3IA 1R3HA 4PRAA 1G6RH 4ONFL 4Z7NF 1EFXB 1CE1L 3D2UA 4HWNA 4J7RA 4GXVL 2V9TA 5GSRA 3LPFA 1F11B 4TSBH 1H3XA 3RGVD 4F7CB 3UTQB 1DSFL 2XN9E 3G6JA 3ZSTA 3HE6D 4G5ZL 4XTRD 3MRHA 3V6FA 3KXFD 3AB0B 4AENB 2R1XB 3HC0A 4K23L 4M7JL 1K85A 4XC1H 4Z76B 5JNYB 1ZEAL 1J87A 1K4CA 5CP7A 2MCPL 4LLYA 2X2YA 5EWIL 1F90H 2GTWB 1RJZA 4M43L 5E5UB 1LEIB 1IGIH 4HG4K 3HS0A 5C07D 1ZWIB 2RBLA 1FGVH 3JWOH 5DUMH 5BV7C 2X4PB 4OSUL 2MMXA 1BECA 2QBWA 3ARBB 1A6UL 4PJHA 2JJVA 3U36A 3DTXA 1UG9A 4J4PD 1CU4L 4PS4L 2IGFH 2EEBA 3F7VB 4PFEA 4K8RH 2Z92B 3RTQB 5KG9B 1FNGA 4QRQB 5I1KH 5MEPA 1XCTB 4R7DA 1RZGA 2KQMA 3GKWL 2B20A 1YC7A 1DQLH 1MLBA 2C3HA 1TXKA 1T7ZA 5HHOA 2OR9H 5GRUL 3MV8A 2DJUA 4FTVB 4WEBL 5F96H 4K7PX 2NYYC 3SKJL 3WV0A 1T1YB 1IC1A 1LE9B 4M8QB 4CRPA 4F3FA 2WK2A 3MUY1 1WSST 4Q9QH 2XXMB 4LCIL 2D3VA 3QAZC 4OZGE 2H6PB 1PZUB 4XCNB 3HUJE 4MS8D 3R06B 4KFZC 2DDQH 4JRYB 4QRSA 4R7NA 1NFDA 1Y6MR 3LN5B 1T03L 4BK4A 5I1LA 4CMMA 5INDA 1BD2A 2JELH 3WS3B 3WIFA 4WFFE 1MLCA 4HJ0D 4NHCL 5I8KH 3C5ZC 4N90D 4YX2H 5GS2D 3F12B 3RDTB 3P11L 5CKGA 5M7QA 4UT7H 4IJ3C 2B0SL 4PUBL 1LO3L 2X4SB 1I3GH 5E8EB 2CH8A 2P8MB 4HK3N 2DRUA 2H41A 5HYIA 2KUTA 3DX6B 4Z7UB 3QZWB 3DGGB 5CKAA 1A8JH 4JGUA 1RUML 4P4RB 1GZPA 3QIBD 4KUCD 4GKNA 4KY1H 5E1AA 1CQYA 1QD0A 1G7LA 4K94H 5DJ2B 4PTTA 1CLZL 1IQWH 2IPUG 4U3CA 3OF6D 5LBSL 1P2CB 1RVFL 3O3UN 2C3VA 4K3EH 4GBXD 1GOGA 1MJ7H 3UTZB 3VFSA 3RNKA 1WISA 2XOTA 3VRJB 4HHAB 4PRPB 2XI9A 4P9HL 5KSAC 4QRPB 3WFDH 1CGVA 4Y4KA 3QPXL 1U8MB 2G9HA 3DVFA 2QQLH 3GMOA 1VSCA 2BSTB 4HQQL 1MCKA 3JWOC 2DKSA 5BVJB 3K4AA 3TPKA 4QF1B 4DK3A 4DAGH 1H15B 4E9LA 3V7MA 1EO8H 2P5EB 2L7UA 2N1KA 2ZSWA 5DGQA 2VDRL 3BPNB 4HH9A 4TRPL 1G9ML 3MA7B 4JFFE 1IQDA 2VDPL 3D9AH 1GVIA 1T04A 1I9IH 2W65A 4LCWA 1GYAA 4KUZH 5E24E 1VDGA 1TCMA 4MGXA 5B21A 1UACL 3O2WH 3MJ8A 3OGCB 1U3JA 5C09A 3BEWB 3CXDH 3FO0H 4JQIL 4NWUH 4X8XA 4Z95H 4ORGB 3GSVB 1T1WB 3UTTB 4LSTH 4V2BA 4DKFH 2N7BA 4OKVB 1HILB 4YE4H 4YBQC 3TZVB 4F7EA 5BOPA 3ULUD 1IBGH 2FYYB 1Q0YL 3CLFH 3RWHA 5SX5K 2HT2D 4L4TE 1KCRH 4IOIA 1BJ1J 4LVHB 2WAHA 3GDBA 5C0DA 3IF1A 3K4DA 4KQ4H 4U1IB 1M05A 3WO3B 4HV8A 4R26L 4EI6A 4XPHL 4WO4D 1CS6A 4QRRE 4KI5C 2X09A 2EDQA 4S0TD 1R5IA 1HINL 3JV4A 3HI1A 2YZ8A 2YEZB 2BOBA 2ESVB 1FZMB 2VR9A 3WUWA 2NY7H 3OB0H 2ICWJ 2AXGB 5CJOL 3S88H 3QFDB 3WN5B 4PRHE 1U42A 2VLJE 3I02B 1I1FA 2C7UA 2KBGA 3BP5B 5DDHB 3BVNB 2EIBA 4G7YL 4K94C 4KXZH 1YPZB 4XB7A 3LS5L 3MLWL 1AD9B 1D3CA 5IKCA 1FPTL 5JPMA 2V5RA 3T4YB 1XGUB 4N1HB 4JFYB 1I3RA 1MAKA 3NFNB 4L8DA 2W60B 4PJ7A 4AEHL 5GJTL 3LN4B 4JRXE 4OZHB 4WV1C 5DD5H 4HPYL 3VFUA 2ZWLT 1G6VK 1RUAL 2F74B 3BRDA 2Z91B 3VXTB 1RAMA 5K59F 1JRHH 4WU7A 1CK0L 1OTTC 1I4FA 1LK2B 1ZSDA 4QWWC 3UXFA 3EOYG 1LVEA 1SEQH 4CKVX 5J11B 3DXAA 4XMKH 3O8XA 3S35L 5I1EL 2ZCLH 3FFCA 3CDYA 2WV3A 4OCSH 3LCYA 1V3LA 2K9UA 2GFBB 1EFXA 1MCWM 1Z9SA 1YMHB 5JLZA 2BNQD 3N1PC 1M7IA 1TZGL 4DN3H 1KN2L 4ZOCA 1F11A 4OZIF 2X1WL 5KZCD 1JGVH 1FNSH 1GL4B 3HI6H 1FGNL 4PY7B 4FG6D 3L3DB 2Z93B 1LNUB 2DQTL 5CJQL 5I9QC 4OLXL 5GGQH 5IBTL 2OXGA 4H20H 3ZDYF 1RK0B 4U1KB 1FZOB 5SX4H 3BD3A 1EZVX 4J3VA 5HY9A 3GGWA 4D9RD 4I0KA 5DMJB 5IROA 5D7IE 5D7JB 3S3JA 3T0EC 4Y4HA 3OX8A 3ARPA 4OM0H 3H9SD 2LU4A 4YEFA 2IG2L 3CD4A 3BZFA 5C0AB 2D03L 5FF6B 1I9RL 3L9RA 2D7MA 1CIUA 1DEEB 3QNYA 2D31B 4JKPL 5C0EA 3MJ7B 1U8JB 4XXCC 4WUUB 3PWPD 4ZTOH 3SBWA 1HEZB 2IAMB 2CLRB 3S37X 3C60D 3TJEH 1CXFA 4F33A 4IMLB 3V5HA 1G7QB 1AGEB 1DDHB 2OBGA 5FGBC 4IDJL 3WIIL 3VD4A 5KW9L 4KMQA 3WFEH 4I2XA 3PABB 4I9WD 2NZ9C 2YBRA 3VFGH 3VXSD 1QLEH 2ZOLB 3PHSA 5TF1L 2GITA 4NO0B 4LNRB 4BQBA 5KSBF 5FEBA 4Q6IC 1S8DB 2XWTA 2QQQA 4JLRA 5J6GB 4RGNE 3X13A 4Y4KC 5CLTA 4JG1L 3HNTH 1GHFH 1P7QD 4G6KH 3B2UD 3MV11 3KPQB 1YNLL 3QUXA 5GRJL 1YN6B 2OR8A 5I74B 1ZK9A 4JRYA 2C9AA 3HRPA 4P46A 4RMVA 5TE6L 3X3GL 4G6ML 3RU8L 3MRCA 2YKLL 3MODL 1FVCB 4P4KB 5DVKA 4UT9L 3VGFA 3TT1H 4OI9A 3SGKA 1FO0A 2CK2A 1HYSD 5I1AB 1RHHB 4RAVB 2ADJA 4NGHH 3SDAD 2ZJSL 4JJ5B 4Q2ZB 3OAYK 1FYHB 5E8PA 1P4LA 3IAPA 5DHVA 5CJBA 4L29B 3T0AA 4A2MA 1JI1A 1BX2A 4EXKA 3U0PB 1IEBB 3HNSL 4QRTA 2WP3T 1LP9A 3RI5F 3O6KH 4EVNB 3VGAB 3TT3L 1CFVL 4DEPB 1OAQH 3NPSC 5CZXD 1EAPA 4ZUWB 1QKZL 4PRPA 1JPSH 3N1MC 1MJ8L 4QRPA 2CRYA 1NCCH 1OGAE 3T08A 3X14A 2NW3B 3KPMB 1TPXB 3MRQB 5FGSA 2E27L 1I85C 1JP5A 5ACZB 3CMOH 2RFXA 4F7PA 1AY1H 3RA7H 1FG2A 5JIKA 4DVBA 2P5EA 3RI5K 7CGTA 3N1FC 5GS0H 1IGJB 3F7YB 1OQOA 3SE3A 3UTTE 1OF2B 1RU9L 3ILPB 3UYPA 4F2MA 1JGUL 2PYEB 3MA7A 3DROA 1J8HA 3QUYB 3VMPA 1I8IB 2VDQL 5C0BA 5ESAA 5ITFB 5FO8B 2BHUA 3QEQA 4WI5A 5FYJL 3RPIA 5JXAH 3WL9A 4GFTB 4MHHI 3BSZL 2KPNA 3FQXA 3MV7B 1MWAB 2JF1A 1DE4A 1KG0B 4APQC 4C56D 2R0ZH 2DBJA 3QXDB 4TTDD 1WCBA 5I66B 1ZGLB 2ESVE 1CT8A 2A9NL 3ETBF 2DF3A 2PW2B 2Z31C 2ZOKB 5B39A 4PJ8A 3OR7B 3M17A 5ESQB 1FVEB 3VFRA 3MRDB 5CD5D 3RVTD 4JY5H 1XGPB 1IL1B 4MA7H 4Y16C 5E4IA 4XGZA 5MERB 4NQSA 3OAUL 4LAQH 3W39A 4GAYB 3A6OA 2FO1A 3TN0D 3C9NB 1FJ1B 3QDMD 4RIRB 3BP5A 1PG7H 5DHVH 5D70L 3WIHA 2E6JA 3E6HB 4MB5A 4K23H 3O11B 4WWID 3AB0C 3FMGH 3TIDB 2X4UB 1FYTA 3EYVB 4L9LB 4GRLD 1BFVH 3QUKB 4OIIL 1U3HA 5FYLD 2W60A 3S5LG 2BNRA 5IROC 3V7AE 4FABL 4P3WA 4P2QA 4ALAH 4FHBD 1B6DA 5FM5O 3H9HB 4BZ1L 4YDLB 4KI5F 1AP2B 3RJQB 5IW6A 5TE7H 3VWJB 3SDXF 5HJ3A 5HGGS 5IESH 1HZHL 3CSBA 2X42A 3MREA 4OB5L 1JTPA 5D1ZA 4NN7B 1PSKH 4C54A 1LK2A 5GS0C 1NKRA 4FQQB 1SY6H 4N8CL 2DICA 5DD1H 5DK0A 5JOPD 5EA0L 1QFOA 5E08H 2OK0L 4JFEE 1LE5A 1RPQA 2XWBB 4QXTA 1WVZA 1XGQB 3RTQC 3GKWH 1XF2A 1ED3B 3HZKA 4B50A 1FV1A 4L8SB 3X3FH 4NKMA 3TBSA 1VFBA 2Y7QA 2CD0A 4MD4A 5DD6A 5HYSB 1K9TA 2AJVL 2BVPB 4XAWH 5D71L 4XZUB 3PQYD 4XNMA 2IH1B 4NT6B 5ADOL 4PJCF 4XPBH 3BP7B 4ZFOA 4OF8A 3RL1A 3GRWA 1CE6B 2ATPB 3CFKB 3V95A 3NABL 4O4YL 3K4ZA 2DIJA 4IBLT 3QWQB 5H35B 2JE8A 3FB8A 4O2EB 3VXRD 5HSFA 3QCVL 4N0UE 3TO2A 1JJUA 3THML 3QUXC 4DOHE 3K3QA 1NCNA 4XWGH 5HGDB 2R2HA 5CHNB 3E8UH 4O02H 2AXFB 1PEZA 5K9KB 4P46C 3S7GA 3JWNC 2OP4H 1J1XH 2OXHA 1T66D 3WMSA 5C7XH 1C1EL 3REWB 1BQLH 3RDTC 5JORA 4M5ZL 2GEEA 3SGKC 4O9HH 3H7LA 4XVTL 4G7VH 3DHJA 4KKAC 1MH5B 2DQIL 3JTTB 3MBXH 1UWGH 3UPRA 4OLUH 3L5XL 1ND0A 1WBYB 3CDFA 4NHUB 1X5JA 3G9AB 2HWZL 1AGEA 2JLLA 4OGAD 3QPQC 4YR6B 4MJ5B 2D9CA 3D0LA 5IB5A 2BOCB 2OJEB 1KG0A 3WCYA 1AD0A 3WD5L 3WNKA 1J1PH 4DFHA 2CK0H 1CDCA 3P4MA 3ZSSA 1NFDF 4NO0A 4I18A 3ZYIA 3MLXH 4LKCA 4LSPL 1KOAA 4XNUL 4JQVA 5IB2A 4JO1L 1TZHA 2W92A 3B9AA 3LHPH 4PRID 1UM6L 1P9MA 3CSGA 1S7UA 4G8GE 1KGCD 3CSYA 4OQTH 2F53D 5DO2D 4OV5B 5DR5L 5C0CB 1WK0A 1K8DB 5EOTA 4P4KA 2V17H 4RFEA 4J3UA 4UU9B 1OARH 2GI7A 3ESUF 3WJLA 3BW9A 3QRGL 5IMMB 4JDTL 3S4SB 4P5KB 4U1JA 5HHPA 2EEAA 3MRGB 3CZFB 3EO9H 5HVHC 5D7LD 5JO5B 2VXSL 4P9ML 1M71A 3OB0K 4HJJH 4XPAL 1U36A 2E6QA 2N56A 4NQED 1YJDL 1CD0A 3GRWH 4Y4FD 5KS9E 3TZVC 4K7PY 4KJYA 1UCTA 5TQ0L 2HKFL 1R5VA 1QA9A 4EVNA 4HIEA 4UI2A 4ZUSA 5GIRA 4H88L 3ULVD 3WSQL 4UILH 2BFVL 4LVHC 3OKMA 4LRIA 4PJ8C 1ADQH 3WS6A 3MRQA 4LRNH 1A0QH 1BFOB 2IF7A 1S7XA 4MDJB 3CDCA 4U3XA 4JO4H 1WFNA 4OD2B 1JHLH 1A4JA 4D2NA 3VXMD 4NO2A 5FUZL 3NCMA 1DVFD 4KMTL 3PWJA 3ECBB 3IAGC 1QFWL 3MV7E 43C9B 2PYEA 4YDKL 4ZFZB 2B2XH 4MNHB 2E3VA 4PG9B 3WN5C 4KKBD 4YHMH 2GUOA 4FMFA 1FPTH 1IARB 4ERSL 1BQSA 4NN5B 5L9DH 2MPAL 4MNQA 1Q1JH 1D6VL 4NKIH 4D0BA 1KPRB 1MSPA 2YK1H 1J0HA 5F9DC 3G5YB 1YUHB 2F5AH 4PJAB 3TGXA 4JZJA 1JYXA 4YDIL 3IXTA 1KIRA 1OWWA 3JWDL 3W0WA 1T7XA 2AK4E 3QDGB 1FL6B 1V5JA 5HXMA 1UEMA 4P2RA 2PW2A 1X5IA 1NLBL 3EZ8A 4R4BA 4JFXB 2DIBA 1D7FA 4ZG1A 3VFNB 5J11C 3CFDB 1HDMA 4BJLA 3FHQA 3T0WA 2FBJL 2R56H 2DS4A 4HIXL 1MJJB 4NQCB 5I76B 4IHOA 5FB8B 4CJ0A 3MLZL 3H6JA 2O61B 1BZ7A 5FFLA 1WLHA 2FLRT 3FN0H 4DUWA 2OMNA 3SDDB 1KPUA 1MCNA 3QNXA 1A6ZB 4JVWA 3P73B 4E5XA 2ILLA 3F62A 5E56A 2CSPA 1T6VN 2XIDA 4L5FH 2AEQH 4HIIB 4NQVB 2WBJD 4HFWB 4UV4L 3EYUH 3HZVB 2VL5A 5IK3B 3KPSD 3RAJL 3FTGB 1S9WA 1RZ8B 1MOEA 3HMWH 4K3GA 5E2UH 2IG2H 1GJIA 5FOJA 3GBML 3CVIL 4KKCC 3H9HA 2LV4A 2CXKA 5FYJE 3RWGB 3QP3A 4S1SH 1KLFA 3CLEH 5GISL 3L3IB 5F8RC 3A67H 3IXAA 3MACH 3L5IA 2NW2B 4Z78B 4FQPA 5GRVL 5DT1H 1VFOA 1INDL 1I9JL 3I6LD 4XNQB 5F8QC 4PGDA 2YSSB 3MUGB 2QSCH 3C8HA 1TTFA 4RMRA 4QHKI 3WFCL 5I17A 3HZYB 1OPGH 2ZUXA 2RGSA 3AFLA 2FSEB 4DKEH 1UH2A 2V2WB 4P3DB 3FN9A 1B4RA 5HGAB 1S7TB 2Z35A 1U58B 3VG0H 5DVMA 1GIGL 3ARXA 2NY0B 1FORH 5I1CL 1YEHH 3VWKB 1IGCL 4X5WB 4I18C 4WDIA 5MI0B 3FL7A 3N85L 5I16B 1HCVA 3QQ9D 1J18A 4OGZA 5ISZB 5JXED 5H35A 2R0KL 5LKNA 4JQVC 2ERJC 1NCWL 1MWAH 5IB1A 5I74C 3TF7C 2X7LA 1CR9L 3IDMB 3PWVB 3LRHA 5E2TL 3FQTA 4PY8I 1PW3A 1OGTB 3SDCD 3TNMB 3NCBB 5E6ID 4DGYH 5IWLC 3LKPB 5BRZD 5IOPB 4Y19B 2FGWH 4P4KC 1KEGH 3WKNA 5ECJE 3O4LE 4X6CE 4PRBA 3WJLC 4P99A 1HIML 4OFDA 5FM8A 1CI5A 1IC5H 3VGDA 5A1AA 4JM2B 3JTSA 1DANU 1LEKB 1AO7B 2VC2L 3VXNB 4S10A 1RIUH 1S7WB 1IC7H 1VEPA 4H5SA 3IDGB 3MV9E 2AJXL 1JPGA 4KV5E 1I1AA 3ZKND 4JFHE 4M7ZB 2QADB 2OL3L 4GW5A 5T1KD 3ZE0E 2OJEA 3TBYA 1MAML 2XY2A 2MJWA 5KTEL 3DETD 4LMQE 3RZCA 3L3OB 3GJEA 5GZOC 3VFPB 3MLRL 3W81A 1MREL 1NPUA 35C8H 1KCUH 1EZVY 4HWEH 2PETA 4LRIC 1NBYA 5FYKD 1A14H 4N0RA 4PGCB 1AJ7H 3O81A 4CDHA 1NANH 1ETZA 5D1XB 5HGBB 1XCQA 3LMJH 5DJ0A 2A77L 4WCYH 4XVJL 1FH5L 1LQSR 5CJXC 3KPRD 5JA9A 1NEZG 1QRKA 3W9EA 1CICA 1UWEL 2WM0A 3FT4A 1CL7H 5C0CA 4QHUB 3QG7L 2F5BL 4Z7UF 2ZG3A 5HYJA 4PGEA 2GY7B 4KHXL 2VLMD 4K9EL 5ADPH 2DMKA 3QUYC 5C0FB 5GQBA 4D9QE 1N5YH 3ARDB 1BM3L 3JUYA 1RK1A 4U0RB 5EUOA 4E41B 3RVUD 3U7YH 5JO5A 4F58L 3NN8B 3TV3L 1RUQL 5DHYB 4LLDA 3IFNH 2AK1H 5CWSA 3EO1B 5E8NA 1PBYA 5SWZE 2EXWD 2GSGA 4HK0B 3FOLB 4IS6B 4JZJC 4NIKB 4XI5C 1T20B 3MNVB 3NA9L 5C0IB 5EU6E 4MQXD 4JVUA 1UVQA 2DM3A 2G5RA 1KB9J 3JVGA 4WNQA 4OLZH 1G7IA 2F58H 3BT2L 3PL6A 1JNLL 3FOMA 5IB4A 3MXVL 2J2ZA 2W0LA 3ARTA 3DWTA 3PWLA 2AV7A 4NJ9L 2AJUH 3ARQA 4AH2A 2F19L 1XF3B 4FQ2H 2VDKL 5IHZA 3DOSA 5L7XH 1C12B 1JGDB 3T2OA 2OL3B 4M9OA 12E8H 2EYSB 5FKPA 3CK0L 1SVZA 2YPKA 4I77H 1JHTB 4WHYH 3A6BH 3T3PE 4MJIA 3TESA 1S7SB 1H8SA 1J8KA 4D0CB 4FFYL 5AUMA 5BW7A 5FOBB 3VFTB 4WHTA 3EDJA 1LO0L 5INCA 2F8OA 1TJHH 1OB1B 3UEZA 3Q3GB 4TTGA 1KPRA 1UWXK 4EOWL 4L9LC 4JHWH 3BMWA 3MLVL 1BIHA 2HRPH 4YDLC 2QHRH 1BJ8A 5DXWA 3ILQC 2YPVH 2YRPA 2JJWA 3HE6B 4JM4L 4Y5VA 4X80H 4JFQB 5HHMB 3DVGA 4BH8B 5L2KD 3MRJB 3BJ91 1LGVA 3G6JE 4HZLB 3HR6A 3LEVH 4NN7C 1JZ5A 4RA0C 3BIAX 4MCZB 4HUNB 1NMBL 1QFPA 3OKLB 4R9HA 1Q38A 2HG5B 1H3UA 4KH2A 1ZE3C 4PV9B 4Y2DD 1FO0L 1J0JA 1WZ1H 1MVUB 4N1CA 5FB8A 3SE9H 2ZCKH 4M6MH 1YPZF 2I5YH 4L8SC 2WQRA 4H0HB 3OKNB 1DQQB 4JY4B 1YNKL 4UNUA 5HYFA 1IAKA 5DJYA 1N6UA 1SYVA 1TZIA 4O4YH 3SCMA 2YXMA 5DQDL 2CDGB 1JPTL 1MHCB 3ARGB 2QSQA 3HB3C 4YJZL 2IADB 4OZHF 4PJHE 2VZVA 1MRCL 3GMMA 5DRWB 3L95B 4FQ1H 1AR2A 1E0OB 1SMAA 5I1GL 5IK3A 1J05B 1CDJA 4KU1A 1SJHB 3VI4F 4PJ9D 4OFYA 2PTTB 1LHZA 1IMHC 2AJ3B 4DUXA 2A6DA 3VRIA 5HHQA 1FAKT 2EDYA 4HKJB 2VLLB 3TVMB 2BC4A 5HHOE 3MPCA 4PJEB 1KLUB 3MV8E 3QIUD 3P30H 4NYLB 3WE6A 5CP3A 4NP4L 3GNML 4LEXL 3VFOA 2VO5A 3ZT6A 2CIKA 2UWEA 2XA3A 4NO5A 4XNQA 2H32B 2EXYD 1HHHB 5JW4M 4NKOB 2FWOB 1KCVL 2ICEB 3S6CA 2ZG2A 3V9FA 2EE6A 5E7BA 4Y1AA 5HDBF 1RZKH 3QB7C 3WBDA 4ZPTA 5C9JB 2J6EL 1QFWI 1BD2E 2NY6D 4NCC2 2F54D 4XP6H 1PLGH 1EEQA 3LRGA 4R96A 2NY5H 4K7FA 1S7QB 1SBSL 3VWKA 4HEPG 3RUGB 4BQ6A 4QHMA 2MCG1 1F02I 4KZEH 1UJTA 4JN1L 1QSEB 1RFDH 3NOIA 2Q87A 3TA3D 3NACL 5I8CB 1AR1C 5F9OL 2BMKB 1AO7E 4N9GA 3QFJB 5TGBA 3TNMA 3MJGX 2V2XA 3FCTA 1UZ8B 5FA3A 1MPAL 1OT2A 2CKBL 4PJXA 2AJSL 3VRLF 2QHLA 2CR3A 4KROB 4R4ND 3P4OB 4YIQB 4RAUB 5F9AC 5IW3A 3D39D 3LKRB 5JHLL 4CW1B 4POZD 1UXWA 2IPKA 2BRQA 5FUCC 1IGTB 2JIXD 5I8EA 5AAMA 3WIHL 3CUPA 4JG0L 5GSVB 2A6KA 2I60L 2GK2A 2YD1A 2P5WA 3F58H 3AAZB 3LQAL 4PJFB 1S7RB 4FQXB 2BFVH 1M6OA 3JVGC 4LF3A 4KRNA 1UB6A 4ZXBA 4LLVA 3JV6B 3PL6C 4LCWE 3GUTA 4UUJA 4ZPVA 1BBDL 3L3JA 3WFHB 5C09E 3B6SB 3PIQA 5MEOB 5T3ZL 5E9DA 4PREA 3EYOB 1G7PB 2NYYD 4KGLA 4LHQB 1JRHI 5ACLA 2FEDD 1AQDA 1RSFA 3QXAB 1F6AB 2LU7A 3MRMA 1CBVH 1JGLH 2VITB 4KAQL 3NFSH 2VERN 3QYCA 1RZKC 2MHAA 1ZKAA 3U30B 1WIUA 4NWTL 5EZIL 5C0FA 2NY5C 4Z7QF 3VGEA 2W59A 4O2CB 4LHJB 5F7LB 4NN5C 4ZFOL 4DGIH 4WI2A 3C5ZD 3EO1A 2MTPA 3SY0B 3HFML 5CILL 3LN9A 3ORJA 3KLAA 4U6TA 5C0IA 5JQHC 2P8LB 1U8KB 3F65A 5E8DL 5E7FA 4NUGL 5BOZG 3VG9C 4BZ2H 3QEHB 1C5CL 5FCUH 3Q1SH 5DQJB 4G6FB 2CKBB 1MNUH 4RMQA 1VACB 2DQJL 4RA3A 3SKMB 3IFPA 3TCLB 1CGTA 4MA8H 1TETH 1B9ZA 1G9EA 3N9GL 4QTIH 1KELH 3MLZH 1TNMA 1JHKL 2FHFA 3MLYL 4MCYA 1NC2B 4PJ7E 5I19H 1A1OA 1A6PA 3OG6B 4JKMA 1JYWA 2O5YL 3ALXA 4NNYB 2XKSA 3RBGA 1NLDL 2NQCA 3SDDC 3SCMC 3GSUA 2ZKHL 4F7MB 4G9FB 3GBNH 5HI5C 2I26N 1KB5A 5CZVL 5ESVA 3ULSB 5HHME 3FZUD 5IVXA 3DXAE 1DBKL 4HUKB 2WWMD 3EJJX 3VFTA 4FZ8H 5FKAB 3BRGC 5CIPB 4X7TA 3FFCE 3Q3GA 3GHEL 4ENED 4ODUB 1KEML 1QBAA 1RIVH 3VD7A 3BKJH 1BVKA 1ACYL 2J4WH 1BBJB 2XTLA 2X4QA 3PWUA 2XNAB 3HPLA 3RGVA 3V4PH 2CKNA 1NMAH 2DQFB 1U8HA 1V7ML 3CX2A 1CFSB 3HNVL 3D48R 4LSSL 3QUMA 3MYJB 3I3EA 4XT1C 5LGHL 5E1HB 1A7QL 3IJYA 5CEXA 5I0ZA 1INDH 2Y72A 3KXFA 5E6YA 1L7IL 4JZOB 5BS0D 3L3GB 3AREB 2PNDA 4TOYH 4OLYH 3OKLA 1DFBL 4JCMA 4YBQD 2FDBP 3PHQA 5FK9A 2WBKA 2W0KA 3J7HA 4YHZL 1DTUA 3H9SB 3V4VH 4UINL 2GJ6D 5IB3A 1FFPA 3DRTB 4G9DB 2NZIA 5DJXB 5C07A 2GIYA 4PJDA 4ZDHB 2R15A 4TVPD 3HMXL 3VMNA 2NY0C 3G5ZB 3OKDB 3NIFE 4KDTA 2DQHH 4AG4H 3VWKC 1CF8L 4J4PA 4HF5H 1YEDA 4KI5D 5MI0C 1KN4L 2FLBT 4XPTL 2AEPL 3L95A 1AQKL 4JDZA 1DQDL 4LQFH 3DV4A 3FONA 1U95A 2W38A 2UZXB 5E03A 1IILE 3W11D 5GZNC 4FQJH 3X11B 3BE1L 3MRRB 1A7PH 1ZA6B 4I2XE 4HLZG 3Q5YA 3OSKA 3BUTA 3C2AH 4P2OB 4P2YA 3ROOB 1JMZA 1DN2A 3CCHB 15C8H 2A38A 5C08D 1P7QB 2Y36H 4WI7A 3OB8A 4ZSOA 3DUHA 1F58L 4UV7H 4PBXA 2CLZA 3GSOA 3P0YH 1FIGL 4KTYA 3VXOA 2QADC 1MAMH 4S11A 4YHLH 2E6PA 2FJHB 2R4SH 5EZOH 4U31A 2HVKB 4ONOA 1CTNA 4TUJB 3C2SA 4HUXA 5EOQH 1ZGLP 4WI9A 5D6CA 2LAGB 3QXVA 3WDJA 3VXUB 5F6IC 3L5WB 4ZXBC 2HLFC 1Y0LB 4GO6B 2C1PB 1MCPH 1MQKL 4YC2B 1OD7A 2EO9A 3NTCL 1IFHL 1HHIB 4OT1L 1I8KB 1KFAH 3QIBA 5D1XC 4AL8H 1N8ZB 1XT5A 2VABB 3NCJL 1QFUH 2E7BA 3OF6A 4I0CC 4GBXA 2H3NB 4BFGA 2WINA 4LSRH 5D96B 5JOFA 1LP9E 4K9EH 3P9LB 1L4IA 2VLKD 3RQ3A 2NNAB 1EO5A 4UTBH 3CSPA 3AGVA 5J8OA 2WQ8A 4OCWL 1MFEH 5D72H 4HKBB 3RWEA 5ICZB 4E0RB 3TV3H 1FNFA 3T0ED 2E7LA 4FFVD 2IFFL 1HWGB 5FECB 4NSKB 1BGXH 4J3XA 5LQBH 2G5BA 2ZZUT 4NBYB 1WFUA 4XNZB 1P1ZB 3E1F1 3GMNA 3O3BA 4LSVL 1EX0A 1T6WA 2HT4D 4N0CC 3FQUB 3GB7A 1S7RA 4QO1A 2OMBA 5FIEA 4UIKH 3KGRA 2ED9A 3SE8L 2FO4B 1NGZB 4DWHA 4WFFD 4XAKD 2HN7A 5C0BE 5TPWH 5B38G 2I07A 4RGMC 3QEQE 5D2LA 1B2WL 3ARRA 3KYKH 4PLKC 1A9BA 1D5XA 4K7PL 4X6DA 4C56B 1X3DA 3UDWA 1WBZA 2WWKO 5T3XL 3IYLW 4TULL 1F6AA 1BJMA 5EO9B 3BEVB 5L0QB 3DSFL 1CGUA 3O6FB 1CFTB 1A3QA 5HYQA 3FQNB 4M48L 4Z0XA 2H32H 3BWAA 4KHTH 1OAZL 1CG9A 2IALA 4WO4A 2VLRD 4NZTL 2JB5L 1XF5B 2DYPD 2VDOL 3LIZL 5GS2H 3CNKA 1KLGA 4GRMA 3DI3B 3BXNB 1JYNA 2P4AB 4M6OL 4ZD3H 1DEDA 5DMIH 1GPOL 4GRWB 3RGVC 2VH5H 1U8KA 1CDBA 3HE6C 1BF8A 1IGML 3UTPE 4MA3B 3MXWL 3ARFB 2KL6A 4YO0B 2C3GA 3BPLC 5DJZA 5IFJA 3LRSA 4K9EC 3LKQB 4OCRH 4W70A 2YD6A 5CD3A 3QG6B 4G9FE 3CFJA 4TUKL 3U9PL 4JPVL 4HUVB 2NY4B 4R3SB 3QBTB 4DGVL 4UDUB 1AGBB 5JW5B 2BNRE 2VQ1B 4UIMB 4P2QE 1C5BH 5LXGL 3CH1A 1NGYA 5MP6H 1EJOH 3S36X 3QNZB 5AAWA 5T3ZE 4KDTC 5JW4R 4PJAF 5K9OB 3GI9L 3MCLH 5IR1B 4OUUB 4FXLA 4TSCH 1YEFL 3C5SA 3LZFH 4JZNA 2R1YB 3INUL 4L4TD 1A3RL 5FO7B 4CNIB 2FX7H 3FKUS 3WXWH 2BNQA 4BSWB 3KDMA 2DLEA 1FNLA 1QEWB 5K9JH 3D3VD 3N06B 1YEJH 5HHXL 3SGEI 5I6XB 1Q9OB 3TVMC 4ODVL 4PR5A 1Q9LA 4P23B 1BWMA 4LSQL 3T8XB 3LY6A 5D1QB 3GSXA 4OGYH 3ULUH 4XWOC 4YAQA 4N0YL 1KPVB 3BP4B 3BGMB 3OL2A 2SEBB 3CX5J 4MAUL 4OGXL 4J3TA 1R3IL 3H9SA 4D3CL 1HK6A 4HJ0C 2DOCA 4F15B 4Z7WB 5KAQF 5TDNA 4FQHA 4J8RB 5JOEA 2Z31D 3CPLA 4QOKD 4NQDD 4H1LB 3IB4A 3BOVA 4DVRL 3G5ZA 5ETUA 1A02N 1FL3B 2WIIA 3H3PH 3PWPA 1HSBB 4HBQA 4L4VE 1TFHA 1UYWH 5ANME 3C60A 4QNPE 4Y16D 3IJHA 1MFCH 3O9WA 5D5MA 2Z8WC 5E2WH 4IDLA 2W9LA 3FB5B 1YNTB 2OYPA 2K7QA 1ZLWH 1TJIH 1OAXL 1CD1B 5E99H 1MJUH 2FJFA 5EORL 3VRLE 2PKDA 3U0WL 2VB5A 5L6YH 3CH8A 3VXSA 5J12B 5HVWA 5HVFB 4YDVB 4ONHA 5I1HL 2AI0L 1M7DA 1KENL 4TQEL 3T0XA 1DLFH 3G5XA 2RCSH 3MJ9A 3FAXA 5C2BH 4JY6A 1P7HL 1J5OL 3OWEA 4UQ3B 2WUCH 1P4IL 4M7LL 1AIFA 4KROC 1EFQA 5JHLH 2KDGA 3DRQB 2ZUYA 5BO1L 1YYMH 3EFDL 1U6AH 4WHDA 1FIEA 1QLRB 4P3CL 2I9TB 1HNFA 1A3LL 1ZGLM 5ICYB 1CXHA 4Q74A 4GMTL 1NDGB 3REVA 1A7OH 5K33A 3U4BL 3BPOB 5DC0A 3ARBD 4JANB 5F88B 3RY4A 1U8OB 4FQXC 1YN7B 4PJGB 4MMXC 5CIPH 2G75B 3SDAA 3NMEA 1LWRA 1ZTXL 4ORZC 4GKSB 3OKKB 3RTQD 5D7LB 2AV1B 1WQVT 4KC3B 3GSRB 1OLLA 2OTWA 3U4EA 4XP5L 3GM0A 2HFGL 3OAZH 3ULUC 2GW5A 3S5LA 3A0OA 1U91A 4XH2A 4X7FC 4FTVD 1YEKH 4QCIB 4UB0H 2X4RB 2V6HA 4POUB 3V52L 3U46B 2AJYH 3LOWA 1IGFL 1EA9C 5E4EC 5AZEH 3FT3A 4G6AD 3QEUB 1KXQE 2XG5A 3ZE1F 2PUQT 4NRYA 1KC5L 2EH8L 3QH3B 2GT9A 3QWOB 5FECA 4Z0BL 3EDKA 3FB7B 4POYA 4O58L 4PGBB 1P69B 3VI3F 3OKOB 4EIZC 1HHJB 3LKOA 3SPVA 3RDTD 5JUEL 1NMCC 3L7EB 3K2UH 2OJZL 4K07A 1AKJB 3RWIB 1CD8A 1YDPA 1ZLUH 3MCG1 4G8FB 5IV2A 3S37L 1RD6A 5IG7B 3AXLA 1AXTH 1GCFA 1ACZA 1T5XA 5I1IH 4HIHA 1NGZA 1HH9A 4IOFD 1ZANL 2OZ4A 5EH1A 3U2SA 3V5KB 3MRPB 4ZO7A 2DBLL 5MHSD 1AGCA 4TN9A 4C56A 4ZOAA 5MENB 3N0PB 3PGDB 4OLWL 2IANE 4YUEL 4DUVA 1A1MB 2ORBH 3OPZH 1WTGT 1CFTA 3W0WE 5C6WH 2ADGA 1VEMA 2HRLA 4OFVA 4U1NA 1X6NA 5IMLA 5KVEL 4L3AA 2XZAL 2R23B 4FQLH 1Q0XL 4P2RE 5CINL 5ID0A 2FB4H 1MFDH 3IU3B 4OLEA 1I7ZA 3D18A 4NKDA 1MIMH 2ZUVA 1BAFH 4YHKH 2A6IA 4X9BA 1W0VA 4D0DA 4X99B 1K2DA 2AKRB 5DD0L 1IAIH 5DVLA 2NTFA 1S7VB 3IU4L 4Z8FL 3DIFB 4BH7B 4X9IA 2Q6WB 3TN0A 4NFCA 3SO5A 3B2VH 4MWFB 2NY3D 3QDMA 4OF3A 3TWCH 4FG6C 4BSJA 4IRSB 4N0FA 1N64L 2BVQB 4M6NH 4PB9H 4CVXB 3UTTD 3AREC 3QSKB 4G6JL 4OCXL 4WFGD 4XP1L 2J12B 4GRLA 2UVFA 3TZVD 3F7QA 4ZFFB 1F4XH 3I50L 3DV6B 5DWUL 2XA8L 3DX8B 5AWNH 5JA8B 2J8UB 4JDVB 2AAVA 5EU7C 3B5TA 4HT1L 5IVXF 4N9OB 4RNRB 3QR2A 4HBCH 3DUUB 4ZTPL 3LKNB 1T21B 4U1LB 4YQXH 3VD3A 4LKXA 3ABZA 2R29H 5T3XE 4G43B 1AQKH 3C60C 1AXSB 2UZIH 3UJTL 2ESVD 2HYMA 2QKIB 3PF2A 1AI1H 4LPXA 3NZ8B 4M7KL 2KQNA 2NLJA 3PQYA 1JZ4A 1JUFB 1FHGA 5J1AA 3OGOE 1QRNB 1XH3A 3R1GH 5IIEB 3P9MB 2BJMH 2OZ4H 1OM3L 3Q5OA 4YHIA 1ZOXA 4X98A 1L6XA 1QBLL