2CDGA

Structure and binding kinetics of three different human cd1d-alpha- galactosylceramide-specific t cell receptors (tcr 5b)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCAPFDRGSTLGRLYFGRGTQLTVWPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords TCR 5E
publication title Structrue and Binding Kinetics of Three Different Human Cd1D-Alpha-Galactosylceramide-Specific T Cell Receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2006-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdgA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cdgA02
4WTWA 5FDYA 1CFTB 5TDPB 3BAEH 4L8SC 5C08A 3RKDD 3VGAC 1WT5A 4FZEH 2MQ3A 4O51A 5F9WB 4HK3J 3CDYA 3X3FH 3UJIL 2JCCE 4ODUA 1I3UA 2X9WA 5DXWA 4QOKB 3D69A 3BUTA 1HOCB 3MMEB 3A67L 1JHKH 2Y06L 3RIFK 2BX5A 2HRPH 5D7JD 3IDGB 4IRJA 2QHRH 5HHOA 4RISL 4GMTL 1HH9B 1U3HA 2AK1L 1J1PL 5ADOL 5EUKB 1RURH 1TCMA 2AK4D 4L8CA 1K8DB 1HHHB 3D9AH 5DJXA 2VLRD 4ZFFA 5D7IE 1DSFL 2E3VA 4F9PA 3QHTC 1R3KA 2P7TA 3OX8A 4M3JA 5GS1A 3VXSE 1PD6A 2A9NL 4AEIH 5DD3H 1ZEAL 1AR1C 3V6BR 1KPVA 2PN5A 5I8KL 4YHLH 2GITA 3Q6FB 4HCRH 3S37H 3VFWB 5TPWL 2BSSB 4K9EC 1S8DB 2A0LC 3FB6A 2A6IA 4LK4A 2W9LA 5FKPB 4I4WB 4MNQA 2QADC 4NJ9H 2W65B 4JGJA 3H3KA 2UV3A 2O5ZL 1PYWA 4IIQB 4I77H 1RUKL 3PGCA 4L8DA 3PL6C 2IG2H 2HWZL 4U7SA 3NIGF 3P4OB 4ZTPH 1G0XA 4KTEH 3PWJA 3NIDF 4XHQA 4XPBL 1UWXK 5I73B 4GRWB 5GIRA 4JHZA 1FYTB 4DGYL 1NKOA 3M8OH 5D6CB 5M94B 1VESA 4CVXA 2VDKL 3Q3GB 2ARJB 2BVQA 2EDRA 1KCVH 1U8HA 4XP6L 2FB4L 5KS9E 1XFPA 4AH2B 5AYUH 5DF0A 2X1PA 2VISA 2HKHH 3H2WA 1S7VA 3TFKD 5A2IH 1ND0A 4HHAA 3DXAB 1SM3L 4QTHA 1S7TA 2QSTA 1BFOB 4JFEE 5HTSA 1G7JA 3BP6B 5KTEL 4MLIA 1U8JB 1R6VA 2PXYA 5EZJA 3TCLB 2CKBA 1S7RA 4YDLB 1I9RL 3EDDA 4J1UB 3MV7A 2DQJH 5FAAA 2YK1H 3WFEH 5HHQA 1JP5A 1TVBA 5H94A 1ZA3B 2FECI 4P5KB 2H8PA 3SY0B 1UEYA 1CGYA 2DYPA 1B0RB 2P5WE 3C5ZC 1ACYL 2ZKHL 3VXME 3GKZA 5D7KE 1FFQA 5DURB 4X7FC 4QRRA 3O6KL 3RGVD 1FL3A 4A6YA 4YAQA 1F13A 2E6QA 5MENB 1F6LL 4KGJA 5J57B 3UYPA 5IQ7H 3M17A 4G8FA 4WI8A 2MMXA 1CGUA 1MPAH 4Y4FD 2Z31C 4EUPA 4KVCH 2XRAL 3QXVA 1XAUA 3SGDH 1KG0B 1QRND 3OKKB 1MIML 3SDYH 2VERN 3MRKA 1QHPA 2ADIB 4P2QD 2XTJD 3FOMA 4JFYB 1GZPA 4ERSL 1MFAL 1FVDA 3BXNA 4G42A 3ZTJG 3OZ9L 2AJZA 2P49B 2HTLC 4HX1B 1Z9SA 4BM7A 5IOPB 3MV9E 3RL1A 1ADQH 1XGRB 1CK0H 5DD6A 1A1OA 4ONGL 5GGUA 4I2XE 5FO7B 3DROA 4UT9H 3WHE0 4ZO7A 4OT1L 5FB8A 1GOHA 4KAQH 3QFJD 4R3SA 5DR5L 4YO0A 1I4FB 4KKCD 4QTIH 3RDTB 4AMKL 4O2CB 1A47A 2BOCB 4OAWA 4U05A 1NAML 5F97E 4XP5H 4XNYH 2VH5H 3VXUD 1RZJC 3JV0A 3TJHD 3C08L 3U1SL 3GSRB 3ULUH 1EAPA 2LV4A 1MJUL 1EPFA 1M7DA 3DNKA 4OSUH 3FB7A 3OR7B 5JMRA 3KPRB 4M9OA 3D87B 1IGYB 4K7PX 1QLEH 4C4KO 3NA9H 3QAZB 4RMQA 4DK6A 4F7PB 3ZKMC 3FO1B 4AJ0A 4DAGH 4F33A 4JRXB 4XHJD 4MJ2A 1LNUA 5EU3B 5LQBL 4Z7WA 5GSVB 4V1DD 3PGDB 3D3VE 3MRMA 1WAAE 4W6WB 4MB4A 4NQED 3BIKA 1YNKH 2LQRA 1FCCA 1NEZB 3BJLA 3EYSL 2V7NB 2UYLB 5GGTA 5IVZA 4MXVF 3GUTB 1NCDL 3KPSD 5IV2B 2YMXH 2QQKH 3TBVA 5DD1L 3O9WA 1LEKA 1ZLUH 4H88L 4MJIE 5IKCB 3S88H 2JJUA 4JRWA 4HC1A 5SWQB 3B6SB 3HNSH 5IB3B 4LCWE 2BMKB 1HXYB 5D96C 3DSFL 4NZDA 3E6FB 3ULSA 4XTRC 1NUNB 1B9ZA 4XP1H 1S9VB 1TQBC 1FVEB 2ZCLL 4XAKE 1F6AA 5GGRB 2A2QT 3RPIA 1BVZA 1CLYL 2BOBB 3N1PC 3FN0H 4K94L 4RGNC 5C92A 1L6ZA 1M05A 2ATKB 3UBXI 1HEZA 2F5BL 3OPZL 1LO4H 4PLOB 5KSBA 3DOSA 4U2YA 4G9FD 1YEKH 1FSKC 4B50A 1YEHH 3UTSA 2EIBA 3N1GC 3QUZB 4ELKB 2I60H 5IB4A 1U8OA 4OF6A 4ZAKD 4N5EC 1EJ6A 4O5LH 3WXWH 4XPTL 4U1LB 3UP1A 5BCAA 4I0CC 4AT6B 3CPLB 4PB9H 3S7GA 4RFEA 4CU6A 3FQWA 2R1WA 4M93B 4DFIA 3WDHA 4PJAE 3WS6C 4URTB 1U92B 1CD8A 2OL3A 1GZQB 1QHOA 3BQUB 3ZDXF 5F9JA 3NCFB 1G7QB 2CLVB 4Z5RB 2IFFH 1PBYA 1J0HA 4JFFE 4ZS7L 3GSNB 3IDYC 3K4DA 1ZA6B 3QDAA 2V2XB 2XWBB 3MR9B 2D03H 3V2AR 4WFGD 4KZDL 4RMWA 1LE5B 4QGYA 1URLA 1QNZL 3BKJL 1Q9KB 2GK0B 3CFDA 2IBGA 3RWGB 4J7RA 4EDXB 2OK0L 2PO6A 4PRDB 4YX2H 5HD8C 3VGBA 2OCFD 4F7MA 3OAZH 5DTFB 5EC1A 4JZOB 4P23A 1NBZA 4POZD 5IMOB 3IRZA 3HG1A 4UT6L 2CQVA 4WFEE 3PABA 1FRGL 2UUDK 4NOFA 3X13B 4CDHA 2Y4SA 1A4KA 1F58L 4EUPG 4PRPB 2IH1A 4PB0L 5M95B 2UWEE 3OAUH 4GKNB 2ZCKH 2R9HD 5AZEL 1ZANH 1XIWC 4MAUH 3SCMD 4PP2A 1MCKA 4TVSa 4WU7B 5MHSE 1U8KA 2MHAB 1CBVH 5K33A 5ENWA 3VFRB 5I8CB 1P7HL 3KS0J 4Z78B 3ZLQC 3H42H 3H9SE 3V4PH 1YQVL 3QCVH 4BKLB 2DRUA 2EDYA 5BXFB 3R0NA 2HLAA 5FECB 1D3CA 3OKNB 1S5IL 1AY1H 4KK5C 3GMLA 3MJ9L 2XZCL 3O2DA 1N59A 2HT2D 1E6OH 5D7IA 3IDMB 2R4SL 1A7RH 1L7IL 4HKXA 3UPAA 4OV6F 1CVSC 4S11A 4F9LA 3BVNB 2C7UA 3CFKA 3WN5A 1I9EA 2C4XA 3QH3A 1JV5A 2IAMB 4XNZC 1N0LA 1ZWIA 4I13B 1MFEH 3THML 5T1DH 2P24A 3CUPB 4UV4L 4POUB 1TTUA 4L4VE 3ARZA 3WS3B 3IAGC 4YZFF 4PRAA 3DUSB 1RZ8B 4K9EH 3SDAD 1EGJL 3LKOB 3TNMA 3QIUA 4ZSOE 2XFXA 3WNMA 3VCLB 3WHE1 3DARA 3RNQA 3EDEA 1DVFC 3G5ZA 4PJ8A 4BELD 1KN4L 1UXSA 4PTUB 1T1ZA 1EMTL 2KL6A 2Y07H 1QFWH 1SY6H 1BFSA 2D0GA 3AU1B 1TLKA 1BF8A 4PLKC 5DVOA 1KJ2B 3ABZA 1JGVL 3FMGL 4UU9B 1FDLH 4U1MA 2X4NA 1SJHA 3B83A 1RK1B 3QRGH 1KV3A 1WISA 3VG9B 2VDRL 2B1AL 3QUXC 5ILTH 4QRSB 3QEHA 4GAYB 3CFEA 1L4IA 3BEWB 2OTWA 4JM2A 3RAJL 3ULVD 5GJTH 4PJ5B 3C8KB 5EU6D 1U93B 1MWAA 5E8PB 3UYRL 4OQTH 4GRLC 1W0WB 2NLJB 2G75A 4TSBH 2ATPB 3OR6A 1KJVA 3DX6A 1VGKB 2P5WA 4X8XA 1DQDL 2NY4C 1NGYA 1UACL 4MHHG 1LP9E 1EFXD 3CK0L 3VH8A 1UGNA 5FGBA 2LVCA 4JN2A 3K0WA 3D25B 2NMSA 1UXWA 3T8XB 1FPTH 1HZHL 2EECA 3KPOA 3IU3B 3U36A 4K3DH 1EA9C 3I85A 5HHNB 1IC4H 5ACZA 1XH3A 3T2NL 2CIKB 3P4MA 5L88L 5C0DB 5IFHH 1KIPA 5IMLA 5JORB 2G60H 4PV8B 4NUJA 1EHAA 3QUMB 1BOGA 4LLVA 2VR5A 1GHFH 1YY8B 1F42A 1MSPA 4P5MB 5B8CA 3MUGB 3QDGD 5HYJB 4ZNCD 3QDMB 4WI9A 1YZZA 3MBEC 4GMSH 3L5XL 5KG9B 4HGWB 4HSQA 4APQB 3F6LA 2IBZX 1DBBH 1ZGLB 3FAWA 1DN0A 4MXWL 2XYCA 5BZDB 4OB5L 4F7EA 1I3RA 1BLNB 4AIOA 5E03A 3SE8L 5ANME 3G08A 5I1CL 4WWKC 3AXLA 1HIMH 5MEOA 1FZOB 5J6HB 4OLEA 1J88A 4GUPA 3ARGC 4GRWF 1T66D 3GSOB 1GIGL 5F1IA 4PY8I 4HUVA 1TITA 3D5OF 5F3HA 4NO0D 3ILPB 3MRCB 3HI5L 1RIVH 5I8EA 1RHHB 1KEML 4PJ7E 1F00I 3KYMB 4KJQD 4JGMA 4LCUB 4NN7C 4X6FA 3SJVD 3KYOB 5D1XB 3MRGA 1RZJH 1TMCB 2F74B 4ZDHA 4G6AC 1UZ8B 5I75B 5D5ME 4O4YH 4RQQA 3HMWL 3RWEB 4DQOL 3D2UA 1AXIB 1LDPH 2J5LB 2XTLA 3RRQA 2VDML 5I2IB 2EE3A 5ITBH 2C1PA 3FL7A 4R2GC 5ITFB 3HE6B 4GJTB 3D3VA 4MMXC 5KN5A 3B2VH 4EI5B 5CGTA 1U3HC 2R0LL 3GGWB 2GAZA 5F8QC 1CFVH 5ISZA 2M2DA 1H5BC 3VE0B 2ADJB 4KRMB 3DX7A 2M1KA 5JZ7C 3CDCA 2V5YA 3NFSH 4KJPC 1F8TH 1JRHI 2YPLE 4X80H 3VFNA 2Y7QA 5DUML 4AENB 2XZAH 4MJIA 2JK5A 1ZHNA 4ZFGH 1UKQA 3QDJD 2FH8A 4LPYA 4BUGA 1AGFA 3LB6D 5CUSL 4KKAC 1A6PA 1WBYB 4LCCB 4OUUB 4PUBH 5FHAL 5EFIA 3QHZL 4UB0L 4X9IA 4UNUA 4JFZH 4DUVA 3RIAF 4PJ9D 1UJ3B 1LO5B 3QWRA 5DUPL 1MJJA 3CNKA 1L9NA 2R0KH 1CDHA 3G5VA 3TN0C 1J05A 1YMMB 4FFVD 4LVHC 1JVKA 1FGVL 4XB8A 5FYKH 3V79C 1X4XA 1N3NB 1GAFH 4NWTL 1FORH 1MELA 3DUUB 3BP7A 1IC5L 4Q9CA 4CJ1A 5HYSB 5IB5B 3P0YL 4IOSD 2BRRH 3PGFH 4Z7VA 4Z0BH 4MNHB 4HJ0D 4Y8AA 1YEFL 2DIJA 5CEYA 1BAFL 2ESVE 5EUOA 3UJTH 2DJSA 3BJ91 3TZVC 4CMHC 2Q1EA 3QXUA 4P3WA 1MUJB 1HHGA 4PJAA 1J18A 2PXYC 4KXZI 4LSVL 3L3KB 1T2JA 4I0PB 3ZKXB 1P4LB 2X6MA 3SKOB 1O7VA 1AGDA 1KB9J 2CO6B 2ZPKL 3CFIC 3EYVA 5E9DE 1S7XB 1U3ZA 3HNTH 4HXAL 3I6KB 4PRHA 5HDQL 4EI6B 2O61B 1Z3GL 4MWFB 4RNRB 2OTPA 2R56H 1CXLA 3VI4E 4WTZA 3OJMB 1R24A 2SEBB 3HE7B 3T3PF 4PR5B 5DSCA 3LKQB 4UV7H 4KK6D 1G9EA 3REWB 3VH8G 1WZKA 1YEDA 3AB0C 5EC2A 2W9EL 1NDMA 3RX7A 5JIHA 3MRRA 4HUNB 1I8LC 4WHYH 4K7PY 2AV1A 2H6PB 4PJGA 5K9OA 1OOAA 4KKLD 1INDL 1PFCA 2Z92A 3GBML 2DQGH 1KIQB 2J8UE 3GSVA 3IKCB 4WHTB 4ESKA 3BOVA 2DQCH 2BXYA 5L2KD 2D7TH 4Z77A 4OLUH 4JFQA 3QNXA 5DJCB 1DBAH 5TE6L 5DO2D 2FCBA 1HHKA 5EIIB 1MY7A 1FGNL 2YA2A 4GKSB 4P5TD 3K74B 1TDQA 1SBBA 2EKSA 2JJSA 3I50H 4KK9C 3I02B 5IJVA 3HN3A 3BI9X 3ALWA 4QCIB 1W8NA 2XA8H 4HIXL 3V52L 3RWCB 1RJLB 5I0ZA 5GGVY 5IBLD 3TBTA 2DM7A 3LS5H 4ENED 1S9XB 3IDJB 1B0GB 4I5BA 4EEEA 4D9RE 4YHYC 5T5NG 4Y5YC 1CTOA 3U6RB 1HHIA 5IESH 1BVKB 4KROC 4HIIB 5L8LB 2D4DA 2CIIB 1GOGA 4HWEH 1EX0A 3E3QC 4S0TD 5I1HL 2F19H 1EO7A 2R39A 3WIIL 1BBDH 3GO1L 1EHLL 3AAZB 5A2FA 3KHQA 2ADFL 1J0ZA 2ICCA 2ENYA 3LEVL 3VXPA 3W0WB 2HFEB 4UIMB 2GSGB 3UJJH 5DZNA 4OCWL 3CVHL 3V5DB 2XIDA 3B4NA 4PRIE 4D0DA 4JZJC 3VXNB 1ZVSA 4YDVB 3T1WA 2DL2A 2PTVA 3TV3H 8FABB 4ACPA 1U8LB 1X5JA 3O41A 2CUIA 3V6FB 2E6PA 5L2JB 4R90H 5BMFH 4N90E 4Y2OA 1NFDE 4OZHE 4DJMA 4JPKL 1MCPH 1ZE3C 2HN7A 3HFML 5DJ6B 3UTPE 1U6AH 3LKNA 2BNQB 3SDCB 2PETA 3C6SA 3ZE1F 1NGQL 1IC7H 1HQ4A 1PY9A 4NO2B 2J88H 4X6DE 3QHFH 4N0FB 1MRDL 3UMTA 1OAYL 4J2XA 1T89A 2JB5H 5DT1H 3ESUF 4NRYA 5DRXB 5FKAB 1SVZA 1CQYA 4HMDA 2J3SA 5J12C 4LQFH 2FYYA 1HYSD 3QG7L 5T1LA 4HFUL 4ONHA 1CLOL 2AVGA 4ZXBD 3BT2L 1S7QB 1R5WB 4Q9RH 1TZHB 5CILH 5HGHB 1F4XL 3QNZA 1I3GL 5BOZG 3TGXA 5C0JA 2D3VA 3GI9H 1OTUC 1H0DB 3MCLH 4J3VA 4H25A 3GKWL 2IALA 4LSDA 2XACC 4TNWF 2OJEA 4O9HH 2FX7H 3EYQD 5DURD 5I76A 4TNVK 4S1QL 4YJZL 1PW3A 1LEGB 3L3OB 4W4OA 4NUGL 2A6KB 5D71L 3L3DA 1EEUA 4HIEB 2EDDA 3ZTJH 5F3BB 2QSQA 1N4XH 3HZMB 2IADA 2AEQH 4TULH 3ARDB 3QUYA 5E8DL 1A7NL 1EIBA 3DV4B 4WTZG 1UH2A 4MCYA 4JHAH 5DMIL 1U2CA 5IF0A 1MY5A 5KVDL 5K59F 1ZAGA 2JCCB 4EIZC 3EDJA 1RJYA 2OXGA 5DMYA 4LHUB 1D5ZB 2VC2L 3MA9H 2DWDB 3UAJC 4FQ1H 5I18H 1X7QA 2X4OA 1UM4L 1X5ZA 3PHOB 4LLYB 3W5NA 1ZLWH 4NPYB 2Q6WA 5GRWA 4GBXB 4JVUA 2ZOLA 4K8RD 4Q7DA 4RZCB 5KVFH 2GT9A 2NR6C 2FATH 4FTVE 1ZGLP 3OKMB 3QRFM 1X4YA 1VCAA 5D5MA 1VDGA 4ZPTB 1QBLL 4TUJB 4XCFL 3MXWL 5CCKH 3O2WH 1S5HA 3DRQB 4JFHE 4YNYB 4NYLB 3H6JA 4U7MA 2A77L 3GMOB 43CAA 3VXSB 3WJLA 3ZE2F 3T0EB 2I07B 1YEGH 5D72L 5BV7L 3A0OA 3PDGA 3SPVB 5CD5D 3LH2H 4QYOA 4IM8A 4XVUD 5JOPD 2ZG3A 3RI5F 1ZLSH 3V95A 4PRNB 4RFNC 1AGBB 4MJ4A 3RUGB 4HKBA 2AJ3B 3NCYS 4IMLA 1A1MB 3LSOB 1NGPL 4NKDA 4JRXD 1T22B 2BJML 4OI8A 5I17A 3U0WL 4HH9B 2WNGA 3RVUD 4Q9QH 4I9WD 4KJWD 2A6DB 3ROLB 1KYOJ 1WTGT 2H26B 3SDDC 3BGMA 2EDBA 3GSWA 4TTDC 5ICZA 4GAFB 4HBCL 3GHBL 4WO4B 5JW5A 4BFIB 1JYXA 4NQVA 4Y19A 35C8L 4NC2B 1MI5E 4UDTB 4FOMA 3D18A 1OQOA 2V17H 4WCYL 3DURB 2MKLC 5FGCE 4PJEA 4CUCA 1O0VA 2YWZA 4YEEA 4PP1C 2I24N 3TA3C 3HRPA 3BEVB 3EYOB 4Y16C 3LD8C 1HSBA 5JPMB 1CR9H 4OGXH 1W72A 4UT7L 1RULL 3K4AA 1PDKA 1A6ZA 1MH5B 2X9XA 1I1AA 2EC9T 4XCCL 2D7MA 3QCUL 1JGDB 2OI9C 1D5IL 3K1KC 5IQ9A 1T04A 3LEYL 3HCVB 5IHZA 2QEJA 2IBZY 5DK0B 1GGIL 4NO5A 1OARL 4F7TB 2ZSWA 1XF2A 1YECH 5E9DA 3O3BA 4EIGB 1J8HE 5E24E 1JNJA 1MQKH 3RVTD 3TBYA 1D5BA 1WITA 1W2KT 3VGAB 4L8SB 2BNRB 4JQVA 3TIDB 2ZNXA 3BKMH 2XWTA 2AABL 2CDEA 4Y0GA 5FGBC 2OTUB 4FQCL 3RVWC 3T3ME 2E9WA 2X44D 3BQUD 4EDWL 3QFDA 1F3DJ 4QRTB 1U8MA 4ORGB 3DETC 4ETYA 2AXGA 4E5XA 3QO1A 2ZUVA 1X5IA 2BC4A 3AS0A 2BCKA 2VAJA 4G80A 1M6OA 1NSNH 3BYYA 3OKEB 5F70A 3V4VL 1JWMB 1V3JA 4LRNH 3WFDH 1LK3L 2GCYA 1TNMA 1C5BH 3EFDH 1MHPL 1GH7A 4C83A 3PDOA 1ZSDA 1F4WL 2VXUH 3U30C 1NC2A 4EUPH 1J8KA 3LVEA 2NCMA 1WEJH 3EGSB 3KPPB 4J12A 1KFAL 5DHVA 4PREB 2L7JA 3UTTB 1CL7H 2QADB 1ES0B 1YNTA 4XNMA 2EDQA 2YUWA 5TF0A 4JRYA 4CW1B 1TETH 5JW4Q 3OMZA 1WZLA 3PL6B 4DN3L 2EXWD 4DZ8B 1FZJA 2BK8A 1KCRL 4PPTA 2WQ8A 5I66B 3PJSA 1KN2H 3EIFA 5IFAL 4LIQL 3NZHL 4NWUL 4C4KT 3K8MA 4PBVC 3Q5YA 4M7KH 4M8QB 2IFGA 5I1GL 3B9KA 1CXHA 3ESVF 3GMQA 4XGZB 3FCTA 3DMMC 2APTA 3LPGA 1C5CH 1FNGA 3MACH 1BFVH 1EEYA 4OZ4A 3CZFB 2VXSL 5E8OA 4GFTB 4N0UA 4WNQB 3ARVA 1HDMA 2DN7A 2HJLA 4EXKA 3K7UA 5JLZA 1F6FB 4LCWB 1MIEL 3U2SA 5B21A 5FEBA 5K9QG 4K8RL 3WD5L 2XZQH 2IAMD 1OTTD 5J9PB 3L5IA 3UC0H 2L0DA 2C3VB 2R2EB 4AIZA 5E2TL 1KSRA 3BZFA 3C5ZB 5I1LA 4FP8H 3S34L 1WK0A 3TVMA 4JDTH 2G5BB 2GK2A 1R0AL 1AJ7H 4QRPE 5GGTH 3SGEI 1G7HB 5BZWA 3EJYD 3CGTA 2OSLB 4HAGA 4HXBL 1VGEL 2VE6A 3BDBA 3DVGB 5DZLA 4G5ZL 4OZHA 1D7FA 3CMOH 5ID1A 1T0PB 5D93C 5J56B 2P5EA 4HC1H 3G04A 3OAYK 3CDGA 4MQXC 3F12B 1WWCA 3BKYL 4YEFA 2X89A 3L6FA 2HT4C 4XMLH 4YIQA 2HFFB 3OTTA 2Z31B 3C6LC 5IBUB 4XNUL 5IIEB 4U6XB 4DKAA 1DEEB 5D1ZA 2RR3A 3I2CL 4GG6E 5TF1L 3RFZC 2R2BB 3PQYD 1L0YA 4TVPD 3WIHL 4JFPA 1NC4B 2X4QA 4MD5B 3ORJA 2DKUA 5TE7L 4ZOCA 3D1MC 1U36A 1OTSC 1AD9A 3HZVB 2E9BA 2PNDA 3EOYG 3IETA 5SWSA 5BRZE 3P0GB 1BD2A 4LLDB 4HS6B 2YC1A 1OPGL 3MGTB 4R0LC 5C0ND 1VFBB 3MBXL 4JFFB 1JNLH 3PHSA 1E27B 4PJ5D 1A8JH 1H15B 3AS2A 3MJ6A 3IFLH 3QA3A 4YWGH 3VXRE 5FCUH 4LLQA 2O5XH 1I7RB 4RAUA 3DGGB 4L3EE 1IEAB 2MCPL 2Q76B 4FFWC 5KANG 3CLFH 4PLJD 1KLUA 5HPMB 5JO5B 4JGUA 5FUOL 4TUKH 1HINL 4FXKB 4Y5VC 3H0TB 3ZDZE 1I7ZA 3VDCA 1K2DA 1WWBX 4ODXB 5HHVH 5DMJB 2N7BA 1MCFA 4IRZL 4OI9A 3SBWA 1A4JB 2WUBH 2W07A 3U0TB 3QNYB 4OIAA 1RVFH 5I1DB 4KI5F 3RZCA 3Q1SL 1RUQL 4LEXH 1H8SA 1T6VN 4K55A 1G9ML 5DEGB 5D1QD 5AWNL 1FFOB 2UWEB 1XCQB 2VSCA 3F7VB 3LN4B 3RY6A 4OGAD 4XX1E 4LLWA 5HYJD 4Y2DA 4ZS6C 4BZ1H 4I18A 3QDMD 4XXCA 3VMPA 5I71C 1U8PA 1JK8A 2DDQL 2QL1A 5D2NE 43C9B 1F4YL 1JF5A 3H9SB 3BWAA 5ESQA 5KSVB 3IDUA 2BY2A 3OB0K 5HY9A 4RBPH 5BO1H 4KQ4L 5IW6A 3IFNH 5SWZA 1G6VK 2F53A 3JUYA 3RWFA 1T1XA 5B3JE 3R0MA 2F54B 3GSNL 3MGOA 4LSSL 4N8VB 4Z7UA 5D96B 5HI3C 3ILQD 4NO3A 1WC7B 4J4PC 4P3DA 3IJHB 4UUJB 4JFDB 5FOJA 2LFGA 2YBRA 1E4XL 1TQBB 5HSFA 2CK0L 3LDBC 1H3PH 2JJSC 3PP3H 4XPGH 5C7XL 2W92A 5TDOB 2XI9A 1Q9OB 2H32A 5DJDA 1OY3B 3JVGC 4RGNB 5D1XD 3U7WH 4UOJA 2JJTA 4L4VB 3FFCB 3JV6A 1PG7W 3U48A 4C56B 5E7BA 5IFJA 3BPNC 4JR9H 1UWEH 1FSKB 2P8PB 5DFTA 3O3EB 5E56A 2QBWA 4P59H 2D4FA 1QBAA 4UNVA 3BP4A 4U3XA 2EC9U 2UY6A 1PGRB 4JO3H 3HE6D 4LCIH 3CU1A 3H7LA 5IWLC 4OGZA 5EWIH 4OF7A 1MCDA 1X5KA 3ULUF 3FQXB 3TBSB 3B2UC 3KYNA 2Y6SD 2BSTB 1AO7B 3QEQE 5DYOA 2PF6A 5EZOL 2IPTL 1IKNC 4NDMA 1JPFA 4WGWB 4FQPA 5HPOA 1DQJA 2AV7B 5F7YC 1CFSA 3VD9A 1BMGA 1FCGA 1KEGH 2MTPA 3IJSB 3LZFH 1BZQK 4H1LA 1MVFA 1I1FB 4BQBA 1AGCA 1MI5A 2DQDH 3MC0A 4YK4C 5HYQB 3HTLX 4NJAL 4WFFD 1G7IB 1NFIA 3TF7C 4QHMA 3IDYB 4XH2B 3W5MA 1YYLL 6FABL 4Y1AE 4Y5XC 4Z18A 4O2EB 1FZKB 2MKWA 2VABB 3LCYA 2WZPD 1G9NL 1LO0H 4PJFE 4D8PA 3L3IB 1RQ5A 3O4LA 1LK2B 3BKCH 5F7DB 4GW1A 5GGSA 4LSPH 3D0VA 3L1OH 2JCCF 1YMMD 1EHXA 1LP9B 4BSVB 5HXMA 1NAMA 4GLRI 4X0KB 3BPCB 3LPWA 4TSCH 2F9BT 3REVA 4HF5H 5FYLE 4UDUA 4QXUH 3MV7D 1I9JL 2E8ZA 2EYSA 5C0RL 5CJOH 4OF0A 5HVFB 1WGOA 1ONQA 2ZG2A 3AC0A 1N0XL 3MUHL 3O6MH 4FHBD 2DYPD 1XF4A 4HV8A 1LO3L 1J1XL 2EZ0C 1XIWB 3NIGE 5FUZL 2IQAA 5HGDB 4LVNC 3NIDE 1RZGB 3VWJC 4I0PD 2V2TA 3SDXB 3I3BA 1UB5A 5EOTA 5F7HA 5C0CE 3FRUA 3B5TA 3PWVB 1UG9A 1QTYT 5E8NB 4L5FL 5FYJE 1Z6JT 4KRNA 4M8VA 3OJDA 4TVPL 3RUGF 3NH7H 4K71C 1CXKA 5DD0H 3QPXH 1UB6B 2NY1C 3STLB 1O7SA 3TYGL 3TPUA 1ZS8B 3ARRA 3HE7D 4WTXA 1JZ8A 3CLEH 4N0RA 2Z93A 2ICWJ 1GC1L 4IOIA 3UTQB 3NCEB 1JNNL 4PIRF 1OF2A 4MAYD 3CDFA 5C6PB 5D7JA 4P9HL 2XKNA 2BNUB 2N4IA 4XNZB 1J10A 2APWA 4YPGA 5I30L 2D9QB 4PJ7B 1SEBB 3MNVA 1A14L 5I9QC 1CE1L 1FAIL 1WCBA 2BFVL 1ITCA 4ODHH 2UZXB 4NKMB 2FGWL 1FBIH 1XR9A 2GUOA 2MQCA 2VLRA 5DJ0A 4WU5B 1YEEL 4WRLA 3S37X 3MX0A 1QVOB 1U8QB 4P46C 4JG1H 3OV6A 4U0RC 1LO2H 1E4KA 2IQ9L 4HJGB 1KTDB 3IAPA 1M71B 2AQ1A 4JG0L 1DVFB 3MRPB 3L7EB 5F1OB 3C9NB 1DLFL 3BZ4A 1Q1JL 4NKQB 1QFOA 1BGXL 2J12B 5IB1A 3PWNB 3O11B 2OX5A 2V7HB 3QUML 2FEDC 1T21B 3QPQD 4ISVA 1FL6A 2YPLB 4L3CB 3V0AC 5IG7B 1B0WA 4HFWA 3SE4A 5T3ZL 4Z7OE 1PZ5A 3JTSA 1AD0B 2F8XC 4UQ3A 1T2XA 3QUXB 5CMAA 3B9EA 5KSAC 3IJYA 4XBGB 5D6DA 4OFDA 2A9MH 3WO4C 4M7JL 4MX7B 1GRWA 1N7MH 3S5LA 5GXBB 4C54A 4MNGA 2CPCA 4GRLB 3G5YB 5E94A 1IGFL 1PVHA 1WFUA 1FJ1A 4HUXA 3O9WD 4KI5D 5CGYC 4V2BA 4X7SH 3VFSB 1NDGB 1JNHB 1SYSA 2NY4B 2VLKD 4HK0B 3T65A 3MO1A 2NZ9C 3A6CL 1S7SB 4NBYB 4QRPA 3H9HB 4TYUA 4L9LA 1UYWL 2E27L 2Q3ZA 2YEZB 5FIEA 5ALBL 1D9KC 4S10A 4B0MM 5C2BH 3LEXA 5HJ3A 1UH4A 5GGVH 3OXSA 3ZTNH 4KHTH 1HYRC 4J3SA 3MYZA 5CJBA 1RU9H 4KJYB 3V5HA 1BJ8A 4EVNA 1BZ7B 1C1EH 4MZ2A 4HWNA 5HGAA 1OP3H 1ETZA 1BQSA 3HI6H 1OAQH 4GAGL 2I9LA 3W11C 4OZGE 3D85B 4LNRB 4LU5H 4OM0H 3HR5B 1YUHB 1IBGL 4MVBD 3FZUD 2HVKA 4OCSL 4LGPB 2ESVB 5ETUB 3RWHB 2JB6A 1MREL 3LS4L 1C7TA 1R5IA 4H1LG 5EOQH 3RGVA 1KIRA 2CUMA 3DYMA 3P73B 4LSRL 1JF1B 4XNXL 3OKOB 3MBEB 2BVPA 1S78C 4K3JH 2DTSA 2FHFA 2DS4A 2OQJB 1T03L 4MXVE 3KXFD 1IQWL 2Q20A 3VXRA 4QNPF 2B2XH 1QRNA 4WWKB 4OCMC 3MV11 4LPTA 3VFPB 3UDWA 4P2QA 4G3YL 5JW4N 1UADC 4KKBD 3ARGB 1U91A 4E41B 1WAAF 1X5AA 3MJ9A 4HT1L 3GNMH 4BZ2L 1J0JA 4JHWH 4S1RL 2X2YA 2L4OA 3MLTA 1MRCL 4U1HB 1N6QL 1YY9C 3K46A 1KCKA 4U1IA 4NN7B 3QFJA 5I8OL 4FQ2L 4TRPL 2QLVB 3ULUD 5GRYA 4X7TB 5DUBA 1N5YL 4KMTH 1V7NH 2GJ6E 5T5FL 3F7YA 2DQUH 1IGIH 1PKQA 3VXUA 4BK5A 4S2SB 4WUKH 2J8UB 1NMAL 5GGQL 4YR6A 5CZVH 2R2HA 5JXAL 2VLLB 1IILE 2KQMA 4R2GB 1PY4A 2QQLL 5EORL 3CC5A 3VD4A 1CFNB 1EGJA 1SJVA 2JTDA 3RIAK 3SJVE 4D9LL 1U3HB 3RVXD 1JGUL 3NABH 5EO9B 1H5BB 3QZWA 5IMKA 5LGKA 4I3RH 1FO0L 3IKKA 5LKNA 1P4IH 2B0SL 4L8CB 5LBSL 4MLSA 3ARDD 5DJYB 4E9LA 2B4CL 3TJEH 4HMCA 1FHGA 2GJJA 3OGOE 1VFUA 1B2WL 1UWGL 3BAEL 4V1DA 4WENB 4YGAB 3NACH 5DRNA 4FZEL 5F7EH 2GTWB 5CKAA 4NQEA 3ZDXE 1MHCB 4GRMA 2HH0L 5EPMA 1TJGL 1B6UA 1CYGA 5IHUL 3KPSA 4U6HA 3WYRA 3FTGB 4LEOA 4L8DB 2EO9A 3TN0B 2P8MA 1RURL 1I1RA 4PD4J 3TIEB 4LVHB 1Z9LA 4WGVB 3LRHA 3D9AL 1OB1A 3NAAH 1UM5H 4MD0B 4DTGH 4ODTH 4TOYH 4YUEH 5GS3A 4NN6C 3MNZA 2QV2A 3VXSD 2BVQB 5DS8A 3T0ED 5DD3L 5FDWB 4AEIL 3GK8L 2RGSA 5CBAB 2VISB 4PRIB 2X1OA 2VXTH 3ES6A 4JANB 4OZIB 3OKLB 5A16B 3TZVB 4CMHB 4NJ9L 3X11B 15C8H 4G9FA 2EH7H 1UWXH 4XCEA 4I77L 1NFDB 2PXYB 1S7RB 5C0GA 1XGYH 4XRCB 3MREA 4AEHH 2EYRA 2XN9E 4OLVL 3HNVH 4KTEL 5K93A 4ZAKA 3TNNB 5JDSA 3ZYOA 1DTUA 5H94B 1T1WA 4NQCE 2AJSH 3TT3H 3T2OA 1IGMH 3S5LG 3IDNA 4ZFOB 5ECJE 3GMPA 4X6DB 4GQ9L 5DC9B 1W0VB 2UWEF 5CIPH 2VIRA 3HPLA 4J8RB 2HKHL 5D8JH 3V4UL 3LRSA 1YN7B 4GSDH 1KCSH 3ZKND 5SX5K 1IL1B 3AB0B 4JFED 4PV9B 4MQ7B 1FVCB 2R69L 4ODSL 3WUZA 5TDNB 3ZMRA 3FB8A 1JRHH 3QCTH 5D1ZC 2YK1L 1BQHA 4UQ2B 1Z5LA 4KTDH 5DRZB 4JAMB 4MSWB 4YZFE 5IVOA 4HWUA 4IOFC 4MJ6A 2XPGB 3QIWC 1CD1A 5CP3H 2DICA 2X4SB 1FVDB 4G42B 3VXMD 3BH8A 1Z0NA 4P4RB 1KYOK 2H9GB 5D7KD 3RL1B 5I1IH 1A1OB 3ELAT 1P2CA 4HEME 4GW4A 4LL9A 3IU4L 1Y18A 5J3HD 4OCYH 2VDOH 1ZHLB 2FIRT 5EZLB 1NGXA 3V5KA 3FT4A 5JXEC 3ZHDA 2VL5A 3VJ6B 1MPAL 1B4JL 1XF1A 1T5WB 4KVCL 4OLYH 2AXJA 3O3DB 2D7NA 3SCMA 3SDYL 2FEEI 5LGHL 4QHLB 4NRZA 2IANE 4YHYB 3F58H 4KY1H 4Y5YB 2IH3B 4KROB 7CGTA 4XZUB 3MV9D 3ZZ1A 2CDFB 1L0XA 3BP5A 1CK0L 2KZWA 3OL2A 4RFOH 4UT9L 4HH8A 4KAQL 3T4AB 3V6ZA 4KXZH 3GI8H 4QTIL 4QOKE 4HKJA 1ACZA 3U9PH 2LTQC 3MLZL 4XNYL 4JE4B 4F7CB 5DQJA 5F6HI 1R5VA 4ELME 4DFHA 1AR1D 4NHUA 3ULUL 2XY1A 5FV2A 4Y8DC 4GG8B 5JUEL 4QHKJ 4JZJB 4AM0B 4PG2C 5EN2B 2A0LD 1JPTH 3QZWG 4NQDE 5EU5B 3BRGC 5CEZH 1RZ7L 4OLWH 4WJ5A 2QADD 2GIYA 3KJ6H 4DGIH 2VQUA 2Q8AL 3NA9L 1FV1A 3I84A 1LP9F 2VITA 3B5GA 3SDAA 3PL6D 4PJBB 4Y4KC 1CG9B 4J6RH 4XXDA 4P4KC 1EAJA 3ARFC 2Y25A 1QSFB 2FSEB 3RPIB 1KELL 3BHBB 4U1NA 5ICYA 1R3JB 4YBHA 4TN9A 3QIBC 1YNKL 4ZUTA 1S7UB 5IK3A 2EDXA 1HEZB 3OSKA 2CLRB 5KSBB 1NLBH 4TNWK 5F9OH 1RIHL 1S3KL 1A9BB 5C0AB 4I3SH 5CEXA 2LE9A 1DBKH 2IMMA 4U1SA 1NCAH 3S88L 1RPQA 5J12B 3SDXF 3S8WA 4GRWE 1LE9B 1FYTE 4QXTA 5IB4B 1ORQA 1U8OB 3HNSL 4AK1A 4LCWD 4L3AA 3GMMB 4M7LT 1SJXA 3H9YA 5AD0A 3DLQR 5EU6A 4FA8A 5IBTL 1T0MA 4XP1L 2AJUL 1UA6L 4XAKD 1L7TH 5FO9A 4FRWA 5I1AA 4R8WH 4K7FA 2AGJH 5E8EA 1DLHA 3DXAE 4MA7L 4OFVA 5I1KH 4EQ2A 3DWTA 3FN0L 4DW2L 1EFXA 3NCJL 2VDNH 1LO4L 1DUYA 1VEPA 1YEKL 1QRKA 2MWCA 4XP9L 3C5SA 4R4FH 1GL4B 1A3RH 3QO0B 4PJ7F 2X9YA 4ZUWA 1OAUL 4YHOH 4TPRL 1M4KA 5GPRA 2R23A 3BIAX 5H37G 4WUUE 4OCNC 4HBQA 4MDIA 3WXWL 3RTQC 5EBWB 3AREC 1A2YA 3RWJA 2Z31D 3BRFA 1J8HB 1CICC 4UBDC 4E0RB 4YHNA 3V0WL 4PB9L 4XMKL 3FT2B 4OCLC 3QDGA 1NC4D 4PGCA 3M45A 2HLFC 2WK2A 4OIIH 1KPUA 2LU3A 2HA1A 1SBSH 3VRIA 1W72H 4EZMA 5MENE 4F3FB 2HTLD 4FFZL 3RI5K 1VFOA 2IFFL 4LIQE 1MJ7L 4JFFD 3W9EB 1F5WA 1DFBH 2R1XB 3EO0B 1N6VA 3VFVA 5B38B 1BQHG 3MLYL 2D03L 1CDIA 4MA3B 2GJ6A 5LAXB 3FONB 4PP2B 4OUOA 4X83A 5CP7A 2YR3A 1DL7L 1RUAL 2D7OA 5TE4L 4NZJA 2WIMA 4FZ8H 4EOWH 8CGTA 1RK0A 1CFBA 2FR4A 3MODH 1ED3B 3SJVA 4HS8H 3BGFC 1X5XA 2HLAB 4RFNB 5E2VL 3CVHA 2EH8H 3QDHA 4UIKH 4WFED 1CE6A 4JO2H 5C6TL 3X3GH 1F4HA 3OAUL 3L9RA 2ZCKL 4JDVB 1JPGA 1A6UH 3CFKB 3PHQA 1JV5B 4R96A 1IAIL 3BDYL 3KPRE 5MHSD 4HKZB 1A6VH 3UPCA 1K4DB 1RY7B 3MRJB 3SDDB 3TM6A 4JQXA 2Y9RT 4PRAB 3W9DA 4JRXE 3H9SD 1JL8A 3QCVL 4HIHA 3ECBA 2UVEA 1XGPB 4U6YB 1QO3A 1TZIB 1YN6B 3J7HA 1T3FA 4MS8C 3T3PE 2ZUUA 1AY1L 3HI1B 3QDJA 2XFXB 2AI0H 1ZGLM 5DJ8B 1FL5B 3VFGH 1PX4A 1E6OL 4G6JH 4LSQH 4XTRD 2HVJB 5AG9A 4L9DA 1A7RL 4PJ9A 1T2QH 3TA3B 5D9SB 3FQRA 4WDIA 3EFFB 4Y16B 3LD8B 4YDJA 3UZVB 2FBOJ 2NY6B 1OSPH 3VI4F 3F7QA 2VR4A 4DGVH 2QR0B 4IRSD 5IW1A 4L4VD 2WLZA 3FFCD 4OQ1A 4ZUVA 1CDUA 4C56D 3QEHB 3CFEB 4NZTH 2J6EH 3E6HB 2Q7YA 2GEEA 3CFJB 2OI9B 4X6BA 3FQUA 4MDJA 3PWLB 2CJUL 4I48A 2XN9A 3T1FA 1FZMA 5F93C 1LEIB 2P1YA 4RMVA 1OHQA 3R06A 4N5ED 2ZSVA 1AGEA 4QT5A 3P4LA 3GSUA 4CMMB 5GRUH 3IXTB 2ZUTA 2J8UF 4M61A 2CDGA 5L7XL 4GG6B 1TJHH 3EOBA 4D94A 1SY6L 3UBXB 5C8JA 5JHDB 1FYHB 1IM9D 1O5DT 3U36B 1VEMA 5DMKA 1NMBL 4FQXC 4YHML 3CSYB 5ACZB 3UZQA 5KZCB 1LVEA 1AP2A 3P4MB 5GJTL 4UAOC 1KIPB 4PG9A 5GRVK 4WV1C 5GZND 4KH2A 4OQTL 4L3EB 2FO4A 2DQFB 4ZOAA 2H3NB 2DQTH 4TSBL 3EO9H 3TYFB 1FNEA 2PUQT 5C09E 3U30B 1B6DA 3RL2A 1JF6A 1AKJB 1T0NB 2I25N 4L29A 5IEKA 1DN0B 2OMBA 1C08B 4Y4FC 3EO1B 3WJJC 2DTML 5J1AB 3QUKA 3BZEA 3AXLB 1BM3L 3UJIH 3WXVH 4X4ZA 2XTJC 3A67H 2Y06H 1K5NB 4KHXL 3DV6B 4HDIB 5JPNB 1DUZB 5L2KA 2ID5A 2P8LB 2EDWA 3BIBX 2VZUA 1XIWD 4RISH 1C16A 4YXLH 2AK1H 5I8EB 3T0AA 5DJ2A 1J1PH 1N8ZA 2HTKD 5ADOH 4OZIF 4P5TA 1N2RA 2YPKA 2Z35A 3OWEA 1XGUB 4XNQB 4NC1C 4KUCF 1CFQB 2H2SD 3DMMB 4RQQB 3Q5OA 4PRPE 4Q2ZB 1CFTA 5TDPA 2A9NH 4JKWA 2XQBL 3FAXA 1NFDF 4KK5D 2IWGA 2IMNA 4P3CH 4X7CC 2F5AH 5C0EB 4CN6A 1HOCA 1CGWA 3MMEA 4BH7B 2GJZB 5ISZB 3O8XC 4N8PA 3IDGA 5KVGL 2V2WB 1GGUA 3VFTB 1HH9A 1RUKH 3FJTA 4NNYB 4X6DF 4LOUD 1JZ7A 4J23A 2PW1B 3GFUA 3RP1A 1NBVH 5EUKA 2JK5B 4XPBH 3H3PL 1D6VH 1RZJL 4LRIC 3S4SB 1K8DA 3C2SA 4XT1C 2N7AA 4ZD3L 5C0FA 3DX9B 1AGFB 3D6GA 2VDKH 2ZUWA 1LDPL 5ITBL 3LHPH 4XP6H 2FB4H 5D93B 5CLTA 5E2UL 3Q6FA 3VFWA 1AXSB 2BSSA 1S8DA 1KLGB 4FQJH 4HJJL 1CU4H 3B2VL 4KQ3H 4LDEB 5FKPA 4I4WA 3QEQB 4OFKA 3G5VB 2O5YL 3C6LB 4JM4L 5JOEA 3U9UB 1IGTB 1X3DA 3HAEH 4MCZA 3F6IA 1F8TL 2YPLD 2VDPH 4PLKD 1I9RH 2H32H 1QEWB 3CVIL 4K23H 1A3QA 3P4OA 3BD4A 4ZFGL 5K59E 1MLCB 2A83B 1I9IH 1FYTA 3R1GL 4PGEB 4Z0XA 4P49A 1KENL 4R0LB 5D6CA 4XI5C 1ACYH 5FK9B 3Q3GA 2ARJA 3TC9A 5IM7B 5CEYB 1HK6A 4AH2A 3IVKB 4JB9L 4JFZL 3O6KH 2ZCHH 4GRLD 4EQ3A 2C3WA 4PJFB 1Q9LB 4ZQKA 4HLZH 3DXAA 1U3YA 3T0BA 1BFOA 4Y5VB 5MEQA 1FNFA 1U8JA 4ZAKC 3KR3L 4ZOEA 4OLXL 5F9DC 3TCLA 3RA7H 3ZE2E 5JA8B 5HDBF 3EYVB 1GAFL 4J1UA 3DVNB 4H1LH 2XRAH 4QXGH 1ODAA 1MIMH 1ZA3A 3LIZL 3SY0A 4YFEA 2BRRL 1A7PL 3LY6A 1R24B 3PGFL 1B0RA 3HLAA 2UZIL 4UMGA 3FO2A 4H8WL 4IBLT 5GRXG 1WBXB 2YUZA 4PTTB 5BW7C 2ESVD 1YEDB 1BJMA 4OJFL 2DIAA 3PE9A 1V7ML 1JTPA 4OFYD 1HQRB 1YYML 4HPOH 4OIBA 2ZUXA 3MBED 2RBLA 3ARWA 1J12A 2BVEA 2XOTA 4NC1E 4FQQA 4YE4L 5C0CB 5I71B 3BE1H 1I3VA 1NAMH 4WW2C 5E9DD 3GSVB 3SGEH 1HSAA 1NCCL 3U1SH 2V9RA 3HNTL 4W6YB 5CINL 1D6EB 1KG0A 4PJBF 3OKKA 1MJUH 2HJFB 2ADIA 4JFYA 4JFQB 5HYJE 3JV4A 2AXFB 1MCOH 1HHKB 3QDME 5T3ZE 2B39A 3CX5J 4HX1A 4POZC 5IOPA 3S35L 1GXEA 1XGRA 2CLZA 3LDBB 2EKSB 3E8UL 5FO7A 5KSBF 3P0VH 5IJVB 4CU8A 4LKXA 5T3XH 1I4FA 1I85A 5LQBH 3OJVC 4JY4B 1GPOH 4O2CA 2BOCA 1A7QL 3SCMC 5I6XC 3SO3C 3HB3D 4JDZB 3BPNB 4Q6IC 2P45B 3F5WA 5F89B 1J0KA 3S96B 4X4XB 3O6FC 5EB9A 1NC2D 4R2GD 2WW8A 1YC8A 3AM8A 4IDJL 4NSKB 4G8EB 4H88H 3O3AB 3OR7A 3KPRA 1CVRA 4QWWC 1KBGL 3PP4L 4GH7B 5JZ7D 4F7PA 2VQ1B 3FO1A 3HZYB 4KJPD 1OLLA 1ZLUK 3DSFH 4JRXA 3I50L 3N9GL 4PJXB 1XMWA 5EU3A 2XA8L 5GSVA 2ZCLH 5J1TC 3PGDA 1WV7T 5D7SH 3WIHA 4YK4B 2NX5B 3B9AA 5CIPB 4KKAD 1X9QA 4K94H 1MRFL 2EE9A 1B4RA 1NEZA 2P48B 2V7NA 4D9RD 2UYLA 2R8SL 1E4JA 3OPZH 4X6CB 4NGHL 4Y5XB 3U4BL 3GUTA 5FA4B 5IESL 5IV2A 4ZFZB 2F58L 2DKMA 3SDAC 3CIQA 5ACMA 1KTLA 2EXYC 5SWQA 2BVTA 3TN0D 2DQIL 2QKIB 1BBDL 2BMKA 4WI3A 4XPTH 1HXYA 5E4EC 2FJGB 3V6OE 3E6FA 1MHEB 3VW3H 1HXMA 3B8SA 1FVEA 4F15C 2OZ4H 1P6AB 5GGRA 4HG4J 5T1KB 2HP4A 4PRID 2Y72A 2OBGA 3FB5B 5GS2D 2ATKA 2EIZA 1YMME 4OZGB 3TVMD 5GISL 3EHBC 4G9DB 2FYYB 3TZVD 5KVEH 4ZS7H 3ULVC 5BMFL 4DCQA 4N90D 4LVNB 3VWJB 3QUZA 1N6UA 3QNZB 4ELKA 4E42A 3TH4T 1P4BH 1U6AL 4U1LA 4W68A 2GKIA 5IT2H 1IC7L 1MFBH 4K71B 3CPLA 4B7IA 1Q9WB 3FO9A 1OGAB 1ZV5A 4YXKL 2NY1B 1DQLL 3QHFL 3VFUB 1U92A 1OP5H 1GZQA 3BQUA 1G7QA 1AQDA 4Z5RA 2WUCH 4LQFL 5HDOA 4NCC2 3SE3C 3GSNA 1FRGH 3OBAA 1W8OA 1F58H 2PW2B 2V2XA 3WHXB 4Q9RL 2XWBA 3MR9A 1WICA 1FLRH 5I9QB 2AJXL 1LE5A 4YQXH 4U4BA 5EIVA 1VFMA 3GI9L 1Q9KA 2GK0A 3MCLL 1UEMA 3U7AA 4P46B 4X7DC 4PRDA 4U0RB 4O9HL 3AY4A 3L3HB 5DTFA 2MNUA 2X4OB 2NPLX 4J3UA 4UTBH 4JZOA 4EN3C 3QI9D 5T1MA 5IMOA 2J2ZA 4MD4B 3VDBA 3RZCD 3HUJB 4QEGA 3X13A 1E28B 3SE9L 1N4XL 3BWUC 2ZOKB 5GS0C 4KUZH 4Q74A 4YXHL 4GKNA 2WWKO 3KPNB 3VXOA 3NTCH 2ZP0T 2WANA 4GLRH 4N9GB 3SGJC 5FUCC 1EEZB 4JHAL 5KSAB 4LKCB 3THMH 1Q72L 2X09A 2MHAA 4Y2DD 1NGWA 3WO4B 3VFRA 3MA9L 5I8CA 1S7WA 3KLAB 3PNWB 4FQ1L 2NY5C 2Y36H 5I18L 2XICA 2JIXB 4BKLA 5K9KB 1S9WB 3B3IB 1KACB 5BXFA 4GG6F 5FECA 3OKNA 4G8GE 5KVFL 4FTVD 4JKMA 1KJMB 1KN4H 1JUFB 1E0OB 1WFTA 3IDMA 4MA1C 4RGOL 3O2WL 1D9KB 1QSEE 4JFHD 3BVNA 4L4JA 2IAMA 1IAOA 5A2KH 5ICZB 1YQ2A 1MLBA 1I8MA 1G0YR 3CUPA 4KI5E 4ZO9A 1JGVH 2W60A 3FMGH 1J11A 2VAAB 2WBKA 3D0LB 3GMNB 5KJRH 4Y19B 3WS3A 1ZLSL 2B1AH 3DUSA 4U1KB 2D31B 3E2HC 4Q9BA 3RAJH 1S9YB 1RZ8A 2O26U 3WNKA 2AJYH 3ZDZF 3W0WE 1DE4A 3LKOA 3ZT7A 3Q6GH 4PJEB 3QQ4B 3UYRH 4OZFH 5IVNA 3DVFA 1NEZG 1I8KB 2EICA 2JKXA 4JLRB 2QSCL 1HSBB 4G6KL 3MJ7B 5DQDH 4NQCB 4PTUA 1VADB 4HUUB 5BVPL 3LMJH 1A6ZB 1Y6MR 4FFVC 1TVHA 3STZA 1PG7L 3AU1A 1QFWM 1BREA 2VR9A 1RFDL 4FNLH 2GFBB 3MLXH 4UU9A 4XVSH 3UXFA 1FFPB 1RK1A 2BNQE 2Z9TA 4QRSA 5CD3A 4Z7QF 5I15H 4GAYA 1EUTA 1QKZL 4PJ5A 3C8KA 4HZLB 1XF2B 1FAKT 1U93A 4M7LL 5E8PA 4WI4A 1W0WA 3IYLW 2NLJA 3FO0L 1OTUD 1OW0C 2ATPA 2FDBP 3T77B 1FP5A 2E7LC 1GGCL 4OGXL 3L5XH 4MXWH 3D25A 4YFLF 3MCKB 4E5XB 3T8XA 3QXDB 3IU3A 3SE8H 3UROR 1FQ9C 4NFCA 3ULUE 4DKFH 4LARH 1U41A 5C0DA 3WCYA 1DQML 4PV8A 4NQSA 1GIGH 4KK6C 5E6ZA 3QUMA 1J8HD 5DHXB 1IARB 1T83A 1YY8A 3N0PB 1UH3A 4P5MA 5FUCE 5FFLA 2Z4QB 4KDTA 5DK3A 3MUGA 1VPOH 3BKML 1E6JL 2VMFA 3OQ3B 2WBJC 5F1NA 2EE2A 5HYJA 3WE6B 3QDMA 4M6ML 5KG9A 3PIQB 4HGWA 1IEBB 3TBWA 3WLBB 3UAJD 4ZFOL 1ZGLA 4KKLC 4XNMB 5MI0C 3HMWH 5KBNC 1BLNA 2ICWI 3C87A 3NFNB 3MNWA 4L4TE 1NSNL 3GRWH 1FZOA 3B43A 4LRNL 5J6HA 3WFDL 2HJKA 1CXIA 4ONFL 5DO2C 4KWUA 1XF5A 2QSVA 4NN6B 2VXUL 1J0YA 2KUTA 3FN9A 3WUWB 3ILPA 3MRCA 3TO4C 4ELMB 1RHHA 1OGTB 5D70L 3KYMA 3MRLB 3FCTB 5DUMH 4JY5L 4LCUA 3KYOA 5D1XA 1FNGB 4PJFF 3FFDA 2F74A 3RPKA 5JQ6H 1UZ8A 4NQDB 4R4BB 3PF2A 1C5DA 3ARBC 3P3YA 1U95B 5CUSH 3VWKC 3GM0A 3RWEA 5CS7A 3G5XB 1BQUA 1TETL 5I2IA 5E0QA 5KW9L 1EV2E 5BS0B 5AAMA 4GW5A 3I3EA 3T0EE 5ITFA 3HE6A 4ZO6A 3G6DL 3GGWA 2DLIA 3RQ3A 5SV4A 1PQZB 5JW4R 3VE0A 4MHHI 4PJIE 3CH1B 3QXWA 2ADJA 3RUGE 3SDDD 3ARUA 4M7KL 4TTDD 4NKOB 1FGVH 4BFBD 3H3BC 5GJSH 1X4ZA 3RBGA 5TH2B 4AENA 4NWTH 2VE6B 3WLWD 1C5CL 2E7HA 1BFVL 1B3JA 5E5RB 2FD6L 5INDB 3P0YH 1IFHL 5DRWB 2P5EB 1KB5H 3G04B 4LSTH 5CJQH 4LCCA 1WBYA 2X1XR 3D39B 4OUUA 1UCTA 1YEFH 5DJAA 1YA5A 5JOFB 1BAFH 4OBSA 4P2OC 1P9MC 3W39B 4LHQB 4PP1D 5IVXB 4GKOA 1UJ3A 5D1ZB 1LO5A 3TA3D 2XZQL 1CF8H 4OF5A 1JCKA 4Y16D 4LSVH 4NRXB 3M1BA 5MERB 2NY6D 5F6IC 3MSPA 3QIWB 3U0PB 3KS0H 3BESR 4CADB 2E6JA 1QD0A 5IB2A 5ICXB 1YMMA 3IETB 4JDTL 1PLGL 2ZPKH 1AJ7L 4QRPD 1QP1A 1N3NA 2DI7A 3MROB 1NCWL 4N1HB 2GSIB 3L5HA 1A3LL 1WUNT 3DUUA 1PKOA 2CRMA 1WSST 1Z3GH 5HYSA 3X12B 4RDQF 4MNHA 1G7MB 4W70A 3ULVH 1X5LA 1KLUB 3CXHK 4IS6B 4WUUB 2NW2B 1FO0A 2FIKB 3V7AE 2CR3A 3P77A 1HYSC 2W9EH 1I7ZB 4NM8L 3TO2B 4ZXBC 1MUJA 4D3CL 5ESVB 5JA9A 1MAKA 5JHDD 3L3KA 3ZE0F 4I0PA 3MYJA 5FYJU 3VDAA 5BRZD 4H5SA 4LBEB 5I1JH 3DETD 3GBMH 1S7XA 2LABA 3F65A 3KPLB 3I6KA 2BNRE 4EI6A 4N0YH 2O61A 3EYQC 4MWFA 4RNRA 3T2QA 3VXRD 4PJXF 2HFGL 2SEBA 3HE7A 4L3ED 4PR5A 1RZKC 4Z7OF 1YNLL 3LKQA 1OP9A 3EOTH 1N64H 2LTQB 3REWA 1FGNH 2Z8SA 4DWHA 4MAYA 4TUKL 1AKJD 2OR8A 5HHVL 3CSGA 4X6CF 1JBJA 5FO8A 1H9VA 4HIXH 3VGDA 3V52H 5KSUB 3SQOL 1UFUA 5E00B 3CFCH 5CLWA 4RAVB 1CDYA 1FNSH 2H6PA 2V9QA 4N5UA 1KF9B 1SQ2N 5E6IC 2F53B 2R15A 4LEXL 5BVJB 3RWFB 1KIQA 3IKCA 4WHTA 5CSBA 3U83A 5J8OA 2GYSA 1ZHBB 4ZNEE 4Y4KB 1Q0XL 3B5HA 4P4KB 2YD6A 3ARFB 3HAEB 1V3KA 4U1GC 2VNCA 5DJCA 1UCBH 2ICEB 4I3GA 5EIIA 4PJDB 3QIBB 5GS0H 3UTTE 2NXYC 4BZ1L 1A7OL 3KAAA 4GKSA 3WKMH 1CT8B 1EHLH 4OD1L 4OZGF 1AR2A 3DMMD 2ITDB 3C60C 3I02A 4QNPE 3NN8A 3PXJA 3LEVH 2PYEE 2X1QA 3RWCA 1RJLA 1NCBH 3BP4B 3IFNL 4CVWA 1OLZA 2ICWA 1S9XA 3IDJA 5DGRA 2NY5H 3L7FB 4XPFH 3PDDA 3U6RA 3K2MC 1BVKA 1FFRA 4NDMB 4HIIA 1Q8MA 3MLRL 4QO1A 1GCFA 1CFSB 4R7DB 4ODWB 2CIIA 1G6RH 4JPKH 3HFMH 3OHXB 2YD4A 2VLKA 4OTXH 3AAZA 3RVUC 3O6LL 1VA9A 4P2RE 2W9DL 4KJWC 3GEWB 1I1YB 4GKZA 1QUNA 1B90A 2HFEA 1MVUB 2GSGA 2R1YA 1MCSA 4JQIH 1GJIA 4JO3L 4LCIL 1VB9A 1ZXQA 1MCWM 3VXNA 1C7SA 2P44B 4YDVA 8FABA 5C0IB 3RTQB 3AREB 3IFPB 3QEQD 1CICB 3QG7H 3IF1A 1CLOH 3V6FA 3BT2H 2EKJA 3PUCA 4YFDB 5CBEB 3MRNB 5B39B 4S1SH 5EU7C 1IAII 1KEGL 3LZFL 1OTSD 1I3GH 3REVB 3SDCA 1TZGL 5FV1L 3SKNB 2VDLH 1GSMA 2EYSB 3VFOB 3GKWH 1HI6A 1IAMA 3BMVA 3KXFA 4NO2A 3HUJF 5EOCJ 2G9HB 1DJSA 3LOWA 4Y1AD 5D7LE 4N0FA 1WWAX 4AL8L 1MF2L 1UJTA 2MQ0A 4PJHE 4S1QH 3PWUB 5DRXA 1P7QB 2V6HA 5FKAA 4GS7C 3HPJB 4F57H 4JFXB 1UB5B 3ZO0A 1L0QA 2LU7A 3S36H 4LSPL 3FRUB 3PG2A 3L1OL 5C09B 4MXQC 5I1EL 4NNPL 1S7QA 5IJKA 4IEFB 1TZHA 5HGHA 3UEZA 3JWOC 5HYSG 3RVTC 1UENA 1A7NH 1EO8L 4S0SD 1AHWB 1J0IA 4TSCL 1KJ3L 3BGFB 3UCRA 2J7LA 1R3IH 5FYLD 4QXUL 5DMIH 1CDBA 5FCSH 1RUML 5L6YH 4LMQE 1F02I 4OCRH 2EO1A 1EJOH 4XP4H 1RIUH 5FA3B 1WZ1L 1A6TB 2D9CA 4FQHB 1LEGA 3L3OA 2FWOB 4LLMB 4ZS6D 5J7CC 4PY8J 1WCBB 5C0CD 4Y4HC 1K8IB 1DP0A 2WSKA 2AK4B 1QBLH 3CZJA 1ZLWK 3SGKC 3MXWH 5FYJD 1N5AA 3ARDA 3HMXL 5C07B 3TPKA 2A77H 3DV4A 1WLHA 4WIQA 1JN6B 5HGBB 1SJEB 2OXHA 1IQDB 2MPAH 5D72H 3KNBB 3QPXL 5HGGS 1EBAA 4PJEF 5LGJA 3MRBB 2H2PD 3LQZB 4KFZC 2JCCA 4X99B 1Z2KA 4NHCL 5AUMB 5HI3D 4G7YL 3CLEL 4J4PD 1D5ZA 5IB1B 2DWDA 4G43B 2VXVL 4YHIB 3LN5B 2Y1VA 3PHOA 4ONOA 4NPYA 1SMOA 2BJMH 4POYA 4XPHH 4GBXA 4UI2A 1T7VA 4HFWB 2QHLA 3U0WH 3OKMA 4U31A 2EDOA 3JTSB 1LD9B 3DX8A 3GJFA 4ODHL 4TUJA 1U58B 2F54E 3IJYB 1TJIH 4QHKI 5FM8A 3DRQA 3P9WB 2BSRB 4YNYA 4NYLA 4JFDE 1EO5A 1Y6NR 3GMOA 4JG1L 3VXSA 1LO2L 5HDLA 1QA9B 4HBCH 3GHBH 3S3JA 3T0EA 2I07A 5FYKE 3SPVA 1NLDH 4MNGB 1R3HB 4LP5A 2OJZH 4RGNE 3B2UD 4HUXB 5HHXL 2HG5B 35C8H 4HQQH 2UZYB 4ZODA 5IMMB 1AGBA 3I6GB 5J0BA 5I16A 1SYSB 1G9NC 2VDQH 3DJ9A 3FFCE 3HC3H 4WY7L 4XVTH 5EA0L 3RUGA 1I8IB 2AJ3A 4C56E 2CH8A 1EXUB 4JKLA 3CX5K 4MA8H 1A1MA 3KPMB 3MUY1 3NCYP 5EU7E 1QFPA 5E1AB 1K4CA 3JTTB 3QQ9C 4GOSA 2NX5D 4K7PL 5DC0A 4FQXB 4D9QD 2A6DA 3KLDA 3LAFA 1HKLL 1AO7E 2I27N 4CN4A 4M1CC 2NXZC 3ROLA 2R0ZH 1FC2D 2H26A 4UAOB 1HILB 2ZWLT 4WV1B 2W91A 1N7ML 5KS9A 4WO4A 4XCCH 5DQ9B 4BFIA 4JKPL 2OYPA 5C9KA 2JB6B 3A6BL 2A73B 3WEXB 1TQCC 1WVZA 4YPJA 1SYVB 1A6AA 4UDTA 3ZYJA 3K4ZA 4JFEA 1UQSB 3WBDA 1OARH 3DURA 2DJUA 4X5XB 4Y4FB 5C2BL 4TUOA 3QULB 1JE6A 2AABH 5DEFA 5GGVL 2BDNH 3BEVA 4KHTL 3EYOA 5J89A 1RU9L 2NY2C 5JPMA 5C0BB 4P2QB 2XTJB 3FQTB 1C1EL 3T2PA 4EDWH 5ELIA 4XC3H 2BZDA 2RIKA 3HI6L 1OAQL 2J8HA 3VXMA 5TQ2H 4M1DH 2DIBA 4PS4L 1OSZB 3MLTB 1J7VR 1IMHC 1JGDA 4ELMF 3VWJD 1AC6A 3O0RL 3QFJB 3HCVA 4N68A 3NCBB 1FC1A 5DK0A 1IZKA 2ERJC 1QR1B 4K3JL 1GYAA 5A2LH 4JJ5A 4F7TA 3QR2A 1F4WH 5HI4C 4L8SA 2ENSA 2BNRA 4YR6B 5CJXC 4DKEH 2NY1D 1WBZA 2OTUA 3EZ8A 3T4YB 3CC5B 4Y7MA 4CDGC 3SDXE 2R0WL 4HG4K 3JXAA 1JHTB 1KTKE 4ZUUB 3LPFA 4QRTA 3BFOA 3O8XB 3BZDA 4ORGA 1D5XA 3FOLB 4DVBB 3QEUB 4JHWL 3KLHC 3MV9A 1A6WL 1RHFA 1JGEB 3MRHB 4KI1A 4DVRL 1XGTB 2BRQA 5D1QC 1RZKH 4NFBA 4I2XA 4HIJA 1M7XA 3VXQB 1JWMA 3DI3B 1OCWH 4V1DB 1KCRH 3MV01 4KMTL 1V7NL 1A1NB 2GJ6D 1X5YA 4NQEB 4LDOB 4NWUH 2IBBA 1IGIL 4P46D 5CZVL 3EGSA 3KPPA 5FYLL 1HH6B 5IVXF 4H20L 2FX9L 4ODVL 4PREA 5GSRA 4LFHD 1T1YB 1ES0A 1TPXC 3NABL 4OZFB 1WT5C 4FFYL 1U3JA 3GB7B 3CU7A 4HWZB 1KCUH 4CW1A 1P4IL 4D0BB 4Z95L 2HMIC 3PL6A 1QPPA 4WEUD 3UTZA 3IB4A 4K8RH 3WD5H 2JJVA 3T0DA 2BXZA 1G0DA 1SY6A 1CGXA 3NACL 3QEGH 5DS8B 4IRJC 5E2TH 1WAAA 2YS4A 4LHUG 5KSAD 5I66A 3HC0A 5FYJL 3ES6B 1OQXA 5EOCL 5AZ2H 1AXTH 4LPVA 4M8QA 3FN3A 4LVEA 1AQKL 5I75C 1R0AH 2KZ1B 1JPST 4XGZA 2GQHA 4HXBH 2JIXD 3FQNB 5I0DA 4F9PC 4YHZL 1OWWA 5CGYD 3CZFA 5E5MB 5GS1C 1DBMH 2NZ9D 4OQTA 4AQOA 4XC1H 1PSKL 4ZAKB 2AEPH 4DEPC 4LCWA 1XR8B 4DTGL 4HWBH 1D9KD 3P30L 3AMLA 2CMRH 4TOYL 4XNUH 1TTFA 32C2B 2PTTB 3I2CH 5J9PA 2R2EA 1E4WL 3NMEA 3T0WA 5J11C 3C5ZA 2VXTL 5H35B 3QQNA 3MV8E 4AG4L 1SVCP 2PYFB 4YLQT 2G5BA 2NY3C 2DJ4A 5DDHB 1G7HA 1JYNA 1QLRB 2OSLA 3MGAA 1OM3L 3MBXH 2EH7L 3DVGA 3OF6D 4XBEH 3CAFA 1XGYL 2VLME 1MCLA 5MEPB 4AEHL 2MCPH 5GQBA 3L3JB 1B88A 3GM8A 2XN9D 3HNVL 1Z5LB 1WJ3A 3F12A 4G6ML 4XWOC 4UZGA 4NQCD 1VACB 2HFFA 1HINH 2Z31A 4WW2B 2AJSL 3TT3L 1NBYB 4M62H 5IIEA 4U6XA 1IGML 1DEEA 2R2BA 2A1WH 3ZDYF 4FXGA 3PXHA 2EDKA 1NC4A 4MD5A 2CD0A 4HPYL 1TCRA 5D8JL 1MAMH 1KCSL 1D5MB 3BUYB 3Q1SH 4LLDA 4PJDF 1RUQH 4MMZC 3O45B 4HS6A 3MGTA 1VFBA 4JFFA 4LGSB 1E27A 4LCYB 1H15A 1BWMA 5AWNH 3OG6B 1LWRA 5E5UB 1CDCA 2CK2A 1I7RA 1VFAB 4LGRB 1JRHL 2YRZA 3DGGA 3FRPG 1IEAA 2Q76A 3QCTL 4CVUA 3EDKA 3SCMB 1IKFH 5HPMA 1ZLVH 3SO3B 5I6XB 5JO5A 4PGZA 2FHBA 1CXFA 3V7AG 3BSZL 4E41E 4Q6IB 1SMAA 1MCJA 2C3XA 3JWOH 4FXKA 3K81A 4NRZB 2IC2A 2YHGA 3H0TA 4U1JB 4CVZB 3B8YA 25C8H 4ODXA 3O6FB 2Y5TB 3U0TA 1BJ1H 2VTFA 1T4KB 4PJCB 3V8OA 4KQ4H 4K3HA 5I1DA 5C08E 1T7WA 1RAMA 2BSED 4N1EA 3CMGA 1ZT1B 3W2DH 1K85A 3OXRB 5DEGA 2P47B 4RBPK 4FABH 1XCTA 4OD2B 1FFOA 2UWEA 1XCQA 5K9QI 5DQJB 1BECA 4MAYC 1R5VB 1ZOXA 2CK0H 3SKJH 1HWGB 1AE6H 3F7VA 4OD3H 5BQ7B 1P6FA 4LHJB 4OLYL 5HHOE 5C7XH 1TNNA 2EIEA 5C9JB 4BQ8A 2ADGB 2IAND 3F58L 2HAZA 4KY1L 1KB5B 43C9A 3GMRB 3LRGA 2WWKT 3H9SA 4EJ1C 3CFBB 5KSVA 4HLJA 3SDAB 5B3NA 1GGYA 1CZ8H 4G8GB 1AC0A 1NUFA 4F8TA 1WIUA 1ROWA 3PV7A 2F54A 4U1NB 4KK8C 5E4EB 4QOKD 1WC7A 4GT7A 3IJHA 4X98B 4TQEL 2IPTH 4HMEA 3U9PL 4UTAL 1QSEB 5LXGH 5IK3B 2V5RA 1IM3B 1EFQA 4F15B 1NL0L 1NANI 3QPQC 1PX3A 2AXHA 2W0FB 4WI5A 5TDOA 3MRDB 2DOCA 3MJ8B 4NOBA 4YGVB 1JPTL 1IVLA 4NQDD 4IRSA 1Z9OA 4L4VA 3FFCA 4F2MB 4OLWL 2EDTA 2X1WL 1V3LA 2FJHB 4C56A 2FGZA 3KPTA 2P8PA 5HHPA 3O3EA 1K3IA 1TENA 4H0IA 5MP6H 3D48R 4MGXA 3LV3B 4KRPC 4X6EB 2E7CA 5EU6B 4J6RL 1G9NH 3KGRA 3X14B 4ZSOA 1H3XA 5KANI 1CWVA 3BW9B 4OZIE 3FQXA 3TBSA 1YEJH 4JPIA 4K2UL 2BSTA 3O9WC 5EIQA 3MOAL 1CD9B 4FG6D 4JPVH 2W0PA 1BX2B 2YPVH 2BY1A 2AV7A 4NZRH 1EFXB 2FHCA 4KC3B 3P9LB 3WS6A 1NLBL 3NZ8B 2XWJB 3IJSA 3VFMB 4I3SL 1CLZL 5CHNB 5EDXA 1DBKL 1IM9A 1WQVT 3JSSA 1NCAL 4QRQB 5HYQA 1UKSA 1NUGA 3VMOA 4ZUWB 3BD5A 1G7IA 1FYTD 3D39D 4XH2A 2EDLA 2OR9H 4MDIB 4BH8A 5D2LB 4O2EA 1FZKA 1LO3H 2VABA 3FZUC 1J1XH 2NY0C 4LAQL 5F7KC 3L3IA 3MXVH 2E8YA 3VXTA 4QRRE 2WP3O 3QDGB 2JLLA 1LK2A 4PGCB 2AGJL 1P5UA 1M7IA 5E6YA 3SKMB 3DXAD 5I1KL 3QJFB 4L5FH 5H2BB 1LP9A 2M26A 4WHCA 5F96L 4TVPH 2ZNWA 2X70B 3BPCA 4X0KA 3AROA 4EN3B 4R4FL 1U9KA 5JR1L 1NAKL 5IBUG 1GC1H 5JXED 4WUUD 3MRFB 3MLVH 2XNAA 4NO0B 1XIWA 5EO0B 4ZYKB 1U0QA 1F11B 4O2FB 5HGDA 1RZGA 1UZ6F 5I30H 3I75B 3P40A 1A14H 5EBGA 4OIIL 3PWVA 2BFVH 3WFCH 5E8NA 2DQEH 5MEND 1JWUB 1UVQB 1YEEH 4OF8A 1MCCA 2IQ9H 5ANMA 1C12B 1UB6A 2PO6C 4L4TB 3S3SA 3STLA 4D2NA 5C2UB 4JG0H 1JPGB 4YHPB 1ZS8A 1NJ9B 4GXVL 4ZUSB 4OKVB 3DHMA 1G6RB 1Q1JH 5DD5L 2X4RB 4LSUH 1BGXH 3UTQA 5ESAB 4N1CA 3BGAA 1UM6L 4MA1B 5TJWK 4J3TA 4R7NB 4P23C 1UKTA 1JTOA 5HDBE 5TFSH 2BNUA 2AEIT 2ZJSH 5KOMC 2LAGB 3KDMB 4PJ7A 1SEBA 3E3QE 3MODL 3F7PC 1JWSA 2YZ8A 4NN5C 4HS8L 4NKMA 3RDTD 2VLJB 3QDJB 4WU5A 4M5ZH 3EJJX 3Q0HA 5I74C 1QVOA 1U8QA 4UIKL 4JO2L 1XT5A 2DBLL 5BOPA 4Y4KD 4HJGA 5TGBB 1ZVHA 4P4KD 1KTDA 2JELH 1JFQH 1M71A 3ARFD 2MCG1 1IT9L 1DVFA 3L7EA 2VO5A 1VKXA 1Q38A 2FJFB 3PWNA 1G7LB 3O11A 3QIBD 3KPRD 1A0QL 1A6VL 2V7HA 5EBLA 1T21A 4PJIB 1QYGL 1DDHB 2YPLA 5ALBH 4L3CA 1MQ8A 4PJBE 2WINA 3P4NB 2RCSH 3S3PA 1AD0A 3FQUB 4F9LC 1KT2B 3QUXA 1MCIA 3DO3A 1QSFE 4N8VG 1FZMB 2CXKA 3WN5C 1GVIA 5GHWL 3VFGL 3N85H 5KAQF 4LSQL 1IBGH 4LLUB 4MX7A 3DBXB 5KSBE 1MREH 3LS4H 4GRLA 3G5YA 1T2QL 1OP3K 4HS3B 5C0AE 1AIFB 1WZMA 1FG2B 3VFSA 1CTNA 4QY8B 1NDGA 3UTSE 4RX4D 3F62A 4HK0A 1F3JA 1CIDA 1S7SA 4BFEA 3QIUC 4FMKA 3H9HA 1RZIB 2YEZA 5CWSB 1T03H 1MCQA 4PJ8C 2J6EL 1IQWH 4XMPH 1AP2B 2R29H 4PG9B 1OAZH 4TSAL 4CNIB 4G3YH 1BZ7A 3SO5A 1IJ9A 5INCB 1FFNB 2A6JA 3RTQD 3D85A 4HT1H 3GHEH 1YUHA 3HR5A 4O02L 1CICD 1T6WA 2ESVA 2YA0A 4S1RH 3RWHA 1RJZA 4N8CH 5GRUL 1HNFA 2NW3B 1J5OH 2RFXB 2WBJB 4XPAH 4JM2C 5J6GB 2HLFD 4OFYA 3C09C 5I8OH 3OKOA 3MBEA 5DA4A 3QUZD 1MCRA 3WNNA 1N5YH 5T5FH 5JW3H 2VOTA 2OQJA 3TH3T 5TQ0L 5FF6A 2DWEB 1QLFB 3CCHB 3EOAB 5MI0B 4X4YB 5ALCL 1NMAH 2BVYA 2CKBH 5I19L 1QFUL 4RWYH 4WWKA 5GRJL 5EORH 3VFPA 4ODBD 1R3LB 2LAAA 4NQXB 4WHYG 4F37F 4LVOC 3MRIA 1P7QD 4D9LH 1JGUH 5DJ2B 5T3XD 1YJDC 1FH5L 3RNKB 5FHBL 3RWIB 1FO0H 3TEUA 5C09D 4YBLC 1FIGH 2B0SH 1DBJH 3HG1E 4LAJH 4LASH 5LBSH 3TO4B 3WNLA 5DK2B 4GQPH 1BZ9B 5E2WH 4A6YH 1B2WH 1UWGH 1YDPB 4X7TA 4UINH 3ARBB 5DA0B 1NEUA 3VWKB 3UYOD 3MOBH 2HH0H 5B8CC 3WXVL 2PCPB 4Z76B 4S2SA 5EZIH 2J8UA 4KDWA 4P9MH 4N9OB 4NM4L 1TJGH 5IHUH 1T5XB 2VLLA 4L8BB 3T0XA 2B5IC 1CFNA 3OKDA 3O4OC 4YDIH 3KVQA 3JWDC 4RMSA 4YXLL 5EBMB 1J9CT 5JNYB 5EO9A 5HVGB 1H5BA 1X5GA 3L95B 2YKLL 4JY6B 1BEYL 4U6VL 2GTZB 3MA7B 4XCYB 2Q8BL 5C0FB 5DJYA 3B9DA 5C07D 7FABH 4OV5B 3HRZB 4PRPD 2PYEB 5LWYH 2FZ3B 4QHUB 4MS8D 2GTWA 3GK8H 4P3CL 1MHCA 2F5AL 3L3GA 5DLML 5ID0A 5EO1B 4P2OB 1KC5H 3A6OA 1WFOA 1I7TB 4WW2F 1T20B 3FTGA 4MCZB 1MCWW 4NT6B 2IPKB 5F6IB 4JHBA 3TN0A 4RGMC 1BVLB 1NBVL 4OLVH 3GBNL 3IXAB 3NA4A 1FN4B 3TIEA 4QRUB 2DL9A 1D6VL 4D0CB 3WIFB 4XBPB 1K9TA 4MD0A 4Z0XB 1WCQA 4P2RB 4ZPVB 3KWWB 1K6QH 4JZNB 1F90H 3LHPL 5FDWA 4GQ9H 1U8IB 5CBAA 4WEBL 4PRIA 4OZIA 4JANA 4EBQH 3V4UH 4ZQKB 4FQJL 4IJ3C 4LQ1A 1CU4L 4KQ3L 1ZT7B 3OKLA 1PJ9A 3TZVA 3WFBL 5A16A 3X11A 5MEQB 3EBAA 4ZXBB 3GJEB 1NFDA 2R69H 4ODSH 1NCTA 4M5YL 2VDPL 4XRCA 3EJZC 4JO4H 3UPRB 3EKCA 4K23L 1FNLA 2CKNA 4PJCF 2NNAB 3TNNA 4FQXD 1DCLA 1I9IL 5IW3A 3M07A 1BIIA 1P1ZB 1P7KA 3HLAB 3FO2B 4ZFOA 4YHKL 4C58B 4X6DA 1W0VA 2GY5A 5D7LB 3L5WB 3V0VB 2R4RH 2P4AB 5JHDE 2ZCHL 4J8RA 5DI8A 4PJHB 1YN7A 5FM5M 2QQNH 3IU4H 3MRQB 4M1GH 4JFOB 5DJZB 1X6LA 1MNUL 2FL5A 1IL1A 4PV9A 4KZEH 3P9MB 4FQQB 3DECA 3HS0B 4FQIL 4MQ7A 1GGTA 1FVCA 1RMFL 1I8LA 2VWEC 3RA7L 5TDNA 2BY3A 1B4JH 1HSAB 2P46B 4UQ2A 4QXGL 4NC0B 5DRZA 4JAMA 5E6IB 5LGHH 1Q0YH 4MSWA 5C0BD 3HC4L 4HAFA 3U4EA 2XPGA 3JV4B 4J3XA 4O00A 2X4SA 4X8JB 1WWWX 3RGHA 3DO7B 3DIFB 4P4RA 4BSWB 5K9JH 2H9GA 2Z91B 4PY7B 2CLZB 4U1GB 4P99A 5A2JH 4M6OH 5L9DL 4P57B 3QI9A 4OLZH 2OL3H 2NXYB 4LKXB 1KGCE 4HPOL 3U46B 1ZHLA 5EZLA 3DYPA 4NKIL 2D0FA 2H45A 4IDLA 3BE1L 1A5FH 1EDQA 3C60B 3MLZH 1NH6A 3VJ6A 3ULVF 3F5WB 1T5WA 3O3DA 3TESA 5JUEH 1MFCL 2M8XA 1IZJA 4QHLA 3MZGB 4Z7QE 1WIPA 1FG9C 1VSCA 1MCOL 1RZ7H 3MLWL 4Y5YA 2IH3A 5T3ZD 2C26A 3O8XD 1BWWA 3QWOB 4XZUA 2Q8AH 4APQD 4JN1H 2CDFA 5AEAA 1HHJB 2X7LB 3H7BB 3P0VL 3QQ3B 5CZXD 5DGQA 3T4AA 5T3XL 2WWMC 4FTVA 1GPOL 1KELH 4PLNC 1H3TA 3CSPA 4M43L 2BVOB 1K3ZA 4F7CA 5ISZE 3GSQB 1MHHA 5D2LF 1RIHH 1S3KH 4GG8A 4FXLA 3RJDA 1JHLL 4JZJA 5IR1B 4AM0A 5EN2A 1MEXH 2A74B 3QJHA 5EU5A 1IGJB 4PRBB 1KTLB 2J4WH 2X41A 2E5EA 5DHYB 2Q86B 4PJBA 4Q0XL 1BF2A 1CG9A 3BPOC 3FT3B 5IBTH 1HXMB 1JIBA 2AJUH 1MFNA 2OS7A 1UA6H 1QSFA 2FSEA 5D7SL 3BHBA 3GJFH 3O2DH 1IAKB 1R3JA 2EDFA 3EDFA 1RUPL 4MA7H 4EI5D 4XI5D 2AKRB 1S7UA 3QG6B 2B1HL 2WIIB 3IFOB 4DW2H 4IHOB 3NCCB 3NCJH 4IRSC 2EIZB 4DN4H 1OAKL 2CLRA 2QQQA 1A9BA 1Y6KR 2KH2B 1JPSL 4XP9H 5C0AA 3IGAB 4NP4H 4DCQB 4H8WC 4GS7B 3LKRB 3AVEA 1OAUH 1LE9A 4TPRH 5JHLL 4E42B 1J1OH 1KULA 4Z7VE 3GMMA 2VWEE 1OAXH 2DLHA 1ULVA 1T7YA 5EUOE 3V0WH 3VW3L 4XMKH 5DVMA 3FO9B 4G7VH 2VN7A 4YDKH 2OZ4L 4M03A 1XZ0A 3ROOB 3HZKB 4R97C 5AYQA 3OKYA 5AG8A 3P11L 4FFZH 1AQDB 4PGDB 2PR4H 3U7YL 1MJ7H 5KVEL 4PYHA 3PV6B 2BHYA 3MLYH 3QO0A 4PRHE 1KPRB 1P4BL 4Y4HB 5GZNC 1JZ6A 1DL7H 1T89C 5EBWA 2X4TB 4C55A 5IT2L 1J8HA 4E0RA 1MFBL 2EDNA 3FT2A 4MQTB 1MWAH 1RUAH 5TE4H 2VXQL 5IEHB 4M9PA 5E2VH 4DZBB 4F3FA 3RX5A 1MFDH 4PJGE 5T1MB 4X9BA 5GZOC 2WUCL 1RSFA 1Y0LA 3IDXH 3MLSH 1LILA 5JIPA 3W9EA 1EZVY 4PJIF 2R1XA 3EO0A 5C6TH 5B38A 3G6JB 4WFHE 4H26B 1KJ2L 1QQDB 1YJDH 4K07A 4LF3B 2B7DT 3VXOB 4MA3A 1FLRL 4ETQB 4ZOBA 3LKPB 1IAIH 2GHWB 4HUKB 5LAXA 3FONA 4YQXL 3GSXB 3INUH 3BDYH 4YFLI 1QZ1A 2HTKC 3MLUL 4UILL 4DOHB 2O93L 4W4OC 1NGWB 4FQLH 3O6FD 1A9EB 2I9TA 4Z6AT 1S7WB 3V8CA 2H2SC 1QBML 2AS5M 3BH9B 1ED3A 2NYYD 1QBBA 4UTBL 3RY5A 3QUYC 4QWWD 4JVWA 1MCHA 4NNXB 1HCVA 2HKFH 4G8IA 3ISWA 3JWDH 3IDIB 4MJ5B 4Z8FH 4NZUH 4KUZL 3EYFB 4JDVA 3DRTB 3NTCL 3ZE0E 4OKDA 1IAOB 1IGCH 5T33H 5FOBB 2W0LA 1MLBB 1MOEA 1I8MB 1QSVA 3JWNC 5LJYH 2COQA 3ETBF 4LOUC 4HKZA 3ALPA 2NXZB 2W60B 1K4DA 5DFVC 1OT2A 3MRJA 3SDDA 4RIRA 9CGTA 1UC6A 1HKFA 2IPUK 2Y36L 2YOCA 3NCMA 4XVJH 1TQCB 1XGPA 4PJXE 1DE4B 4U6YA 1TZIA 2EXYD 1YN6A 3ZL4L 2CJUH 3C5JB 3HI1A 1V5JA 4OCXH 2NX5E 4G8GD 3DUHA 3WJLC 4D9QE 2NTFB 5DJ8A 1FL5A 1XEDA 4BZYA 1BBJB 2OLDA 2HVJA 2EEBA 4X6CE 5CJ5A 1INEL 1QSED 1P69B 3TA3A 5L7XH 5D9SA 3EFFA 3PQYB 1TVHB 3GIZL 4Y16A 3STZB 2NY2B 2EYTB 2YSSB 3QXAB 1YEIH 1A64A 2QR0A 5KJRL 1AFVH 3O2VL 4JREC 3MV8B 1NMBH 5GGSY 3EHBD 4YHMH 5CD3B 4QF1B 3UO1H 4AY0A 1INQB 4M6NL 3E6HA 4OGYL 4AQ1B 2XZZA 3CFJA 3KYKH 2AJYL 1OWRM 3W0WD 3N50A 3Q6GL 3PWLA 2FX8H 4JCLA 1SEQH 1LEIA 3LKSB 3DPBA 2ERJB 3MCG1