2CDGA

Structure and binding kinetics of three different human cd1d-alpha- galactosylceramide-specific t cell receptors (tcr 5b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCAPFDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structrue and Binding Kinetics of Three Different Human Cd1D-Alpha-Galactosylceramide-Specific T Cell Receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
molecule keywords TCR 5E
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2006-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdgA02
2UWEE 5H2BB 4P2RA 2BVQA 5E4IA 2H2SC 1EEQA 2NLJB 2JJTC 3GMNB 1NFDF 5F72S 1RUAH 4PJCE 4PRDB 5IB4A 4OF6A 3WKML 4WTZG 5ADPL 1AH1A 1KXTB 2NXYC 5IOPA 2NTFA 4R3SB 3P9LA 4U7MA 4XP6L 1NFIB 1XF5A 2X7LB 2VLKD 4WI2A 4X6BA 2B8OT 1L7TH 4ONFH 5JQ6L 1OAXL 5L9DH 1UCTA 4IRSA 2JK5A 3KYKL 3FO1B 3WLBA 3OKKA 1YEJH 3WJLC 3MNWB 5I8KL 1A7NL 1JGLL 2VN4A 3S34H 4CKVX 4Y4FC 4UT9L 4RMSA 5TDPA 4ONGH 3MJGX 4P2QB 1RJLA 3RWCA 3TCXA 4RFOH 5HHVL 3OB0K 4M9OA 5DDHA 5E8NB 1IRAY 4G9FA 1FIGH 3M1BA 2X1PA 3P4NB 3QXDB 1ZT1B 5MERA 4WW2B 3KYMB 1AGBA 4M7JL 3QIUC 3QRGL 1ERNA 2DMCA 3R0NA 1JTOA 1J8HB 3BKCL 5H2BA 1BMGA 2UWEF 2EDDA 1UACL 1SY6L 3TA3B 5HSFA 3QFJE 1RUMH 4KDVA 3NCMA 4LF3A 3TO4A 4Q6IC 4GXVL 5I76A 2A9ML 2XTLA 1XGTA 3ARDC 3UROR 2MQ3A 5CLWA 2GCYB 5SWZB 2EH8H 3DGGA 3QA3B 5C0AB 3LMJL 2WP3T 3QEQA 4WUUA 3QRFM 4PJXE 4ORGB 3T3PE 4LBEA 3QFJD 1XGPA 1YC7A 3WYRA 1U3HA 1ZSDB 4KHTL 2IPKA 2WW8A 5EC2B 4EDXA 1OM3H 4Y19E 1KELL 4Z78B 3QQ4B 2FECL 5I1EH 3IAGC 5AYUH 2YOCA 3MV8B 1UWXK 3DI2B 4KH2A 1RZFH 3L3HA 3SE4A 4OAWA 1SJEA 1J0KA 1JGEA 1IAIM 2FHFA 3L5XH 5L6YL 5LCVL 3WL9A 4OQTL 1JWMB 2X4PA 4BELD 2FX9H 2R69H 2VXTH 1Z9LA 3QG6B 1MHHA 1Z2KA 5FGSA 1MQ8A 5HYFA 2R23B 1Z5LB 4X6FA 4OLXL 3CSGA 3TNMA 1MCRA 2JTDA 4OF5A 1DBMH 1IAIH 5IG7A 5CWSA 2AJVL 1JN6A 4WTZA 3V5HB 4J6RL 4L8SA 5LBSH 3JWOL 2IEPA 2VDKH 3SGKA 5TF0A 1JGDA 5DVOA 4MA8H 1AI1H 4OF7A 3CFDB 3OJDA 2NY5H 2ZUYA 1F11B 1T2QH 3T0BA 2WLYA 4QRRB 3IXTA 1N0LA 4PRID 3OGCA 3FHAA 4JRWA 4WFED 3WEXB 5DD5H 4Y4FA 1ZE3C 4LHUD 4OGYH 1AGEA 1FZMB 5J3HC 4YFEA 1L4IA 3O2DA 4Z7UE 2WAHA 4ZFFB 4L8DB 4BZ1L 3DOSA 3RGVB 1LO3L 5IQ9A 3Q1SH 2CLRB 3TA3A 1A3QA 5JW4M 4OBRA 3STLA 3DUUB 4OV5B 3V0VB 3SO3C 4Z77A 2HFFA 4OT1H 1T1YB 3RI5F 1GAFL 1ZWIA 4H1LB 5MEQB 5HGAA 2EE9A 4YHMH 3MRNA 2RR3A 3V4UL 4WFFE 5C9JA 2XTJC 3DVFA 4RMTA 5EOTB 3WSQH 4HIIB 4K3JH 3RWHA 3QIWA 2BVEA 1MCIA 3V5HA 1SEBA 2L7UA 3O6KH 1E28A 2D0HA 1NH6A 5D1XD 1FFQA 1I1AB 4NKIH 3TN0B 1OP5K 1E4XH 1CLZL 1NL0H 1FBIH 2XWJA 5E9DB 4LVNB 4MCZA 3B9KB 3THML 5JXED 4LCWE 3QHTC 1E6OL 7CGTA 4HCRA 1B0RB 3TBSA 5C6TL 4YHKL 4BSWB 2Q8AH 3CGTA 1EA9C 1VFBB 4TVSa 2QL1A 4L9LC 4QRUA 1XF2B 1ZHLA 1I1AC 4MD5B 5D1XC 4U1IA 1OPGH 1KUMA 1JGVH 2BOBB 4PV8A 2R23A 1T5WA 1LILA 3OQ3B 5T3XE 1IAIL 4HQQL 1E4WL 4Y4KD 4ELMB 1GAFH 4JQVC 4K7PH 4OLWL 1IQWH 2AKRB 4D9LH 3L95A 4QXGL 4RX4D 3AM8A 4Z7VE 5EZOH 3HZMB 1HKFA 3VGAB 1LNUA 1MFBH 2LVEA 4FTVE 2F5BL 3SDAB 3U7WL 3WFEL 3S37L 3T0VA 1VSCA 1F00I 3GSVB 4ONHA 1FDLH 2X09A 4BFEA 1JVKA 5D1XB 3FONB 4XBEH 1V7NL 2YMXH 3W0WB 3A67H 4XCNB 1C5DA 2R1YA 1BGXH 3RIFF 3ZTNL 2V2XA 1S7RA 5D1QC 4HIHA 1Y0LA 5DUBA 4FTVD 2WUBL 4YBLB 1UM6L 5LGHH 1DFBL 2O93L 3OZ9L 4HEPG 4FXLA 1U3ZA 1U8PB 3R06B 1RZ8B 1UENA 2DQHL 3RI5K 4HMDA 1JGUH 1VFUA 3QUYB 2PTVA 1KB5B 5F9AC 3ARFA 4YHML 5HYSA 2VZ1A 4LF3B 3NIGE 1BLNB 3TO4B 5E56A 3KLSA 5DMKA 5HHPB 3VFWB 3HMXA 3L3OA 3GMPA 3QUXD 2QSVA 1D7FA 5IIEA 4D9QD 4OCSL 1UJ3C 2FJFA 3EFDL 3IVKB 1G7IB 4M6OL 3D69B 5DC4B 5EFIB 4OZFA 2C3GA 1S3KH 2YXFA 3GMQB 3SCMA 3PP4H 4NSKA 3V2AR 1T2JA 2N1KA 1OHQA 1QRKA 1YNLL 3RDTB 3FOMB 2HTKD 5GJSL 1MFAH 2QQKH 1NCUA 4PRPE 4G9DB 2X1OA 5H94A 4LARH 1GC1C 2ZPKL 1RVFL 1FN4A 1MFCL 4U1SB 3SKJL 5E8PB 1FCGA 1C5CH 3QAZB 3T04D 4UIKL 3HI1A 2IWGA 2NTFB 4BQBA 4JDVB 4IHOA 5IW6B 5EU4A 4UMGA 3AREA 4C57C 2NPLX 4WHTB 1G7MA 2J8UA 1DBAL 4QRTA 1I1AA 3AAZA 3F7RA 3SGEI 5DRXB 5D70L 3RWDB 5DMKB 3BVNB 2CJUH 1I7TB 5KZCB 3EOBA 5TH2B 2X4QB 5ESAA 4LVHC 3FT4B 1FGVL 2AV1A 3S4SG 3IU4L 4FQQB 1LO5A 5DC9B 1FL6A 2DOCA 4Z18A 2AS5M 1MCFA 3UMTA 4H88H 1ZLSL 3N9GH 4CUCA 4OZFH 4EKXA 5J1AB 1J05A 1F8TL 3UTQB 5I8EB 3LKSA 3MJ8A 4PV9A 4DQOH 2IPUK 3DPBA 1GCFA 4OGZA 1H8OA 1NMBL 3IDIB 4LOUC 1EAJA 4LNRA 1N5AB 2XV6B 1TQBB 1YEJL 1N7ML 4G8EB 4PTUB 1K5NB 5ID0A 2LTQB 4QNPF 1H8NA 4F15C 1ZKAA 3SGJA 5T1MB 5I73C 1RJZB 3SE3C 4GS7C 1ORQB 2GYSA 3BMVA 2ZJSH 1G1CA 2EC9T 2J8UE 3LEVL 2XTJB 1JNHB 4XCNA 4GG8B 4NZUH 4R90L 4P46D 5EUOE 3DYPA 2H2SD 4PRHA 4PJ8D 5CUSL 3IDXH 5T1LA 3REVA 3DBXB 1MCSA 5I30L 3IDJA 3BPCA 1RURL 4JZNB 4NNPH 4YIQA 3R06A 1FL5B 2MCPH 4LARL 5ACZB 4LSDA 4L29A 3SCMC 3E0GA 2OR7A 5B8CC 3PXHA 1S9XB 4FQCL 4J1UA 5JPMA 4U1NA 3BYYA 4DCQA 4JQIL 5C0RH 3UZVB 4FQXD 4P59H 3QIBA 5DMIL 3GSQA 3MGOA 3O4OB 2UUDH 4JFDD 2BNQE 5ANMA 1X5IA 1V3LA 2A6DA 2GJ6E 5F1SA 5DMGC 2AGJL 3NIFE 5HHME 2YPLA 4JRXE 3HZMA 2W38A 2P5WE 1A4KA 2P5EE 1A64A 2QQNH 1OAUL 5DEFB 1KTRL 4M5YL 3R0MA 4NJAL 2CKBB 1OF2B 5EUOF 5IJVB 5MHSE 3QO1A 4IRSC 3O4OC 3TBVB 1MRDH 5J0BA 5C07D 1ZLVH 5F88B 3SJVA 2IPTL 1AO7E 4WEUD 4ZPVB 3MXWH 4YFDB 4O9HL 3H42L 5F93C 1A7OH 3KPQB 5M95B 3VA6A 4ZTOH 3H7BA 2IH1A 3D25B 4OZGA 3VFNA 5LCVH 2D9QB 3VXME 1EEUA 3ZE1F 1J9CT 5DTFA 3MV9B 4KTDH 3PJSB 1CFVL 3RBGA 1EAPA 4A2LA 1CD8A 3QIBB 3UBXI 3CK0L 1SHMA 1RIHL 1A5FL 4I3GA 2GT9A 3TIDA 4ZTPH 3T0DA 3AU1B 1WC7A 3PE9A 1F58L 3NIFF 1HWHB 5E94B 3CH8A 2WBJC 1DUYA 2P4AB 3JV4B 5CS7A 2PKDA 4YHPA 3QUZB 1PJ9A 3VMPA 4J8RB 5IT2L 5I1KH 3ULVL 3WDHA 4IRZH 2E9WA 5IIEB 2Q3ZA 1U6AL 3DBXA 4PJ5A 5FYKU 3SOBL 4NJAH 2DIAA 4M1DL 4U7SA 1EO8L 4MYWB 3S3JA 1JGVL 5TDOB 1BBJB 1EHNA 2R4RH 1YPZB 1A1MA 1DJSA 4KDTC 1X4YA 4HG4J 3EYUL 1UXSA 3VE0B 2FJHA 1B6UA 4MJIE 5GSVB 1JF1A 1X4XA 5ISZD 4QXGH 1T89C 2VLKA 3CFIC 4KVCL 4CU7A 5HVHC 1XGPB 2N4IA 3H3BC 2GCYA 2OMBA 3B3IB 3V5KB 3LY6A 4OF0A 3KJ4C 4BH8A 1TZIA 4MJ4A 3T3ME 2N7AA 4R4BB 4GBXC 5FM5M 1SJXA 3O3DB 4XBGA 1I1AD 4JM2A 5GGQL 2EDNA 2OCFD 1SJEB 3CUPB 1CFQA 3LKPA 1F58H 4EDXB 5K9QI 2D7PA 4YDKH 4TYUA 2YZ8A 4JFEA 5CP7B 1MOEA 4UQ2A 1N26A 3RRQA 5IM7A 5FA4A 4N1EA 4Z7UA 2VITB 3BKYL 2HG5B 4KPHL 2A77L 2JJSC 2PYED 3CVHH 5F7NC 2IPTH 1JK8B 4QT5A 4WU7B 3L7FB 4HIJB 5HPMB 1FZJA 2BNQB 5HBBA 2LVCA 4F9LA 3MGOB 3O3EB 5F3BB 3QWOA 4GT7A 2A1WL 4FOMA 3HTLX 4XPFL 2O61A 1YEKH 1X5LA 2APXA 1O0VA 3TVMA 2ZUVA 5I18L 1LDPL 3ES6A 3ZMRA 5L7XL 4NQEA 2FD6L 5FYJE 4G8GD 4P46C 1A22B 3E1F1 2DIBA 2VLKE 2VISB 5DEZA 4PRNB 5I75C 3AU1A 4XPTH 5C3LD 1KJ2H 1PZ5B 3GMOB 2C3HA 3HI6H 4JFYB 2X4UB 1UM6H 5D1QD 3L3GA 4JVPA 1AQKH 1U8LB 4Q2ZB 3LHPL 4OCMC 1N5YH 1QLFB 3CMGA 5LGJA 2HVKB 4JFEB 3RUGF 4M7LT 4K7FA 2E7MA 3BH9B 3BPOC 3DMMA 4JO4H 3WIHA 4PRHB 3WNKA 1QFWM 4U1LB 5HGDB 4PIRF 4XTRC 3KXFB 5L8KB 1QLRA 2ICWB 1MREH 1X7QB 3EJZC 4LSSH 2VE6A 3MJ9A 4PJBF 4UU9B 1NCAH 4N0UE 1UA6L 4WU7A 1YJDC 3QZWG 3ZHKA 3LIZH 5DRNA 3ALWA 2X6MA 2EYTA 4KVCH 4GQPH 5BJTA 4EDWL 5CP3A 4PGJA 1KF9B 4GAYB 4OFIA 5SWZA 1NBZA 3WDJA 1LDPH 1SJVA 3PHOB 4JKMA 5FYLL 2B4CH 5C08B 4F7TA 4YX2H 6FABL 5C7XH 4PY7B 1M7IA 3MJ8B 3QCTL 5GZNC 4D0CA 4NKDA 1BQHA 5E2TH 4KROB 4RMVA 1NMAH 5J1AA 5B3JE 3VD4A 5EU6E 3LKSB 2OTUB 4NDMA 5L2JA 2VQUA 4RFNB 1DSFL 1WIOA 3CVIL 3Q6GL 1K3ZA 1S9VA 3FZUD 3F8UB 1QFUL 4DVRL 3C8KB 1AHWB 3EO1B 1YUHB 5E5MB 2J6EL 2ICWI 2W0FB 5FCUH 4BSVA 3TA3D 3O4LE 1NAMB 2ATKB 3RDTD 2JIXA 1FNSL 1MF2H 5EIIA 1S8DA 1H3GA 4MXWH 4JJ5A 5L7XH 1I1CA 3WKNA 4ELMA 5FHBL 5DD6B 4ZXBB 4GRLD 35C8H 2VSDA 3LB6D 5ICZB 5I16B 1KXQE 2ZCKL 5D1XA 5F7MC 4BUHA 5DFVD 3HCVB 2AXFA 3PWNA 1BQLL 4F7MB 3ILPB 5IR1B 2QSCL 3EJYD 2B5IB 1HHGB 5FGRA 3LZFL 4R2GC 1H8SA 2DQGL 4PRAB 1TETL 2W9LA 3C5SB 3W9EA 4MA3A 2CJUL 1IC4H 4JO4L 3KPPB 5B3JF 4ZXBC 1MAJA 2ICCA 4WFEE 4FXGA 1RZIB 2JKXA 4G9FD 4ZO6A 4K8RH 3MNZA 3SDYH 4MD0A 2BC4A 2I26N 3SKMB 2RGSA 1BLNA 3H6JA 4LLUA 3OKDB 4BZ1H 1MAKA 4PPTA 4ZFGL 4N0UA 4HWZB 4L1HA 1ORSA 3CC5B 2QBWA 3OTTA 1SEQH 1U8QA 4POYA 3RWFA 4PRIB 5KOVC 1HI6B 3U7AA 4HFWB 1C08B 2HJFB 3MLRL 5JLZA 4KI5D 4F7PB 3UTTE 4QRPB 5K9KA 2AK1H 1AR1D 4D9RE 5GXBB 2BRRH 3H42H 4M4PA 1HOCA 2Q86B 2OL3L 3QYCA 4P3WA 4JG0L 4NT6B 4GAJH 4OFPA 4U1HA 1ZT4B 3LAFA 3ORJA 3T4YA 3MJ9H 4I0KA 3EDJA 3IDJB 2YD3A 3OMZA 4JAMB 1JPGA 5M94B 2D0FA 1MCWM 4U1GB 3BPOB 1RJYB 3UBXG 3C5ZD 3FB6A 1WEJH 5C09A 3QUXA 3T8XB 3IXTB 1NCTA 1O7SA 3MO1B 3V0WL 3QNZB 4Y16B 3P9MB 2AK4D 4U0QB 5JOEA 4LVNC 4PJ7B 1A14H 5FKPB 5BRZA 3QXTA 2EYRA 1NUGA 1J0YA 1PGRB 1DLHB 3H9HA 5D7JA 2FX8L 1VCAA 4U49A 3QWQB 3FT2B 4H1LH 4JY5H 1A9EA 1CD0A 1BZ7B 3C60D 4NHCH 3T2OA 1FLRL 2VN7A 2JIXB 4QXWA 3K3QA 3WUZA 5J06A 2F15A 4Y4FD 1XF4A 4X99B 5EO9B 5ICXB 4TOYH 1A02N 3K2UL 4ZFGH 5IP4A 4KROC 3NIGF 3HUJB 1A5FH 4L4TE 3H3PH 1RZ8A 4WEBH 4GBXB 2XWTA 3L3KA 4URTB 3ULUL 2H9GA 5C0FA 4OFDA 3BGMB 3MLSL 1CFQB 1OSZB 3LKPB 4ONGL 1WWBX 1YY8B 5CGMA 5CMAB 3PABA 2W0LA 2ZSVA 4JZOA 2MOVA 4XH2B 4QT5B 3GI8H 1T6VN 5SV4A 1I7ZB 3LKOB 1A47A 4AENB 4Q9RH 3VXUE 2FX8H 5DHYA 2Q76A 2FR4A 3F12A 4CMHC 3CFEA 1NC4A 4TSCL 3ZE0E 2X40A 1P7QB 4BM7A 2DQUH 3GIVB 4U6VL 5ALBH 4HCRL 4OB5L 1FN4B 2QQKL 1DBKL 4S1QL 4DKDC 1BD2D 4PRPD 1NGYB 4HZLA 3UJIL 1G6VK 1DVFB 4WI5A 2VH5L 1R3JB 4FQXA 3BP6B 4NKQB 4WTXA 5ELIA 1X5KA 1U58B 3UO1L 3MV7E 1D5BB 4X4YB 1IMHC 1FNHA 1INQB 3N1MC 4S1SH 5C1MB 4X80H 3TZVB 1WIPA 1FGNH 4OLYH 4IOSD 1QRND 4ERSL 2DJ4A 2EH7L 4KXZI 2C3VA 2GTZA 1MWAB 4HWNA 4UT7L 2HRPH 4KQ4H 5CINL 3BISA 2AI0L 2Y7QB 3E8UL 3GJEB 3QIWB 3FMGL 4PJHE 4P4RA 1MCEA 3BWAB 5MENA 1BFOA 5D2LB 1WVZA 2J8UF 3DVIA 4LLYA 1VEMA 2Q87A 2VZUA 3M1BB 5INCB 3RX8A 3B9KA 5I1DA 5FB8B 1T66C 5IVZB 4G8EA 2BSRB 3FB5A 3VGFA 4YHLL 1QG3A 2JB6B 2MCG1 3ULUH 5DJDA 5DK2B 5E6IC 2FNBA 2D2OA 5FXCH 5DT1L 1Y18B 2GEEA 1FO0L 5HI3D 1XF2A 1MIEH 4U2YA 4KDTA 4WRLA 2GJZB 4OSUH 1FVEA 4G7VH 1P7KA 1G9NC 3HS0A 4WWKC 1DUYB 3JV4A 1AJ7H 5I1JL 4IRJA 4QY8B 5HHQB 3O8XA 1H3UA 3RY4A 4PG9A 3F7YA 1MRFH 5H37G 3VW3H 3VFRA 2APTA 3MXVH 4PJ8B 5EIIB 5TGBA 1U92A 2P45B 5GSVA 5F9JB 2CIIA 1CXHA 2WBJA 3MV9E 4JM2C 3NCJL 4CN1A 3QCVL 1FQ9C 5JOFA 3EDFA 3I6LE 1ULVA 2J8OA 1WBXB 3EJZD 2LABA 3DX7B 2HT3D 1ZLWK 4OLZL 2OTPA 5TFSH 1B4RA 4XTRD 4N0FA 1KXVC 2HWZL 3RPKA 1FVCA 2VLRE 1OGAD 4YQXH 4FQHB 3W11D 2B7DT 1Z6JT 3S34L 2IANB 1MVUA 2EDKA 5EZOL 4HX1A 2ERJC 1ZA6B 3PGDA 3P77A 5FHAH 1OD7A 2C1OA 3FCTA 2OTWB 2RIKA 1UCBH 3ZO0A 1OP9A 2ZKHH 2NXZB 4WUKH 1OLZA 1UQSB 3QQ3B 2YD7A 1EEZB 1A4KB 2EDLA 4G7VL 2D31B 3MOBL 1OCWL 4V1DA 2CGRL 4EUPH 1FVEB 4KK8D 4YHKH 1N4XH 4LCIL 3ABZA 5TE7L 1IM9A 3O0RH 1BM3H 1GGBL 5I30H 4PTUA 1IGJB 1UACH 2HG5A 1BREA 3IDYB 1GZQB 1T1XB 1XGUA 4JN2A 5KS9A 5BZWB 1P84J 1YDPA 3B43A 4HHAA 5GISL 2DI9A 1N6QL 3ARBD 3OKMA 5I76B 1L9NA 5EBGA 4HH9B 1DEEA 1AO7D 2VLLA 3Q6GH 4GJTB 3QDGE 1MHEB 5DSCA 4D9LL 3WS3A 1IZKA 3B6SA 4GMSH 1A7NH 1JGLH 5ADOL 5IHUH 3EYOB 5E8DL 5CKAA 1CFBA 4EIGB 1PZ5A 1XR9B 1J18A 2IANE 4PRNA 3T65A 1NSNH 4FABL 5EZIH 2EYSA 5IFAH 3MLYH 3QDGD 1CBVH 1RHFA 2P5ED 1OAZH 5ID1A 2B1HH 2J8UB 4H26A 1U8NB 3F58L 5K9QG 1CK0H 5IEKB 3W82A 4ZD3H 1UKTA 1HSAA 5JPNB 3RX7A 2Y5TB 5AZEL 4PJEE 4HH8A 4PB0H 4W70A 1MRDL 5I17B 2DYPB 5I1LB 2BVOA 5D9SA 5DHYB 2BNRB 1SEQL 5IV2B 5AWNL 1JGUL 2Z92B 2DM2A 3ALPA 5TQ2L 3IJYA 4Q6IA 4XNZB 3I2CH 3TVMD 2BP3A 5IVXF 1RZ7L 2C4FU 4ETYA 1AGFA 1JHTA 4MJID 1EHAA 4MNQD 4YK4B 2Y6SC 1MQKL 2EDEA 1DVFA 1O5DT 4Y4HD 4JFFD 4IMLA 3RP1A 1CWVA 4P5TA 4OCRL 3ZKND 3BZ4B 5KVDH 4F15B 5KOMC 4IMKC 5IROA 3RZCC 5BMFL 2FZ3A 3LQAL 4NQDD 2CH8A 1CE1L 4J12A 4UTBL 4WV1C 1MLBA 4UV7L 2ADIA 5E7FA 1KCUH 4BQ6A 5D4QA 4NKDB 2XQBH 3C2SA 4OKVA 4YBLC 1QSVA 5T1MA 2KKQA 5E9DD 4DVBB 1PLGH 1HQ4A 5FA4B 4BSVB 4X7CC 3H9YA 2R0ZL 5EBLB 3HZKA 3CCHA 5D1ZC 4KQ3L 4F2MA 4NQDE 1FYTA 2A77H 2H9GB 5EU4B 3CPLB 4JY4B 4KK9C 3QJHB 4LU5L 4HWUA 2A38A 5EOQH 4J3TA 3HNTL 4LVHB 4E0RB 1QNZL 4DTGL 4D0DB 5BOZG 2MQ0A 1D3CA 5D7LD 4X6CA 1Q9OB 3QPXH 3BZEB 4M43L 1MCBA 4YHPB 3QDMD 3ARDD 3X11A 4HS6B 2CLVB 4HC1H 5CIPH 4LVOC 3QIWD 1FFNA 1AXIB 4N9OB 4AMKH 1YEEH 2PO6D 1LP9B 2WP3O 4F9PA 1P4BL 3UC0H 5LWYH 1Z3GH 2GJ6B 3O9WA 2E9BA 2OXGA 3MNWA 1U8JA 2M8XA 2ZZUT 1Q8MA 4NZUL 3EAKA 5F9WC 4EI5C 4KFZC 4UNVA 3FO9B 5HHOE 1K2DB 2KPNA 4LRNL 2R56H 3INUH 1T3FB 2FX7H 3VXUA 2CMRL 5F7DA 1IARB 3PV7A 4HJGA 3BSZH 2YUVA 1OVZA 3LHPH 4WEBL 5JW4N 2ZOKA 4KRLB 3LKQA 2DQTL 4EBQL 4CMMB 1ZHLB 2VIRA 3RL2A 4Q9BA 3G9AB 4H5SB 4KKBC 4P5MA 3BDYH 3RDTA 5SX4I 5JW5A 5DZNA 2CKBA 1MRCL 1ZEAL 2FECI 4ODWA 5SX4H 4MQ7B 5FKAB 1FJ1B 2XOTA 3QXVA 2APWA 2A74B 4QHLB 4R4FL 3MRCA 4Y1AE 4G8IB 3KPQA 2UY7A 3V5DB 5LXGL 3CDGA 3NFNB 2PW1A 1UB5B 5CD3B 3FONA 4XPTL 1QA9A 1TQCC 4WHYH 1S7SA 2IGFH 4UIMA 4BFBD 1BJ8A 1MEXH 5DO2D 4YXLL 3GBNL 4L9DA 1AFVH 2DLEA 2W9EL 3FO2A 1FVDB 3VXSE 2VC2H 5CCKL 2VYRE 5EU6D 1S9WA 2HFTA 1ZMYA 4MS8C 5E00A 1FH5L 1ZT7A 3DO7A 4M61B 4EBQH 1U8PA 3IFNH 1G6RB 2X41A 3EO0B 3LRSA 1LE5B 12E8L 1ACZA 2BXYA 3BUYB 5KAQF 2V5TA 4P5MB 2VLMD 5IF0A 2Y6SD 1S78C 4GQ9H 4P4KC 4M43H 5F7HA 1QEWA 2JCCA 5DO2C 3S98A 5B3NA 4XXCC 4EIZC 1EHLH 4HLZH 4OCSH 3REWB 2V2WB 2Q6WA 4RQQB 3S3SA 1UEYA 3QO0A 2VL4A 3MACH 5FYKD 4NIKB 3L5JA 5FECB 3KXFA 1U8JB 2YD4A 3HE6D 5IBLC 2E7CA 1G7PB 3MRQA 1T7WA 3G6DH 2X42A 1AXTL 1B6DA 1LO0L 4PRAA 2QHRH 2YPKB 3VD5A 1QFOA 2NQCA 4FFVD 3O9WC 5IHZA 2ENYA 4PJHA 1G1YA 3OGCB 1A3LH 3VWJA 2I60L 2XZCH 5D1QA 2DJUA 3S36L 2XNAB 4M62L 4P57B 5ILTH 4KKBD 4OJFL 3MRRA 4X5XA 3WIHL 4D0DA 1JV5B 4QYOA 1OTUC 1R5IA 2AV7B 5D7JC 4Y5VB 1N0XH 1Q9KA 4WGVB 2E9IA 3LN4A 4LDEB 3WFBL 4NO5A 2CRMA 2FSEA 1NGXB 4X4MA 1WZ1L 4YFLI 1M7IB 3I50L 1CZ8H 3BXNA 2NY6C 5CEZD 1BQHB 2D03L 4MDIB 4IOFD 2IQAB 4XP6H 2B1AH 2B0SL 2ZSWB 2EKSB 5BW7A 3O81A 1I7TA 4PRIE 5DGRA 1SQ2N 2FATL 1DANT 2NY7H 3TIEA 5IESL 4YO0B 3KPTA 4XP5L 1XGUB 3FN9A 4LCCA 3HUJF 4M6NL 4PUBL 3ELAT 4RMRA 4OGXL 3SGDH 1F6FB 3UTTD 4CDGC 5SWSA 1LMKA 2DKSA 1FO0A 4K9EH 1P1ZB 4GW1B 5HHVH 1CL7L 4P2YA 1TCMA 4O58H 1URLA 1A1OA 1ETZB 5FGBC 3OV6A 3VXNB 1SMOA 1YEIH 3L5IA 5JHDE 4K3EH 4PRPA 3HZKB 3ZT7A 4XBPB 1XFPA 1F42A 1HH9A 3W5MA 4PJGB 1WZ1H 2R2HA 4HIEA 4XHQA 1FNEA 3MGAA 2JCCE 2HT3C 1YMME 2HT2D 1YEGH 3MZGB 3NFSL 5I66A 3O6LL 3BJLA 2CIKB 1BECA 4AG4H 5IESH 5FDWB 3QZWA 2Y5TA 1J1OL 3QNYB 4G9DA 4ZO9A 3HAEG 1EDQA 5EG6C 4CDHA 1CE6A 5HYIA 4I2XB 5F8QC 3LS4H 1J8KA 4DFHA 1WUNT 3L5WB 4HKZB 1WWCA 4JFQA 3IJYB 1TVBB 3UXFA 2ZCHL 2VDNH 5HPOA 2YRLA 2DD8L 1NDMA 3FTGB 4HPOH 1LD9B 1MREL 1FLRH 5E1AB 5DD1L 1YEKL 3Q3GA 1YZZA 5F1NB 4PJFA 4MDJA 1WITA 2NZIA 3DURB 1ZA3B 2DM4A 4QXUH 4WGWB 1CGVA 5D7IB 3TV3L 4CJ1A 4NUJB 1RK0A 3TPUA 5F70A 5KS9B 1R0AL 3MBXL 3IT8D 2C3WA 3OR6A 2VOTA 5D96C 2DBLH 1OQOA 5DHVA 4HHAB 3E3QC 5F9OL 5I2IA 4U6XB 3AMLA 4QEGA 2R15A 1ZSDA 2HFFB 1OWRM 3QUMH 2R4SH 1VEOA 2IBZX 2ZOLA 3OX8B 4XP9L 1KBGL 5IHUL 3NA9H 4P2QE 4YR6A 1YNTA 1G6RL 3S6CA 2GY7B 2HFEB 4F8QA 4KVNL 1PX3A 5J1SC 3T3PF 4MXVF 4NN6C 5F7EH 2AEQL 4K9EL 1MPAH 3TT3L 3WHXB 4OZHA 3MROB 3PWLB 3PHQB 3GSXB 3GHEH 5TF1H 2JIXD 2I5YH 1CFSB 2Z31B 3RWJB 4KRPD 4XMPH 1XGRB 4N0FB 3U83A 3OJMB 3O8XC 1U8KA 3FOLA 3SDXE 3DXAD 5JHDA 3VDAA 2VZOA 3BEWB 3I3BA 3AROA 4RMUA 3IKKA 1DCLA 1F6AB 1V7NH 2GAZA 4JFFB 4KY1L 4F57L 2ZG3A 3QCTH 2VWEC 2V17H 1YYMH 4YE4L 1CD1A 1BQSA 4QKXB 1A9EB 3D0VA 2E27H 1A6ZA 3TVMB 4BKLB 3HZVA 4EVNA 1SYVA 2QV2A 3BSZL 5JIIA 4L8SC 5I8OH 2YKLH 2V6HA 5BZWA 4NO0D 4ODTL 2BDNL 5GS0C 4XP4H 1ZK9A 5FFLA 3GMNA 1ES0A 4C56B 4UV7H 3I9GL 4NO3A 4NQCB 3VRIB 3EYUH 5D72L 1UG9A 1S7UB 4E41B 1HH9B 3QXUA 3X12B 3HC3L 3U2SB 1CDGA 4HSQA 4PR5A 1LE9B 3D87B 5B39G 2WIIB 4I3SL 5ISZA 4WUUE 3HE7C 5C0IA 2FL5B 3RKDD 4G80A 2WINB 2DQEL 5HGAB 1IL1B 4HWBA 1OTUD 5A40E 5KANG 3BQUD 4H20H 2R1XB 1GGUA 3RVWD 3VI3E 1PKQA 2HN7B 4C4KT 3SE8L 3NZHL 3TO2A 2XN9B 3QDGA 4JRYE 3QUKA 4ZFZA 1NJ9A 2P5EA 1BOGA 3VFSB 1OSPL 1IM9D 3VG0L 4Z7WB 25C8L 1ZLVK 3MZTA 3SO3B 4FS0A 4LGPB 1UZ6F 2BRRL 1ZT7B 3DO7B 3ZDZF 5ETUA 1BJMA 4XPHH 4EI5D 3ARQA 4XMPL 1T04B 5FKPA 3RUGB 2ADGA 4LCYB 2NW2B 4UZGA 5JR1H 2YD1A 5IB3A 1U58A 1I1YA 1U8KB 1I9RH 1N3NB 4FFZH 1JNNH 1WBXA 1EHLL 1K8IB 2CDFB 4G42B 3I6LD 2WK2A 1AXSA 1YQVL 3QXAB 3ZL4L 4P99A 3FRUA 4LQFL 3S3PA 3VJ6A 4JFFA 1NGQL 5HYQA 2V9RA 2IPKB 4OI8A 1DL7H 3HI6L 1MRCH 1U95B 3EBAA 1QFPA 4ORGA 2BJML 4N0CD 2JJUA 2Y36H 1JFQH 3B2UD 1RUQH 5CEYB 5IK3B 4X4ZA 3MBEB 4U31A 4RBPH 1KLUA 2R2EB 5LXGH 4IDLA 1AO7B 1NEUA 4HKXA 5GRJH 1WCBB 3UBXB 5JA8B 3OWEA 3S88L 1AD9A 2BX5A 3K8LA 1OAYL 4GRWF 4Z7NE 4Y2OA 4NBZB 5F7WC 3WXWL 1NLDH 4RZCA 5FYJH 1KIRB 3ZKNC 2Q1EA 3W9DB 5HHMD 2Q76B 4N5EC 1GGIL 3SDCB 2R0WL 3WN5A 2X1XR 4YQXL 5M7QA 3V6FB 2P5WD 3G6AA 2CLVA 3TBYB 3UZQA 3T0EC 4JPIB 4P46A 4OGXH 3NVQA 4M6ML 5D7JB 3ZTJG 3BZFA 3PQYE 4GRMA 4X7EC 2NY6D 4HJGB 1NC4D 3UTSD 1DSFH 4FXKA 3P0GB 5DQ9A 5C0JB 5C0RL 2Z35A 2A83B 3L5XL 5L6YH 2YS4A 1M05B 2J4WH 4X4YA 3U36A 4F9PC 4XNMA 1NPUA 2R2EA 5B4MC 4MLSA 2M26A 5T33H 3EJYC 2DQUL 4ODUA 1YMMA 4ZOAA 3QPQC 4AM0B 4XBPA 2VIRB 2NYYD 4DZBA 2X4NB 5HI4D 4AH2B 3EYFB 5DVLA 5FYJL 1VACB 3L5HA 1RI8A 1AD0B 4JFDA 5C0DA 4LLWA 1JHKL 5IBUB 1J5OH 5DUPL 2EDYA 1RMFL 3MLPA 4LQFH 2VXQH 3MFFA 3EKCA 1H3PH 1RZ7H 4KJPD 5DWUH 5C0BA 3VJ6B 2RFXA 2P24A 5FA3B 3RDTC 4Y5YA 1YN7B 4JR9H 4S0TD 1YEHH 3CX5K 4R26H 4RRPG 3RU8H 4K7PX 4Q0XH 2D7TL 3TBYA 4OZFG 5B39B 1E4XL 1MJJA 1H9VA 3MV8D 2AW2A 4YAQB 5FM8A 3UYRH 5ANME 1IEAA 3LQAH 4Z7VA 4PJFE 5LKNA 4L8CB 4ZS6D 5I19H 4LASL 2GJJA 3MMEA 4HXBH 3F58H 4KK8C 2ITCA 3GO1L 4HCRH 4L5FL 4V1DD 1H0DB 3GK8L 3IFPB 4NQTA 4MS8D 4L3CA 2B2XL 5J9PB 3BX7C 5D5MA 1MWAL 3HC0A 3CUPA 3LPGA 4ONFL 3MODL 3UAJC 1E4XI 1RPQA 3F65A 3DVNB 4DK3A 2QLVB 4Y5XC 2Q7NA 3BI9X 4QRSB 2C7UB 4AEIH 5JXAH 4WUUB 5DT1H 3TJEH 3LKRB 4KV5F 3VXMA 1W2KT 3WN5C 4XZUA 4U0RC 1Q72L 4WU5B 3UTOA 4RNRB 2SEBA 4M1GL 1S7RB 2DQIL 4ZDHB 3C6LC 3T0EA 5T1LB 1MI5A 2XNAA 4P57A 3FN0H 2FHCA 1U8LA 4Q2ZA 3C60B 1BIHA 5FUCC 5KANI 3GJFK 5DD6A 4ZXBA 1EZVY 4LOUD 2EEDA 4YK4C 3DV4A 2O5XL 2R1WA 3GIZL 5ETUB 5TE6H 4V1DB 1ZT4A 2DQHH 4LCCC 3QUMB 2J3SA 2YD2A 1MWAH 1KJMB 3O2WH 3B2VL 2EDJA 4PBVC 3GB7B 3RTQB 2V5YA 4UOJA 3U4BH 4TQEL 1WWAX 2HWZH 1VADB 4KKLD 2P43B 4LIQH 1DZBA 1MY7A 3PP3K 1VENA 4PJGF 3DI3B 1AKJD 4LLDB 3TJHC 2JJWA 4ODBD 5GRVK 1NAMH 2BNQA 3CFCL 1R3KA 3FQNB 3LPWA 3GKWL 5IEHA 4KZEL 3QEUA 5IJKA 4MD0B 3P9WB 3MXVL 3EYOA 1RZKC 1D5ZA 2VXUL 3CSBA 5F89B 4LCIH 1XR9A 1F4AA 3QJHA 5IT2H 4MWFA 4YGAB 2MKWA 2GUOB 1J0IA 1JYNA 4UBDD 3HPLB 3VCLA 1FZMA 2FEDC 3HNSH 2FL5A 5C07B 4I18B 3D2UB 1PG7W 5L2KA 1G7LB 3ILQC 4PD4J 4FMKA 4Y4FB 1ZHNA 4PJXA 5JW5B 4N90E 1MCKA 5DLML 2ZG2A 3MRDA 1AGEB 1W0WB 3RJDA 1J1XH 1HH6B 1TPXC 2XRAL 2NXZC 4NQED 3RGVC 2P24B 1XIWD 3HB3D 3EO9H 3LSOA 1JZ5A 1PSKH 1A3RL 4JE4B 3DHJA 4F8TA 2Y25A 3VGDA 3DX6B 3BH9A 1OLLA 4OI9A 3MPCA 4KRNA 2XWBB 1MAML 2X4RB 4PLKD 1U36A 1FGVH 4JHAL 2AJ3B 5FK9B 1IGCL 4KKNA 1VGKB 3TYGH 2E7LC 5E8EB 2FD6H 3IS1X 3ZKQD 1FBIL 5DJZA 3MUGA 4N5UA 4QLRA 3ILPA 4LHQB 5DJXA 4MLIA 1EMTH 3BGAA 5EO0A 1S5IH 4PB9H 4YDLC 1N3NA 3IJSA 3BIKA 2FIRT 2VLJE 3VXSD 4XVSL 3L6FA 3TBWB 4A6YA 1DBBH 3HHRB 2C3XA 4NNXB 5IG7B 1D5IH 2RCSL 5HYEA 4M62H 4MNQA 1PZUB 5D2NE 5FO8B 3V4VH 4BQ8A 2FO4B 1QO3B 4PJAE 3GJFB 4NOBA 1YMMB 1TCRB 4GKSB 2HAZA 4HULB 2WBJB 3GB7A 3RTQA 1PX4A 3MRIB 5E4EC 4KMQA 4JANA 5KS9F 1WFTA 3O3EA 1R6VA 4IOIB 3K46A 1OARH 3LKNB 5ACLA 4ETQB 4YXHL 1RUQL 3V95A 4WJ5B 1I3GH 1UWEL 4NZJA 1F5WA 4YPGB 4LCUA 5JDSB 2HRPL 5EIVA 3PDDA 3VG9B 2VDQH 3I6KA 4LMQI 3HN3A 4NKMB 2YMXL 2DWDA 3T3MF 3C60C 1KJ2L 1MF2L 5IQ9B 3QIUB 1DQLL 5I0DA 2ADFH 3EYVB 3WDIA 1JRHI 2HKHH 2ADJB 4P9HL 3WE6B 5CEXB 1QRNB 3IF1B 5AWNH 5J11B 4AEHL 1NCDL 1K6QH 2A6JB 5BS0B 5FB8A 5EOCH 4HQQH 3ARYA 3GI9H 4TVPL 5EO1A 4NWUL 4P4KD 4KK5C 2VE6B 4WY7H 2IQ9H 1ZGLP 3D85D 2ARJA 2G75B 1FNSH 1ROWA 3DRTA 4RIRA 5GJTL 1TNNA 4G43B 2E8ZA 5CWSB 2YRZA 3BH8A 4HGWA 2JB5L 3G08A 4X6CE 1BVLB 3KHOA 4MA1B 4PJEA 1TTFA 3OL2A 3QZWB 4TRPL 4BSWA 4G9FE 5BV7C 5K9JH 1RK1A 1CIUA 4RWHA 4X5XB 2FYYA 2J8HA 4I77L 4W4NA 5EO0B 1FAKT 1EFXA 4JFXB 3NH7H 3N85H 4NN5B 4DGVL 1IC7L 2WQ8A 3JV5A 5JQ6H 3MLVH 2VJXA 4ORZC 2DQTH 5EU7C 3VFOB 3GDBA 3LV3A 4RFNC 5ID1B 1J8HD 4WI8A 3O6FA 3D25A 4OZGB 1QFUH 4B7IA 2RFXB 4Y89A 3VA2C 5IB5A 3BP7A 3DIFB 2EKJA 5TPWH 5JHDD 3MV9A 3B9KC 1DUZA 1FNEB 3FFCD 2IFGA 4UOW0 4Y19B 5E8PA 5GGSB 1DBAH 3LS5H 1I4FA 2OSLA 3H0TA 5H8DA 5LWYL 2NY0B 3WFHB 5F3HB 3C9NA 2AEWA 5CKGA 1KTDB 3RTQC 5DZOA 3HMWL 3VXOB 3HE7A 1S5HA 4PGDA 4XWGH 1CF8H 1TPXB 5E6ID 3KYKH 3TESA 4X6CF 2PYFA 1AGDB 4JFZL 3VXNA 1FCCA 2YBRA 2D9CA 4IRJC 3SE9L 3T0AA 1YYLH 1J05B 3CXHK 4JVUA 3NCJH 3OAUL 4DEPB 2FRGP 2UZIH 4O9HH 1FORL 3QNZA 1FG9C 4OTXH 3MQIA 4U1JB 2EKSA 5B8CB 4YWGL 3LV3B 1MCNA 1RQ5A 4S2SA 4C54A 3QIUD 2YPKA 4N0YH 2F5AH 1QYGH 1LEIB 4HGKC 4Z7WF 4OD2B 1MI5E 1KJ3H 4PTTB 2NY5L 2NYYC 4X8JA 5INDB 1W72H 3X3GH 4M1GH 2JB5H 5EBMB 4U1MB 4GW4A 4OI7A 1G7JB 4IBLT 4LLWB 1NBVL 1FHGA 1WAAA 1FZOA 1BQUA 3LMJH 5C0EB 4EZMA 1AFVL 3FZUC 3E6FB 1X44A 4XX1E 4PP1C 5JOFB 3MV11 4HUUA 3QXWA 3MO1A 3QAZC 2YRPA 4OZHB 1UB6A 2RAMA 4X83A 1BD2E 2NW3B 3VRLE 5D6CA 1P5UA 3VXPA 1CL7I 1EEYA 3PQYB 1FG2B 2ZWLT 1T7XA 1I3VA 4F37F 2EXYC 3K7UA 3CFBB 4Z7QE 4YIQB 3NCYS 3RY6A 1C7TA 5DJYB 1MQKH 1KPUA 4M8VA 3U7YH 1T2QL 2EIZB 3GRWA 5I8CB 3HR6A 3QUYA 2VABA 2KZWA 3IDGA 3GKWH 2AGJH 2Y07L 2NY4D 3MRHB 3MLYL 5DK2A 3RTQD 4F57H 3TF7C 4I4WB 2B0SH 3MGTB 4YE4H 3UDWC 4Z5RA 3I75B 3MRCB 1IZJA 3O45A 3TNNB 4MA7H 5FOBA 3AS3A 5I6XC 3BN3B 2R0ZH 1NEZB 2O5XH 5GGRA 2VH5H 3KYNA 4R0LA 5ITFA 3B9AA 2DLFH 5I1IL 1QPXA 2F53A 3MNVB 1F4YL 2HT4D 1E4WH 3I6GB 5DFVC 1CS6A 2OJEA 4U6YA 4DGYL 3HNTH 4JCLA 2W59A 2R2BB 1XGQB 4ZOCA 4UU9A 3FB8B 3CX5J 5TE4H 5CJ5A 3HNVH 4JDVA 4HPYL 1S7VB 4F7TB 3C6SA 2X70A 4L8SB 1TIUA 3U4EB 3D48R 2P1YA 5C0CB 4OM1H 5GS0L 5DJZB 4FQXB 4HS8H 2YC1A 3O9WB 3DSNA 3RWDA 4AJ0A 3PGFL 3C6LB 4D94A 4Z7OF 5IQ7H 3UJJL 4AQ1B 2NY2C 3DTXB 5F6HI 2HJLA 3QUZD 3HRZA 4Y5VC 3MRGB 3WL9B 4I1NB 4NQEB 5T3XH 2D7NA 4RFEB 3MREA 4XHJC 1A7OL 4G6AD 2JF1A 1EFXD 2D7QA 2DD8H 5GS2D 1E6JH 1QBML 3C8KA 2Z31C 3OJVC 1P4LB 5GGUA 5E08H 1CFVH 4JFYA 4YBQD 1H15A 1N2RA 3L3DA 1AR1C 1IBGL 5E2UL 1DQQA 3EW3B 1ZLWH 1ZWIB 5GIRA 5C71A 5DFTA 5EZJB 3PDOB 3B83A 3LQZA 4ZTPL 1GYAA 1PVHA 3RY6C 1G7IA 3BOVA 2BHZA 3CDGB 4UILH 2DQDL 3D5OF 5F9OH 3DGCR 1VGEH 4HKBB 1H3WM 5MEPB 2I9LA 3TFKC 5HD8D 4K3GA 4M9PA 5KTEL 4K2UL 1I8MA 2JELL 4KU1A 5FO7A 4UIKH 3ECBB 5DK0B 4UT7H 1UWGH 2FLRT 4NUGL 4L4VA 1OGAE 3MNZB 2HLFC 1ZT1A 3BJ91 4Z95H 3JTTB 3CFDA 2XACC 4RFEA 4WI6A 2GSGB 1S7QA 2XKUA 4M1CD 4UNUA 1GC1L 4HFUH 4N8VB 4X7FC 2BNRA 5EU3A 5T3ZL 1U9KA 4RA0C 3ARFD 3DX8B 4AQOA 3VGAC 4GW5B 4JFPB 4FQLL 5ERWA 3IU4H 2E3VA 3T0WA 2EH8L 5F3BA 5KW9L 4OIIH 4FFWC 2OQJA 1SMAA 5IK3A 3SDXB 1MEXL 3UCRA 2MHAB 4PJFF 3F7PC 4LSQH 2DYPA 4K94L 5GGRB 3PGCB 3TZVC 1B90A 4J3VA 1CR9L 4RFOL 2VDML 4LCYA 3GMOA 4XPAH 3WXVL 5MP6L 1YEHL 4R26L 2Z35B 3BPNB 2MJWA 3G5XA 1ZVSA 3UYRL 3SQOL 4UNTA 1A6WL 4WWKD 2FWOB 5CSZA 4Q58C 1Q0YL 3DUSB 5ICYA 3GUTA 1AC0A 1N7MH 4XNUH 1AGCB 4LKXA 4Y1AA 5BVJA 1OCWH 4NRYB 4HUUB 4S10A 1SJHA 1JTTA 4H1LA 4M5ZL 2PTUA 1QBLL 1EXUA 4QXTA 5HI3C 1RUML 1GGYA 3DMMD 5BV7B 4L3CB 3UYOD 3CH1A 5C9JB 1KJ2A 2X5PA 4JRXA 4OIBA 1A7RL 4PJHF 2BRQA 5DMGD 3AREC 1OB1B 2GSIA 3QCVH 1OP3H 3G5YB 4MQXD 4JN2B 4LLQA 1XZ0A 4OKVB 5DRZB 3Q5OA 5F7KC 5E70A 3QFJA 1I8IA 4CMHB 1A9BA 3CDFA 1NCBL 1JF1B 1DBML 3O2VL 3SKUD 3D0LB 3KJ6H 2CK0H 3TIEB 4U7KA 3PWPE 1DN2A 5JXAL 1I9EA 1IT9H 1MJJB 4U1IB 1CFTA 1GVIA 1JYWA 3U0TA 3WJLA 1P4IH 1WWWX 3LN5B 4MAYA 4LPYA 3WEXA 2WBKA 5SWSB 4LLAA 1LEGB 1IAKA 2YR3A 1F11A 3OG4B 2IPUG 4PJ8C 3VXSA 1QACA 1U95A 3BAEH 1QFWI 5JMOC 4UB0L 5JO5A 3D3VE 4MQSB 4NO2A 4E9LA 1EVUA 4X8JB 3C5ZB 3D39E 4JLRA 4LKCA 3VFGH 2XKNB 4OZGE 4NZRL 2EE3A 4JANB 4EDWH 4CADB 5GS1B 3PJSA 5MEOA 3RAJL 2VSCA 1FVCB 3SE3A 3RWIA 4XWGL 3C09C 3NCBB 4DEPC 4KAQL 5J56B 4H20L 3CVHA 2CDEA 3CFJA 4PJ5E 5J13C 5JHDB 4Q74A 1A14L 4JJ5B 1WBZA 3Q6FB 1QBAA 4JFOA 3WO4C 1NMCB 2WM0A 2XWJB 5E9DA 2H41A 4PJAA 1JGEB 4OCRH 2R2CA 3QO1B 3QI9D 3GSRA 1CT8A 4IIQA 1R3HA 5HYJB 4X5WA 3BKJL 1FIEA 4DAGH 4WHYG 3IFOB 2OZ4A 2GQHA 3NTCL 4G6AC 1FV1B 1TTUA 1TVHA 5FM5O 2EXYD 2X89D 3QDME 1I7RB 5FUZH 5FGBA 5IVNA 1CDIA 1W0WA 2LV4A 4YO0A 1RK0B 5MENE 3LOWA 3QDMA 1YEGL 1QFWH 5T5FL 1CGSH 2ED8A 1C16A 1M71A 1EZVX 3O2VH 1OAXH 5SX5H 2PR4L 1R5WB 1NEZG 4J23A 5I8KH 4X8XA 3MCLH 2MFNA 5JLZB 4QRRA 4FHBD 3TNNA 3GI8L 1BAFL 1P7QD 1FGNL 4G8GE 4Q9RL 5FYJU 4RDQF 3GJEA 1ADQH 3TWCL 4XBEL 3BFOA 3MRMB 3BWAA 1NGZA 1W0VB 2XZAH 5DHVH 1UC6A 4H1LG 1V05A 3RWGA 1P9MA 2HVKA 5GRUH 5IHZB 3SJVD 2W65A 3AREB 3LH2L 15C8L 4GKNB 3V5DA 5B4MD 4BFIB 5LGHL 3ZE1E 3N1PC 1S78D 2OI9B 1MCJA 4X6EB 3MMEB 4R3SA 5DK3A 1HDMA 1HHHB 1Z0NA 5DUPH 1D5MA 2X4PB 5GQBA 2Y9RT 4TUOB 1S7WA 2VKXA 1A3RH 3RWIB 1RJYA 3L3IA 4XWOD 4LAQL 2PR4H 5DXWA 2XN9D 4KJYA 1RZKL 1Q1JL 2GIYA 4XWOC 3BP5B 3S5LB 2Z93B 1OAKH 3GNMH 5KVEH 2V9TA 3SGEH 3GRWL 2EDXA 4ZUVA 5LQBL 5E2VH 2FJFB 3QEGH 4BZ2L 1NBQA 3L1OL 1AKJA 1HHJA 3MRFB 3B9KD 2AXHA 5D2NC 3ZTNH 1AGBB 2VLJD 3EOAA 3RJQB 4PBXA 2AJYL 4PG2C 1NC2D 1HHKB 4CGTA 5JW4R 5JUEL 1T83C 3S7GA 3D85B 1AC6A 5DS8B 4LSVH 3L3DB 4PBWD 1RUPH 3ARXA 2CR6A 2I9TA 3DVGB 5FYKE 4NZDA 1FZKB 2QADB 4PJDE 2R4RL 1TTGA 2IANA 2GFBA 5J13B 2BHYA 2WWKO 3KLDA 3G5YA 5EWIH 4YJZL 2R1YB 1OARL 3WHE1 4V2CB 2J5LC 4NHUB 4KJWC 5HVWA 5IW3A 3QDHA 1S3KL 1FL3A 4P3CL 1IAOA 3GO1H 3BWUC 2BFVL 2F53E 2VRAA 1S7TA 4XCFL 1R24B 1I1FB 3TYFA 3W9EB 4EI5A 1QSFA 5CEZE 4DQOL 2P8PA 3HAEB 1OAQL 2AJYH 1CICD 4X6DE 1YECL 3BKYH 2GJZA 3MCG1 1DTUA 4GRLC 3QUXB 1I3UA 1G9NL 3FT3B 5C0CE 5IMKB 4XP5H 4LLMA 1P2CB 2Q8BL 4O51A 2EDFA 4OUOA 5FEBA 5KVFH 1AI1L 3GMQA 2FIKA 2HJKA 3QUYD 1E6JL 1QBMH 2X4NA 4DUXA 5L2KB 2A1WH 2LTQC 5D70H 3FOMA 1ZXQA 1UCBL 2SEBB 1MH5B 4P4KB 1MIMH 6CGTA 2QKIB 4Q6YA 1DLFH 3BXNB 2E5EA 1INEL 2C1PB 4KI1A 5JORA 3H9SD 1UJ3A 4XX1G 4ODSL 5HD8C 2DQDH 2EIEA 2RJMA 3C6LD 1CLOL 3VD7A 1AO7A 3FO2B 1T5XB 2P49B 1KIPB 3O4LA 4FFZL 4MNHA 1UH2A 1IC7H 2XZZA 1N6QH 4APQB 1D5XB 4AIXA 4S1QH 4U05A 4UTAH 2I60H 2OZ4L 3BO8A 3T1FA 4M93C 3H9SE 2W1NA 4X0KB 4Z76B 4LLQB 4R0LC 4NM4H 4BJLA 4EN3C 3OPZH 4NP4H 3EOTH 3LCYA 5L2KE 2I9TB 1G0XA 4QHNA 2VDOL 3QDJA 3EYSL 1CR9H 4XPAL 3RNKA 3SDAC 4Y5VA 3HMXH 1JE6A 1U8OB 3ZYJA 5ESAB 2DDQH 2K1MA 4M3KB 4JM2B 1GGCH 1G7JA 2DAVA 4LFHD 1NDGA 4LEXL 2F54A 2K9UA 4RAHA 5E6YA 2AABL 4R7NB 3CLFL 1Q38A 2BY1A 2Q8AL 1X9QA 2OYPA 1BPVA 1YPZF 3GGWB 5D71L 4JG1H 3VW3L 1BIIA 2NNAA 3RNQA 5CZXC 2OS7A 5KSBF 1TJHH 3O8XD 2HLAB 5LJYH 3GBMH 1E0OB 2CIIB 2O5YH 4L8BA 4QRUB 3GHBL 1CLYL 2CKBH 3QIBD 4MB3A 3I2CL 4Z7NF 3RFZC 4E42B 1KEGL 4AIZA 2HTKC 4XVJL 3FFDB 3VWJC 2VDPH 4Y2DA 3NOIA 1RK1B 2CDEB 3DO3A 4M5ZH 4MD4A 3KLAB 1CVSC 2WINA 1A7PH 1LHZA 4FQ1H 4PJ9B 4U1MA 3X14B 2YPVH 4KWUA 1WLHA 4X9FA 1CXKA 1CFSA 2Z31A 2OR8A 4X4XA 3U9UA 1N64L 5DD3H 1INEH 1RSFA 4G7YH 5FO7B 4RAUA 2YN5A 1K3IA 3EZJB 3MCKB 3ARGB 1FZJB 5FOJA 1F4XL 4M5YH 3D0LA 5E7BA 4NZRH 3DXAE 1K4DB 3V6OE 3B4NA 2ZCLH 1ADQA 3RL2B 3NA9L 3ROLA 4G8FB 3T4AB 1IL1A 4Z7VF 1I4FB 1RVFH 2R0KH 2CLRA 1UM5H 4GBXD 3FB7A 3VFVB 5KSBE 3BKMH 1KYOJ 3NCCB 4JRYA 5AEAA 4EN3D 1CXLA 3GHEL 3VXQB 1QLFA 5E99L 1LK3H 1IEHA 3ARBA 4WW1B 2XPGA 4K7FB 4OV6F 3RU8L 1QSEB 3UTPE 4ZSOA 4M6OH 5JNYB 5GGVH 1P4BH 1A7PL 5JMRA 1GGCL 1L0YA 4NQCA 4JZJB 5I19L 5A16B 2IH3A 2A0LD 4R4NC 3EGSB 4PRBA 3VXRA 1YA5A 5HGDA 2AK4B 4JHWH 2MPAH 2W65B 4EXPX 2DL9A 3KG5A 3JSSA 4BKLA 2ESVE 1NFKA 1KCSL 4L4VD 3MNVA 1WBZB 2V7NA 3G5ZA 3Q6FA 1L0QA 3JTSB 2DM3A 2YK1L 3FRPA 3IFNL 2NY4C 5ACMA 1BBDL 4HBQA 4EN3B 3BUYA 5D9SB 3MV7A 5T3XL 3TM6A 4GRWH 4OZ4B 4G9FB 3QUMA 4M7ZC 4X9HA 3RL1A 4TSAH 2Z92A 3PL6B 1OL0A 3NTCH 4XNQB 3RUGE 4A2MA 2OK0L 3P30L 3RWJA 1BOGB 1RZKH 1BF2A 3BH8B 4HGWB 5GJTH 2GT9B 3HC3H 1FNAA 2BMKA 2IAMC 2XA8L 4QO1A 3ESVF 2WUCL 5B38G 3J8F7 2O61B 4D0CB 4NZTH 4PJEB 1J1PL 5I74B 2I07B 1RU9L 2QTEA 1U3HD 1ZOXA 4XAWL 3ES6B 2X9XA 4PGCA 3QEGL 5L8JB 2AJZA 3CFKB 2BSTA 1W72B 3QDMB 4QRPA 2EDRA 5IQ7L 2DQCH 4UDUB 4ETQA 4YHYC 3DUUA 1R5WA 1YJDH 3MCLL 5TDNA 1BZQK 1UQSA 3WUWA 3H9SA 1DEEB 4YC2B 2AQ1A 1MLCB 2I27N 1DBJL 1KCSH 1BWWA 1VDGA 1G7LA 2R0KL 4I18A 5BVPH 1K8DA 2P5EB 3IJHB 3KPSD 4MAYC 7FABH 4GSDH 5CJOH 5DYOA 5E6ZA 4F37K 3P0YH 1ZHBA 1QP1A 3VRIA 4IIQC 5CEYA 3GSWA 4C56E 4R4BA 1Q9KB 4XP1H 1NCCL 2EYSB 2NXYD 5E0QA 1S7XA 1OWWA 1NL0L 1HYSD 4WW2A 1VFMA 2KQMA 2AI0H 1CT8B 2WWMD 3OKYA 3PG2A 3HZVB 5E8EA 1HSAB 4Z9KB 5JPNA 3A6BH 1HKLH 2WWKT 4DN3L 4ZFOB 2C5DC 3TBTB 1BWMA 5KTEH 1Q1JH 3CLEH 1BZ9A 2BJMH 1FORH 1ZV5A 2JELH 4ZUWA 5D96B 2NY3C 2OTUA 4NDMB 2ILLA 1NANH 4YHLH 3T77B 4K8RD 1RV6X 1XIWB 2JJSA 4ZUSA 1UA6H 4F33A 2F5AL 5GRJL 2R2HB 3TGXA 3E2HC 5HDQL 5TQ0L 5EU5A 2Y06H 4NGHL 1IGFL 3T2PA 1WTLA 1JNNL 4NBYB 3RVVC 1I8IB 1NCCH 4NRXB 2UUDK 1DDHB 4O02L 4AMKL 1FFOB 1HEZB 2BFVH 1MJUL 5C3TA 4IRJB 4QY8A 5HHQA 2ZCKH 2ICEB 4Y19A 2BVPA 4UI2A 4QYOB 3U0TB 4M03A 4GLRI 4ISVB 5E95B 1IM9B 1X6LA 1K9TA 5C07E 5DMJB 3HC0B 5ICYB 2CRZA 4XCCH 1Q0XL 4UQ3B 3GUTB 3VI3F 3RWEA 1TETH 4PV9B 3RBSA 3VXOA 1DBJH 4J3WA 5E1AA 1MCLA 3TNMB 2ZSWA 3NBNA 1QHOA 1KG0A 5CSGA 4X0KA 1HHHA 2H32H 2R29H 3WD5H 3KYMA 4H0HB 1WQVT 1U0QA 2EYRB 1S9WB 4NNYA 3OJDB 5F1IA 3ULUE 1A7RH 2C9AA 2CPCA 3O3UN 1U8MA 3GBLA 1R3JA 4GG6F 3GSWB 1PW3A 5D2LE 5C92A 1U93A 3C08H 4JCMA 1YC8A 3QDJE 2BSTB 1QEWB 5EBWB 1KB5H 4W6YB 2PO6C 3KYOB 1ZVSB 3TIDB 2FGWL 1IKNA 4MHHI 2L0DA 3DUSA 3SQBA 4V1DE 2J88L 3OKLB 5DWUL 4Z0BL 5BV7H 4YDKL 1T7ZA 1TZGH 5D6DA 3ARVA 3DV4B 4KHTH 4LBEB 1WTGT 2FBJL 1EBAA 4UTAL 3SKNA 2NY6B 2DYPD 2P47B 3QFDA 4MAUL 4PJEF 1IGIH 3WBDA 1A3LL 2Z4QB 3NFPA 2I25N 5ISZE 3D18B 2I9LB 3FO0L 3PABB 4ODSH 2F8OA 5D1ZB 4UAOB 1OY3B 3KLHC 2ZOKB 2H8PA 5HDQH 3EJJX 1NGPL 1WBYB 1RULH 1OD9A 2PF6A 3AFLA 4ZAKB 4WUKL 1CGWA 2CLZB 5BRZE 3HPJB 1EJ6A 4R8WL 2X10A 3GMRA 5KJRL 1KN2H 4PLNC 3QULA 3MCKA 4GH7B 1YYML 2AVGA 4F3FA 2HLFD 4U6TA 5JOPE 4AENA 5IM7B 3X13A 2VXVH 2H45A 1X5AA 2ADJA 1A6UL 4K3DL 5SWSE 1CFNA 1NAKL 5DZLA 4FQJL 1IEBB 1KYOK 2VDOH 3GSRB 4G6KL 1NBZB 4X98B 4MVBC 1WISA 2D4FA 1N5YL 3I85A 4LMQE 1ED3B 4CW1A 2YWYA 4ZMAT 3TC9A 2PXYA 5HDLA 4M02A 1T3FA 5HHOD 4OD1L 1C8PA 4TNVK 5SWSD 4JDZA 4OQTH 5E99H 2WIIA 5ISZB 5DMIH 3TCLB 1UADC 3NPSB 1VFAB 4PGEA 5CLTA 3ARED 1RY7B 1AD0A 3F62A 2APFA 2JJVA 3X12A 3T09A 5C0DB 2ATPB 4NC1E 2ZUUA 5C09D 3FT3A 3WO4B 3LEYH 1A6PA 1DQDL 4HS6A 1T1WA 1A2YB 4TUOA 4JKPH 4JKWA 5DQDL 3ZKSD 5C0BB 2XQBL 2FATH 2FYYB 4K71C 5E5UB 4FZ8H 4ZSOE 1G7PA 4Y5YB 4YDLB 3IFLH 1UXWB 4IHOB 4G5ZL 1CXIA 3FO9A 4N0RA 3D6GA 4JO3L 3P11L 1KCRL 1GPOH 5C09E 3REWA 3W81A 2X4TA 1IEBA 2Q86A 3QWRA 4XP4L 1K5NA 4M7KL 2XRAH 2BVYA 3CFCH 3EO1A 3F7VB 5I1AB 2A6IB 1A4JB 3KPLB 4Q9QH 1WAAF 5D6DC 3ZSTA 3MLUL 1KNOA 2BSRA 3FB5B 1KCVH 5F1IB 2ZUQC 4HPOL 5GRUL 1MFBL 3SDAD 2HRLA 5F89A 3ARUA 1UVQB 8FABB 3DRQB 1Q9OA 5KSBB 1VKXB 1WBYA 4XB7A 2DWEA 1YEEL 2D4DA 4RGOL 3KYOA 3ROLB 1DVFC 1MSPA 3UPAA 4JFED 3T2NL 4MJ6B 3SEPA 2F8XC 1U8IA 1FFRA 4Q97A 3O3DA 4XBGB 1T0NB 2EC8A 2QADC 3KPRD 1HWGB 2QSCH 1WJ3A 4MDIA 3FQWB 2IADB 5I15H 4Y5XA 3WLWD 1UZ6E 1I7RA 3KPPA 2H1PL 4QRPE 3NIDF 3WNNA 2DLFL 4Z7UB 5CJQL 4L9LA 1EGJL 3CDCA 4JFEE 4JHAH 5IFJA 4OLUL 3LPFA 4LVOB 4HAFA 3V7MA 5D1ZA 5CGTA 3O4LD 2I5YL 3ARGD 1NCNA 1A1MB 4LFHG 1FYHB 3LDBC 5H37H 2HVJB 2YN3A 2C1OB 4QRRE 3N1QC 2F53D 3RVXC 4NCC1 2XA8H 3CC5A 4G8GA 1WAAE 4MSWB 2CQVA 2LU4A 1NGWA 4U1NB 5F44A 1MFEH 5I16A 4R97B 1IC5H 4Z0XB 3BP7B 3DIFA 4RISL 1JZ8A 1S7VA 3OHXB 1BBDH 4M48H 4FNLH 4YDVB 2VAAA 4XHJD 5GJSH 4XVTH 4XH2A 3KNBB 1YJDL 3FAXA 3RWGB 1WZKA 4Y2DC 4AEHH 1PKOA 2XWBA 4Q9CA 3U36B 3EFDH 2FCBA 5CINH 4KJWD 2C4XA 2QQLL 2XIDA 3HS0B 3P9LB 4UDTB 2P7TA 1ONQB 3O41B 4L9LB 5DQ9B 3EO0A 4OBSA 5C0JA 2YBRB 3B8YA 4P2OA 3IGAB 3HAEA 2P8PB 1KJVA 1RZIA 1NBYB 3WIFB 2DQFB 3C87A 4KMTL 5DJXB 4F2MB 5DURD 5JW3L 5KN5A 1LWRA 5F9JA 3MR9B 4TNVF 3SDDA 2P8MB 4PP2A 3K4AA 5EU5B 4UV4H 1YECH 5SWQB 3MLXL 2MTPA 2ID5A 1S7UA 1UEMA 3UYPA 3N50A 1SM3L 5C0CD 3WUWB 1NC2A 1QFWL 5T5FH 5HY9B 1EGJA 3AXLA 4HS8L 5DURB 1AHWC 1YN7A 3QPQD 3TT1H 3BZEA 3VRJA 4K23H 4QGTA 1PQZB 3O3AA 5JA9A 5F97E 4RGNE 2WZPD 3S97C 2AK1L 5C6PB 4D9RD 1EEZA 1MFNA 3IFOA 3TYFB 4RMQA 3O3BA 4JKKA 2BNUA 5I0ZA 1QFHA 5CIPA 1P7HL 3MLWH 4R96B 5JDSA 5AYQA 5TE7H 4DCQB 1F13A 4YR6B 3E6HB 4Z95L 3BE1L 3FFCE 4G6JH 3SY0A 5HVGB 4MCYB 1MJ7H 2NY3D 4HGMA 4OCXH 3FKUS 3SBWA 2NY2B 3DLQR 4DN4H 1J5OL 1IC5L 1MCPL 4EI6B 5J6HB 3MLXH 3GJFA 1LK2A 3KDMB 1FC2D 3GSOA 1Y18A 3MV8A 3KAAA 1A21A 5D7IA 6FABH 3VI4E 3P4MB 4KHXL 2AK4E 1J0JA 2ATPA 4DZ8A 5LGJB 2XYCA 4I18C 5EA0H 1XAUA 4WNQB 3BEWA 5E6IA 4RNRA 2G9HA 4KUZL 4Z7QF 3O8XB 1JI2A 2ZJSL 5IVXE 4YXKH 5ILTL 5FIEA 1WK0A 5L2JB 3CXDH 4LEXH 5F7FA 1Q0YH 4JB9L 4Z5RB 2OX5A 5CP7A 4H88L 5D7JD 3ALXA 1L7IH 1YNKL 5F6IC 4N9GB 2VITA 4TOYL 3QDAA 4YDIH 4WW2C 4J4PD 1N59B 1UKSA 4UT6H 5DEGA 2X1QA 1HILA 5CHNA 2VABB 4P2CG 5C86A 5KSVB 2C3VB 2GTZB 2YEZA 4CU8A 1I7UB 3IDNA 4MDJB 1MJ7L 4LLUB 4RSVA 2V2TA 5A2FA 4TUJB 3ZYZA 3QQ4A 5E2WH 4F3FB 5HHNB 5ENWA 2EO9A 5FUOH 3LEXB 1HHIB 3GMRB 1BFOB 5D2LA 5E5RB 5DHVB 3G04A 3U79A 5E2TL 1T21B 3C8DA 4JZOB 2DLHA 3HA0A 4KZDL 5DJ2B 3SCMD 4LIQL 4OQ1A 5D6CB 2ICWJ 1HHGA 3BN9D 4HV8A 5I1GL 4IMLB 5DF0A 5GGVL 3WLBB 2IAMD 4OFVA 4WCYH 3IKCB 2Y7QA 3STBA 2EC9U 1D5ZB 4XNUL 3S36X 3FN0L 3HMWH 1D9KD 1GZQA 1T1XA 3OAZH 3WIIH 4QOKD 3AY4C 3U1SH 2CRYA 4HWBH 3IETB 3UEZA 1LD9A 5DC0A 4OIAA 3JTSA 4LP4A 3ZHDA 2Y07H 2KBGA 5CAYB 5D1ZD 2ESVD 4LEOB 5D8JH 5ECJE 1F2XK 2ZUSA 4MJIB 4CADA 1BD2A 1A7BA 1ACYL 5F6HJ 5J6HA 4L3EA 5TGBB 3NN8A 1INDH 3BEVB 3C09B 3DX6A 3U46B 2FDBP 1T0MB 4QWWC 3IDYC 4P59L 4GAFB 4G6KH 1LO4L 3MFFB 1IGYA 5F7LB 1HN1A 3ZE0F 3MLZH 4GRLB 3HG1D 3JUYA 2YD8A 5JIPA 4NYLA 5H94B 4IJ3C 3VXTB 3TN0D 5C2BL 4TULH 2QEJA 3BGFB 3MRLA 3BAEL 3MROA 3PWLA 1M7DA 5K33A 1U8OA 3MUGB 4ACPA 3VU2A 3WIIL 1J1OH 2FB4L 5EPMB 1A6UH 4K3DH 5CEZH 4E41A 1P1ZA 4GW1A 4YHZL 3VXQA 2Y4SA 4GKZB 2D7MA 3O45B 1A9BB 1J0HA 1KIQB 1IKNC 1R5VA 2QJDA 3KLAA 4MJ5B 1S9KC 1G9ML 2X1WL 4UDTA 3K8MA 4RGMB 2LE9A 3IGAA 4PD4K 4Y88A 2X9WA 4K7PL 4OLWH 1Z9MA 3GSQB 3NCEB 3QEUB 3RGVD 3NCYP 4MJ6A 5C09B 3T8XA 2A6DB 4WFGE 1A1NA 4PJHB 4EXKA 4JN1L 2RQ8A 3VE0A 4ZUTA 1WGOA 4GKSA 1KLGA 1D6EA 3L3GB 2DDQL 3ROOB 4FXGB 2CK2A 4OF8A 3T1WA 3OKKB 1RZFL 1IQDB 1DP0A 2OJZL 5EN2B 3BPLB 4JKPL 3FQUA 3FT2A 3LDBB 5C2BH 4WO4A 2A73A 4LRNH 1FPTL 1OTSD 3MV7B 4MSWA 5E08L 2CMRH 4YNYA 4P49A 5BZDA 2VR4A 3B5GA 1R5IB 4JG1L 5DVNA 3DX8A 1BEYH 3VWKC 4ZDHA 3T0EB 2Z4QA 3H3KA 2AJSL 3HFMH 4WW2F 1CGSL 4AL8H 2HH0H 4QHNB 1ACYH 3ZE2E 4F7PA 3JXAA 3TEUA 3D69A 3VRLF 1JK8A 5A3IC 1XCQA 3EGSA 1KJMA 4ELKA 3D3VB 1XF3B 3OKEB 3SE8H 4MA8L 5DJ8A 5KSUB 5F96H 5K93A 2Q6WB 4R7NA 2XN9A 1ORSB 2WBWB 3OXRB 5GRVL 1ZLUK 4NN6B 3PP4L 3LKQB 4HIIA 4NRZA 4XC3H 4H25A 3S9DB 3JZ7A 4J3XA 2XY2A 3W11C 1A1OB 1ETZA 4XAKE 5EC2A 2XTJE 1T7VA 3LIZL 2BNQD 4NQSA 1I9IL 4ZD3L 4HFWA 4PJDB 4OV5A 2PW2B 5H35B 3DYOA 4F9LC 4CNIB 1FJ1A 4DGIH 2P48B 2APBA 3ZYOA 1QD0A 4NQVB 3WS3B 3W0WA 1P9MC 3MYZA 4HDIB 3HUJE 1OTSC 1A6TB 1X4ZA 2X4QA 2NXZD 1J1XL 1SY6A 4QTHB 4I48A 3CU1A 3VDBA 2PXYC 4YEEA 4KJQD 4LLVB 1QA9B 2X05A 2IAND 3JV6B 1UXWA 3IYLW 5DUMH 1JNHA 3ILQD 1OP3K 1A8JH 5I8EA 4JY4A 1U41A 4TNWF 3MSPA 4NM8L 1PEZA 5BMFH 1NC4B 4ODHL 5E8NA 2J6EA 4S1RL 2NY5C 2PYFB 4HWEH 5SV3A 2X4SA 4HKZA 5JXEC 3E8UH 3PHOA 4D8PB 3MA7B 1IAOB 1NKOA 4R96A 5JDJA 4XCFH 4WHTA 3G6JA 5L88H 1I9IH 3SKNB 3TJHD 2ORBL 2GITA 3BN9C 1NMBH 1T03L 3NZHH 2UZIL 2IF7A 5D2NA 5HHOA 1OGAA 1MHCB 3DV6B 4FQCH 4GS7B 4QOKA 1IM3A 3A0OA 2B20A 2Z91B 4QF1A 1BX2A 1RZGB 4HUMB 3GSNH 1T2XA 3PUCA 4RQQA 2BSSB 2Z93A 5C8JB 5F8RC 3VWKA 4F7CA 3W39A 4ZSOB 1PD6A 1AGFB 1JHTB 3G6AB 5E5MA 3P73A 4WI4A 1MCOL 3D1MC 5CBEB 1XF4B 2EDOA 2HYMA 1MAMH 3DVNA 4YXHH 3KPOA 3QULB 4Z6AT 3MRNB 5BRZD 1UWEH 3CD4A 1KN2L 5CUSH 1O7VA 1Y0LB 2FGWH 2MPAL 2ADIB 2MWCA 4NQDA 3UTTB 4L1DA 3D3VD 5FO9B 3CDYA 4X7TB 3NGBC 3QUKB 4ZFZB 4C55A 3INUL 1IT9L 4CU6A 4U1LA 2UVEA 4DN4L 1CTNA 1NFDE 3DNKA 1BHGA 3QIUA 1LO5B 5EBLA 1HILB 5CHNB 1CGUA 1V7ML 3MRLB 5DJDB 3SKJH 4KAQH 4S1DC 5F3HA 5K59E 1QNZH 5F1NA 4YHOL 4YUEL 1JPTH 4XC1H 4WFHE 3EOTL 1HHIA 3Q5TA 3ZHLA 1L6XA 3GSUA 4NKOB 1KV3A 4Z0XA 2BOCB 4P48A 4UQ2B 4YXKL 3OR6B 5BRZB 3G5VA 1KTLA 1A0QH 5T1DH 3MGTA 1I8LC 5C70A 3PWPA 4F58L 1TMCB 4YHIB 1TNMA 4F33B 5JOPD 3L3IB 2R56L 3KJ6L 3IXAA 4YDIL 1KPVA 2YD9A 4KUCF 4JREB 3MA9L 1U6AH 1QR1B 1T66D 4J8RA 3IETA 4EUPG 2B2XH 3G6JE 5MEND 3FQUB 1HDMB 3QO0B 2FJHB 4HLZG 4GSDL 5I1LA 2WIMA 2AJVH 4XCEB 4Y4HB 1T4KA 1BBJA 2HFGL 4P2RB 1HOCB 5DSCB 1NJ9B 3BIBX 3OKOB 5JO5B 4KTEL 1G7QB 5DJ0A 2VQTA 4UQ3A 5C0AE 2PN5A 5HI4C 1NFIA 1XF5B 1X3DA 4FN0A 1A6VH 1CDYA 1CIDA 4ALAH 4N90D 3LEYL 5IFHH 4Y5YC 4I0PB 4N68A 1KG0B 5DQDH 4FG6C 1N8ZA 2B1HL 3SBWC 4R2GB 1EUUA 2W9EH 2OP4H 4JPWL 1FYTD 1MNUH 2F58L 3CSYA 3M8OL 3WFCH 4YHZH 1JHLH 1KCRH 3O3BB 4UOW1 3ZLQC 5DTFB 5E03A 2XI9A 5DRNB 3MTRA 3GIZH 4PREB 4GG6A 3DX9A 1IFHL 1S9YB 1WSST 4O2FA 4UUJB 5ESVB 3P4NA 5IBTL 1BFTA 4P3DA 4AEIL 5C9KA 4HXBL 4JG0H 3BD5A 4OZIB 4KJQC 3TBVA 3ZT5A 1VACA 1DDHA 4DZ8B 1MJ8H 1U92B 3VD9A 5EB9A 1ND0A 1QTYT 4HZAA 1HNGA 3WJJC 4JPVH 5E8OA 5IVXA 4LEOA 2EDTA 4KI5C 5HGBA 1C1EL 4I0PA 2YD5A 3AGVA 2FGZA 2OMNA 5GSRA 4O4YH 2BVOB 3BEVA 1I8LA 4ZO8A 3U46A 4MMXC 1MNUL 2F58H 1TZGL 4WI9A 2UWEB 4PRDA 1BAFH 3GSXA 3PHQA 1EO7A 3GNML 4AIZB 3O6FB 3WIHH 3Q2CA 3P4LA 2HVJA 3CSPA 3GRWH 1FFPA 1B9ZA 1CFNB 4I3RL 4OGYL 1UYWL 3VGBA 2YA2A 3GSUB 4NKOA 1PG7X 3RA7L 5J11C 1VEPA 4GAYA 3F12B 3T65B 2XQYK 3HAEH 4Y8DC 3NGBB 4OFYA 5BOPA 3QEQD 1RU9H 5KS9E 5HY9A 3ARBC 4M6AA 1I75A 4OCWL 3KPRB 1E6OH 4KRPC 2G2RA 2Q7YA 4R7DA 4Y16C 1OF2A 5IJVA 3DURA 5EU6A 3CFKA 4RIRB 4ZO7A 4TQEH 4NWTL 3NAAH 1DE4A 2FEEL 4TPRL 4IRZL 4XZUB 1V3MA 1NANI 1DQTA 2AJSH 1GHFL 1RAMA 3QEQE 5LVEA 1T7YA 3MX0A 3A6CL 4HG4K 4POZC 4LU5H 5BQ7A 3BQUC 1ZGLM 3ESUF 4WTWA 1U8QB 4X99A 1VFOA 5CGYC 4K3EL 5EO9A 1CICA 4KI5E 5HDBF 5ALCL 4JHZA 4OD1H 5L2KD 4LDOB 1MIEL 1OGTB 1U8NA 3NZ8B 2X4TB 3FN3A 4HT1L 3L3HB 1G7MB 1YPZE 4QXUL 4EUPB 4MJIA 4FQLH 1TITA 5A1AA 1ITCA 2XWTB 4L3ED 4LSUH 3V8CA 1QSFE 3GSOB 1J8HE 4Z78A 2RBLA 1TZHA 2WV3A 1FL6B 1JZ3A 4HK3J 2NX5D 2H3NA 3TT1L 3V8OA 2FH6A 4L8CA 3RIAF 3NABH 5F7YC 4FQ2H 4RGND 1DFBH 5E94A 5IBUG 5A2KH 1EHXA 1QLEL 2ITDB 4LPUA 1JFQL 2NTSP 2GJ6D 5IR1A 3AMKA 3U4EA 1HIMH 2RCSH 1D9KA 2WANA 4HJ0C 4XNYH 3TH4T 3IXAB 3RPIB 2VDNL 4K9EC 4JRXD 4P3DB 4JDZB 3VMOA 1XR8B 5J6GB 1EJOL 3IRPX 1IM3B 4L4JA 4WI7A 1KULA 3MRPB 3LKRA 5D7IF 5EZLB 1KEMH 1TQBC 3BKCH 1EMTL 1KIQA 1R5VB 4MJ5A 4I9WE 5DUML 5ID0B 1CYGA 3R1GL 2Y06L 3QHZL 3PHSA 4AM0A 3PWUB 3MOAH 1CU4H 2NY1B 4N8CH 1JTPA 1W0YT 4RAUB 4X4ME 4PFEA 1D5IL 5GGQH 4OM1L 2LAGB 5J7CC 2BK8A 1HCVA 3K81A 4Z76A 1UH3A 4E5XA 2P7TB 3BMWA 2F54D 1HI6A 5FO9A 4FQIL 5F7UA 2UWEA 2ORBH 5CFHA 5F7EL 2MSPA 4L4TB 4ENED 3HMXL 4JO2L 4ZS7H 5JW4Q 2H26A 3GHBH 1L9MA 4JRXB 2MMXA 5EORH 4YBQC 2G60H 3BPNC 1MFDL 4ODHH 1L7IL 1YNKH 4J1UB 1FC1A 3RIFK 1NQBA 1SY6H 4OUUB 4QOKE 1QKZH 1G9EA 2HJFA 5A2IH 2LQRA 4NGHH 2P46B 1CZ8L 1JPGB 2GK2A 4LSRL 5D7IE 4Y4KA 5T1DL 4MVBD 1K4CA 3CAFA 3QG7L 4DK6A 2OL3A 2YPLB 5B22A 3HKFA 3D9AH 3VFWA 2VB5A 3ULVC 3S37X 3JV0A 1VA9A 1DQMH 5C0EA 4XT1C 1VGKA 4B7LA 4XPBL 3CMOH 1OTTD 1JPFA 4WWKB 3S36H 3VCLB 3SDXF 1FSKB 5HVHB 4JY5L 4OJFH 5KAQG 4M7ZB 3I75A 5TPWL 4NUGH 5EFIA 1U8HB 2BOBA 1PQZA 3O3AB 4U1KA 1BP3B 2JCCB 4ZNEA 4ZYKA 4DKAA 1NGWB 5KVGL 3DETC 4APQD 4LL9A 2B39A 3O6FC 4UIMB 2QR0B 2CDFA 3MBED 4LLVA 1S9VB 1A6VL 3MRJA 4U6HA 3OKOA 1M1SA 2A6KB 3C08L 1SBSH 4QHUB 4YDJB 5D8JL 4PYGA 4LKXB 4Y1AB 2ZNXA 2DQJL 2W0PA 1FSKC 2GK0A 3OKNA 3EFFB 4OIIL 5LBSL 2C26A 4P23B 4AG4L 2GW5A 2DKMA 1G6RA 3HG1B 2XXMB 3MUY1 5DJAB 1LO4H 2EE6A 1D6EB 3QJFB 1IGTA 3QSKB 3C5JA 1IEAB 2GY5A 2DMBA 4M7LL 5ICXA 4H5SA 3BD4A 3HCVA 3VFPB 2DQIH 5IWLC 1PBYA 3KS0H 2CXGA 43C9A 4JO1L 2OJZH 2DB8A 3B9EA 4BSJA 5D5MB 3KPSE 9CGTA 5DVKA 1F3DJ 1IGJA 1MLBB 2WWMC 3V6OA 2RB8A 5CP3H 3GEWB 3KR3H 4B5EA 3QNXA 2HLAA 1TDQA 4MXQD 5HHOB 4JFZH 1U8HA 2FJGA 5EULV 2HJLB 4ZUWB 1QUNA 1T0MA 1XH3B 2VDRH 4QOKB 1D6VH 1YYLL 2A74A 4QHLA 3O11B 3OAUH 4L4VB 5JHLL 4P5TC 3RAJH 4BQCA 4QRSA 3W2DL 2QQNL 4IMKA 1A1NB 3M17B 1N5AA 5CZKA 1CDCA 2GAZB 5J4MA 4O5LL 3OB0H 4PG9B 3MFGB 3AS0A 2GTWA 1ZVHA 3SCMB 3FQRB 2YA1A 5GSRB 5F96L 2ZUWA 1F4WL 3GMPB 1ORQA 4JREC 4GKNA 4Z7OE 1X5GA 4PJXF 3WFDL 4WO4B 4L3AA 3BDYL 4NQDB 3UTTA 4H26B 2NY1C 2Y72A 1MCWW 4LSTL 4ZFFA 1F3RB 2ARJB 2DICA 2AXGB 2GJ6A 4JFXA 4XAKD 4RBPK 4PS4H 3KPSB 4C56D 3O2DL 1JNLL 1NUDA 5FUZL 3HNVL 4QRTB 1AQDB 3PV6A 1V5JA 1WIUA 3MRPA 3MJ9L 2K3TA 1ONQA 3O41A 3UTQA 4HKJA 1JMXA 1S9YA 1HKLL 2ZNWA 1AKJB 1HHJB 5DRWA 3BPLC 3BZ4A 4S1SL 3QPXL 4ZAKC 3C9NB 1J12A 3UDWA 4GRWB 1U3HB 3UTSE 4D2NA 1J1PH 4WV1B 4OCYL 4P3CH 3OAZK 1F4YH 3FTGA 2AJUH 4CJ0A 3UC0L 5INCA 3WFDH 4PLOB 4S1RH 1QQDB 4QHMB 4FTVB 4ZG1A 4BA8A 4D3CH 4BK4A 1WFOA 1T1ZA 5DJ6B 1W72A 5ESQA 1WCQA 2QADD 3IDNB 4EUPA 3ARPA 4MZ2A 3DETD 4APQC 3ULVH 5IB2A 4GXVH 4ELME 5D2NB 1AR2A 4PV8B 4TSBH 2HMID 1RFDH 2DLTA 3O6ML 2VC2L 4JPKL 4XMKH 5ITBL 1DVFD 4Y4HA 4CVUA 3F5WA 5DQJB 3ARFB 5HYSB 1UGNA 2VLJB 4ODXA 1W8NA 2XQYG 1KLFA 3QXDA 3VGGA 3TVMC 3QDJB 3RNKB 2W0KA 1LNUB 3GSNL 1TZHB 2MQCA 1IGTB 4NWUH 3MUHL 4V2BA 5J57B 3QEQB 1FL5A 3BP4B 1R3IH 4Y4KB 2PUQT 1BF8A 43CAA 1E4KC 3EUUA 2MHAA 4AEEA 3HPJA 3MLZL 2A9NL 5K59F 4PRHD 4LASH 2YXMA 4LSSL 4PJBB 2V5RA 3ZDYE 1HINH 4GXUN 3MJ7B 5LG1A 2HFEA 3LRHA 3SN6N 2Q7YB 3ULUD 3QUZA 3DMMC 1AE6H 3OR7B 4LPCA 4FFYL 5ALBL 2HKFH 2BVPB 1KACB 3OKEA 5IB4B 5AG8A 2YZ1A 4PJGA 4TSBL 5GGTA 5FYLD 4KUCD 2FEEI 1NMCC 1MH5A 1SVZA 4P4KA 5GRYA 2ERJB 4JPKH 4RISH 4FP8H 5HTSA 2XZCL 3RKDC 4MNGA 3WS6C 3QQ3A 1JPTL 4NRZB 3FRUB 1E28B 3HPLA 4WFHD 4M6NH 3TO2B 4ENEC 4NFCA 3TZVD 1Q9WB 2VDMH 5MP6H 3WXVH 3B3IA 3V5KA 1RD6A 4I5BB 4HT1H 2FH8A 4MD4B 4IDJH 1N4XL 1A6ZB 2CUMA 3GMMB 1OAZL 2DJSA 3FO0H 4PJ5D 3VXPB 1CF8L 1Y6MR 3IDXL 2XXCB 5C07A 3V79C 4ZOEA