2CDFA

Structure and binding kinetics of three different human cd1d-alpha- galactosylceramide-specific t cell receptors (tcr 5e)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
191
structure length
191
Chain Sequence
NQVEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGADRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR 5E
publication title Structrue and Binding Kinetics of Three Different Human Cd1D-Alpha-Galactosylceramide-Specific T Cell Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell receptor
total genus 34
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2006-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdfA02
2Q6WA 3QEQD 3IXTA 5LGKA 4NFCA 4MX7A 4MJ5B 2Y25A 3T0EE 3VCLB 1WWWX 2MKWA 4OCSH 5CSZB 1D7FA 4MMXC 5C0JA 3CFCL 4HFWB 1S7QA 2H3NA 4L4VB 1U8MA 3UTSD 5ADOH 1DANU 3UTTE 1PJ9A 5A16A 4B50A 2Z8RA 3MV9A 1A4JA 4V1DA 3V4UL 3DV4B 1WBYA 1DUYA 1WVZA 5J6GB 1BIIB 5IFHH 3QXVA 5H37G 5JO5A 5JPNB 5IBTH 3W0WB 4D9RD 3UBXB 3I2CL 4PJIE 2XWJA 4UTBL 2W0LA 2W59A 1YEIH 5TDPA 2O61A 1YQVH 3JZ7A 1Q38A 2Y06H 3GO1L 5IROC 5LWYH 3TV3L 1OHQA 3NZ8A 1KIPA 3QAZB 1XMWA 5FO8A 2ZNXA 4DKFH 5AZEH 5HHMB 3BIKB 3PHOB 4J3TA 4HWZB 2VDRH 5E5UB 3LY6A 4EI5B 2A9NH 1N5YH 5HVWA 5E99H 3WFBH 5L2KE 4YBLC 2XQBH 3MOBH 4ZXBA 4D8PB 4JM2F 3WHXA 1T0MB 5F8QC 2OJZL 3T08A 3HAEH 1MCHA 1NL0L 4MA8H 3D39E 2JE8A 1GH7A 3MRRA 4JM2D 4R2GD 4XNQA 4XPGL 4G9FA 4HPOH 2YPLE 3RVVD 2AK4E 3OAZK 1ZLUK 5EORH 3RZCC 3V5HB 4D0DA 2PYEE 3BGAA 1ED3A 4KJQD 5JTWA 4DN4L 2YPKB 1HKLH 3CC5A 4MD5B 3BKJH 3QQ4B 1RK1A 3NTCH 2BNQE 3QEUB 4BQ9A 4GOSA 5KSAC 4QNPE 2VAAA 2EXWC 4TVPD 3SBWA 5IK3A 1PLGH 2PXYC 5HVGB 2VYRE 1U9KA 2NY4B 3X3GH 2NY7H 1I85C 5F1OB 5IW1B 4U6VH 5ERWA 5C0EA 2BNUA 3I9GL 4PRIE 2FGZA 1EA9C 2ZJSH 1LO2H 1CQYA 1AD0A 4M02A 1PBYA 4RWYH 1P84J 4IIQA 5IHBA 3D18A 3T0WA 4NRXB 4P9HL 1MEXL 3QUYB 2GTZA 4Q58C 1OLLA 1S5HB 1DEEA 1U42A 4NJAH 3CDFA 3X12A 4Y2OA 1F58H 2ZCLH 4S11A 4Y2DC 2OR9H 2WIIA 3VFTA 1YMMB 4GSDL 3CFEA 5FCUL 2BY1A 3HZKA 1U93B 1F4YL 3ZKNC 2NX5E 3MLWH 5KSBF 2ADJB 2IAMD 1EEQA 1UVQB 4C54A 3LKNB 2HFEB 2MCPL 1S8DA 4Z7NE 5GGRY 4JFEB 2X4NA 5ICZA 3VH8G 4O02L 1IM9B 5KVGH 4UIMA 4ZTPL 4JGUA 4P2QD 3DSFH 3MCKA 1TETH 4A6YH 1JNLH 2BSSB 4OUOA 3ZMRA 3RUGE 2A6DB 5I15L 2BVQB 4OZFH 5IVNA 4EQ2A 5TH2B 4FFWC 2GYSA 2NY0C 3QXDA 3Q48A 5D1XD 1G9NH 1XGPB 1INDL 5AWNL 2ENSA 5C0BE 3EZJB 2NQCA 5F7DB 4FZEH 3LHPL 1Q9LB 3BPLC 5CD3A 1OTTD 3RVWC 3UO1L 1P6FA 3QZWG 4UAOC 1Q1JH 1I9JH 2WP3O 4K71B 1CGVA 2EO9A 3MPCA 1ADQA 1F5WA 1KN2H 3DROB 4N1EA 5ESAB 3ZDYF 2OL3A 5D70L 5FO7A 3RGVB 2FATH 4BH7A 1HZHH 2DF3A 4DFHA 4FXKB 3JWOC 1T1ZA 4LSTL 4Y1AD 1P7QD 4YHIB 2EO1A 5EZIH 2HFGH 4P5TA 3TT3L 5B38A 1BWWA 2YWZA 2VQUA 5B8CC 2DQEH 5ESQB 1S78C 4PRPE 2IMNA 1OAUH 3WJLC 1HIMH 3VFRB 3MNWB 3TA3A 2F58L 4UQ2B 3WN5B 4N1HB 1NCWH 4JRYE 5F3HA 3PUCA 5FYJD 2R2CA 3AU1B 1D6VH 3U4AA 1IC4H 2V2XB 1JHLL 3OR6A 3AREA 3U9PL 3Q5YA 4JY5H 2X2YA 3QIUB 3HRZB 4PJEB 4YHML 4OD3H 4LSVL 1J11A 3CMGA 2KPNA 2DLHA 5FYLL 4N0FA 4LLUB 1PSKH 2XKSA 3BZFB 4PJFB 3RVTD 3FQXB 1OAXH 4OCRH 4LAQH 3GMRB 1NEZB 2A6JB 1FG9C 1K8DA 3REWB 2DQHH 2Y36L 4JHBA 1EHNA 3N1GC 4TSCL 3U4BL 1RZ8B 3OXRA 1U92A 1ZHKA 2I5YL 1T0NA 3L9RB 4CJ0A 5C2BH 1F3JB 5DDHB 4R8WH 3V9FA 1CDBA 3WXWL 1FRGH 5IIEB 1FN4B 3VXNA 3DX7A 4G80A 2EDYA 2YA0A 3P40A 5EC1A 3RGHA 1ZTXH 3BYTA 4JFPA 5IB2B 2VLLB 3OPZL 5F88B 4P3DB 1PZ5A 1UADC 2UV3A 1A6VL 4PY8J 4Q9QL 5CSGA 4HGWB 2AK1H 4L29B 1T4KA 5DT1L 4PUBL 3MROA 5FUOH 5AG8A 3QWQB 5BS0A 2DM4A 4LLMA 1JK8B 3F6IA 4YJZL 1OP9A 1A1MB 4OT1L 4OLVL 5LCVH 4J4PA 4JFZH 1LGVA 4KY1L 3UPRA 3VWJB 3L3OB 3U1SL 1A1NA 1PVHA 2H41A 4FQQB 5D7IB 2X4SA 3OZ9L 3MR9B 4AZ8A 3GSUB 3DX6B 2P44B 2R9HC 2XTJB 4OF0A 2NR6C 2H9GB 2V7NA 1WIUA 3L95B 5I30H 2A73A 3AAZB 2ZUSA 5I1IH 4NN5C 1R0AL 3QIBB 1NBVH 2UUDK 2NY5L 2VABA 3OBAA 2VN7A 2I27N 2DTMH 3CSBA 1S7XB 3U0TB 2ZCHL 4LL9A 3O6FB 3WNMA 1D5BA 1BF8A 5D1ZB 4U3XA 4OGYH 5F7WC 1U41A 3WNKA 1S3KL 2SEBA 3EDKA 3QFJE 1IAIM 2EYTA 4XGZB 1UJ3B 1TZIB 3OKOA 2ZPKL 3LQMA 2WSKA 5FCSH 5DVOA 2UWEF 1FPTH 3BDYH 5BOZG 4KVNL 2JK5B 43CAB 2AXFB 1ZLSH 4CMMB 1T66C 1X44A 4MJ5A 3VCLA 5CSZA 1YDPB 4HFWA 4L4VA 4XWGL 1MJ8L 1KCUH 1M7DB 2VXTL 1RVFH 2UZIL 4M6ML 3ZO0A 2W9EH 1M71B 4F9LA 2Y72A 3I85A 5J6GA 1BIIA 5JPNA 4XCYB 2FSEB 1UM6L 4ZO9A 3RTQC 3MXWH 3W0WA 3UBXA 4HC1A 4ZOBA 2IWGA 1IGIH 3DRTA 4P2RE 3U36A 3L3DB 5C0RH 1QHPA 5C0CB 3VXSD 2CDFB 2J88L 3FRUA 4HKZB 2CIKB 2X1XR 4KVCL 1V3MA 3K8MA 4U7SA 2VDQH 1C5CH 4TNVF 4A2MA 4JY6B 4YBLB 2YPVH 3PHOA 4HWZA 5LKNA 4HIJB 1OGTB 4EI5A 1T2JA 1MI5D 3FOMA 3O4OC 4JPIB 5KZCD 3VG9C 3I50L 1H3TA 4Y16D 3RVUC 2B1HH 4EXKA 1BECA 3PDGA 2VLKD 5IUSA 4HUXB 2MWCA 1QFWH 4L3EE 1T0MA 4LKCB 4WFED 3NCCB 4QYOB 3ARVA 1QRNB 3RZCB 4OCYH 4GH7B 3GHBL 3N85L 3RDTB 5HHVL 2HP4A 3L3GA 4IOIB 4IRJC 4OSUH 5D7LD 5GGVH 1U2CA 1JZ6A 2ESVB 2W9LA 1HN1A 4OM0H 5AYUL 1DN2A 4OI9A 5KSAB 2YPKA 1UZ6F 3I6GB 3QQ4A 4S1QH 5DD6A 1QFOA 2PXYB 1JF5A 1CBVH 3NPZB 1QG3A 1ZVHA 3JWNC 4MCZB 4MSWA 4OGZA 3R8BB 1IFHH 4KK8C 3O3BA 2QHRL 3JUZA 1AXTL 5AEAA 1CXHA 4XT1C 4XP4H 5HYJE 5IW1A 5KVEH 1RZ7H 3OHXB 5I9QB 2E6PA 3E3QE 4WI9A 1EHXA 12E8H 3IU3A 2AJSH 4NO5B 4KZDH 1CT8B 1SQ2N 5IB3B 4Y2DB 2VAJA 2FD6H 3R8QA 4N0CC 4NRXA 2CPCA 2R0LH 3GI9L 3QUYA 4Y88A 1A14H 1A3RH 1S5HA 2LQRA 4DJMA 1ES0A 1YN6A 3O3EB 1H0DA 1YMMA 4Z7QE 5CSBA 4HMCA 1ZV5A 2ARJQ 2APFA 4DKEL 5E6IC 4FQ2L 1RMFH 2ADJA 1UVQA 4U1JB 1BAFL 2HFEA 4X9FA 2IGFL 3G6JE 1S5IL 4M5YL 2P7TB 4NNPL 3ZDZE 1CF8L 1LP9E 4YAQB 1F2QA 2A6DA 3D69B 2BVQA 1CLOH 1XF3B 3BDBA 5T1KD 4G5ZH 5TH2A 3C5SA 5LAXB 3VFGH 2Q7YB 1XGPA 2N4IA 4LBEB 1BD2D 3P3YA 2HN7A 3P4OA 1MCIA 4J3XA 4UAOB 3GSXB 4X7TA 1T7VA 4S1RL 5F7DA 3HC0B 1OTSC 5B21A 3RWDB 2ZCKH 4LCWE 1CK0H 3ARFD 4MQ7B 3CSGA 2AJVL 3VW3H 3SGDI 3QULB 4NCC1 1JZ8A 1CFBA 4GXUM 3WXVL 4LLQB 5ESAA 1KELL 3O8XC 4IJ3B 4WI8A 3RWHB 3BN9D 3RGVA 4M7LL 4Z7WA 1K9TA 3IU4H 4HWBA 4L5FH 2VDNH 1OM3H 3FRPA 4WHTB 4FXKA 4X4ZA 4H8WH 4LNVA 2YC1A 5B8CB 5JQ6L 5ENWB 4YDVB 4YHIA 3NFSL 1S7TA 1WZMA 1T5XB 2VXUH 4LLVA 5ESQA 1PGRB 3PV6B 3CCHA 3VFRA 3DGGB 3MNWA 4RAVA 1ZS8A 5D93C 3RVXC 5IHZB 1VDGA 2YSSB 4JZOB 1KB5H 4QT5B 4UQ2A 3WN5A 1DL7L 2NW2B 3H8NA 1XT5A 4NCC2 4RX4D 3AU1A 4ZUWB 2H6PA 2NLJA 2V2XA 3EO9H 4HV8B 3T1FB 3T0EC 5KBNC 1DQQB 4K3EH 3QIUA 3HRZA 1ZEAH 1HHIB 2Y6SC 5DRWB 1RAMA 4RCAA 4LIQL 2XA8H 4LLUA 5IHUH 5D2LA 4Z5RA 4FQIL 3VDAA 3O4LD 4XAWL 3JV6B 3L7EA 2NCMA 4PJFA 4K8RL 2VISA 2LE9A 5CCKL 1LD9B 2LVCA 4MJ6B 3GMRA 3F7PC 1AR1C 1NEZA 2A6JA 2IJ0C 3SOBL 5BV7H 5I73C 5D6DA 1HCVA 4BFGA 5E2TL 1MAML 2WAHA 1RZ8A 2C1OB 5CD5C 5C0AB 2ZSVA 1KJ2H 3VI3F 1DQJB 1F3JA 2EYSB 5DDHA 3SJVB 5JMRA 3KPSD 2G60H 1ZHBB 5IIEA 3ECBB 1FN4A 3WNLA 4DOHB 1PFCA 3NGBC 4I0KA 3BD3A 1MJUL 1A6TB 5AZ2L 4OZHE 2VLLA 1AKJB 4HBCL 3ZKQD 4PGJA 4GKZA 4OTXL 2GJ6B 4HGWA 5FA4A 5KS9F 4L29A 3BP5B 3TVMD 4PRHE 5I1KL 1JK8A 4OFPA 5DURB 4UTAH 1KULA 1BFOB 5HGBB 2M2DA 1H3WM 3L3OA 1CFNB 2E9JA 3ARYA 1RUKH 4FQQA 2ADGA 4CVZA 3MR9A 1JI2A 1JP5A 4KTDL 4LQFH 3GSUA 4NN5B 1CFVH 2ATPB 3HHRB 1SJEA 4X6DF 3IXAA 1BF2A 4TUKL 5GGQH 3MRDB 5ISZD 4L9LC 5MEOB 4FG6C 3WNOA 4GRWH 2ZG3A 1SBBA 2GT9A 1AD9B 1S7XA 1ACYH 1G0YR 1PG7H 3R06B 1U8OB 3VXPB 5BO1H 4YE4L 4GXUN 5F6HI 4L8SC 2QSCL 5FECA 2F74B 1X5AA 1MF2L 1ND0B 2G2RB 2DQTL 2DQDL 5GZNC 1J8HB 1FFNA 4XGZA 1CG9B 1GZPB 3MV9D 4FHBD 4OZ4A 1TZIA 4HUWB 4G6JL 4V1DD 4XX1G 1AJ7L 2QSQA 3QI9C 3K1DA 1RZIB 1F3DH 2OMBA 1IQWH 3LKOA 4G6KH 43CAA 2AXFA 4JG0L 4CMMA 5I1HH 3C8DA 1D5MB 1MRCH 1AGDA 3MV01 3MA7B 4ONFH 1YDPA 1ACZA 3VMOA 1MREH 5E5MA 3MLXL 3VD3A 2O5ZH 5BW7A 1M7DA 1FC2D 3VFMB 3T3ME 5EU4A 2VZVA 3RTQB 5HGGS 4QRUB 2W0FB 3C9NB 4JFFE 4BSWA 1M71A 1A5FL 3HLAB 2FSEA 1IT9H 4XVUD 4ZXBD 3UROR 4TSBH 3PDDA 2EH8L 4CMHB 1FNSL 3VW3L 3KLAA 1C12B 4PJHA 1CLYL 3SPVB 2CDFA 3RWFB 4KUZH 4QCIB 4MDIB 3FO1A 2CIKA 5DHXB 4DQOL 3U30B 3VDCA 1NQBA 2WWKO 2DBLH 4C57C 3O4OB 5JR1H 4JY6A 3VG9B 1NC2A 4G9FD 3TNNA 1NANI 2VWEC 4W6WB 4HIJA 1OGTA 3G08B 1G84A 4I5BA 4XBEH 3RWIB 1JFQH 4P46A 5TF1H 4LKCA 4K3DL 4GQPH 2VSCA 4XPAL 3PABB 2B0SH 4QYOA 2IMMA 1NAKH 1U3HA 5DMIH 3JVGC 2BC4B 3QDJD 1QRNA 2H8PB 4IRJB 2BOCB 1C08B 4P48A 3OAUH 4JO4H 1RJZA 3RDTA 3FHQA 4PJ5E 3LKSB 3FT2B 4IOIA 5IVXF 2ESVA 2W9DL 1UJTA 4M48L 1NCDH 4TPRH 2R0ZL 4G7VH 2JTDA 3I6GA 1ADQH 1MRDH 1ZHLA 4Y8AA 1HYRC 3CXHK 5IHLB 4KQ4H 4MCZA 3SE3A 2CXKA 5JNYB 4IHOA 2UYLB 1T7YA 4PS4H 3ZKXC 2VUYA 3S36H 4UIKH 4X6CB 5IWLC 2K3TA 3OHXA 2IPUG 4BFIB 4ZFGH 4ORZC 4MB5A 3BXNB 4NO5A 5IF0A 4WY7H 5ALBH 4KKBC 1HKFA 4M62L 4AIOA 1QRKA 4Y2DA 1ROWA 5J13B 2Y9RT 1PX3A 3FZUD 5E6IB 3O3EA 2DQJL 4XP9L 3QFDB 1NMAH 4FFVD 3LSOB 3IDJA 2W38A 3K80A 5T3ZH 2AV1B 2Y4SA 2R56H 3HCVA 5F7FA 1KBGL 1MWAB 4X5WA 3FQTB 1ZA3A 4K94L 3CX5K 5J12C 1ZLVK 1PEZA 2F53E 3NCBB 5HDBE 4RDQF 1G9MH 1F4XL 5HHOE 3PGDB 1GGYA 2FBJH 4GMTL 2P7TA 1U8IB 4YHYC 4KK5D 4NT6B 1KYOJ 4U1LB 1MFEL 1J1XL 1DFBL 1CZ8H 1XF3A 4TULH 2V2TB 4ELMA 3FQWB 4KPHH 1PY9A 2Q7YA 1VERA 1HXMB 1CFTA 5IFAH 5DJDA 2CRYA 4LBEA 4ZO6A 3ROLB 4WGWB 3ROOA 2BVOB 3GSXA 4ZS7H 4FQHB 3WFCL 1AO7B 4LPXA 4P5TD 4YDKL 3RWDA 4HF5L 1V7MH 4LEXL 1ZT7B 4YFDB 4O51B 4XNMA 1WAAE 3S4SG 4JN1H 3O8XB 1QO3A 2V5TA 4LKXB 4YX2L 4DVRL 4NSKB 3TA3D 4JB9H 1P7HL 4LLQA 4R3SB 1L9NA 4GW5A 3RWHA 2CLRB 4OGAD 1XGRB 3LN5B 5B8CA 5ENWA 3WJLA 4QHKI 5CJQH 3HG1B 5D93B 3QZWB 2Z35B 5ACLA 2KQNA 3TZVC 4DGYH 5D7KE 2F9BT 4XHQA 1CGTA 3PV6A 1GHFL 2ED8A 5IHZA 4O5LL 1KC5H 1XCQB 2YSSA 3B2VL 4JZOA 4QT5A 3KWWA 4X7SH 3QO0A 2NW2A 2LAGB 4X6FA 3T0EB 4AMKH 1AC6A 1MPAH 4HIXH 2YK1H 4OLZL 2YN5A 3ILQD 3NA9L 3UZVB 4HV8A 3T1FA 3UTTB 4DGVL 5GS0C 3G04B 4HFUL 1DQQA 5FA3B 1MFDH 4GUPB 1NFDE 3UJTH 4PJDF 1HHIA 5DRWA 4P23C 3U79A 2R1WA 3HNTL 4TQEL 3B2UD 4R90H 4XAKE 1P7KA 3B5HA 4ZFOB 2K9UA 3V4VL 3JV6A 2DMBA 3HI1B 3SCMA 3ARBC 5I73B 3LEXB 4PJIB 4MJ6A 3QG7H 3UTZB 4PTUB 5D5ME 2WLZA 1GGCH 4P3WA 5DD5H 1D9KC 1Z3GH 4PLJD 5C0AA 1UWXH 3M45A 1VGEL 5IQ7H 2I9TA 2EYSA 3SJVA 3MV7A 3NGBB 2HG5B 3DURB 2J4WH 5CAYB 3UDWC 3ECBA 5DC4B 4DUWA 3IDIB 3NCJL 1B6UA 1HHHB 1T1YB 4PGDA 4XI5C 4OLUL 4GS7B 5E7BA 1CCZA 1ZOXA 3D39B 4KQ3H 3UYRH 5IB1B 5I1JH 5GIRB 1S7SA 5GRJL 2YPLB 2BRRL 1YEHL 3CFDB 2AK4B 4QHMA 3HC4L 3BP5A 4PB0H 4YXKL 4LVOC 1BFVH 3Q0HA 1KJ3L 1W72B 1JYNA 2C1PB 3P0YL 4IM8A 1CL7H 4L9DA 4XHJC 1BFOA 3JV5A 4XP1L 2BNQB 1BMGA 4EQ3A 2APTA 4JHWL 4KTEH 4WTXA 1JGUL 1IMHC 3MJ9L 4YXLL 4J2XA 1B9ZA 2EDJA 4NN6C 4QXGL 4QRPD 5D72H 4M1CC 3EYSH 3OXSA 4LGSB 4YPJA 4L9LB 1K8IB 1P6AB 4JCLA 3LS5H 1A9EB 4KDTC 4PRIB 4X80H 3GKWH 1SM3L 2DQCL 3MRDA 4W6YB 3GJEB 3EYVA 4L8SB 2VQ1B 2NY1C 2R0KL 5IMKB 2HRLA 1AD9A 3PXHA 3R06A 1U8OA 1YPZE 4GAYA 1YYLL 1RD6A 3OQ3B 4NRZA 4U3CA 3VXPA 4U31A 4K9EH 1E28A 1I8IB 3MRFB 2F74A 4YH6A 1ND0A 3DMMC 2G2RA 5E9DE 2VLME 5FDYA 3RNQB 4OD1H 4P49A 3VJ6B 1J8HA 1A6WH 3QI9B 3N1PC 1G7QB 1QFHA 1CG9A 1GZPA 3KPQB 2NX5B 4HUWA 4M6AA 1FGVH 1OSPH 4FQXD 3KAAA 5KSVA 1TNNA 1RZIA 4DUVA 4QHLB 5DI8B 2NW3B 2BFVH 1YY8B 3MLZL 2XN9D 3QHFH 4JFDE 3B8SA 4Z76B 2JF1A 1D5MA 1DP0A 1RK0B 4TVPH 4XH2B 3M1BB 1EFXA 3MA7A 1EVTC 3IAPA 1MLBB 5C07E 3RUGB 1KOAA 2RQ8A 3QB7C 2H26B 1BQHG 5D6CB 1OP3H 1CTNA 4QRUA 4PLNC 2W0FA 1UXWB 3C9NA 3IS1X 5C0BB 2H2PC 3CLEL 3HLAA 2F19H 1TJHH 1W8NA 3FL7A 5DLML 4OBSA 2DQGH 1VKXA 3R4DA 3HR5B 4PJ7B 1DBJH 3DXAE 4FZ8H 3TIEB 4ERSL 1KUMA 3SPVA 3SDDD 2IANB 3KPOB 3RWFA 1PYWB 4QCIA 4IOFD 4OQ1A 1JTPA 4MDIA 2JCCE 3ZYOA 2OZ4A 3HZVB 3MRJB 1JIBA 3PWVB 1KEML 3DVNA 3ES6B 4WNQB 4Z7UE 4DW2H 1A7NH 3PWPE 3LPWA 5DD0L 1VGKB 1FNEB 2HH0L 5ADOL 2J6EA 2K7QA 3G08A 3IGAB 2N1KA 4H0IA 5TE6H 3RRQA 4UILL 1HXYB 1OAQH 5EH1A 5IQ9B 1RY7B 4NHUB 4PRPB 5EULV 2KBGA 4TUOB 2FLRT 3PABA 4Z0BL 4NKDA 3GBML 2BC4A 1DN0B 2H8PA 4JRYB 32C2B 1RI8A 5F7HA 3GDBA 3WMSA 1NDGA 1C08A 4UUJB 2Y07L 4XP6H 2MOVA 3MNVA 1YQVL 3UMTA 3LKSA 1JPTL 4WFFE 3FT2A 2OTUB 4I0PA 2VZ1A 3CH8A 1W8OA 1HINH 4YHNB 2LFGA 3GJFB 2P5ED 3GMQA 4J7RA 1U91B 1NGXB 2VDRL 3ZKXB 5I8EB 4WFGE 2A9NL 1U36A 1N5YL 5JNYA 3V52H 3LS4H 2UYLA 5F7UA 3MOBL 2LU3A 5DVMA 4HLZH 1JGLL 4IRZL 5KVFH 1Q9KB 3NABH 4X6CA 1YMMD 1JNNL 2NMSA 5TQ2L 4E5XB 4BFIA 3FMGH 2A2QT 3BXNA 3B5TA 4M6OL 3WE6A 4MWFB 1JGDB 5IKCB 4L3AA 3LZFL 2C3HA 5DC0A 4F9PC 4M5ZH 1MCEA 1XF1A 1RZKH 3NTCL 5BCAA 3ARGC 3QFDA 4ONOA 5FYJH 2ZUVA 5LBSH 3TJHC 4JGMA 2HT3D 3LSOA 5I1AA 4KKAD 5HHXH 3OKEA 4D0CB 5J12B 1F6FB 4F7MB 5FYJU 3X3GL 1MWAA 3FQTA 4JKWA 5JZ7C 5A2KH 3PGDA 1IGMH 4WCYH 1RULH 4UBDD 1T1WA 1EUUA 1U8IA 3H7BA 4Q6YA 3V2AR 1I8MB 5EOQH 2KZWA 1CGYA 4Z7WF 1UENA 1J0IA 3GKZA 4ZFZB 1F90L 2HWZL 2R39A 2D7NA 3QRFM 1XGTA 4EOWH 1LO5B 1U6AH 4NJAL 3RGVD 1HXMA 4ZUUB 2Z31A 3ELAT 5ILTH 1P4BH 4EN3C 1U8JB 3ZE2E 3ROLA 5DFTA 5DO2C 2AP2A 4MAYC 4OQTA 2BVOA 1T20B 1I9RH 4P3CH 1AO7A 5JW4N 3SHSA 1ZT7A 2EEDA 4O51A 4PRDA 2B4CC 2IPKB 4PLKC 3MMEB 2ILLA 3O8XA 2R23A 3S9DB 4KTYA 4FRWA 4LKXA 4U1MA 4M1DL 4NSKA 1CTOA 3OJDB 3MUZ1 5JQHC 1MCJA 4R3SA 2JJVA 5B3NA 3ALWA 4KKLD 1N7ML 2E3VA 2CLRA 5JPMB 1JNLL 5CBAA 3TZVB 3CVIL 4HIIB 3LN5A 4YO0B 5HD8D 3MRKB 2V2WB 3QFJB 1DQML 5MHSD 5C0NC 5JOPD 3QZWA 2W92A 5D2LF 3UCRA 2Z35A 3HMXH 3SGJC 4OZGE 2IFFH 1XCQA 3FB6B 4OZIE 1OAZL 1E6OH 4JQIH 4K3JL 3GMMB 5DD3H 1I7RB 5J9PA 3T0EA 5DEFA 3H3KA 4Z95H 2C4FT 3WFDL 4IRSC 4FNLH 4OI7A 3THML 4ETQA 1FLRH 5CP3A 3A6CL 5FA3A 4GUPA 3WO4C 1IZKA 1FL5B 4M03A 1MIMH 5IESL 4Y4KB 4CJ1A 4YBQC 1T80A 4JFXB 3ULVC 2BNRE 3HI1A 4UNUA 5EZIL 1NLBH 3RA7L 4S0TD 3LEXA 4PJIA 4JPVH 3RWGB 2DQEL 1D9KB 4P2RB 3UTZA 1RHFA 4PTUA 4BSJA 1S7VB 4FTVB 1HOCB 1MCWW 1W0VB 5AG9A 4LPCA 3MUJA 1TITA 5GZOC 4XCFH 3MJGX 4N0UE 2BCKB 2X4PB 4OLXH 3D3VA 2B39A 5C3LD 3QO1B 4JY5L 5L2KA 3IDIA 3B9DA 1TZGH 5CZXD 3AXLB 3WYRA 2D7TH 2BHUA 1HHHA 1T1YA 3FB5B 3HFMH 4R26H 2DLFH 4L3EB 1VACA 2APBA 3C8KB 3MC0A 4X6EA 4YHZH 2YKLL 5KAQF 3D39A 3LD8C 5IB1A 4HZLB 2E7LC 3QJHB 4WW1B 1ZGLP 4LVOB 1OY3B 4I18B 4GBXA 2YPLA 1F4AA 4U49A 2A9MH 4C56B 1KNOA 4XBGB 2DQHL 1VFAA 2PYEA 1W72A 2ERJC 5DFWH 5T33H 1W0WB 4XNUL 1YEDB 4RMUA 2DLEA 2HLAB 5CGMA 2BNQA 4NN6B 5B4MC 4NNXB 4R7NB 2FCBA 3DX9B 3L5IA 2FLBT 1A3QA 5DC9B 3X3FH 4N8CH 2CKNA 1SEQL 2Q86B 4L9LA 1K8IA 1MAJA 3U2SB 4E42A 1A9EA 2NY1B 1SEBB 1A9BA 4PRIA 4XNYH 4RA0C 4ZS6C 2R2EA 2VQ1A 3BMVA 5CINL 3QP3A 2Q8AL 3DMMB 4CUCA 2BDNL 4HAFA 1CLCA 4WEBH 1I8IA 2ORBH 3JUYA 5GJSH 1P9MA 4G42B 1FGNL 5IFJA 3WIHA 4PJAA 3RNQA 2F15A 3L7FB 3VJ6A 2W0PA 1N6VA 2FJFB 3V0WH 1KCLA 3CH1B 1G7QA 2RFXB 5SV3A 1QBLH 3O41B 1ZT1B 2NX5A 1AP2B 5F71A 5FM8A 5FYKD 5DI8A 1JRHI 2NW3A 2IH1B 4LGPB 5JIKA 1S9KC 5KOVC 4PJHF 2H2PD 3G6JB 4Z76A 3W82A 3KDMB 1NBVL 4CNIB 5CFHA 4F8QA 1RK0A 4XH2A 5HVFB 4PR5B 1P5VA 1MCNA 1LP9B 1MLBA 4KV5E 3CFKB 4P9HC 2RB8A 4PJGE 2FIRT 2NY3C 3RUGA 3UAJC 1B2WL 4LASL 3SO5A 2EKSA 2H26A 5C6WH 1K2DB 5KG9B 5I74C 5D6CA 3GEWB 5H94B 3CFJB 3H9HB 5C09A 4YDIL 1UXWA 1NC2D 5C0BA 1L4IA 2AJXH 2X4RB 4PB9H 4MJ2A 5GGVY 3WHE1 4HUNB 1G7IB 1YNKL 3A67L 1VFOA 2P45B 5A43C 1XR8B 1TDQA 2V17H 2PO6C 4GAJL 4LCWB 3BPNC 4P46D 1FPTL 4PD4J 3TIEA 9CGTA 2MNUA 1PYWA 4EUPG 3I6LE 4XCCH 1U3HD 1J12A 3HZVA 3QXWA 3PWVA 1IRAY 1WC7B 4GRWE 4WNQA 4XPFL 4NQTA 5KANI 4HHAA 3RNKB 1VGKA 1FNEA 3RDTD 3AM8C 1QA9B 2NXZB 3IGAA 4GG8B 1YEFL 4WHYH 3NIGF 4NM4L 1T89C 1HXYA 5IQ9A 2W9EL 4NHUA 4OIAA 4PRPA 3HPLA 3G5YB 3EHBD 4KI5C 4TUOA 3BT2L 2Z8VC 3ULUL 4KK6C 1EAPB 5EU7E 2QQQA 2HKHH 4RGNC 1DN0A 1X5FA 3LV3B 4JRYA 2XWTB 32C2A 4FS0A 4GKOA 3X13B 5CEZD 4HS6B 1S9XB 4XWOD 2WP3T 2ZUXA 1G0XA 3QRGH 4N0RA 4NM8L 2OTUA 5IW3A 3TCLB 4G8EA 4YHNA 3JWOH 4XTRD 5C7XH 1F3DJ 3BEWB 1U91A 1NAMA 1NGXA 1VCAA 3C60A 5I8EA 3NN8B 3O11A 4LHUG 2BP3A 3VG0L 2B1HL 2XWBA 1Q9KA 3FB7B 2A83A 5HI3C 4BQCA 4O4YL 3UEZA 2P5WE 5IT2L 4KMTH 4ZPVB 3FAWA 1X5IA 4AEHL 1IC5L 1X7QB 5I6XC 1MCRA 3WKMH 4MWFA 4OSUL 5DR5H 5GRWA 1JGDA 1D5XB 1BZ9B 1N0XH 4G6AD 1YA5A 3ARGB 5EZJA 3TPUB 5IKCA 3BP4B 4LCCB 3G5VB 3KGRA 4ELMF 4Y5YC 2VUOA 2FJGB 4K55A 3IDNB 1CBVL 3WS6C 5HJ3B 2FL5A 1G6RA 4OZHB 4UZGA 1DBKH 4YBHA 2PW1A 4F7MA 5D71H 5EZOH 5HDQH 4XP4L 3SDCC 5JIIA 4I9WE 3W9DB 3ZT6A 3O3AA 4PRAB 4XMKH 4PRHB 1A47A 5GXBB 3AY4C 4PJBF 1I8MA 3FFCD 2AJSL 5DQDH 1INQB 1K5NB 4YK4B 2IEPA 1GXEA 1LO5A 3TH2T 4EN3B 2EDRA 5CJ5A 1A3RL 5I8OH 4MAYB 2ITCB 5JHDE 1DQLL 1JPSH 1EEUA 4N5EC 3GSNL 1HH9B 3SQOH 3VFNA 1FSKC 1N6QH 4RFEB 1T20A 1WBXB 1EXUA 4HCRL 1TXKA 3W2DL 1RMFL 2IPKA 3N50A 3DTXA 1YNLH 4M4PA 5DGQA 4F7EB 3VI4F 1KGCE 4LLYA 3OJDA 1OARL 4YQXH 1SJVA 4WTZA 1AY1H 1SBSH 1OP5K 1I7ZB 5JPMA 3P73B 1DBBH 4MJID 4HIIA 5JA9A 1CLOL 1FFOB 3MBXH 3MRKA 4NUGH 2NPLX 2V2WA 3QFJA 4XRCB 3S4SB 3L3HB 5FAAA 5I1LB 1WCQA 4U0RB 1G1CA 2HLFD 5GJTL 3O2VH 5D8JH 3KLDA 5DMGC 3H3BC 2YUWA 4WW2F 4PREB 1JI1A 4U2YA 4IRSB 1IE5A 4JFHD 3SCMD 3V8OA 3PWLA 3LOWA 4C55A 1I7RA 2D0GA 3L5XH 4L8DA 4M4RA 4NQXB 3WFEL 3WO4B 4WHDA 3S88L 3BKMH 3LIZL 1C1EH 4PIRF 5HSFA 3MJ7A 1ZHNA 4L3CB 3K8LA 2CH8A 3G9VA 5GGTH 5JXEA 4E41E 2VDNL 1OM3L 1T21B 4JFFB 2NXYD 1E0OB 4H8WL 3SJVD 4Y4KA 2XTLA 3K46A 3MV7D 1DLHB 3VGHA 1R5WB 1W2KT 4OLYL 4XP5H 3RWGA 1D9KA 4P2RA 4DGIL 4U1NB 4CADB 5DJYB 4O2FA 1S7VA 1EHLL 3BKYL 3C08L 1Y6KR 3CVHB 2FYYB 4XPTH 1I1AC 2VDOL 3SGDH 3RKDC 4HXBL 15C8H 5JW3H 3PDOA 1H15A 3UDWA 2D7PA 3SGEI 2X4TA 2M26A 5E70A 1FZJB 1S9VB 2H32B 4EDXB 1BQLH 3QO1A 3AXLA 3LD8B 3EOAB 5FKPB 4H1LG 4LVEA 3FB5A 3P11L 1EERB 4L3EA 2MHAB 1FAIH 5FHAH 3C8KA 4KMQA 2CDGB 4UV4L 1TJGH 1TVDA 1FG2B 4WUKH 4HZLA 3QJHA 4OF5A 4I18A 3WHE0 1U3ZA 3QXTA 5J3HC 4G6FD 1PDKA 4PJ5B 4PJ8C 4XVJH 4HD9A 3KPTA 4W4OC 4XBGA 5LGHL 3ZTNH 1A3LH 2EC9T 2AJYL 5DMKA 1W0WA 1YEDA 3GSWB 1UB5B 1UB6B 2HLAA 5CILH 4XCNB 4AEIL 5H37H 3MLYH 4NNXA 2G60L 3DX9A 2V5MA 1UG9A 4ZAKA 2P24A 2J6EH 3NA4A 1FBIH 3SE8H 3B9KA 2QQNL 4NNYB 3F7YB 2YEZB 5HYJA 2XRAL 3QJFB 4MDJA 4S1SH 1P4IH 1NKOA 3RIFF 2A38A 3BN3B 1DBMH 2YD7A 5BRZB 5ID0B 4WEUD 4KK9C 3ARDC 4G43B 3PQYD 4ONGH 5J1TC 4JFQB 4NJ9L 3DMMA 1HSBB 5LVEA 2XXCB 4YWGL 1AGFB 5T3XE 5ETUB 2D4DA 3MV8E 3S96B 4I48B 1T3FB 2JB5H 3V5DB 3MRGB 1EFXD 4G42A 4KAQH 3BD4A 3L6FA 1I1RA 2FJFA 3CH1A 3FTGB 4OM1L 5HHPB 3O41A 1ZT1A 1JTTA 1AP2A 3B43A 3IKKA 1HDMB 4O9HH 2O5XH 2W0KA 3OB0K 4LEOA 4B5EA 2IH1A 1H8SA 1MUJB 4TOYH 1I4FB 1MFCH 4R4NC 3TBTB 1DVFB 4Z9KB 1JNJA 4NZUL 5HHOB 2NY3B 4CNIA 4Z7OF 4PR5A 1Q0YL 5I74B 1UWEL 1LP9A 3LMJL 3SKUD 3CFKA 4YHOL 3O2DA 5MERA 1RUQH 4V2BA 1ACYL 2RCSH 1PG7L 5BO1L 4ENEC 2AEIT 3SN6N 5KG9A 5J6HA 5H94A 3H9HA 2VXSL 4KH2A 5I1CL 5I0DA 1SY6A 1IM3A 4HS8L 2X4RA 3BPNB 1GIGH 2JIXB 5FUCE 3M07A 1G7IA 1KN4L 1KCSL 1XR8A 3BP7B 1KENH 1J88A 1KLUB 4LCWA 4H5SB 3SDXF 3BDXA 4G6KL 1AQDB 3CGTA 4K7PH 5DHYB 4I4WA 4UOJA 4NQCA 1WC7A 2CIIB 4ZODA 3D6GA 4LGRB 3RNKA 3RWEB 2OCFD 1QA9A 4GG8A 1A7BA 4X98B 4I0PD 3LRGA 4P4KA 1EGJH 5SWSB 5J06A 5I66B 4KJYB 3G5YA 1NFIB 4ESKA 2CUMA 5JUEL 1F4WH 2LTQC 3PL6C 1LK3L 3LV3A 2XWTA 1MIEH 4TSBL 3CDGB 3X13A 1INEL 4NO0D 1TTUA 1XGQB 3TCLA 4TVPE 2EDXA 4AK1A 5DZNA 2X4UA 2FO1A 1NGWB 1NFDB 4KJWC 2YZ8A 1SYSA 1MHEB 3BEWA 1WWAX 5DRNA 1NBZB 2DI9A 4FQCH 1A7QH 3NN8A 3TGXA 4KDWA 1MFAL 3P0VL 1UC6A 3V6ZB 4CVWA 5M7QA 3SEPA 2C9AA 3BZDA 5D5MB 3JXAA 4TRPL 4FQ1L 3F12A 5I6XB 2G75A 3B3IA 1I9IH 3ZKMC 4ZPVA 5FV2A 2YUZA 4DN3L 4X9BA 4WI4A 1EV2E 1IGYA 1X7QA 1X5GA 3VWKC 1XIWD 1LO4L 4Y5YB 5SX5K 2EEBA 3DVIA 1NANH 4FOMA 5F1KC 2CK2A 5KW9H 3ARGA 4G7VL 3BP4A 4LCCA 1KEGH 1S7UB 1ADQL 2YXMA 1EMTH 2OL3L 5EO9B 1HYSC 3IDNA 1BZ7B 3P2TA 4K8RC 3D9AL 3SDCB 4JR9H 4OZHA 5L6YH 2X1OA 1ERNA 4OIBA 4PS4L 1A2YB 1DDHB 1OT2A 3ZE1F 1CICD 5KSBE 2DQIH 3MACL 3S36L 3VXOB 1EEYA 1IL1A 4P2QE 43C9A 3W9DA 2Z31D 2A0LD 1UKQA 2AJ3B 4Y89A 5FUZL 3FONB 4PRAA 4EDWL 2HTLD 1GC1L 4PRHA 1UCTA 1AO7D 3KJ4C 5D1QC 2M1KA 1QSED 3PV7A 4R4FH 2DWEA 4N90D 4M1GH 1INQA 1K5NA 4HJGA 3HMWL 5DUPL 4OLWH 3MLSL 5I75C 3SKOB 4QHUB 1FSKB 2O5YL 4JO2L 2X89A 4Q0XL 3V0VB 1K6QH 2VR9A 3U7YH 3I84A 4RFEA 5T3ZL 5EU6A 1MHPL 2MPAH 4G8IA 2R56L 1UKSA 4LRIC 4LDEB 3AB0C 5KSUA 5D9SB 5DJXB 3EJZD 1NGZB 4FMKA 1NCCH 4GG6F 4F7EA 4RMQA 2WWMC 4Y1AE 1AGEB 2HRPL 3BPCA 2WV3A 5BV7C 3P73A 5E9DB 3P30H 3KR3H 1AH1A 1CZ8L 1FFOA 4XRCA 5DUMH 2VXQL 4P59H 1OAYH 3L3HA 4ODWB 5J89A 2OR8A 5I1LA 2R8SL 4KPHL 3DGCR 5GS1C 1FORL 4GKSB 2FZ3A 4LSQH 5FYJE 4PJEE 4BSVB 1JYXA 3CXDL 5FV1L 5JW5B 1QFUH 4K23H 4PREA 3A6BL 5CS7A 3WEXB 4IRSA 2W60B 3I3BA 1JGVH 4HJJL 2IBZY 3MYJB 4NQXA 5C07B 2GKIA 1QHOA 3DUHA 4JB9L 4Q2ZB 2KL6A 4L3CA 3VGDA 1ZLWH 4D3CH 2EE6A 2NY2D 4CW1B 4Y4HC 4X7CC 2ENYA 4JFFA 3K2UH 5E5RB 3ZYIA 4OB5H 3D3VD 1DLHA 5CJQL 1G7HB 1QSFD 1R5WA 1HSAB 1EJOH 2H1PH 4BQ6A 4RAHA 5L2KD 4JFYA 1WITA 1I1AB 5FHBH 3CK0H 3DXAB 2E7BA 1J1OH 3GI8H 4U1NA 4CADA 5DJYA 3GBNH 4YZFE 3LH2L 3CVHA 1U8LA 1KG0B 2JCCB 4X7SL 3W11C 4JDTL 3SDYL 3BW9B 4YR6A 1UM4H 3B6SB 5T1LB 4Z7UB 1A02N 4GBXD 1FVDB 4LSUH 3PWPB 3ZLQC 3WSQH 1S9VA 4EDXA 1UZ8B 4W70A 2PYED 4OLEA 3BE1L 4APQD 1MFDL 3RIFK 3UJTL 5FKPA 3EOAA 4I3RL 2E7LA 1WIPA 3SDAA 4ORGB 5EFIB 2V9TA 1MCFA 2YMXL 2CMRH 3QCTL 2CDGA 3Q6FA 2ZWLT 4PJ8B 1OB1A 5T5FL 1FG2A 2F5AH 2GJJA 3Q5OA 4KJPC 5D7IE 2EYRB 5T1MB 2Q3AA 5KN5A 4EZMA 3S8WA 4M7KL 3TBVB 2Q8BH 4NO3B 1GGCL 3RAJL 3CUPB 1RSFA 3GM0A 3NH7H 3GSWA 1UB5A 4XCNA 2VC2H 4PJAF 1NGQL 3IFLH 4RGOL 4NHCL 3BX7C 1KIRB 3F8UB 4NNYA 2CGRH 3F7YA 1HWGB 1KFAH 3NZHL 4LPWA 3ARDB 3QJFA 3T2QA 5EA0H 1VADB 4KQ3L 5TE7L 1JN6B 5HXMA 4TVSa 3FQNA 4BZ1H 1H5BC 3RL2B 1A0QH 3AS3A 1SJXA 4G43A 4HC1L 1EBAA 2ED9A 4PB0L 3RP1A 3WD5H 1BFVL 2CQVA 4M9PA 3QUXD 5ETUA 3HE7C 4I48A 2VITB 2JJWA 1MFBL 1T3FA 3O45B 3MRGA 1MNUH 1T0PB 3GJFH 1XF4B 4NCDA 2C3XA 5F21B 3FTGA 4PJXF 1FO0H 5HHPA 1QKZH 3JBG7 5E08L 5D72L 1FNGB 5C09D 2UWEE 4NC1C 4YDLC 5DJ8B 2LVEA 1MUJA 1I4FA 3HAEA 1A6ZB 1DVFA 1KB9K 2F53A 4U1SB 4QWWC 2VLRA 5HHOA 3QQ3B 2KUTA 4X80L 4WUUD 3H3PL 4QY8B 2Q7NA 5C9JB 3C5JB 4KDVA 3K4AA 2IALA 4RMWA 2WBJC 1FV1B 3BMWA 4H88L 5C0CE 2C3VB 2ITDA 1YQ2A 1V05A 4KZEL 1S7RB 5JLZB 1OSZB 1T6VN 2JB6B 1QLFA 1GGIH 1EEZA 5J4MA 2JIXA 3DYOA 3VXSE 3SE9H 5LJYH 2NY6C 5K9JL 3BP7A 1KLUA 3ARWA 4H5SA 3VMNA 1WAAA 1UCBL 1OPGL 5FEBA 1AQDA 3NIFE 3K2MC 4JANA 1C16B 1F6LL 2E7MA 5CHNA 1T03L 4NKMB 4JRYD 2CIIA 4POZC 1T89A 4MA3B 2QQLL 3DYPA 1IAIL 3WS3B 4Y4FC 2VLKE 4IDJH 2AGJL 4M7JL 5FGBC 1QLRB 4WFEE 4X98A 1D5IL 4HT1L 2ADFL 1G6VK 3TFKC 2LTQB 3PL6B 3LEYL 4PJCB 1V3LA 5I66A 1REIA 4KJYA 1CS6A 1L7IH 1YEKL 4OZGB 1NFIA 3C60D 2F19L 2FX9L 5BJTB 2JJSC 4AEEA 5L9DH 4OZIB 1LQSR 1T7WA 2G9HA 2ZUUA 3BSZL 4FFZH 5D7LE 4HLJA 5D2NA 5DUBB 3EYQD 3CDGA 4TTDD 1XFPA 1LO3H 1UGNA 5ANMA 1XGQA 3HUJF 3QHZH 4BZ2H 5DWUH 5C6TL 5EUOB 1I1YB 1UZ6E 1NFDA 2OYPA 4A6YA 1MHEA 1A7NL 4XPHH 4OZFA 2EIEA 4JM4L 2Z8SA 4PRBB 5CBEB 3GMLB 2BNRB 2R4SH 3REVB 2DJUA 1N8ZA 4XPBL 2JELL 3V6ZA 4N9GB 4UT7H 1RZFL 5D5MA 4ZMAT 1MCQA 4RRPA 4ZG1A 1DLFH 3VWKB 3BAEL 3H2WA 4U1HB 4LHUB 3PGFL 1GAFH 5HYQA 2C3GA 3GRWH 1QFPA 1TTGA 1RU9L 1YC7A 2Z92A 4I0CC 1PX4A 5I8KH 3WS6A 4S10A 3ZTJG 5AAWA 1SVCP 2QQKL 4ODHH 5EO9A 4J12A 4F3FA 1QYGL 4HWBL 3SDCA 3BHBB 4M7ZB 1JNHB 3AVEA 1A2YA 5F3BB 1E27A 5KOMC 1L0YA 1HH6A 1KACB 4OAWB 1U8QA 3HNSH 5E56A 3VXOA 3MCLH 3AY4A 3KJ4B 4DWHA 5D1QB 2AXGB 2WINA 5BZWB 2ICWI 5I1EH 1KPUA 2OK0H 1OW0A 3VXTB 2CRZA 1TPXC 2BX5A 3CXHJ 2J8UB 1XR9A 5I75B 4D9LL 4Q7DA 1WEJH 2X9YA 4OFYA 2ZUYA 2Q76B 4LNRB 3SKOA 4QHUA 4F8TA 4HWEH 4XMLH 3CFBB 3QEGH 3V0VA 1AR2A 4JPKL 3AB0B 4MQXC 5CIPB 2VNCA 4JRXD 4QRRE 4PBWD 3PWJB 3MLRH 3KPRE 5DJXA 5BV7B 1NGZA 3SE4A 1YPZA 3FCTB 1C5BH 1AGEA 4HPYH 1BGXH 4L8BA 1KJ2B 5HYEA 4MB4A 1RUMH 3O0RH 1TCRA 4BK5A 4OF7A 5E9DA 4YHLL 5H35B 4H26B 5I19H 1LWRA 1DZBA 4EI6B 2Y5EA 3VD5A 4ODWA 1JYWA 1U6AL 3QWRA 4YXHL 4GKSA 5DRZB 5DS8A 5JXED 1JZ3A 4BSVA 5JMOC 3OGCB 4Y4KD 5F7EL 1LO0L 4JFDA 5D7SH 1I9RL 1WCBB 3ARZA 4LPYA 2YRPA 2VXVH 4P2RD 1Z0NA 3MYJA 4PJGB 5C07A 4Y4HB 3IRPX 4WJ5B 3GHEH 3QNYB 4C83B 1K4DB 4Z8FH 3VFVB 1QFWM 3QUMH 4LFHG 3O3UN 1CXEA 1TVHA 3TBYA 1G7HA 2OXGA 2P46B 4KMLB 3NCEB 1HSAA 3DNKA 3T4YB 1AGBB 3FO0L 3HMXL 3T2NH 5I1GH 4J6RH 3DXAA 5FUCC 3V7AE 1QLEH 3MCG1 4JO1H 1FFRA 3JTSB 1JPGA 1E6OL 4DAGL 5IR1A 3BWUC 3KPSE 4JQIL 1KG0A 2JCCA 5FGSA 3BW9A 3J8F7 5TFSL 1UH2A 3B6SA 4KU1A 2AEQH 3IFNL 4Z7UA 1HI6B 5C0IB 5T1LA 1FVDA 3WFHB 3PWPA 4Y19D 2GJ6E 2VDLH 5FYKH 1BJ1H 1ORQB 4Q97A 3O2DH 5SWZE 3VXRD 5I76B 3FN3A 5KVMC 2FX8L 3I6KB 1RUPH 4FP8H 2BVEA 3SKJL 5FYKU 4QRSB 5EU5B 5HYSG 3CMOH 1NC4B 5FO9A 2E7CA 1IBGL 4JM2C 1H3PH 4R2GC 4W4OA 5EBLB 4ZAKD 1UACH 2DDQH 4DEPC 2EYRA 4JPVL 5T1MA 3QDHA 3B9KD 3RVVC 2X40A 1KT2B 5HYJD 1T7XA 1VSCA 3TBVA 2LABA 3GUTB 4NO3A 1P5UA 5KS9E 3CUPA 4KJQC 3KPMB 1EZVY 2HTKD 4OCXH 1T1XB 3D0VB 4XNXH 2R29L 4JVWA 2VZTA 1LDSA 3MFFA 1HE7A 4Z7QF 1VHPA 1KIRA 1HHJB 4XNZB 3DVGA 4P2OD 1I8KB 2LU7A 5ISZE 1H5BB 3ARDA 5EO1B 3U7WL 5IMLB 4FQJL 4X6DE 1JN6A 2P5WB 3S34H 3FN9A 3RL2A 1G9EA 5FK9B 1A6PA 1CGSL 1EPFA 4WHYG 3T0BA 3WIIL 4AIXA 5EZLB 4HQQH 5FDWB 5HVHC 3KYKL 2YR3A 2VITA 3UJIL 1O7VA 5EOCL 3VXUD 3OKNB 1IAOA 1IAMA 4QKXB 1XF4A 3Q1SL 5B39G 4YDLB 1HQ4B 4XXDB 2IAMC 1FNGA 5C8JA 4P99A 4U6HB 5C3TA 4JQXC 1A6ZA 3CSYB 4U1SA 1EO8L 2WBJB 2X5PA 3QQ3A 5F9OL 1NCAL 4N9OB 4PJ9D 4QY8A 3OAYH 3D85D 1NCBL 4LCWD 5FF6B 2EIZA 4LU5H 3RPIA 3C5JA 2E27H 1BLNB 4G7YL 4MNHB 1FV1A 2HFTA 3HI5H 3ETBF 3CFIC 1WFOA 4NQCD 5JLZA 3R1GH 5D1XC 3BQUB 5E8NB 1OSZA 2JB6A 2HT2D 4WU7B 2OSLB 2NY6B 1RFDL 3L3KB 3LEVL 1TJIH 2JJTA 1JUFB 2HJKA 2NXZD 3NOIA 2H2SD 4P4KD 1OTTC 4POYA 3WIFB 4YUEH 1J1PH 2OS7A 5CEZL 3NFNB 2IQAB 5C08B 4NKIH 4Y4FB 1J86A 3BYYA 1C16A 5IW6A 2BMKB 4NKMA 1Q72H 4JREC 1YEJH 4MA3A 3WS3A 5HGHB 4Q6IC 1QLRA 3C6LD 1X9QA 3OKYA 5TQ0L 1MH5A 1PG7X 5KTEL 4JO3H 3QDJE 3PL6A 3DRQB 4OZGA 4PV8A 1UA6L 3IDXH 2PYFA 4HKBA 1DBAH 1JRHH 4OZIA 5CJOH 1CLZL 3TO4A 2CKBH 1RZKC 8FABA 4M6NH 1Y18A 2B4CH 3GIZL 5GISH 3F5WB 5TE4L 3WLBB 2OQJB 2VLJD 4H25B 1HCFX 5IVXE 2YUXA 1L6ZA 1A7OL 1NMBH 1I1YA 1V8HA 2L0DA 3NAAH 1LK2B 4E41B 4OFVA 4RBPH 1X4ZA 3BWAB 3OJMB 3GMLA 4PRBA 2BNRA 3MRPB 5CBEA 3RVTC 4F7TB 4OZHF 2J12B 3CLFL 3REVA 2OLDA 2OJEA 1QBMH 1FYTA 3QDMD 4N9GA 3MFGB 4QHNB 4X5XB 4AG4H 1NGPL 25C8L 4RAUB 3VWKA 4YC2C 4U1HA 4D0BB 4LHUA 3U83A 3WLWD 4NRYB 1MQKH 2AABL 1EO7A 4M8QB 4N0UA 5TPWL 4LSPL 4Z7VB 3L1OL 4PRHD 1E4XL 4WO4D 4HIHB 3MUHL 3KHQA 5DFVD 3ULVH 5IBLD 1I75A 1AHWC 2C7UA 3BHBA 1JNHA 2YUVA 3BGMB 1EUTA 1TQBC 4OAWA 5F6HJ 4AY0A 3AMLA 2HT4D 1TPXB 5D1QA 5IM7A 2AXGA 1KB5A 1WZ1L 3CFCH 5BZWA 1OGAD 1IGTA 3QPXL 1OWRM 3VXTA 5EU6D 5F1NA 5I18H 3ABZA 5CGTA 3SGKC 3WKML 3IJHB 5DR5L 4MAUL 2D7MA 2H32H 4LNRA 4M9OA 4HBQA 3BIBX 5DVNA 1FFPB 3I2CH 3QYCA 5CP7B 1MHCB 2M8XA 3IKCA 4UTBH 1T2XA 4KRNA 1R6VA 3TV3H 5J11B 5EBWA 5HI5D 4JFOB 1VEPA 2MQ0A 4OCMC 3S36X 2DM7A 2FEEL 3JWDL 2ICES 1UYWL 4DTGL 3FCTA 1H8OA 2UZYB 4QOKB 2CRMA 3MV8B 3MBEB 1KJ2A 1XH3B 5CZVH 2HVKB 2YD6A 4JZJC 5H35A 4H26A 1I7UA 1OAKH 2OJZH 3QEQB 1NL0H 5DRZA 4CDHA 3F6LA 2YWYA 4J1UB 4NZJA 4NQED 1N0LA 3OGCA 3MUGB 4XPGH 2XG5A 3UTSB 3F65A 1WCBA 2D3VA 2EIDA 3S5LB 1YNLL 1DTUA 3BISA 4PJGA 2CK0L 4WJ5A 3QNYA 3CDCA 4C83A 4YQXL 5FFLA 3BRFA 3VFVA 2IBGA 3EFDH 4F2MA 4RSVA 1SBSL 2F5BL 4PJDE 3O9WA 2BSRB 4LPUA 1A7RH 1GGTA 2R69L 3MBXL 4OKVB 4ODSL 3T4YA 4TNWF 2OX5A 3BOVA 1Z5LB 4IS6B 3I9GH 3KXFE 1JHKL 1S7WB 5MI0B 1F6AB 2FHCA 4MNGB 5BVPL 5IJKA 5MEND 3SDAD 3JTSA 4XXCC 1JF1A 2ZP0T 2J2ZA 2X1PA 3TO2B 1FP5A 2J8HA 4P9HH 4KGJA 4QTIL 1MEXH 5C0IA 1HI6A 3WFHA 3QXAA 4WI6A 4HZAA 4J8RB 1ORQA 5I8CB 5F70A 5I76A 4GSDH 3TN0A 4Y16C 5FCUH 1JTOA 3I6KA 1Z2KA 3K81A 1IJ9A 4CBPA 1F4YH 5L8LB 4R2GB 1I3RA 4DEPB 4QRSA 5I1DB 5EU5A 2MCPH 2D0HA 3TLRA 1IZJA 5EBLA 4ODXB 2VDML 3FT3B 4O02H 2FWOA 3DECA 1KT2A 4ZTPH 5HY9B 4HX1A 3H9SD 2AI0L 2YXFA 5I15H 4P57B 5E2VL 1MY7A 3KPMA 3VA6A 2XKUA 4JVUA 1U8KB 4WV1C 1T1XA 5JW3L 2O93L 3D0VA 1M6OB 4QRPE 3TJEL 5GPRA 1INDH 5AWNH 5EO0B 4LQ1A 4EBQL 3HPJB 3MUY1 1HHJA 3MOAL 5JIPA 3LHPH 1H5BA 4MXQD 5EO1A 2AS5M 4KKNA 1PKOA 3OMZA 1WF5A 5D4QA 1Y6MR 2WW8A 1FZOA 3PHSA 4NWUH 2P5WA 5HDBF 1J05B 4WUKL 2QKIB 1X6LA 5HVHB 3UC0H 3QUZD 5D70H 1RIVL 3C6SA 3I02B 2IPTH 2YHGA 3SGEH 1DVFD 2F53D 3QXUA 5EZLA 3ZTNL 2VLRD 2X70A 5JDSA 1N64H 3IS0X 2IF7A 4GRLD 2OZ4L 2I24N 3TT3H 4RDQG 3QCUL 4M3JA 3OKNA 2IAMB 4K7PY 3EDEA 3EYFB 1D5ZB 2XN9E 3PHQB 4ZO7A 2WZPD 1NUDA 2J6EL 2F58H 2GUOB 1FBIL 1HQ4A 3S37L 3STBA 5KSBB 3DOSA 1ZT4A 4P2QB 4U6HA 2EE2A 3VXQB 5CLTA 2IBZX 2JIXD 3S6CA 2WBJA 1X3DA 4QHKJ 4S1DD 3QSKB 3U9PH 5FF6A 1OTUD 4PJ7E 4AIZB 5D1XB 4MNHA 4KFZC 4UDUB 4LSVH 4KGLA 4X9IA 5FYLH 2IANE 4GQ9H 3BQUA 5E8NA 2VWEE 2P49B 2AERT 4WU7A 2OSLA 5JHDA 3L3KA 4KKCD 4Z0XB 5DK2B 2FGWL 5D7JA 3ZT5A 1JUFA 2I60L 1Z9LA 2Y36H 3V8CA 2VKXA 3U4BH 5KVDL 3ARFC 4I2XB 5D7KD 2HA1A 3WIFA 3MRIB 1X6NA 3LKRA 2Z8WC 3NFNA 2IQAA 3NPSC 4JREB 1G0DA 3PP4L 4Z77B 2GHWB 3O6LL 5C0GB 3OTTA 4ZUTB 4Y1AB 3BN9C 1P7QB 2BMKA 1T2QL 3WXWH 3N9GL 4K7FB 3N06B 2KZ1B 1RUQL 4ODTL 4AH2B 1LEIA 4RWHA 5BXFA 3DRQA 2JLLA 2D9QB 1A6VH 4Q9QH 4XAKD 1C8PA 4U1KB 3MRLB 5DT1H 5CJXC 5T5NF 4PUBH 3SKMA 3F5WA 1XF5A 2P5EE 2K7PA 4OUUB 3WLBA 2OQJA 4K7PL 4YGVB 3TNMB 4H25A 1MWAL 4OLVH 2GSGB 4H0HB 4ODVL 1E4KC 4KY1H 4KHTL 3U1SH 4E41A 1LK2A 3O2WL 4MA1C 3OZ9H 3T0XA 3BWAA 1ZWIB 3MRPA 1E6JL 3C09C 2BY2A 3I75A 3RU8L 1EGJL 3EOBA 4YC2B 1R0AH 5LGJB 1HILB 2NY5H 5T1DH 4QHNA 1FFQA 4X5XA 3FQRB 4RAUA 3IDMB 2PETA 4L1DA 4ZOEA 5F7KC 4OQTL 2ZCHH 1DJSA 2ZKHL 3QDGD 3VD7A 2RHEA 4WGVB 3QNZB 3C5ZD 1JVKA 4LPTA 1KIUA 1AHWB 1WT5C 1UFUA 4ZQKB 4G8GE 4HIHA 2VR5A 2ZPKH 1WGOA 4PBXA 5JDJA 5HGAB 1A7QL 2FH6A 3K74B 3RY4A 2MKLC 2HJFB 4QO1A 3DHJA 1I1FA 1XF2B 1ZANL 1FIGL 2BJMH 3BGMA 5E2WL 4NQDE 1ORSB 1CE6A 1DE4B 4K2UL 4D9QE 3LB6D 3TVMC 1YJDC 4XWGH 4X8JB 1YPZF 4JY4B 1MJ8H 4LSSH 1CDGA 5IB4B 2VXTH 2X1WL 2J1KA 2UZIH 2DAVA 4HWUA 4M6MH 3IJHA 4JGJA 2R4RL 5E03A 5DHVB 1LVEA 4PTTB 4YFLF 1NMCC 1UM6H 5A3ID 1FFPA 4Q74A 1WLHA 1BX2B 1VEOA 4MB3A 5E9DD 5CP7A 1MHCA 2XQYK 4NOBA 5F89B 3RY6A 3NCMA 1FJ1B 2FBOJ 4JR9L 2Q1EA 3KG5A 5L6YL 1R3JB 3QWRD 4ZDHB 1GCFA 2YD5A 4KVCH 5CWSB 1MHHB 2EZ0D 4JFOA 4XC1L 4OBRA 3HE6D 3IAGC 1OOAA 3P9WB 3RBGA 4JFDD 4JZJB 3IJSB 5JOPE 1J18A 3MV8A 3MBEA 4R4FL 4ZNCD 1D6EB 5FKAB 3TYFB 1V3KA 2GTWB 2FDBP 4TNWK 4AJ0A 1UWGL 5EWIH 4AL8L 2OI9C 2W91A 1DANT 4OGXL 5EB9A 3PP3K 1CE1L 5DQ9B 2EDDA 3DIFB 4MA7L 2UWEB 4J1UA 1YEGL 3DV4A 4LCIH 3MUGA 3UZQA 3ESUF 1LEKB 3U7YL 5HHVH 1Q0XL 1ZGLB 3TYGL 3VFWB 1HNFA 3QCVL 5AYUH 3S5LA 4KHXL 4FTVE 1FE8L 1P2CB 4C58B 4AENB 1S9YB 1W72L 2QHRH 3D25B 3LDBC 1AXTH 2BSRA 3BIKA 3RJQB 5DUML 3CZFB 4LFHD 4G6ML 4P59L 3VXSB 3LKQB 2WUBL 4XVUC 1NEUA 4MD4B 3H9ZA 4ZXBC 4IS6A 1MFNA 4ZNEE 5BOPA 1S7WA 4D8PA 2OP4L 1QFUL 5ITBH 1GRWA 4KRMB 4L4TD 2V5SA 3TO2A 1MI5B 1QSZA 3IVKB 5KZCB 1NKRA 1U2HA 3V6BR 3GI9H 4Y16B 4HJ0D 3OGOE 2VLKB 2NNAB 4J8RA 4WFFD 2RGSA 5I8CA 3BP6B 4C56E 1KYOK 3VRJB 3V5HA 4Q9RL 4N8VG 1GZQB 5TDNB 5E8EB 4DKEH 4MD5A 5I1DA 4FQ2H 3UTOA 3QEUA 5IB5B 1BAFH 3WIHL 3L3IB 3KYAA 3SBWC 5D7LB 5LQBL 5M94B 2XI9A 5DJ6B 3ULUF 3AS2A 2IGFH 4XBPB 3FT3A 5FHBL 1UM5L 3WJJA 2YBRB 1RJYB 4M5YH 1J1OL 3RX8A 1QZ1A 1EH9A 4NNPH 1BBDL 3H6JA 1GOFA 4JJ5B 4LVHC 1CF8H 4WV1B 5HY9A 5CKAA 5GRYA 1CR9H 3ULUD 4P57A 3VXMD 5CJ8A 5HYSB 2GJZB 3W5MA 1U8KA 3GK8H 1M6OA 2GY5A 2IFGA 4YNYB 3NMEA 4IIQC 1EHAA 3EO1B 4MXVF 5EO0A 4PLOB 5F7YC 4JDZB 4WWKD 4S1RH 2VZUA 3O3DB 4EUPH 1FL6B 3T3PE 2AJVH 2A1WH 2A6IB 1J05A 4PP1D 2Y23A 4GKNB 1JF6A 1U93A 2QKIA 5DEGB 2VN4A 4R7DB 3I02A 4M7LH 3LKNA 1NJ9B 3LQAC 4JFEA 4KRPD 4POUB 4XC3L 3NH7L 2Q87A 1YEEL 2KH2B 3NFSH 1IM9A 3FZUC 3DSNA 3OJVC 3BD5A 5FYKE 3QIWD 4FFVC 2NY0B 1IILE 2BSSA 3EYFA 3N1MC 4NKQB 4PG2C 5DZLA 1KTLB 1FCCA 3PHQA 4JQXA 1QBAA 1I1CA 4XX1E 2GUOA 4FMFA 2CXGA 4G3YL 1DL7H 5KSBA 2VMFA 3FRPG 1KFAL 4P2QA 1F45A 2V9RA 1LE9B 1BJ1J 3BPLB 4FFYL 1WZKA 3C2AL 4BZ1L 2DOCA 1GL4B 4PBVC 4KK5C 4M8VA 3S35L 3DVFA 1MJ7L 1Q9LA 3PIQB 4AIZA 1IGFL 5C1MB 1DR9A 2D0FA 4LRNH 4UDUA 1RURH 3WD5L 3IDGB 4LIQH 2P43B 2PNDA 1DQDH 4FQIH 2BHYA 4W4NA 4XAWH 3DROA 3JV0A 4K8RH 3EIFA 1CFQB 2DM2A 5CCKH 1MCBA 4Z0XA 5DK2A 5DVLA 1AFVL 1NAML 5GRUL 3SOBH 3NPSB 4P5TC 4OZIF 2APWA 1IKFH 5L8JB 1MAMH 1F8TL 4FQLL 3MRIA 3O6KL 4QRRB 5GS2D 1GC1C 1OD9A 2WUCH 3KPRB 3TA3C 4Z77A 5C0GA 3TO4D 4ZUTA 2EXYD 3S97C 4Y1AA 4HSQA 4OGAC 4UT9L 4HUVB 1BVKB 3GSNB 1T04B 4LMQI 2IH3B 3T04D 1T83A 3NIGE 4MJ4A 1MJUH 5AZ2H 1NUNB 1Q9WB 1QVOB 4PJEA 2D4FA 4OTXH 4UI2A 3ZDXF 2UY7A 4U1KA 3MRLA 1J0ZA 5BMFL 1G6RL 4I77L 4HXAH 2C5DC 2FEDD 1P1ZB 3BZFA 4NZTL 1IC1A 3FQXA 1RZJL 1EZVX 3ILQC 4XCEB 1FYTD 3ZL4L 2HMID 4UT6L 5CIPH 3TNMA 4YGVA 2GSGA 4MA1B 3REWA 1A7PH 2F54D 1BM3L 1MJJB 1VFMA 3O4LB 3C09B 4ZD3H 4JKMA 1PD6A 2VSDA 1CDUA 4QXUL 3B2UC 4IDJL 3L9RA 5E2JA 1JZ5A 1ZGLM 3VRIB 1NLDH 1Q94B 1WTGT 4OJFL 5HI4D 4TUKH 1HILA 3IETB 1K4CB 5A2FA 2ZOLB 3FN0L 4NZDA 4JPWL 3T1WA 3KJ6L 3IDMA 2A77L 3KPSB 4J3VA 3WNNA 4PLJC 5IB2A 4XMPH 3RFZC 5F88A 4X4ME 4EJ1C 4P3DA 3TPKA 2QSCH 1TFHA 5KAQG 4U33A 1MF2H 2DKSA 2DQTH 5J1AB 5DD1L 3QNZA 1NGYB 2F8VA 2DQDH 4X99B 5FOJA 5SWZB 1AHWA 1JWMB 4ZQKA 2IG2L 3MXVH 1A1MA 3LPFA 1AJ7H 2HJFA 3D2UD 3VWJA 1XF2A 3HMXA 2YN3A 5D7IA 2EH7L 2UY6A 5JORB 1ORSA 3FFCE 2DYPB 1UEYA 4UT7L 5GSRB 3DX6A 1IEBB 3MA9L 5KS9B 1GGBL 3BEVB 1JWSB 2H9GA 3SGKA 2N7AA 4ZO8A 4X8JA 5EN2B 3L95A 1XCTB 4JY4A 3AAZA 1NSNL 3MLXH 4PJBE 3QIBA 5GS0L 1NMCB 5E0QA 3M17B 1IEHA 4Z6AT 4ALAL 2ZNWA 1A5FH 1AIFB 2B2XH 3U0TA 3QBTB 1BQSA 3QPQD 3O6FA 4N8PA 5ISZB 1BX2A 5F89A 2EH8H 2FB4L 1FNSH 2WANA 2MTPA 3QEHB 1FJ1A 5D1ZA 3KYMB 4YHKL 5F6IC 4BH8B 1CLYH 4X6DB 2Q6WB 3ULSB 1R3JA 1FHGA 4ZDHA 4W68A 3IXTB 4DQOH 1UJ3A 5CWSA 3HNSL 1HWHB 1T5WB 4MX7B 3OB8A 2QADD 1BP3B 4MJIE 1S7QB 5IEHB 2JK5A 1U8MB 3VI4E 3IJSA 2OI9B 4H1LH 1VB9A 1D6EA 5FKAA 2ADIB 2DB8A 4NUJB 4V1DB 5H2BB 3TYFA 1WBYB 3MSPA 5CGYD 4K3DH 4XPAH 5ADPL 3P77B 1XZ0B 2VDKH 4FQXC 4JFHE 3DIFA 2XPGB 3EUUA 2UWEA 1AE6L 4NWTL 3ULVE 4F9LC 5DK3A 3O9WD 4XMLL 4QF1B 2VIRB 1LEKA 5TDPB 3RL1B 2GEEA 5ACMA 4XCYA 1ZGLA 2W9DH 4M48H 4ZSOE 3VFWA 2R0ZH 5FO8B 4GRWF 5IROA 2CDEB 2DQUL 1N4XL 3L3DA 5C0CA 4X8XA 3PNWB 4HKJB 4U1GC 3I6LD 1P2CA 4HKZA 3D87B 2XZQL 1ETZB 1ULVA 4AENA 1S9YA 1RUML 3D25A 4ZXBB 3OAZH 1ZLUH 1YY9D 3CX2A 4K07A 1BJMA 3WHXB 3VXSA 4NBXB 5EBMB 3TN0D 4MD4A 4JPIA 3MRRB 4RIRB 3SDDC 2MSPA 4G9FB 4IOFC 4HUXA 4M62H 1F42A 5D7SL 4ZUVB 4NGHL 5HHNB 2BY0A 3IVKA 4H20L 4CN6A 4Y16A 3RZCA 1CGWA 2VLKA 2NNAA 4L8CB 3ESVF 3L5JA 4GMSL 2DQJH 3RHWF 2VAAB 3VRJA 1Y0LB 1GZQA 3QDJB 5TDNA 4YIQB 5KSAA 5DQJB 4B0MM 3HNVL 2NTSP 5IB5A 2PXYA 3L3IA 4K94H 5ERWB 4KROD 5D7LA 5C0EB 1QNZL 1F4XH 1I85A 3T2NL 3EAKA 2BNUB 2B7DT 3MV11 2FO4B 1EAJA 2YBRA 4J6RL 1RJYA 4GMTH 1QLEL 4JO1L 4WV1A 4JJ5A 1A22B 5C6PB 4BUGA 1J1XH 2HKFL 5IVXB 4MS8C 4M00A 2P5WD 4IIQB 5E00B 3D18B 5BRZE 2GJZA 3Q5TA 2X4OB 1LHZA 2AEQL 1OQXA 2YD2A 3X12B 1SMOA 1PKQE 3EO1A 1CT8A 1YECH 3WKNA 2VB5A 2FX7L 3O2DL 5IB3A 3CFEB 1BHGA 1LNUB 1RUPL 2CJUL 3HS0B 3O3DA 4OCNC 4YDKH 3GGWB 4HF5H 4LEXH 3PQYE 4CU7A 1FL6A 3QQ9D 1SY6L 2VJXA 5HPMB 3EO0B 4YX2H 1KTRL 2X4NB 2A6IA 1UACL 2DDQL 4GKNA 2NYYD 4JKPL 4UIMB 4R7DA 4U1JA 2APVA 1CU4L 1CI5A 1FVEB 4OCXL 4M7LT 5C92A 2I07B 3GZKA 2K1MA 3BZ4B 3G6DL 2HT3C 5F9WC 4MMZC 1L0XA 5ALCL 4KKAC 4YAQA 5E2UL 1GHFH 1KTLA 4OCWL 3D69A 2EDLA 4O5LH 5KJRL 3B2VH 3MLVH 1TLKA 1TQCC 3OL2A 3BQUD 5LAXA 5CD3B 3WDJA 3VH8B 5JHDD 3LCYA 5EC2B 1GPOL 1LE9A 5GHWH 5D7JD 3S3PA 1U8PB 2IQ9H 4UBDC 3V4PH 1VPOH 3NA9H 4DGVH 4LOUD 4NQVB 4GXVL 4Z7OE 3HC0A 4HFUH 2ARJB 3PIQA 4BJLA 1F4HA 1CVSC 4DK6A 4K71C 4MQ7A 4PFEA 3VA2C 4HQQL 4I13B 4TQEH 3HZYB 1KGCD 3QULA 5I0ZA 3RGVC 3V4VH 3TWCL 4HS3B 4P5TB 3M8OL 1H9VA 1YUHB 1CFQA 2FECL 2PKDA 4WHTA 4JRWA 3TA3B 3MRBB 3HA0A 3ARED 7FABL 4KI5E 4YDVA 5KANG 1R3IH 3SDXE 1T5XA 5F3HB 5SWSE 3S37X 3UBXI 4QRRA 5GGSY 4RGNE 3KPRA 1VGEH 2EEAA 3DGGA 5EUKB 5EG6C 5T3ZD 4RNRB 4KKLC 1GGUA 5C0FB 1MVUB 1J5OL 3K1KC 4HUVA 3K4DA 5FM5O 5HD8C 1BVKA 1T04A 3HI5L 4ZUWA 5EBGA 2EE3A 2XV6B 2IH3A 3NACL 4N0FB 4OLUH 3MODL 1IC7L 3UJJL 1F00I 1QVOA 1Q9WA 1KPRB 3E8UL 4LSRH 3ZZ1A 5CJXA 2LAAA 4RX4A 1TJIL 4M43L 2H45A 5GRJH 5L7XH 5JHLH 2BRRH 1I3GH 1K8DB 3HC3L 1Q8MA 3TT1H 3HC4H 3Q6GH 4YXKH 1KJ3H 2NZIA 3NIDF 3P0YH 4RISL 2UZXB 4XCEA 1LD9A 5C2UB 1RJLB 5D6DC 4IOSD 4JHWH 1MJJA 4ELKB 4BK4A 3MJ9H 4YXLH 3VXNB 5T3XH 2C1OA 4PJDB 4QXGH 5FYLE 1DQJA 5MP6L 1RUAL 1KJMB 1Q94A 1ZXQA 1ZHBA 5BS0D 5K9OB 2FHFA 3TEUA 3KXFB 4DKDC 1SM3H 2DQCH 4BYHA 1Z6JT 3IETA 1PZ5B 2F8XC 2ZOLA 4J4PD 2X41A 3KPSA 2R0KH 1T4KB 1A6TA 4AQ1B 4QGYA 2R2HB 3OKKB 1AKJA 4LLMB 2D7OA 2EDQA 1JL8A 2DM3A 1IAII 1KCVL 2GJ6A 1BVLB 5J1AA 1NGYA 4K7PX 4X99A 3KNBB 5SWZA 3UPRB 5CZXC 2UUDH 3P4MB 1JWMA 3QWOB 1A1NB 5IMMB 4BZYA 1OCWH 3ZSSA 1FDLL 5HGBA 3MLZH 2FNBA 1CFNA 3BGFC 5GS3A 1QSEE 1DQTA 5JORA 2DYPA 4U4BA 5GSRA 4N90E 5DXWA 1UXSB 4MCYB 2VABB 1IEBA 2ATPA 5KS9A 2CLVB 4NQSB 1E4WL 3O6ML 2AJZB 5EN2A 4PD4K 4LHQB 5JW4R 3PG2A 4JG1H 1MQKL 3HB3D 4QRPB 1LEGB 2COQA 3F7QA 5MEOA 1EDQA 3M17A 3R0MA 1G1YA 3CLEH 5F6IB 5GGTA 5ID1B 3MBED 5DLMH 1P4LB 2AQ1A 5JIHA 4QRTB 5ISZA 1VESA 4ZOAA 3PE9A 3QQNA 1J0HA 6FABL 2AEPL 3QEHA 4BH8A 4ERSH 4X5LA 3H42H 4L4VD 1R3HB 4X6DA 4P2YA 4F57L 1F3RB 2QSVA 3AUVA 4P9ML 2XZZA 1T5WA 2YA1A 1BFSA 1KEMH 1AXSB 4O58L 1M1SA 4ZFFB 4MNQE 1LILA 5DD0H 1AQKL 2HH0H 5IEHA 4GG6E 3CVHL 3E6HB 1V7NH 4UILH 35C8H 2ADIA 3W0WD 4F58L 4NUJA 5H2BA 2D31B 5I18L 5JXAL 3W81A 4FQXB 2BHZA 4XVTL 4WDIB 4AEFA 2XN9B 4ZTOL 5BW7C 4Z0BH 1TMCB 3P77A 3GBLA 1XZ0A 2VH5L 3GBMH 2XPGA 4TSAL 3VFMA 3RTQA 2YD3A 3DRTB 4QF1A 2Y07H 2VIRA 3U36B 5HHMD 3MYZA 4I8DA 3RL1A 1JPTH 2ID5A 3FRUB 4EI5D 4U1GB 2BSED 3RHWK 1QD0A 1A8JH 2CR6A 4OF8A 3MLTB 2CDEA 2DLGA 2OTWB 1C12A 3PNWA 4HKJA 1AI1L 3D3VE 1QSFE 3STLB 3FOMB 1ETZA 3S98A 4R9HA 5CZVL 4OCSL 1JGLH 3TBSB 4IRZH 4P5KB 5EBMA 3SDDB 1OAKL 2CLZB 1JNNH 4NC2B 5TQ2H 2ZUQC 4P46C 3RI5K 2VOTA 3RWIA 1FZMB 2F8OA 1N2RB 4RIRA 4LVNC 4M6OH 4MYWB 1U3HC 3DETD 4QGTA 4I3SH 4ZUVA 3L3GB 5IFHL 5HHNA 2DIBA 5IBTL 3Q3GB 3GNMH 4P2CG 4IRJA 3BIAX 3LZFH 3RDTC 2BOCA 4JLRB 5DD6B 3P4LA 5L2JB 2NY4D 4L8CA 1YEIL 1HQRB 3A6OA 4MSWB 4DCQB 5ACZB 2Y06L 1Y0LA 3EFDL 5FM5M 5LWYL 3O3BB 3QDJA 4MS8D 4YIQA 4OFIA 3DWTA 1YN7B 3EHBC 5DQJA 2R1YB 4BFBD 5AZEL 4DKFL 1A7RL 3P9LB 3SE3C 1M05B 1FO0B 2PTTB 3VD4A 4NYLB 4IMLB 4MQTB 5E99L 3WFBL 2FO4A 1MRFH 2XQBL 3QUYD 4XWOC 2P5EB 2GK2A 3IU3B 4N8VB 1CDIA 1O0VA 5I9QC 1Z0MA 5IVXA 2WBKA 3JSSA 3EJJX 1F90H 2CRIA 4MA8L 2HWZH 5E00A 4XTRC 3T4AB 2X4OA 2Y5TB 1MCOH 4HPOL 1ES0B 1YN6B 4PJAE 1H0DB 4R4BB 5EORL 4JFED 5EIVA 1LNUA 2E6JA 1IM9D 4UNTA 1HKLL 1JYVA 3HS0A 3BKJL 3GGWA 1T22B 3QG6B 4F33B 2X7LB 1KXTB 5E6IA 2FH8A 2YD8A 3GMNB 5HPMA 3EO0A 4M1DH 5DEZA 4EEEA 1PLGL 3CPLB 1CXKA 2AV1A 1KSRA 1N7MH 1CDJA 2NY7L 1VENA 1N5AB 4G6AC 4YHYB 3CVIH 4U6VL 3BH8B 5F9WB 1FVEA 1Q9OB 1DQMH 4PG2A 2I07A 3C5SB 3V5KB 3KLHD 4G8GB 2ZJSL 2YOCA 1LO2L 2ZG1A 3BZ4A 1TQCB 5C09E 4NT6A 4U1LA 4F80A 4RWYL 3BO8B 4PJXE 2HN7B 1EGJA 3P4OB 5E6YA 1OAZH 3ARSA 5IV2B 4X7TB 2V2TA 4WUUE 4K3JH 1L7TH 5GRVK 3FQWA 1FC1A 4NQDB 3VH8A 1F58L 5EC2A 2ZCLL 2OR9L 1U8PA 2D7QA 3WFDH 4NWUL 3THMH 4UB0H 3FOLB 4NQVA 4FQHA 3UC0L 1PAMA 3MLWL 2C4XA 3A6CH 2ARJA 2IPTL 4Z7WB 3EDJA 3CZJA 4HWNA 5EOTB 5IESH 1JHTB 2YC1B 4PGEB 3RPKA 3HZYA 2V9QA 3PWUB 1N64L 4IJ3C 1S7TB 4HS3A 5KVGL 2W07A 3WO3B 3BESR 3RA7H 3V0AC 1YUHA 1K3ZA 4LLVB 3DSFL 3MZTA 1TETL 4A6YL 4PJEF 3CCHB 5DTFB 4RAVB 1XGRA 1ZS8B 1T6WA 4QXTB 3MRBA 2N56A 3HG1A 2X4QB 3QIUD 4PJFF 1G9NL 4PJCE 4RMVA 4MVBD 4MQSB 2H6PB 2NLJB 3ZTJH 3E6FB 5EUKA 4RNRA 4FZEL 3S3JA 5C0FA 1MVUA 4HMDA 3S35X 1B3JA 1D3CA 1B0GB 5GGUB 1BWMA 1Q1JL 1I9JL 4GQ9L 1OL0A 3UTTA 2C3WA 4P23B 5D2LB 3VGAC 4Z5RB 2YKLH 1KPRA 1KN2L 3G04A 3L7EB 2HLFC 3GSOB 5DHVH 2Z9TA 5EUOE 3DLQR 3ZKSD 2VISB 3GMOB 2FATL 1HZHL 3ARBB 3FAXA 3WUZA 3SCMC 4YZFF 5CEXB 1J0YA 4ZFOA 2HFGL 3JWDC 4WW2C 2ZSVB 4XNUH 1OAUL 1HIML 1RJLA 1BFTA 1UEMA 3EJYD 3HUJE 4PGZA 4ELKA 4HUMB 1NCWL 3DBXB 4WFHD 1CFSB 4PJDA 2NXYC 1PZUB 5E95B 1IARB 3U46B 1D6VL 1SEQH 1IC4L 4HULB 4LIQE 3V95A 3T77B 4UINH 2HG5A 3DURA 4LARH 1KJMA 1J7VR 3TBWB 2NZ9D 4HG4K 5K9OA 3VGFA 3KXFA 5D7IF 5AYQA 4GKZB 4OD3L 3ARPA 1UWXK 3ZE0F 4C59B 1PSKL 5CINH 5FA4B 2Q8AH 3VWJD 2BDNH 2R2HA 3OKKA 2C26A 1WV7T 4OCRL 1OAXL 1J0KA 5GIRA 4LAQL 5L8KB 2CUHA 4O2EB 1FGNH 1XEDA 3DUSB 1BVLA 3CFDA 2XTJD 2AK4A 3KNBA 3CJJA 4HMEA 4FABH 3P4MA 3QWOA 5IMMA 2ADGB 4ZUSB 3QIBD 2C1PA 5A2IH 4CVZB 2J8UE 3BGFB 5IP4A 2V7HB 5C2BL 5DJCB 3A0OA 4R8WL 1SJEB 2X09A 2X9WA 1FRGL 3IXAB 4M93C 2DICA 3O6FD 4NN7C 1UXSA 4MCYA 5T1DL 5D1ZD 1DUZB 1ZTXL 4HKXB 2CLVA 4NQSA 3MRNB 2GT9B 1B2WH 2AJZA 4LASH 4NFDA 5FECB 4QRPA 1LEGA 3AS1A 3GJEA 4YDIH 4L8SA 4GW1B 4Y5XC 2AK1L 5IMKA 5SV4A 1FFNB 5FUOL 3QUMB 5ID1A 1P4LA 1YNKH 3A67H 3G5ZB 4OZ4B 3MRFA 4G8FB 4QRTA 4MGXA 4GAJH 4JRXE 2PN5A 4MHHG 2R0WH 5LCVL 4JFZL 4WRLA 3LKOB 1R3HA 4RFOH 1CWVA 1I8LC 3QI9A 2BJML 3KPQA 1SMAA 1R5IB 2AV7B 1AGDB 3G5XB 1AXSA 2CO6B 4XPFH 4ZFFA 4QHLA 1YY8A 2Z93B 2GAZB 5E5MB 5J0BA 2EECA 5I30L 1E4XI 1YEFH 5I1IL 3E6HA 4LSSL 4NM4H 4CKVX 4LPVA 2D31A 5EU4B 3M1BA 4FQXA 4BSWB 4WDIA 5C0CD 2DTML 2XN9A 2XZCH 3BT2H 2DD8H 3AS0A 2X6MA 4DZ8B 3ULUH 1UT9A 2OXHA 3IB4A 3DHMA 1X5ZA 1ZAGA 3KLAB 4OGYL 3MGOB 4PJHB 3NIFF 5L0QC 4WWID 3FO1B 4NM8H 4B7IA 1FZKB 4ACPA 3WDIA 4CMHC 3F7RA 3HR5A 5EPMB 4PJ7A 3HTLX 3RJDA 4C4KT 3BDYL 1JMZA 1SYVB 1NC2B 1RHHB 3MLTA 2OTWA 3P9MB 4S2SB 1OP3K 3TNNB 4P4RB 4NP4H 1ZLSL 2IANA 3KPOA 3U30C 2ATKB 3STLA 7CGTA 4I5BB 3MRJA 2EDEA 1LMKA 1QRND 3QA3B 2ZUQB 3RZCD 3ES6A 4P46B 5DK0B 3VG0H 2P8LB 2XG4A 4TTGA 3TBSA 5EWIL 2QJDA 4P5KA 3OWEA 4LVNB 5F93C 3SDDA 1URLA 2CLZA 4BKLB 2ESVD 1U3HB 2YRLA 4O4YH 5IT2H 1FZMA 1KCUL 5KSAD 1N2RA 1RVFL 2EXWD 4LCIL 5F44A 1B4JH 3V6OE 3JVGA 4AEHH 1IC5H 2FEEI 4Y19E 1RJZB 2PXYD 4UDTB 3EOYG 5K59E 4B53A 3VXRE 1VEMA 3MXWL 3Q3GA 2XA3A 1IGIL 2XZAH 4UUJA 4JLRA 3L5WB 1ZHLB 5L2JA 5C0RL 4NZRH 4I0PC 1HQRA 4WEMB 4DCQA 5ACZA 1G7LB 4IHOB 2VDQL 1VA9A 3GJFA 1YN7A 1C5CL 3D1MC 2R1YA 2YPVL 3P9LA 4EKXA 1M05A 3LRSB 1FO0A 2PTTA 3WL9B 4EIGB 2B1AH 4Y2DD 1G7MB 4NYLA 4IMLA 5IWLA 2YD4A 2XICA 1A1OB 2P5EA 4O00A 4N8VA 5ITFB 4A2LA 5IF0B 3ZKND 5ITBL 1QFWL 2CSPA 4E5XA 4ZYKB