2CDPA

Structure of a cbm6 in complex with neoagarohexaose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
STASIAVEAENFNAVGGTFSDGQAQPVSVYTVNGNTAINYVNQGDYADYTIAVAQAGNYTISYQAGSGVTGGSIEFLVNENGSWASKTVTAVPNQGWDNFQPLNGGSVYLSAGTHQVRLHGAGSNNWQWNLDKFTLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Family 6 Carbohydrate Binding Modules in Beta-Agarases Display Exquisite Selectivity for the Non- Reducing Termini of Agarose Chains.
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords BETA-AGARASE 1
total genus 30
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2cdpA00
1W0NA 4XUQA 4JKKA 4JHZA 5C71A 2DDUA 3I2GA 5G04L 4A45A 4ZY9A 5HPOA 2YFZA 2QQOA 3GDBA 3ACFA 3HJRA 3I97A 1JHJA 3HN3A 2VZUA 3T09A 3IAQA 4MADA 2WO1A 5LCWL 4PQQA 2EIBA 1DLCA 1J84A 1XNTA 2B4KA 1K12A 4JX0A 2HLEA 3PUIA 3I2HA 4CVUA 1GNYA 4QX1A 1JZ5A 2OKXA 4E8DA 1PX3A 4QB1A 4OYUA 3GM8A 4AAXA 3NQHA 3ABZA 1L7RA 2Y64A 3OBAA 2V72A 1UWWA 3CIHA 3U37A 5C7GA 5IFTA 3THCA 2QQIA 3LE0A 4GWIA 2J1UA 1UMIA 5JXJA 4D0QA 1SHWB 3SEPA 4GWJA 2XQXA 2YB7A 1CZVA 5JUVA 3W5MA 3T2PA 4LHSA 2WQ8A 1GOHA 3I3EA 3LEKA 2JE8A 4IUGA 3UETA 1XC6A 4XUTA 4A3ZA 5DMYA 3C7GA 3OEBA 1PMJX 3OGVA 2ZEYA 4CU7A 3WF4A 4KWUA 3EYPA 2L9LA 2WN3A 3I2IA 2ORZA 3CKHA 2VCBA 3C7HA 3I3DA 1UY1A 2VZRA 2VZTA 3WSOA 3CQOA 1UY2A 2W1UA 4OUEA 3K4ZA 5FUIA 1KGYA 3WNKA 3W5NA 1CZSA 2KD7A 2W47A 3VDBA 1JYXA 2VC9A 2R7EB 2ZEZA 2WDBA 1YQ2A 2LS6A 1W9WA 1P8JA 4QDRA 4CU8A 1NKGA 3ACHA 4DXRA 2VCAA 2J1VA 2X09A 1JZ6A 2QQJA 4PT6A 4XUPA 3VDAA 4W50A 1K42A 3NRUA 2QQNA 3OG2A 1PX4A 3HNYM 1GOGA 3PUHA 3T0AA 2BGOA 4DUVA 2W1QA 2VZQA 1JU3A 1R64A 1ULOA 5LA1A 5J1XA 1US2A 4UI9L 3WF3A 1SG3A 5DN2A 3DYMA 3T2QA 2VZSA 2QQLA 2XHNA 1CZTA 2VR4A 4W8JA 3VD7A 3C7EA 4GZ9A 2ZEXA 4XUNA 4LQRA 3WQBA 1JU4A 3HNMA 5DPNA 3WEZA 1IQDC 2ZEWA 1UYZA 1CIYA 4QX0A 5F7UA 3F2ZA 3GXUA 3HEIA 1O8SA 3LPFA 1JYNA 5C70A 2E31A 3ACGA 4LPLA 2W1SA 2ORXA 3FHAA 3OEAA 2WO3A 5I0DA 5B4NA 2E32A 3FHQA 5IJRA 5JXGA 4XZUG 2B9VA 3K46A 2Y6JA 4YPJA 3SKVA 2WBKA 3GGLA 5IHRA 1H6XA 3HPNA 2C4XA 1T2XA 4DUXA 1EUTA 3WNPA 3WNOA 3E1F1 2VL4A 4ZXEA 3UESA 1UYXA 1XNAA 2W1WA 2W9XA 2BZDA 2Z4FA 1JYVA 3THDA 3VD3A 3I3BA 1GOFA 3SKJE 4D8MA 2V4VA 3VD4A 3LPGA 5LA0A 2QQKA 1O59A 4QAWA 1SDDB 4XUOA 2W46A 1W8OA 1DP0A 1PMHX 4BDVB 2WN2A 5A1AA 3CMGA 3I2JA 2Y6HA 4QB2A 1KEXA 4ET7A 1CX1A 1K3IA 1HN1A 3ZM8A 2WZEA 2E33A 4OMDA 5DQ0A 1OF3A 5EIYB 1W9SA 4ZZ5A 2YG0A 2WABA 1NAEA 1MPXA 2DCKA 4M4PA 2J1AA 4XURA 1W99A 2Y6KA 2BGPA 2W3JA 4RYDA 3OB8A 1DYOA 3LEIA 5B4XA 2HYXA 1LNSA 2JKXA 3ETPA 2VZ3A 3DYOA 5EJZB 4BJ0A 1J83A 3JXSA 3K77A 4PF1A 2PQSA 2W95A 1JYWA 1WCQA 2VMCA 2RV9A 1GU3A 1TG7A 3I2KA 1JZ4A 4M4RA 2V5DA 1NUKA 5JXHA 4ARXA 1TVGA 4KI5M 2EIDA 3VD5A 3WF1A 3NJVA 3MUY1 3T2OA 3P6BA 2W94A 3VD9A 1OF4A 2VZOA 4JKMA 4MO3M 2E26A 2CDPA 2VZVA 2YFUA 3IDAA 4P02B 2Y6GA 4LKSA 3T0BA 2Y8KA 3MBWA 1GMMA 4P00B 1ULPA 3NJXA 2W87A 3MV11 3OGRA 4L0PA 4W4ZA 3WNMA 1JZ3A 2C26A 3A23A 3K4DA 2VZPA 5LA2A 3D3AA 2VZ1A 1UXXX 1UYYA 3LEGA 2EICA 4QB6A 1OT5A 3DYPA 3C7OA 3FN9A 3T0DA 4KMQA 2WO2A 4OMCA 1JZ8A 3ACIA 2DCJA 4TTGA 2QBXA 3MV01 1I5PA 1UMHA 2J1SA 3CZUA 3MO4A 4MGQA 2JD9A 4A42A 2WUHA 2X05A 1UXZA 1OD3A 1K45A 3BGAA 2VMEA 3A22A 2J7MA 4BK5A 1XPWA 5IFPA 4OZOA 3C7FA 4A41A 4FI9A 3A7QA 1UY4A 4P5YA 4JKLA 4BK4A 4CU6A 2CDOA 1NX9A 4RN5A 5HXMA 2WAAA 2VCCA 2YC4A 2C9KA 2JDAA 4DEQA 3P1IA 2ID4A 2VMDA 1H6YA 4QDSA 5G05L 3WF0A 4QDQA 1W9TA 4P08A 2WAOA 2VQTA 4CUBA 4UOJA 4A4AA 2VO5A 1L7QA 3T08A 2EIEA 2LW8A 1BHGA 3EB7A 1D7PM 4MOAA 4DXSA 2Y6LA 1JZ7A 4CUCA 3WF2A 2X10A 5CZKA 4Z2AA 1EUUA 4DXTA 3IIIA 4A44A 1RYYA 1F4AA 2W91A 2XONA 4TXWA 1OH4A 4QPWA 4AG4A 3C8XA 2J1EA 2RJ2A 3A21A 2VJXA 1JZ2A 5CYYA 2WYSA 1F4HA 3SEEA 3MUZ1 3BN6A 2VM9A 4MGSA 1UZ0A 1W8NA 5EJ1B 2BBAA 3I2FA 5IYYA 4QX3A 1US3A 3FL7A 4A6OA 3IAPA 2J22A 1GUIA 3HNBM 1UY3A 3WNLA 2BERA 2J1RA 3OGSA 1UY0A 2XOMA 5JXIA 5JR2A 3UNPA 2WZ8A 2J1TA 1JI6A 5JMOA 4HG6B 2VOTA 3NNGA 1WKYA 2YC2A 3AC0A 3CZJA 4BXSV 2ZXQA 3HOBA 4QX2A 4CU9A 1GQPA 2RVAA 2W5FA 4E8CA 4XVHA 1UX7A 1O8PA 3IB3A 4ARYA 2VQUA 3VDCA 4DEVA 4UAPA 2VMFA 3CDZB 2VTFA 4DUWA 2QQMA 3ECQA 3K4AA 3LQCA 3WNNA 3K75B 2W92A 4CUAA 3DECA 4ZZ8A 3J7HA
chains in the Genus database with same CATH superfamily
5JSRA 1SFYA 4RSUA 5T50A 3APBA 3ZPOA 5FR3A 4M3CF 3U4XA 3SLIA 3VZKA 2VUAA 1MS1A 4MLOA 4Y5SA 2VBPA 1VBA1 2MNGA 1AR83 1ULEA 2WL1A 5HPOA 1CAXA 3AFGA 2A3XA 1U5XA 3MIEA 4CP0A 5CISA 3GDBA 4XTMA 3ACFA 3U11A 2P4EA 5GLTA 3T1MA 3BYWA 2ZPXA 3KT4A 1C8M3 5FK7A 3JQWA 2HYKA 1DBNA 3ES4A 5D2AA 4DZGA 5CFDC 3NV4A 1AR82 1VBA3 4PQQA 4MG2A 4OFGA 3WV6A 1J84A 1V0AA 4AQTA 5FOJB 4MXWA 2XVKA 2D97A 5DG1A 4Q0UA 2FDFA 1HRI3 2ARXA 5KXEA 1PO11 2DU0A 1R082 2XUMA 3H8UA 2OIIA 4XJ8A 5A32A 3J7NA 4CEYC 3N7MA 4XMAA 4AR2A 4QX1A 4ES9A 3V0AA 3ITQA 3TN91 2AEZA 1PX3A 1CPNA 5F3EA 3ZYJB 3MYXA 5DZGA 4A7YA 1CESA 2GSYA 5L9VA 4IGOA 2WZR2 4Q4Y3 3OBAA 2V72A 2ZGMA 2ENRA 1UWWA 3CIHA 5A6YA 1VBB2 1C5HA 2NM1A 5IFTA 5IWFA 3TN93 4HSLA 2ZS6B 3MF6A 4GWIA 3SISA 2C1FA 4BQ3A 3SEPA 1G9DA 1AZDA 1YYNA 2E51A 2XQXA 2YB7A 3I7DA 4FOYA 3M4FA 3IT8A 4LHSA 2Q1ZB 4IE6A 2WQ8A 1VJ2A 5FPXA 5FUNA 1RXFA 3NO8A 3RNSA 2JE8A 4AF9A 5A1FA 3BODA 3KV4A 3RVHA 4CEWB 1XC6A 4XUTA 4A3ZA 2VQ0A 5FV3A 1TQ5A 3WQ1A 5FZ7A 2AEYA 2KR2A 1Y43B 1LR5A 4D7TA 4Z8BA 3ZXKA 5CKMA 3ILNA 4P9YA 4LIUA 5DG2A 4YG0A 2W52A 3T3YA 3SH4A 3UKVA 3N4MA 4XDOA 3E5QA 4LK6A 2XLGA 3N7LA 1LCLA 3FLTA 4QPGA 2KA3A 2BOJA 2RM22 4MXWB 1GICA 1POV3 3CQOA 2O1QA 4XJAA 2W1UA 4HFSA 3WSOA 4DMIA 1EAH2 4R9AA 2CY6A 1AR62 1J58A 3K4ZA 5F2WA 3I49A 1ENQA 5FUIA 3OPTA 2TNFA 1AL21 1AR61 2CNAA 5FPZA 2BQPA 2WR9A 3POBA 4CDUC 4XFBA 1RUF3 3VBFC 4DRRA 3AP5A 3Q8BA 1ZBE2 2VW1A 3IKWA 5FZ9A 3WR0A 2JG8A 2R7EB 2ZEZA 4X6RB 1SCSA 4UXAA 2IXKA 1YQ2A 3ZSMA 1WW4A 1KJRA 4EV0A 4EN8B 2ZHLA 1ULGA 2ZGRA 4DXRA 2VCAA 2RG4A 3QOPA 2ZACA 4EE2A 4Q27A 4XUPA 4H2AA 1ZZ9A 4R4XA 1K42A 4XZPA 1QXPA 2QQNA 1PX4A 4YVWA 2CSGA 5FY1A 1W9FA 2VZQA 1ULOA 3MW3A 4CE8A 1US2A 2DBIA 4JHTA 5FLIA 1DYPA 1SG3A 1YQ5A 4N7UA 1APNA 1FV2A 1PNFA 1V6OA 3DYMA 4CZSA 2FDIA 1W2NA 4YW6A 3JUUA 4HKLA 5IAXA 1HQWA 2DCYA 2QQLA 3HBZA 3ZFFA 2IXHA 1ZM1A 4FP3A 5I8YA 4NRMA 5IK5A 1VBC2 4NJ4A 1TMF3 4LHKA 2R1DA 4HT1T 2RM23 1KS5A 2NLRA 2VVDA 4W8JA 5JOZA 2ZEXA 4ORFA 4XUNA 3VBUC 1DG6A 2HEWF 2R042 1DCSA 4LQRA 1W28A 2WFF1 1LOFC 5DPNA 3WXPA 5F37A 4YW5A 1IQDC 3KD4A 2WLPA 5F5QA 2VY0A 2P3KA 2DVFA 5JI7A 1QJEA 2GZWA 2VAUA 5D8AA 3TN92 4G4FA 1CIYA 1GZCA 2PQQA 4K1ZA 4QX0A 4LMFA 3USUB 1AXKA 3KCXA 1X82A 2FHRA 4N9HA 3ST7A 4OQ8A 5FMBA 2XDVA 1PGW2 5F9TA 1JYNA 5C70A 4KBBA 2FDKA 1N1TA 2E31A 3ACGA 2W1SA 3MI8A 2ZOEB 1VRBA 1TMF1 1BLZA 3PUAA 1EY2A 4INDA 4ONUA 1JUIA 3LA7A 4GMP0 4RGAA 4DNYA 4FFHA 1BEV3 3O5SA 4AEJA 4XBNA 4WZFA 4KG8A 4AEMA 3K46A 2Y6JA 2BU9A 3NAPA 3PTYA 3POGA 4QXKA 1YCIA 2WBKA 5FXZA 3VDDA 1OLRA 1RHI2 1YUDA 2Y6FA 1VBA2 3B69A 1UMZA 3GGLA 2OZJA 5EHDA 2VTXA 4OVEA 2PHLA 2VH9A 4FOWA 4NRPA 2P3YA 4BQ5A 4GB31 2F4LA 2A6XA 2X5IB 1Y9MA 3A4UA 3HPNA 1W8ZA 1OKOA 2Z42A 1IPKA 3S7EA 3WNPA 3DXUA 5I0RA 1S2KA 3KSCA 1CX4A 2JDMA 4EN9B 5BYNA 4GJZA 4F7ZA 1UYXA 2ERFA 4Q29A 2JEMA 2A1XA 4RHV2 4Y1YA 3BI3A 1UPSA 1AX2A 3THDA 5F2SA 4XAEA 2GC2A 3T4VA 3VD3A 2LROA 1JUHA 3VBOC 1LHVA 1X8MA 4QQOA 1V9U3 4CDWB 3RWNA 4UF0B 2XJPA 2ZMNA 4BCUA 1C8M2 3JCIA 4H55A 4FCAA 1PVC1 4LT5A 5L7OA 5LA0A 1O59A 4Y24A 5T5JA 5SV8A 1DGRA 4WM7C 4FPHA 3ZSLA 3OSDA 1ZBA3 5A1AA 3HQRA 2NMNA 1ZZ6A 1S0JA 2QNKA 5E1RA 5CB7A 1IQAA 2QKDA 4XQWA 2AC1A 1LGCA 3HIFA 3ZSKA 1RUI1 1AYN1 4YZ1A 1KEXA 5FZEA 5JSPA 1JN2P 1H9WA 4IE5A 4CCNA 2WSUA 1KS4A 1MS8A 1BJQA 1LENA 1UNBA 1UQXA 3CF6E 3KV9A 4OMDA 3RZKA 5KC5A 1X8EA 4DXZA 4CUGA 4GH4C 4M4PA 3RJRA 2J1AA 4MGZE 1RUD1 2GDFA 2NMOA 4CCKA 2WNEA 1HN0A 3V0BA 1H2KA 4RYDA 1R093 4NMIA 5FMOS 3OB8A 1DYOA 1AR71 1N1SA 1Z7S1 1R083 2C6SA 5B4XA 4XF3A 4YM3A 1PO21 2JKXA 4QPIC 5FZLA 1RL3A 5C5TA 1J83A 1C1FA 1QH7A 4CEWC 3D5OA 4G9SB 3RS6A 5A7PA 3AYCA 1JYWA 5HBAA 3KWVA 3POFA 1XQNA 2JXAA 4BA6A 1WCQA 1B35B 3DPRC 2VMCA 4QHZA 1CGPA 3I59A 3ME2A 1QOSA 3M7AA 2RV9A 1QXJA 4ZONA 1LULA 3GBFA 1TG7A 4LO5B 3I2KA 2Z69A 2A7AA 4M4RA 3JD71 2V5DA 1NG0A 1NUKA 5FZAA 4XXAA 2DF7A 3PMSA 3ZXDA 3JD72 1PK6A 3WF1A 1ZRDA 1QY4A 3TEYA 1CN1A 2ZHKA 1PO23 2W94A 3LKJA 1RIRA 4LTAA 4JKMA 4NR1A 4QD2A 1NLSA 3OUIA 2YFUA 1WW6A 4Z1VA 1NQJA 2G4IA 1CONA 1RUH3 4P02B 4B4PA 3D4KA 4LKSA 3T0BA 4CDQC 2Y8KA 4K8FA 2D3PA 4BPZA 4R9DA 1AR63 1OOPB 1R1A1 3N3HA 1GMMA 1DZRA 1ULPA 1PO22 2VOKA 1VMHA 4Q8KA 1OHFA 4OCTA 2C26A 5FMDA 1UX6A 2RJLA 2VZPA 3O1SA 1RTVA 5LA2A 1M06G 3I3QA 4AI2A 5FO8B 3M3CA 4DPNA 1OH3A 4GXLA 3HAGA 4IV3B 4OHZA 4CPBA 4OHWA 3LEGA 3QACA 4R9CA 1OT5A 3DYPA 3PDQA 1QQP1 4N43B 2B7YA 2Q8OA 3VBHB 1NZIA 5DZEA 4AE2A 3ZFEB 5HV4A 1DDLA 1RJ7A 2WO2A 4OMCA 4RQPC 1VE0A 3UKNA 5D21A 1JZ8A 5FZBA 2Y26A 1AXZA 4E4HA 3BIEA 1ALYA 3GHMA 4YG6A 3RZZA 1HB3A 5FZ4A 2J1SA 5A33B 2XLAA 4S2DA 2E7TA 3KM5A 4NN0A 1UO9A 3LOBA 4A42A 3M70A 3ZYFA 2X05A 3DL3A 1OD3A 3BGAA 4PI0A 2QTWB 1AHSA 2OVUA 4B1LA 1YRZA 3O1VA 2K0GA 1SDWA 4YZ5A 1FATA 5IFPA 4WBBA 3WUCA 1GFF2 1WZXA 4OZOA 4NWWA 4FPLA 3RZHA 1O4TA 3CNAA 5JDBA 2ZX3A 1UU4A 2WNUA 1JXNA 3H9AA 3Q9OA 2MEV3 2WLQA 4JKLA 3PUQA 5LASA 4QU1A 4OI2A 5T5LA 1H4GA 1K5MC 5KXDA 4FPYA 1ACCA 1ND2B 1YFUA 2JDAA 4YVWB 5JSOA 1FOD3 2ID4A 4N53A 4WVMB 3AKRA 2VMDA 1RUJ3 2JDZA 1H6YA 4QDSA 3AXDA 4DY5A 1OQ1A 5BNOC 1YI7A 3PVBB 4JQTA 2OQ6A 4L8QA 2VQTA 3VUOA 4A4AA 1NLQA 3T08A 2J42A 3N9MA 3BOPA 2JG8B 3UJQA 3KQRA 4GB32 2PLV3 4UFHA 2PELA 2A3WA 2ZGKA 4D69A 1HRI2 4QKBA 1YLLA 4IGQA 5KR7A 3Q8CA 5C33A 1H8VA 2GH2A 4AHWA 4XEZA 3WW2A 4P9JA 3MZHA 1AX1A 5C3SA 2A6YA 4X8NA 3FBYA 5CZKA 1A3KA 1AL23 1TME2 3AP6A 3IIIA 4JGYA 3R6SA 4S2FA 4A44A 1QJX1 2CWMA 1QF3A 1AJOA 1I9RA 3GF6A 4IESA 3THTA 3WVJA 2WWUA 4TLGA 2XONA 2IXLA 1RUC2 2PLV2 1OH4A 5FREA 3WNMA 1RUNA 3LIGA 2AR6A 3C8XA 4LJHA 1POQA 1VBD2 2QQWA 4KWJA 4ZU5A 5A7WB 5CADA 5HCAA 2Q1FA 4JQRA 1YFXA 2AENA 3VB9A 3OGGA 5J3UA 1IS3A 4IV1C 4K20A 2G1MA 5JR7B 1ZZBA 5DABA 1F4HA 1GKBA 3KT1A 1DYKA 2RMU2 3DN7A 1DQ0A 2P34A 4IV3C 4E2QA 2IUWA 1Y9GA 1OA4A 5FAXA 1BQPA 1QJU1 1OLQA 3ZYBA 3ZYRA 4AFAA 5FXXA 3OYWA 4QX3A 1QNWA 4BYYA 1HJFA 2YUEA 2BFUL 3POEA 5A3TA 1IKPA 2HWC1 3KCCA 5FIXA 3NL1A 5FYUA 2BYVE 1COV1 4B4RA 1UY3A 2VD7A 1VRH2 3FC0A 5A3LA 2P1BA 2VNGA 3AM2A 1DQ4A 3AB0A 1OBNA 4ISQA 1LGBA 1LU2A 5JR2A 2BTVC 3AYAA 4PBOA 3HBKA 2J1TA 2GN7A 2BNNA 2G9ZA 3VBRC 2VOTA 4TZDA 5AVPA 5FZDA 2RDQA 3T30A 3AC0A 4JAAA 3GCXA 2K2SA 2D93A 2NZ9A 4JVAA 3BPZA 3MPBA 4QX2A 2OYZA 4QQLA 1RUD3 1GQPA 4Y22A 1O3SA 1JYIA 3UL2A 5FZIA 3OPWA 3ZIWA 3RGBA 1E5HA 1BMV1 4E8CA 1Q8VA 4AXOA 3UJOA 5GKAC 1ZRRA 5BY5A 4NAOA 5C4WC 2GP3A 5TSWA 2ZGSA 1AUYA 4RS5A 2MHFA 4QQPA 1O8PA 2O0OA 5FYZA 1AYN3 3AFKA 3VZMA 4EZ4A 1U5ZA 2A6ZA 3G6JB 1UYPA 4UAPA 2VMFA 1S0BA 1W2OA 4DUWA 2LUWA 4FPGA 3VL8A 4CDUB 4OHYA 2CAVA 3EQEA 2BRTA 4RR3C 5FZCA 4B29A 2FZ2A 4H14A 1XNCA 3WNNA 5CG9A 4GH4B 5LA9A 2VOWA 3MPPG 2W92A 1YEWA 4ES8A 3E5XA 4BQXA 2RM21 5FCCA 4CUAA 2VU9A 2XVLA 2MEV2 2IXJA 3DECA 4HL0A 5FO9B 1GLHA 3AP9A 5FYSA 3HWJA 3IZOA 4YGCA 2EAAA 2XB6C 5C71A 1FMD1 2DDUA 3MFAA 3N9QA 3U75A 2HWB2 2RS33 2R073 1RUH1 1ZZ8A 5G04L 5LBFA 2YPDA 4ZY9A 3KVBA 4NIHA 3AMPA 3BIWE 1FX5A 2D98A 2QE3A 1MVQA 2QQOA 4GALA 4BIFA 1WD3A 4CCOA 1QNYA 1DQ2A 1RMU1 4Q4Y1 4FFGA 1PZ7A 4I0AA 3I97A 5FZ1A 3J7MA 4FPOB 4BM8A 1RVF2 3WP3A 3KHCA 1V6NA 3IAQA 1QJU3 2WO1A 3FHIB 4MADA 3K2OA 3FX3A 2VNRA 1DLCA 2EXHA 4K40A 1PGSA 5HCBA 1K12A 4JX0A 1IPSA 1W6NA 5E88A 4JGZB 3CEWA 1NA1B 4NWVA 1OOPA 3PIJA 1MR5A 1S4CA 3PUIA 1M4WA 4CVUA 2CWSA 3RRDA 3LF7A 3ZFFC 4EWDA 2D6PA 3LFMA 4LUKA 2OKXA 3ZSJA 2R0FA 2WQ4A 1YFWA 5LK5A 2R49A 2EF6A 3VHRA 5EYYA 5FP7A 1R081 3O1OA 2VCMA 2DFBA 3W9AA 1W0OA 2Y64A 4FO9A 1Z0HA 2D7FA 2XHKA 3OBZA 3OPZA 1G8WA 4XHBA 4IEXA 4X8PA 4D7YA 3THCA 1AR81 3LE0A 2J1UA 1ZX5A 3BKZA 2WFF2 5D8AC 3LSDA 5EJ3A 3IDCB 3WDUA 3FLRA 4CEYB 1VMFA 3O7OA 5JVVA 1SMVA 1NCRB 1W6NB 2P17A 1DZTA 4Q4Y2 4QQHA 1H1IA 1CZVA 5GALA 3VZNA 4ATFA 4K1YA 3BVCA 1BYHA 1W6OB 2A3YA 4SBVA 1GOHA 1RUE2 3LEKA 1RUH2 1S0GA 4IUGA 2K9ZA 3B00A 1Q56A 4P9IA 1IG3A 4BQYA 5DMYA 2JB4A 4JGZA 4N53C 3S30A 1UAIA 3OEBA 4OUMA 1PMJX 1HRV1 4YGDA 4N9IA 3U07A 2OS2A 5A1LA 3HN1A 3JD73 3V56A 1WCSA 4URTA 1SBEA 3J7LA 3PTRB 3WF4A 3LOIA 4XJWA 1G9CA 2F17A 4YW1A 1EP0A 2EA7A 5I0UA 3W58A 3GBWA 3RPQA 1MZEA 3C7HA 2UU8A 4CA9A 1HRV3 1SFPA 2DFCA 1GV9A 1XJAA 3AP4A 1LHNA 1PZ9A 1F31A 4MSVA 3RWKX 5BPXA 5K4LA 3SNMA 2GNDA 3J26N 4JGYC 4MYEA 4WVZA 2H6BA 2OUHA 2W47A 3I2DA 1X7NA 3VDBA 1MS3A 1C8M1 2W2IA 2YZ4A 3KVAA 3SCHA 4Y33A 3IMMA 2B39A 5D1IA 1W9WA 4A7ZA 3B5LB 3ZXJA 1QJY3 2CGOA 2OPKA 3OGJA 1C4RA 5L7OC 2QQJA 3FMGA 1XBFA 1PIV2 1AYM1 3EMRA 3H3LA 3OG2A 3HNYM 3PUHA 2ZAAA 2BGOA 4DUVA 1ND3A 5JXJA 5LW9A 3B9CA 2UY8A 5J1XA 1PM4A 4NUBA 1IS5A 1NYWA 5FPVA 1HRV2 2R1BA 4UI9L 4NE9A 4AVSA 5J96B 2XMLA 5IAVA 2BV4A 3THPA 3UT0A 4ZKTB 4CP9B 1NA1C 5ACA3 2VZSA 1ZBA1 3D82A 1S2BA 1FT9A 5KHGA 4YFWA 4YYOA 1MZ6A 1HJGA 4YG3A 4CDXC 3FE5A 1CZTA 2BOIA 4XMIA 1IHMA 2HWD1 2WNVA 3NNFA 1VLNA 2XR4A 1V6IA 4GZ9A 4LKFA 5KHIA 2PN5A 3MFCA 5F8PA 3H8OA 2YBPA 4XILA 3O14A 4GJYA 1GBGA 1AR92 2D6NA 2XBO2 1XXNA 4QXCA 1SEFA 3N35A 5IK4A 1BBT2 5DAXA 2QUOA 2PXJA 2XJVA 1VALA 1YXWA 5I8TA 4FTSA 5F7UA 1W39A 5F39A 1RUJ1 5FY8A 2G19A 4HANA 1RUC1 3UYJA 3M3QA 3LPFA 3AKPA 1BBT1 2DCZA 4E4ZA 1QJX2 1H4HA 3E97A 4QT6A 3LFIA 3BTZA 4UFMA 2RJKA 3FHAA 4L11A 1OMIA 1RHI3 5DAWA 2D6OX 1QJFA 3NV1A 5C6CA 3ZFGA 4BZ4A 5C9AC 5IJRA 1FPN1 4YRDA 1RUF2 1WW5A 5JXGA 1PNGA 1EPWA 2HEYF 1ODMA 4W6YA 5A7OA 4YPJA 3JBG3 3SKVA 1CVNA 4CPBD 4AI3A 4YWAA 1ULCA 2Q8DA 1GWLA 1RUI3 1N1VA 2I74A 1LHOA 5HCFA 1H1MA 2HWB1 4AGRA 5AC92 2JDPA 3ZOIA 3O1RA 3BUCA 2VMIA 2ZZQA 1IPJA 1B09A 4P9GA 3ZIXA 1ND2C 4R8HA 3OJBA 5JZGA 4YLZA 1ZRFA 1DQ6A 1RB8G 2AREA 2VL4A 3AK0A 2AZ5A 4M00A 5ISLA 1XNAA 1KXGA 2CYFA 3ORJA 2W9XA 1AL0G 1PZ8A 2BZDA 4KGGA 5FZ0A 1JYVA 1MEC2 3K48A 5AFBA 1F8VA 4EZHA 5AC93 3MW2A 4JV4A 5BXXA 4M3CE 2DUQA 4Q4V2 3JU9A 2XG3A 4H3WA 5CIRA 3POYA 3LWCA 1GOFA 1MZ5A 2RS51 5GZFA 1KQRA 2V4VA 1XE7A 2Z79A 4OI4A 1RVF3 2QQUA 1J3PA 2ZX1A 4O9EA 2ZBJA 5DUXA 3UGHA 2QQKA 3VD4A 3GNEA 1SDDB 5K8SA 3GJBA 4D6RA 4EROA 2W46A 5JIAA 3VBUA 1PMHX 3HQUA 2Y6HA 1V00A 3E6DA 1RINA 2ADEA 1W9YA 2WFPA 1PVXA 1K3IA 3ZFEC 1W3XA 2WZEA 4QMAA 4C0BA 3DKWA 1GZ9A 1DGWX 1ZBE3 3CJIA 1S0IA 3OTFA 2GU9A 3USUA 5EIYB 3RFRA 2TBVA 5KWRA 2YG0A 4FXKB 3VV1A 2QZ3A 4J6GA 2WABA 1YIPA 4BE3A 4D6QA 2RS12 1N3QA 4PLOA 1Q8OA 3OD4A 2GP5A 4TYSA 1W99A 4XURA 2CV6A 2GAUA 2XJRA 2W3JA 2WIIB 4N43A 3ZN6A 5KHJA 3LEIA 3WNXA 2HYXA 4D7SA 5L73A 5AC91 3VBUB 2D5HA 2UYBA 2HH9A 2XXZA 3DYOA 5EJZB 4BJ0A 4CDQB 2BUKA 4BHPA 3JXSA 4Y4RA 1XOYA 3K77A 1WD4A 1HQLA 4PF1A 1V70A 4B8EA 4YZ2A 4IE0A 1W6QB 5ACA2 2LRPA 3HT2A 4LBMA 4E2GA 1H8TC 1NZCA 5C8CC 2F6BA 1AYM3 1IOAA 4FOVA 3JBG1 3KF5A 1O4ZA 3QD6A 4TN7A 5J98B 3UKTA 5BNPC 5JXHA 4QPYA 4ARXA 4NVPA 1IGOA 5CFDA 3POIA 3NNLA 2VUJA 2JIJA 4TWTA 4CCJA 4DB5A 4Q1RA 4Z92B 3NJVA 3CJIB 3MUY1 4TLFA 5FY5A 3TB0A 2XUEA 4GD4A 2PLV1 3T2OA 3WINE 5A3MA 1O4YA 1BEV2 5J37A 5JIUA 1TZOA 1XE0A 2VZOA 4MO3M 3AMMA 2E26A 2VUCA 2RDRA 4I2OA 1ENRA 2YBKA 2AYHA 2BVBA 4P00B 4YFZA 1CAVA 2GALA 2YXSA 3NJXA 4MXVA 5IK7A 5C8CB 1O3TA 1SACA 1W8UA 1FV3A 1OLMA 2WZR3 3DEMA 4PDWB 1LOGA 3L2HA 4HSJA 4TSVA 4W4ZA 1Y4WA 4FPFA 4BH9A 3AL6A 4Y26A 4CXXA 1D4M3 2VZ1A 1HXS3 5FPUA 5LRSA 1UXXX 5FZMA 4ZU4A 1UYYA 4XQDA 2EICA 4K7JA 2VOXA 1UOGA 2NP0A 1H2NA 1GP6A 2JG9C 4QB6A 2ARAA 4Q2FA 5E6HA 3C7OA 4LLOA 3WQ0A 4CCEA 5B2GB 1K5JA 3ZYIB 3T0DA 2HWE2 3NSTA 4Z2WA 3CU7A 5FJKA 1GANA 4ITCA 5ABJC 2W08A 3VLBB 2RHPA 2YMZA 5FJHA 4J25A 4OULA 3MV01 3NNMA 1I5PA 3B7MA 4OLLA 4XDQA 4C0HA 1LGNA 3PLQA 4Q4W1 4V2WA 2ZX0A 4IE7A 4DY3A 2ZX4A 3M3EA 4XABA 3WP4A 1CWPA 1FMD3 1UXZA 4RGKA 2JDYA 4WM8A 1W6MA 4RHV3 1KITA 3EXUA 4I01A 5CKNA 4CDXB 3MLKA 3RDIA 4WVWA 4BK5A 1XPWA 2NYYA 2R6QA 5F3IA 1D0GA 4XOGA 5F6KA 4NHKA 4FI9A 3KGLA 4Y5TA 1UY4A 1PVC2 1B35A 1ODNA 4E27A 2OXBA 4R9BA 1X50A 1JHNA 4HETA 3POSA 4COZA 1WBLA 1W05A 5BNNB 5L36A 2WAAA 2ARBA 2OZ6A 2VCCA 2Z2SB 4PIYA 5FY4A 2C9KA 3VKFC 3ZSEA 5J48A 1PK6C 1ENXA 4F83A 5M0TA 1ONAA 1E5SA 3MIHA 2VQAA 3WHTA 5C5UA 4XF9A 3AJYA 3ASIA 3VBOA 1W9TA 2UYAA 3ZXLA 1XYOA 2UURA 4QKNA 4CDWA 1PMIA 5I91A 1UOJA 2HWE1 5A32B 1LKNA 1J1TA 2EIEA 5F32A 4Q4W3 1OI6A 3HT1A 5FLHA 2XKOA 1BHGA 4CRQA 3OBRA 3FFZA 2WJSA 3SCGA 4YM2A 4WM7A 1ZNPA 4RFT0 4MOAA 3KMHA 4DXSA 1RUE1 3IIAA 4HVRA 2BFUS 4EQVA 3K3OA 2X10A 4AK3A 5BNNA 4YW3A 5FKCA 4YGEA 4PBPA 4LR4A 3LA3A 1WCUA 1HV1A 5A7SA 2DWRA 3MIDA 4LOTA 3QH7A 1IKQA 1XNBA 2BGCA 2Q5TA 1MS4A 4AG4A 2XQRA 3OF1A 2VJXA 4FPJA 2ES3A 1JZ2A 4XETA 4NPLA 1AR73 1D0HA 1MS0A 1S0DA 1Z7S3 3MUZ1 3BN6A 4N53B 2VM9A 5GZDA 2ADDA 1SLTA 1VB2A 2HWD2 3MEPA 2FD8A 4IV1B 4PI2A 5EJ1B 1W06A 3FZ3A 2VUDA 5IYYA 5F6LB 2Y34A 2FDJA 3FL7A 1O5LA 2R041 3IAPA 1NE4A 2J22A 3RI9A 4WM7B 4C90A 1GWKA 4E4SA 3HNBM 1RUOA 1RXGA 3M2MA 3OYWB 2XL7A 1MVEA 1QOOA 1HKDA 4JC1A 5FOBB 2WZ8A 5JWPA 1YQ8A 3B94A 4AGVA 5AVAA 4JTOA 3VBFA 3B01A 1LU1A 4I3GA 2MEV1 3GHNA 2YC2A 5FQ0A 2JG8C 1O3RA 4BXSV 3UGFA 3KHBA 1GR3A 4A3XA 1AYN2 1FMD2 4AVAA 2UWAA 3PHMA 3WLUA 5LY1A 4FQ4A 3C2UA 4JGZC 1R092 5A70A 3VZLA 2Q8EA 1UX7A 5L7OB 4YVWC 1AF9A 1O5UA 3ETQA 4M0HA 1OQDA 2OX0A 2R071 3IB3A 2Q30A 5FZ8A 4ARYA 3MICA 1YO8A 4A6SA 3VDCA 5A7WA 2Y0OA 2F4PA 4QGNA 4XPVA 4DEVA 5LK7B 3M3IA 2BW8A 5K7PA 5IVCA 1LOAA 2P5BA 5FY7A 3ZN5A 5JAXA 1YFYA 4UFLA 4XIOA 2QQMA 2XWJB 2D44A 4G3YC 3K4AA 4IEQA 4YNIA 1JODA 3H7YA 2RS52 5FK8A 1EAH1 4PCRA 4UFKA 4B7EA 5A3WA 5FYTA 1OC1A 1LHWA 5EZWA 3T2TA 3J7HA 1WGPA 4HN0A 4XUQA 1Q8SA 4JKKA 3ZN6B 3TEWA 4NIGA 4Q4X3 1MQTC 3I2GA 3QLQA 2Q4SA 4JDOA 2RS53 3AVRA 4AQ2A 2YDEA 4A45A 1GP4A 1ZRIA 1VBB3 2YFZA 3NAPB 2A75A 4Y1VA 4DINB 1JH5A 4NPRA 1MS9A 4AZZA 1W0PA 4CXWA 3HJRA 3LB9A 2WYFA 4WVMA 3H8XA 2VW0A 3BTAA 1BVVA 4K9SA 4BQ4A 2VZUA 3T09A 3OD0A 4ZU7A 1K5MA 4K21A 5FQ0B 3JZVA 3ELNA 1JTZX 1VBB1 1QXRA 5C3RA 4NIAA 1XNTA 3OUHA 5F5AA 1C1LA 2B4KA 1FPN3 2I2SA 4F3JA 2ZGUA 5FPBA 1UKGA 3ZN4A 4FT8A 3GYDA 1NXD1 3PVOA 2HLEA 1XU2A 2XVGA 3I2HA 4Q4X1 1GNYA 2DUPA 1JZ5A 4GH4A 5IUQA 4PJYA 2E6VA 3BTYA 4E8DA 1HXS1 3Q8FA 5JOWA 4LBJA 1G9BA 1H9PA 1R1A3 2FMYA 4QB1A 4J1WA 1UU6A 3IPVA 4OYUA 1JS9A 1G86A 2VBDA 1RUJ2 3NQHA 5C8WA 1WCDJ 1L7RA 3DV8A 2UY9A 4LHLA 1CAUB 3E5UA 1W90A 3ZO0B 5LZ6A 5KC6A 3ON7A 3U37A 1VBD1 2JB8A 3KGZA 1VAKA 4LORA 4UW6A 4RS5B 4LHNA 4SLIA 3N9LA 1N3OA 4QPIB 5I8SA 1PO12 3PURA 3SC7X 4D0QA 5JZGB 1FNYA 1SHWB 4HZFA 5DDJ1 4GWJA 5JOYA 2YU2A 4QPGC 3WZ1A 4FTBA 4RA0A 3W5MA 1V6MA 1ASJ3 1C8NA 1JMUB 1R1ZA 2ZA9A 2D43A 4R52A 4FOQA 2DVGA 4BLIA 4AFMA 2XJQA 5T54A 3UETA 2CHHA 3C3VA 1UU5A 5DAVA 2GN3A 4CCMA 1LOCA 1EYBA 3ALQA 5J7MA 5FP4A 1RC6A 4B4QA 4LOSA 3M1HA 1DQ5A 1C28A 2YPJA 3OGVA 1JW6A 2PAEA 3O0VA 5FRAA 1EPZA 2PAKA 3RZGA 4OQ9A 4K6BA 4CU7A 2WS91 2B46X 4KWUA 5FWEA 2XJTA 2D5FA 1AYM2 5CFCA 1KDMA 4WM8B 2ORZA 2ZABA 3JQXA 4MGYE 4YZ3A 5CG8A 1XB9A 4XACA 1NCRA 5T5PA 5FDBA 3I3DA 1KDKA 3WP6A 1H30A 4UT5A 2VZRA 2VZTA 2ZGOA 3SHRA 4L99A 1QDCA 3V0BB 4COUA 4Q5OA 5KXCA 3DXTA 5FWJA 2ARCA 1W6PB 1RUG1 4NRQA 3VBOB 2QVSB 4LBOA 4AVCA 5DUWA 4IW3A 1WBFA 5HCHA 4LBNA 4BISA 3K51A 4AHYA 5JLVA 2QJVA 2KD7A 4QPGB 1UOFA 1RMU3 3MGUA 1S0FA 2VC9A 5A7QA 4AQSA 1LODA 5L19A 2ZKNA 5FUPA 2G9FA 4B1MA 2WDBA 2ET7A 4HK9A 4RHV1 4Q8LA 3IN9A 1NCQC 2ATFA 1REEA 1UZZA 2PHTA 4Z82A 1P8JA 4CU8A 1NKGA 3ACHA 1SZBA 2HKXA 2J1VA 3KT7A 2GC3A 1JZ6A 2HWF2 3O1TA 1GYKA 4PT6A 3VDAA 2A5ZA 3NNJA 4N90A 3DGTA 1W04A 1XSQA 5DUVA 3MIFA 1QIQA 2OW4A 1JYTA 1GOGA 4XAAA 3T0AA 1JU3A 3RYPA 4URAA 2O14A 1SQ4A 3B02A 1C3HA 1RITA 2K46A 1O91A 2R062 1JYCA 3WF3A 1VRH1 5DN2A 4H7LA 4P14A 3M3OA 4GMP3 3S0MA 1TE1B 3UV9A 4I02A 2ZHNA 5C3QA 2BWCA 3MF9A 3ILFA 4JGYB 3GALA 2ETEA 5L9BA 5EQUA 2AH2A 2B42B 4XHXA 5FBZA 2VR4A 1X9TA 4A2UA 3VD7A 3C7EA 2CGNA 2X5IA 2HWC2 4JDMA 1F15A 2V5YA 3VZJA 4HVQA 2VW2A 2B5HA 3AYEA 3WQBA 1JU4A 3MDPA 2RR13 1JOPA 3OY8A 3NAPC 3U4SA 3ZMOA 4A7KA 4BMBA 3O1PA 2ZEWA 3AMNA 4X6QB 1C5IA 2BNOA 3WG3A 4Y1XA 1HB1A 3LCPA 3PL0A 4JZRA 4K8RB 1PIV3 4QM8A 2NPIA 1YJLA 3BPSA 2VULA 3F2ZA 3GXUA 4E4DX 3NMBA 1O8SA 1Y7BA 1HB2A 2GH8A 2P6CA 2B9UA 3OEAA 4Q0SA 5ANNA 4KH9A 4Q1PA 2GMPA 1DZQA 1LOEA 4QU2A 2WO3A 5B4NA 1QEXA 4JDNA 2NN8A 1D2QA 3FHQA 1GZTA 1ULDA 2JWPA 4LITA 4XJ9A 4XZUG 1MACA 2PAMA 1OOPC 2ZGNA 3PIGA 3SXWA 4LO6B 1Q3EA 3HD8B 4CCLA 3AVSA 2HBTA 1ND3B 4UW5A 5IHRA 5FP8A 1H6XA 1OVPA 2ZZJA 2WNUB 2H6CA 4DUXA 1EUTA 3ZYPA 2R061 4W6WA 4P9XA 3AL5A 2I07B 4ZPIA 5E89A 5J09A 2ZKLA 1IS4A 4IDZA 3TBDA 3H7JA 3J4UH 4ATEA 3AMQA 1Z78A 2Z4FA 4XJUA 1WUVA 4PQ9A 1S0EA 2JG9A 4GB33 2JDNA 2YC0A 1COV3 3J8F2 3RG0A 1TNFA 4UWDA 3WW3A 3SKJE 5CEHA 4YW7A 1S2EA 3D8CA 2YV8A 3WCRA 4AHZA 4AYUA 4AI8A 4NHYA 3LPGA 3KZ4C 4QAWA 3ZXAC 5HI0A 1VR3A 4QHOA 2ZGLA 1W2AX 2D6LX 3ENRA 1REFA 3RI8A 4IEPA 4BQ1A 3PVNA 2OPWA 1YNAA 4XIKA 1SPPB 4AVBA 2ZGTA 1DGLA 4KGQA 5T52A 4KWKA 1HN1A 3TNQA 2BP6A 5F3CA 1TEIA 3LGRA 2E33A 3DPRA 2JG9B 5L9RA 5DQ0A 3BU0A 2PHUA 3URFA 1OF3A 2DCTA 1PGL1 2WFF3 1H2LA 2RR11 1W8HA 4FVVA 1V9U1 2DCKA 1LEMA 1O6UA 2AGSA 3TYJA 3UGGA 1UZVA 3KQ4B 3NW4A 3QH6A 3VL9A 4BQWA 4RQPB 5FMOL 1UCXA 5FYHA 3IPVB 4QXBA 2BPA2 2GMMA 3AJZA 3H42B 2E9QA 4RD7A 3U14A 4CDWC 2Y38A 4NHLA 3WG1A 1RJ8A 2WSVA 2ZMKA 4AAPA 4GULA 4MGKE 1JBCA 4K3UA 4LBQA 5DDJ3 5BUVA 1I6XA 1PGW1 2ZX2A 3S6PA 5I0TA 2XJSA 3SCFA 2H0BA 3DCQA 4UBGA 4UBHA 1GU3A 3LAGA 3HR9A 4HK8A 2RDNA 3NV3A 4ASLA 1JZ4A 1D4M1 2D6MA 4BQ2A 1TVGA 4KI5M 2PHFA 3VD5A 4AQ6A 5T3NA 4QM9A 3WG2A 4Q4X2 3U0ZA 1E5RA 3O12A 1QQP3 1I1EA 4CP9A 3KS7A 3VD9A 4QPIA 1OFNA 1OF4A 3VGIA 3B9IA 1CAWB 2CTVA 2BWAA 5CFDB 1RUE3 1XE8A 3IDAA 1AR91 2XBO1 4Y22B 5KHKA 4HPKA 5BNPB 1SLIA 1YWKA 5K9YA 3MBWA 3LEMA 1KFUL 3ATGA 5AFEA 4AHXA 3E6CC 3MV11 3OGRA 4L0PA 1TME1 1X33A 2E7AA 3DPRB 3K4DA 5GZEA 2DTWA 1U12A 3MW4A 5FMCA 5FY0A 2SLIA 2WKKA 1SBDA 3D3AA 4OUSA 5CVRA 4AFCA 5FXVA 1MQTB 3WDYA 5HV0A 3LD8A 1J1LA 2DBNA 1PVC3 5FBJA 4XFIA 4PDWA 2IZWA 1XU1A 4PIXA 1SCRA 1BXHA 3A0KA 4LO8A 3H1YA 4KMQA 3H8RA 3EBRA 1AR93 2XBO3 3NWKA 3PJYA 4TTGA 5H9SA 3FJSA 4FAHA 3U78A 4CDQA 1UMHA 4D3WA 3KV5A 3CZUA 4LUMA 3LZZA 4MGQA 1ZBE1 4EJRA 2JD9A 2KXLA 3LSEA 1CD3G 2Q1MA 2JKBA 4XBLA 4FAGA 2VXJA 4NIDA 1ASJ1 1W6QA 4HOOA 5IVVA 5IVYA 4HPKB 5BNPA 2VMEA 2NQYA 1CR7A 4NHMA 2J7MA 3WHUA 4AFDA 3FUQA 4FPEA 4C91A 5E16A 1S1AA 3IMNA 5I0SA 3AKSA 1D2SA 3N9PA 1Y3TA 4A41A 4U36A 3A7QA 1A8DA 1ZZ7A 2Y60A 4IEOA 4P5YA 4FQZA 1OKQA 1W6PA 1H1AA 4BK4A 1A8MA 1UL9A 1CAXB 2X29A 5ANQA 3VKNA 1WLWA 4BU2A 4CU6A 4RN5A 4AEDC 1D4VB 1OPMA 2BNMA 3KB5A 1Q5OA 2YC4A 3VBSA 2ILMA 3INAA 2HWD3 3LIHA 2W0XA 4Q4W2 4V1PA 1Y9QA 2VBBA 5JOXA 4PLMA 3BOWA 5A6QA 4Y20A 4FSJA 1BMV2 1QQP2 1GP5A 1UZYA 4CEYA 3WF0A 4QDQA 4GIQA 5LY2A 2W68A 4BB3A 2WAOA 1OUXA 4CUBA 2D40A 2EVXA 3OY8B 4QKFA 2RMU3 3GZEA 4UOJA 2VO5A 1W6OA 4LKEA 1SLCA 2R16A 1EV11 3MIBA 4YM0A 2JIGA 3EB7A 3O0WA 1COV2 3J8F3 4PF5A 1CQ9A 3WY6A 1FPN2 2YGLA 3ZMNA 2WNUC 4EYUA 5A3NA 2E63A 5DDJ2 4CXYA 1KJLA 2Y6LA 1JZ7A 2YHJA 3ZYGA 1ND3C 3Q8EA 2Q8CA 4CSWA 5EXOA 1UIKA 3NKGA 4FPCA 4BWOA 3KF3A 1EUUA 3KLSA 4DXTA 3N9NA 4DIQA 5FO7B 3S7IA 1RYYA 3SH3A 3QBQA 1F4AA 4NPMA 4HKWA 3TAYA 1NA1A 2C9AA 3I59B 1R1A2 3WX5A 3BCWA 5A7NA 4TXWA 1U5YA 4QPWA 2ZAHA 2E53A 2LALA 2QDRA 1FAYA 4YW2A 3A21A 4I3PA 5IT6A 2N7GA 1SLAA 2BEOA 2WWSA 3H3UA 2C24A 5CYYA 2P6HA 5EPAA 3ZKUA 4XFGA 3O0XA 1V6KA 3PMEA 3I8TA 4LO4B 4QHBA 1W2UA 1W8NA 2DUOA 2IC1A 2ZJCA 3OBTA 1DLLA 1UD1A 2RS13 1FNZA 4Y5Z0 4IXLA 5H9QA 1W6MB 1J3QA 4QX5A 1NT0A 4XFHA 5HXVA 4RR3B 4GWMA 3EHKA 1US3A 3QCWA 2WA3A 3PVEA 4A6OA 4O7XA 4AI9A 4LO7A 5K0UC 4JRLA 1UKRA 1MS5A 2DURA 5C4WA 4YZ4A 1GUIA 3WNLA 2BERA 2J1RA 1BK1A 4XF4A 5JXIA 4AVTA 3RZLA 1HDKA 3UNPA 1AJKA 5LRRA 4COYA 3P3PA 1CJPA 1GZWB 3M8LA 2E7QA 1PGL2 1JI6A 5JMOA 4LNVA 3LDBA 3NNGA 5FTTC 1FXZA 4ZS3A 3WP5A 3CZJA 2VE1A 2ZXQA 1BKZA 3VHOA 4CYDA 1PM7A 1LRHA 4CU9A 5GZGA 2AUYA 2RVAA 1PIV1 2W5FA 1A34A 1WW7A 4EN7B 4XVHA 2JDHA 2IVJA 3OOXA 1QDOA 2XJUA 1POV0 4IE4A 1DGRN 1FYUA 1PK6B 2Q0AA 3RMYA 3WDXA 4BXFA 1REDA 4GKXA 5BNNC 2VQUA 3AYDA 3TRSB 4C8DA 4LIVA 2KM2A 1W8FA 4FPKA 1RGSA 3SQOA 2JECA 3CDZB 2VTFA 1IZ3A 3DUIA 3AZVA 2HWF3 5T55A 5LWBA 5CAZA 1KRIA 4RQPA 3ECQA 2R072 3LQCA 3V0AB 4P5HA 3SITA 4E9KA 3T4HB 2EIGA 1WMFA 3H3ZA 1W8TA 3K75B 4NAMA 5IVJA 1LAJA 4XE9A 2FCVA 5DAPA 4LE4A 4ZZ8A 3S5AA 1OD5A 4AI1A 4MGIE 2O8QA 3X29B 1W0NA 2R063 3ZXEA 4XCAA 4JHZA 3ZX7A 3V64A 4IQPA 1HIXA 1YIFA 1SFNA 4WM8C 3RMXA 1XRUA 3VZOA 4CEWA 3O1MA 4LA3A 1QH6A 2D3SA 4I09A 4O9GA 3ZFEA 4AEKA 1PHMA 3W20A 2IVIB 4DO0A 1QOTA 1RUF1 1A78A 4QKDA 3BB6A 4P9LA 1UW8A 4HXCA 5CU1A 1JHJA 2G9GA 4ISRA 3HN3A 3MHZA 3FUOA 4LE3A 4QGMA 5FPAA 5F1RA 1C57A 1CJDA 4EN6B 1LECA 2B45X 5LCWL 5JPNB 2EIBA 1H2MA 2QQVA 1W8WA 4MUVA 3AZXA 3I3MA 3CJIC 1F9KA 3L9JT 4PDWC 4ZXKA 3TEZA 1ZA7A 1O3QA 3WG4A 1TMF2 5FXWA 1VBC3 4IL7A 3N9OA 2A71A 2WC2A 3N7KA 3NJZA 4PLNA 5IVEA 1GWMA 5JI9A 2PTMA 5FPLA 4ASKA 3MLJA 5FFOC 1H8TB 5ERLA 3GM8A 4LK7A 2X5IC 3ABZA 5FP3A 4AAXA 5IATA 4LXLA 2VECA 5FY9A 2I45A 4IERA 4GQ7A 4XFAA 4Y1UA 1HX6A 1ND2A 2XKPA 2YYOA 1HXS2 3RZJA 5C7GA 1D4M2 3R4UA 2JE9A 3JBG2 1K5MB 4XBQA 2QQIA 1UMIA 3ZDSA 5JCTA 4WVVA 4JRAA 2C5DA 4META 5EV7A 2FDGA 4HBNA 1JOBA 5F5CA 5JUVA 5LBCA 4IEYA 3T2PA 1VBC1 4XQ4A 3S5QA 3EJKA 4NOTA 2WT1A 3I54A 3I3EA 5LBBA 1G6NA 3NVCA 4IV1A 1VBE2 5EWSA 3Q8AA 4EN0A 3C7GA 3NJYA 1EV12 4OI1A 4Q0VA 4AGGA 3PUSA 3MIGA 1J59A 1LOFA 4H7MA 2V09A 1X36A 4IV3A 5C3OA 1MQTA 3ZLIA 1VBD3 1VAMA 4HLTA 2RS11 3AKTA 4BMEA 2ZEYA 1XNDA 2WN3A 2L9LA 3EYPA 4XDPA 3I2IA 1SPPA 1T6GC 3CKHA 3EO6A 2VCBA 4I0WB 4KBZA 4XF0A 4AFBA 4XYXA 3VBHC 2BDRA 1UY1A 1VMJA 5BNOA 1Q8QA 4MHUA 3AZZA 3D6EA 1YHFA 1UY2A 5A33A 4YARA 4D94A 2RS31 4OUEA 1NY71 1QJY2 1RUG2 4COWA 1QGLA 1KGYA 2ZHMA 4FXGB 4QXHA 4UYBA 3WNKA 4W65A 5A3OA 3W5NA 1ASJ2 1CZSA 3TWIA 1JYXA 3AKQA 3GBGA 1UPIA 3JB4C 4MZUA 5FZ6A 1ENSA 1GQHA 1OPOA 4CCDA 2LS6A 1W03A 3FWEA 2WS92 3P3NA 4QDRA 5FZKA 2CU5A 2HWE3 2GMEA 1OVSA 3OUJA 3J9SA 1QJX3 1VAVA 2X09A 3PJQA 2PA7A 4Y4YA 4PIZA 5GLWA 4AL9A 2EXIA 4B3NA 4W50A 4CP1A 1H8TA 2VNOA 4I0BA 3TEXA 2YBSA 3NRUA 4D6SA 4DQAA 4GAZA 4QWNA 1VBE1 2VVEA 4LBLA 2W1QA 5IW0A 1R64A 4C1XA 2WS93 3AMHA 5LA1A 5FZOA 1HLCA 2PHDA 1F35A 1OXCA 4XTPA 2R043 2YROA 4ZS2A 3T2QA 1LOBA 1V6LA 2GNMA 4Y3OA 1B35C 3VKOA 4QX7A 3UK9A 2A70A 3VBSB 2PFWA 5EFUA 2PYTA 2XHNA 1Q43A 5IVFA 2FMDA 4AI0A 2FQPA 1I3HA 5C9AA 1DFQA 1E5IA 1UOBA 3H1WA 4KNCA 5APAA 1N1YA 4W6XA 1EV13 1X9PA 5GZCA 1LJ7A 2WZR1 3HNMA 2GC0A 3CJXA 3ILRA 3WEZA 1QJU2 3GZTB 2QQPA 3U1XA 2JD4A 1OFSA 2CGPA 1UYZA 1I5ZA 5CFCC 2JX9A 2OQ7A 2RE9A 2ZTNA 4L2NA 2HWC3 4LLFA 3FLPA 4XJZA 3HEIA 3NKTA 1NE6A 3MLLA 3R4DB 2EXJA 5CNAA 3VBRA 4LPLA 2PMWB 3S57A 2ORXA 1Q8PA 2Z5WA 5DUUA 3B93A 1WLTA 3WW1A 1RVF1 5I0DA 1VB4A 2E32A 1S0CA 2WNVC 5J36A 5I93A 1KD7A 2W39A 2ZMLA 1BCXA 3VHNA 1DGWA 1HRI1 2IXCA 1RMU2 3CBNA 2WZPP 5FKBA 3WT3A 5SV5A 3ZR5A 5JPMB 1GZWA 2JE7A 3POJA 2B9VA 4MHRA 2GNBA 1XNKA 4QQ2A 1QMJA 2PHWA 4GA9A 4RS5C 4MVTA 4ASMB 2DYCA 2D6KA 5FYIA 1UN1A 2RR12 4O65A 2WO7A 1NXMA 2C4XA 1T2XA 1OLME 1WA4A 2X8KA 3B3QE 4HKOA 3ZR6A 2HWF1 5A80A 2O8OA 3AZYA 4UW4A 5FZ3A 3VKLA 2BJSA 1W3VA 3WNOA 1QJZA 3E1F1 4RR3A 3ZPYA 4L97A 2WNOA 3I2OA 4OI0A 2IFRA 4ZXEA 4RL7A 1RUI2 2R32A 2V73A 3UESA 4CTEA 4CP2A 2W1WA 4S2HA 4FTEA 2HWB3 5EP9A 2CAUA 2PHRA 3RQ0A 2DVDA 2D3RA 3VBRB 3HMYA 2WA4A 1J3RA 4J1XA 2Y0IA 4KL1A 1F2NA 2EAKA 3P5BA 3I3BA 4NHXA 3R0RA 4D8MA 2WINB 3L2YA 3WDWA 2WRAA 1ZREA 2WQZC 2XGXA 1WLDA 4FFFA 4GMP1 1S55A 1MEC3 1ULFA 4XUOA 5A3PA 5IVBA 1QHDA 1W8OA 1DP0A 1U0AA 2UWCA 3FFQA 1H0BA 2WN2A 2P2KA 4UW3A 3VKMA 4BDVB 3CMGA 3I2JA 4V2VA 4AVVA 4QB2A 4LEJA 2FDHA 2RS32 1DF0A 4KG0A 2WT2A 4ET7A 1CX1A 2LM3A 3ACLA 3ZM8A 5A6XA 3O1UA 5A6ZA 1YQCA 3WOGA 4Y20B 1VP6A 1W9SA 4ZZ5A 1XSRA 1N3PA 5KHHA 4OZXA 3RSJA 2XPJA 1T6BX 1NAEA 1MPXA 5A3UA 1JZ3A 4YVSB 3PU8A 5FYYA 5CBLA 2Y6KA 4BIOA 4EWEA 4AEDA 4COVA 2BGPA 4Z07A 5ABJB 4QGLA 4P9WA 5CA6A 2FCUA 1LNSA 1PO13 3ETPA 2VZ3A 3T1LA 1G9AA 2DU1A 4YW4A 2JENA 1UZWA 1NCQA 3BTXA 2PQSA 2VPVA 2W95A 3TNPB 1IG0A 2VGDA 5FZHA 1DIWA 2ZGQA 5H9PA 5JMCA 3K3NA 2QZ2A 3PU3A 1LB2A 4JTNA 4YVSA 3KCYA 4IETA 4FFIA 4UF0A 1LTEA 2EIDA 2P3JA 1CAUA 2RMU1 2IWGB 2MPFA 2VG9A 4XW3A 5FYVA 4S2GA 2JJ6A 4HVOA 2XWBB 3R4SA 3VBHA 4XC9A 4YSFA 1WCKA 2Y33A 3P6BA 5IK8A 5E8AA 1NLRA 2BVVA 2VZVA 2CDPA 2YY1A 3OCPA 1W2TA 4Q26A 3VN4A 2VTXJ 4CDXA 3WDVA 4AEDB 2Y6GA 1NCQB 5FP9A 3AX4A 3V65A 1OSGA 1QKQA 3ZFFB 2YU1A 1KFXL 4AWDA 4LBQB 1CPMA 3LDKA 3GCWA 2W87A 1WLCA 5FZGA 4BOWA 5FZFA 2WNVB 4FP2A 4GWNA 2DTYA 4I30A 2OT7A 3W59A 2DV9A 3A23A 3ZXGA 5FYMA 1QWRA 2HJIA 4YGBA 4R4ZA 4F8AA 1YC61 4JCKA 1AVBA 2XLFA 4L92A 3ZKYA 4E2SA 3IDEA 1YI9A 3ZYHA 1HV0A 2QFEA 4L9BA 1FOD1 5K0UA 3ZXFA 2LTNA 4IEZA 3FN9A 1DU3D 4OHVA 4IGPA 5CFCB 3H50A 3ZVXA 2P37A 5LEJA 3HVDA 3RJ2X 3ACIA 2DCJA 4HONA 4KQ7A 4NIIA 5GLUA 1V9U2 1RUG3 2VVFA 1N47A 2QBXA 3H0OA 4OHXA 3MO4A 2JDUA 3CLPA 3RYRA 1YQ6A 3D0SA 1CIWA 1HQNA 2B8MA 3H1MA 3ZFGB 2WUHA 1LHUA 4AW7A 3IBMA 1K45A 1UF2C 3AP7A 1NQDA 1L3JA 2OUJA 2DVBA 3A22A 4MX3A 1SBFA 1NY72 1QJY1 4CCCA 1BZWA 2A73B 2DVAA 5H9RA 5BV6A 3NV2A 3C7FA 3LA2A 4WV8A 3J8F1 1VPHA 4Q0PA 4EWAA 1AL22 1TME3 3GZAA 5JZGC 1VBE3 1F5FA 2VMGA 5GJ6A 1WMXA 3FBMA 3PNAA 2CDOA 4LBKA 1NX9A 4C1WA 5HXMA 2ZCWA 1CAWA 1O7FA 4Q4V1 2GC1A 4HMZA 2XH6A 4DEQA 1OUSA 1STMA 3P1IA 4RGGA 3BALA 3F95A 4LBQD 5C4WB 3E6BA 4LKDA 5G05L 4DS0A 2VOVA 5DXDA 5GLVA 3JB8A 1ST8A 4P08A 3IDBB 4DFSA 5CKQA 3AXEA 4ZHNA 4Y1ZA 1RHI1 1WA6X 1L7QA 1G9FA 3TOJA 3RZMA 2LW8A 2P3IA 5FYCA 1FOD2 1BVP1 1DQ1A 5K0UB 4N7IA 1RUC3 5FLJA 2A6VA 1ZA4A 1NOVA 1D7PM 4LA2A 4M01A 4N8MA 1XYPA 2SBAA 4HN1A 4GKYA 4CUCA 3WF2A 1ZYBA 3CL1A 4Z2AA 3G7DA 4KWLA 3ZFGC 1MZFA 4CDUA 2TEPA 2W91A 3DKQA 4PHZA 1BEV1 3ROUA 1ZRCA 1VIWB 1OA2A 1WMDA 1F5JA 2FBEA 5FZOB 5C9AB 2J1EA 2RJ2A 4WZCA 5GLZA 2A6WA 2AACA 1BK0A 5F3GA 5F5IA 3WD5A 3SMHA 1U5IA 4Q4V3 3WW4A 1G7YA 2IFWA 3WUDA 2WYSA 4UFIA 3N36A 1AX0A 1AXYA 3D0JA 4QX8A 1L7LA 4XFFA 5DZFA 3SEEA 4BLJA 4MGSA 1OA3A 1UZ0A 1DHKB 4XF1A 3RYKA 5LATA 5EYXA 1YJKA 2BBAA 3I2FA 3AZWA 4IEVA 4KU7A 3VDDB 5KXBA 2BBVA 2H0VA 1SLLA 1XYNA 3HQXA 1OQEA 3IM0A 4M0NA 4IEWA 2VXRA 3GZUC 3R05A 1JOJA 1NCRC 4XFCA 3VHPA 5ACA1 5C8CA 2QDNA 3CHXA 1AR72 1Z7S2 4B7KA 1POV1 5D8AB 3OGSA 1UY0A 5LBEA 1LEDA 2XOMA 3SH5A 4O61A 1RUD2 1TNRA 2X53S 1ZBA2 5BNOB 3VBSC 5C3PA 1V6JA 1QU0A 2GNTA 2YGMA 5KBFA 5GM0A 3N7JA 1GSLA 4HG6B 1GNHA 2JICA 4KU8A 4M3CB 4U2AA 3WQ7A 4MV2A 1CAVB 1ZVFA 2R0HA 1WKYA 2V4AA 2R30A 3IWZA 2WWJA 3HOBA 4NO4A 1URXA 2WT0A 3USSA 4MGTA 1EAH3 2FCTA 2PHXA 4NROA 3ZDVA 4FBFA 4Q0QA 3U10A 4LULA 2HBUA 2QCSB 3VBFB 2VMHA 3A0NA 4DOUA 1A6CA 3I4IA 1UIJA 1BBT3 1HW5A 3LDRA 2C0ZA 5LEKA 4IEUA 5DAQA 5BNQA 3BU7A 4AOCA 2ET1A 2ZGPA 2RDSA 1HB4A 2EALA 2TUNA 2IXIA 1VRH3 1WMEA 4RFRB 2FZ1A 5FYBA 3WCSA 2CL2A 4M3CA 1WWYA 1GNZA 3KV6A 4MH0E 3W21A 5ABJA 2XL9A 2UWBA 1OURA 5T5OA 3VDDC 3WDTA 1ZZCA 3POWA 3ES1A 4XXPA 4YM1A 2OA2A 2HEVF 4XCBA 2EXKA 4YVSC 1SLBA 2JDKA 5LB6A 1LESA 2VNVA 3CO2A 3DF0A 1R091 3GJAA 4UFJA 4N43C 1IS6A 1GQGA 4DRVA 1E57A 1MEC1 1FI2A
chains in the Genus database with same CATH topology
1W0NA 4XUQA 4JKKA 4JHZA 5C71A 2DDUA 3I2GA 5G04L 4A45A 4ZY9A 5HPOA 2YFZA 2QQOA 3GDBA 3ACFA 3HJRA 3I97A 1JHJA 3HN3A 2VZUA 3T09A 3IAQA 4MADA 2WO1A 5LCWL 4PQQA 2EIBA 1DLCA 1J84A 1XNTA 2B4KA 1K12A 4JX0A 2HLEA 3PUIA 3I2HA 4CVUA 1GNYA 4QX1A 1JZ5A 2OKXA 4E8DA 1PX3A 4QB1A 4OYUA 3GM8A 4AAXA 3NQHA 3ABZA 1L7RA 2Y64A 3OBAA 2V72A 1UWWA 3CIHA 3U37A 5C7GA 5IFTA 3THCA 2QQIA 3LE0A 4GWIA 2J1UA 1UMIA 5JXJA 4D0QA 1SHWB 3SEPA 4GWJA 2XQXA 2YB7A 1CZVA 5JUVA 3W5MA 3T2PA 4LHSA 2WQ8A 1GOHA 3I3EA 3LEKA 2JE8A 4IUGA 3UETA 1XC6A 4XUTA 4A3ZA 5DMYA 3C7GA 3OEBA 1PMJX 3OGVA 2ZEYA 4CU7A 3WF4A 4KWUA 3EYPA 2L9LA 2WN3A 3I2IA 2ORZA 3CKHA 2VCBA 3C7HA 3I3DA 1UY1A 2VZRA 2VZTA 3WSOA 3CQOA 1UY2A 2W1UA 4OUEA 3K4ZA 5FUIA 1KGYA 3WNKA 3W5NA 1CZSA 2KD7A 2W47A 3VDBA 1JYXA 2VC9A 2R7EB 2ZEZA 2WDBA 1YQ2A 2LS6A 1W9WA 1P8JA 4QDRA 4CU8A 1NKGA 3ACHA 4DXRA 2VCAA 2J1VA 2X09A 1JZ6A 2QQJA 4PT6A 4XUPA 3VDAA 4W50A 1K42A 3NRUA 2QQNA 3OG2A 1PX4A 3HNYM 1GOGA 3PUHA 3T0AA 2BGOA 4DUVA 2W1QA 2VZQA 1JU3A 1R64A 1ULOA 5LA1A 5J1XA 1US2A 4UI9L 3WF3A 1SG3A 5DN2A 3DYMA 3T2QA 2VZSA 2QQLA 2XHNA 1CZTA 2VR4A 4W8JA 3VD7A 3C7EA 4GZ9A 2ZEXA 4XUNA 4LQRA 3WQBA 1JU4A 3HNMA 5DPNA 3WEZA 1IQDC 2ZEWA 1UYZA 1CIYA 4QX0A 5F7UA 3F2ZA 3GXUA 3HEIA 1O8SA 3LPFA 1JYNA 5C70A 2E31A 3ACGA 4LPLA 2W1SA 2ORXA 3FHAA 3OEAA 2WO3A 5I0DA 5B4NA 2E32A 3FHQA 5IJRA 5JXGA 4XZUG 2B9VA 3K46A 2Y6JA 4YPJA 3SKVA 2WBKA 3GGLA 5IHRA 1H6XA 3HPNA 2C4XA 1T2XA 4DUXA 1EUTA 3WNPA 3WNOA 3E1F1 2VL4A 4ZXEA 3UESA 1UYXA 1XNAA 2W1WA 2W9XA 2BZDA 2Z4FA 1JYVA 3THDA 3VD3A 3I3BA 1GOFA 3SKJE 4D8MA 2V4VA 3VD4A 3LPGA 5LA0A 2QQKA 1O59A 4QAWA 1SDDB 4XUOA 2W46A 1W8OA 1DP0A 1PMHX 4BDVB 2WN2A 5A1AA 3CMGA 3I2JA 2Y6HA 4QB2A 1KEXA 4ET7A 1CX1A 1K3IA 1HN1A 3ZM8A 2WZEA 2E33A 4OMDA 5DQ0A 1OF3A 5EIYB 1W9SA 4ZZ5A 2YG0A 2WABA 1NAEA 1MPXA 2DCKA 4M4PA 2J1AA 4XURA 1W99A 2Y6KA 2BGPA 2W3JA 4RYDA 3OB8A 1DYOA 3LEIA 5B4XA 2HYXA 1LNSA 2JKXA 3ETPA 2VZ3A 3DYOA 5EJZB 4BJ0A 1J83A 3JXSA 3K77A 4PF1A 2PQSA 2W95A 1JYWA 1WCQA 2VMCA 2RV9A 1GU3A 1TG7A 3I2KA 1JZ4A 4M4RA 2V5DA 1NUKA 5JXHA 4ARXA 1TVGA 4KI5M 2EIDA 3VD5A 3WF1A 3NJVA 3MUY1 3T2OA 3P6BA 2W94A 3VD9A 1OF4A 2VZOA 4JKMA 4MO3M 2E26A 2CDPA 2VZVA 2YFUA 3IDAA 4P02B 2Y6GA 4LKSA 3T0BA 2Y8KA 3MBWA 1GMMA 4P00B 1ULPA 3NJXA 2W87A 3MV11 3OGRA 4L0PA 4W4ZA 3WNMA 1JZ3A 2C26A 3A23A 3K4DA 2VZPA 5LA2A 3D3AA 2VZ1A 1UXXX 1UYYA 3LEGA 2EICA 4QB6A 1OT5A 3DYPA 3C7OA 3FN9A 3T0DA 4KMQA 2WO2A 4OMCA 1JZ8A 3ACIA 2DCJA 4TTGA 2QBXA 3MV01 1I5PA 1UMHA 2J1SA 3CZUA 3MO4A 4MGQA 2JD9A 4A42A 2WUHA 2X05A 1UXZA 1OD3A 1K45A 3BGAA 2VMEA 3A22A 2J7MA 4BK5A 1XPWA 5IFPA 4OZOA 3C7FA 4A41A 4FI9A 3A7QA 1UY4A 4P5YA 4JKLA 4BK4A 4CU6A 2CDOA 1NX9A 4RN5A 5HXMA 2WAAA 2VCCA 2YC4A 2C9KA 2JDAA 4DEQA 3P1IA 2ID4A 2VMDA 1H6YA 4QDSA 5G05L 3WF0A 4QDQA 1W9TA 4P08A 2WAOA 2VQTA 4CUBA 4UOJA 4A4AA 2VO5A 1L7QA 3T08A 2EIEA 2LW8A 1BHGA 3EB7A 1D7PM 4MOAA 4DXSA 2Y6LA 1JZ7A 4CUCA 3WF2A 2X10A 5CZKA 4Z2AA 1EUUA 4DXTA 3IIIA 4A44A 1RYYA 1F4AA 2W91A 2XONA 4TXWA 1OH4A 4QPWA 4AG4A 3C8XA 2J1EA 2RJ2A 3A21A 2VJXA 1JZ2A 5CYYA 2WYSA 1F4HA 3SEEA 3MUZ1 3BN6A 2VM9A 4MGSA 1UZ0A 1W8NA 5EJ1B 2BBAA 3I2FA 5IYYA 4QX3A 1US3A 3FL7A 4A6OA 3IAPA 2J22A 1GUIA 3HNBM 1UY3A 3WNLA 2BERA 2J1RA 3OGSA 1UY0A 2XOMA 5JXIA 5JR2A 3UNPA 2WZ8A 2J1TA 1JI6A 5JMOA 4HG6B 2VOTA 3NNGA 1WKYA 2YC2A 3AC0A 3CZJA 4BXSV 2ZXQA 3HOBA 4QX2A 4CU9A 1GQPA 2RVAA 2W5FA 4E8CA 4XVHA 1UX7A 1O8PA 3IB3A 4ARYA 2VQUA 3VDCA 4DEVA 4UAPA 2VMFA 3CDZB 2VTFA 4DUWA 2QQMA 3ECQA 3K4AA 3LQCA 3WNNA 3K75B 2W92A 4CUAA 3DECA 4ZZ8A 3J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0N A;  4XUQ A;  4JKK A;  4JHZ A;  5C71 A;  2DDU A;  3I2G A;  5G04 L;  4A45 A;  4ZY9 A;  5HPO A;  2YFZ A;  2QQO A;  3GDB A;  3ACF A;  3HJR A;  3I97 A;  1JHJ A;  3HN3 A;  2VZU A;  3T09 A;  3IAQ A;  4MAD A;  2WO1 A;  5LCW L;  4PQQ A;  2EIB A;  1DLC A;  1J84 A;  1XNT A;  2B4K A;  1K12 A;  4JX0 A;  2HLE A;  3PUI A;  3I2H A;  4CVU A;  1GNY A;  4QX1 A;  1JZ5 A;  2OKX A;  4E8D A;  1PX3 A;  4QB1 A;  4OYU A;  3GM8 A;  4AAX A;  3NQH A;  3ABZ A;  1L7R A;  2Y64 A;  3OBA A;  2V72 A;  1UWW A;  3CIH A;  3U37 A;  5C7G A;  5IFT A;  3THC A;  2QQI A;  3LE0 A;  4GWI A;  2J1U A;  1UMI A;  5JXJ A;  4D0Q A;  1SHW B;  3SEP A;  4GWJ A;  2XQX A;  2YB7 A;  1CZV A;  5JUV A;  3W5M A;  3T2P A;  4LHS A;  2WQ8 A;  1GOH A;  3I3E A;  3LEK A;  2JE8 A;  4IUG A;  3UET A;  1XC6 A;  4XUT A;  4A3Z A;  5DMY A;  3C7G A;  3OEB A;  1PMJ X;  3OGV A;  2ZEY A;  4CU7 A;  3WF4 A;  4KWU A;  3EYP A;  2L9L A;  2WN3 A;  3I2I A;  2ORZ A;  3CKH A;  2VCB A;  3C7H A;  3I3D A;  1UY1 A;  2VZR A;  2VZT A;  3WSO A;  3CQO A;  1UY2 A;  2W1U A;  4OUE A;  3K4Z A;  5FUI A;  1KGY A;  3WNK A;  3W5N A;  1CZS A;  2KD7 A;  2W47 A;  3VDB A;  1JYX A;  2VC9 A;  2R7E B;  2ZEZ A;  2WDB A;  1YQ2 A;  2LS6 A;  1W9W A;  1P8J A;  4QDR A;  4CU8 A;  1NKG A;  3ACH A;  4DXR A;  2VCA A;  2J1V A;  2X09 A;  1JZ6 A;  2QQJ A;  4PT6 A;  4XUP A;  3VDA A;  4W50 A;  1K42 A;  3NRU A;  2QQN A;  3OG2 A;  1PX4 A;  3HNY M;  1GOG A;  3PUH A;  3T0A A;  2BGO A;  4DUV A;  2W1Q A;  2VZQ A;  1JU3 A;  1R64 A;  1ULO A;  5LA1 A;  5J1X A;  1US2 A;  4UI9 L;  3WF3 A;  1SG3 A;  5DN2 A;  3DYM A;  3T2Q A;  2VZS A;  2QQL A;  2XHN A;  1CZT A;  2VR4 A;  4W8J A;  3VD7 A;  3C7E A;  4GZ9 A;  2ZEX A;  4XUN A;  4LQR A;  3WQB A;  1JU4 A;  3HNM A;  5DPN A;  3WEZ A;  1IQD C;  2ZEW A;  1UYZ A;  1CIY A;  4QX0 A;  5F7U A;  3F2Z A;  3GXU A;  3HEI A;  1O8S A;  3LPF A;  1JYN A;  5C70 A;  2E31 A;  3ACG A;  4LPL A;  2W1S A;  2ORX A;  3FHA A;  3OEA A;  2WO3 A;  5I0D A;  5B4N A;  2E32 A;  3FHQ A;  5IJR A;  5JXG A;  4XZU G;  2B9V A;  3K46 A;  2Y6J A;  4YPJ A;  3SKV A;  2WBK A;  3GGL A;  5IHR A;  1H6X A;  3HPN A;  2C4X A;  1T2X A;  4DUX A;  1EUT A;  3WNP A;  3WNO A;  3E1F 1;  2VL4 A;  4ZXE A;  3UES A;  1UYX A;  1XNA A;  2W1W A;  2W9X A;  2BZD A;  2Z4F A;  1JYV A;  3THD A;  3VD3 A;  3I3B A;  1GOF A;  3SKJ E;  4D8M A;  2V4V A;  3VD4 A;  3LPG A;  5LA0 A;  2QQK A;  1O59 A;  4QAW A;  1SDD B;  4XUO A;  2W46 A;  1W8O A;  1DP0 A;  1PMH X;  4BDV B;  2WN2 A;  5A1A A;  3CMG A;  3I2J A;  2Y6H A;  4QB2 A;  1KEX A;  4ET7 A;  1CX1 A;  1K3I A;  1HN1 A;  3ZM8 A;  2WZE A;  2E33 A;  4OMD A;  5DQ0 A;  1OF3 A;  5EIY B;  1W9S A;  4ZZ5 A;  2YG0 A;  2WAB A;  1NAE A;  1MPX A;  2DCK A;  4M4P A;  2J1A A;  4XUR A;  1W99 A;  2Y6K A;  2BGP A;  2W3J A;  4RYD A;  3OB8 A;  1DYO A;  3LEI A;  5B4X A;  2HYX A;  1LNS A;  2JKX A;  3ETP A;  2VZ3 A;  3DYO A;  5EJZ B;  4BJ0 A;  1J83 A;  3JXS A;  3K77 A;  4PF1 A;  2PQS A;  2W95 A;  1JYW A;  1WCQ A;  2VMC A;  2RV9 A;  1GU3 A;  1TG7 A;  3I2K A;  1JZ4 A;  4M4R A;  2V5D A;  1NUK A;  5JXH A;  4ARX A;  1TVG A;  4KI5 M;  2EID A;  3VD5 A;  3WF1 A;  3NJV A;  3MUY 1;  3T2O A;  3P6B A;  2W94 A;  3VD9 A;  1OF4 A;  2VZO A;  4JKM A;  4MO3 M;  2E26 A;  2CDP A;  2VZV A;  2YFU A;  3IDA A;  4P02 B;  2Y6G A;  4LKS A;  3T0B A;  2Y8K A;  3MBW A;  1GMM A;  4P00 B;  1ULP A;  3NJX A;  2W87 A;  3MV1 1;  3OGR A;  4L0P A;  4W4Z A;  3WNM A;  1JZ3 A;  2C26 A;  3A23 A;  3K4D A;  2VZP A;  5LA2 A;  3D3A A;  2VZ1 A;  1UXX X;  1UYY A;  3LEG A;  2EIC A;  4QB6 A;  1OT5 A;  3DYP A;  3C7O A;  3FN9 A;  3T0D A;  4KMQ A;  2WO2 A;  4OMC A;  1JZ8 A;  3ACI A;  2DCJ A;  4TTG A;  2QBX A;  3MV0 1;  1I5P A;  1UMH A;  2J1S A;  3CZU A;  3MO4 A;  4MGQ A;  2JD9 A;  4A42 A;  2WUH A;  2X05 A;  1UXZ A;  1OD3 A;  1K45 A;  3BGA A;  2VME A;  3A22 A;  2J7M A;  4BK5 A;  1XPW A;  5IFP A;  4OZO A;  3C7F A;  4A41 A;  4FI9 A;  3A7Q A;  1UY4 A;  4P5Y A;  4JKL A;  4BK4 A;  4CU6 A;  2CDO A;  1NX9 A;  4RN5 A;  5HXM A;  2WAA A;  2VCC A;  2YC4 A;  2C9K A;  2JDA A;  4DEQ A;  3P1I A;  2ID4 A;  2VMD A;  1H6Y A;  4QDS A;  5G05 L;  3WF0 A;  4QDQ A;  1W9T A;  4P08 A;  2WAO A;  2VQT A;  4CUB A;  4UOJ A;  4A4A A;  2VO5 A;  1L7Q A;  3T08 A;  2EIE A;  2LW8 A;  1BHG A;  3EB7 A;  1D7P M;  4MOA A;  4DXS A;  2Y6L A;  1JZ7 A;  4CUC A;  3WF2 A;  2X10 A;  5CZK A;  4Z2A A;  1EUU A;  4DXT A;  3III A;  4A44 A;  1RYY A;  1F4A A;  2W91 A;  2XON A;  4TXW A;  1OH4 A;  4QPW A;  4AG4 A;  3C8X A;  2J1E A;  2RJ2 A;  3A21 A;  2VJX A;  1JZ2 A;  5CYY A;  2WYS A;  1F4H A;  3SEE A;  3MUZ 1;  3BN6 A;  2VM9 A;  4MGS A;  1UZ0 A;  1W8N A;  5EJ1 B;  2BBA A;  3I2F A;  5IYY A;  4QX3 A;  1US3 A;  3FL7 A;  4A6O A;  3IAP A;  2J22 A;  1GUI A;  3HNB M;  1UY3 A;  3WNL A;  2BER A;  2J1R A;  3OGS A;  1UY0 A;  2XOM A;  5JXI A;  5JR2 A;  3UNP A;  2WZ8 A;  2J1T A;  1JI6 A;  5JMO A;  4HG6 B;  2VOT A;  3NNG A;  1WKY A;  2YC2 A;  3AC0 A;  3CZJ A;  4BXS V;  2ZXQ A;  3HOB A;  4QX2 A;  4CU9 A;  1GQP A;  2RVA A;  2W5F A;  4E8C A;  4XVH A;  1UX7 A;  1O8P A;  3IB3 A;  4ARY A;  2VQU A;  3VDC A;  4DEV A;  4UAP A;  2VMF A;  3CDZ B;  2VTF A;  4DUW A;  2QQM A;  3ECQ A;  3K4A A;  3LQC A;  3WNN A;  3K75 B;  2W92 A;  4CUA A;  3DEC A;  4ZZ8 A;  3J7H A; 
#chains in the Genus database with same CATH topology
 5JSR A;  1SFY A;  4RSU A;  5T50 A;  3APB A;  3ZPO A;  5FR3 A;  4M3C F;  3U4X A;  3SLI A;  3VZK A;  2VUA A;  1MS1 A;  4MLO A;  4Y5S A;  2VBP A;  1VBA 1;  2MNG A;  1AR8 3;  1ULE A;  2WL1 A;  5HPO A;  1CAX A;  3AFG A;  2A3X A;  1U5X A;  3MIE A;  4CP0 A;  5CIS A;  3GDB A;  4XTM A;  3ACF A;  3U11 A;  2P4E A;  5GLT A;  3T1M A;  3BYW A;  2ZPX A;  3KT4 A;  1C8M 3;  5FK7 A;  3JQW A;  2HYK A;  1DBN A;  3ES4 A;  5D2A A;  4DZG A;  5CFD C;  3NV4 A;  1AR8 2;  1VBA 3;  4PQQ A;  4MG2 A;  4OFG A;  3WV6 A;  1J84 A;  1V0A A;  4AQT A;  5FOJ B;  4MXW A;  2XVK A;  2D97 A;  5DG1 A;  4Q0U A;  2FDF A;  1HRI 3;  2ARX A;  5KXE A;  1PO1 1;  2DU0 A;  1R08 2;  2XUM A;  3H8U A;  2OII A;  4XJ8 A;  5A32 A;  3J7N A;  4CEY C;  3N7M A;  4XMA A;  4AR2 A;  4QX1 A;  4ES9 A;  3V0A A;  3ITQ A;  3TN9 1;  2AEZ A;  1PX3 A;  1CPN A;  5F3E A;  3ZYJ B;  3MYX A;  5DZG A;  4A7Y A;  1CES A;  2GSY A;  5L9V A;  4IGO A;  2WZR 2;  4Q4Y 3;  3OBA A;  2V72 A;  2ZGM A;  2ENR A;  1UWW A;  3CIH A;  5A6Y A;  1VBB 2;  1C5H A;  2NM1 A;  5IFT A;  5IWF A;  3TN9 3;  4HSL A;  2ZS6 B;  3MF6 A;  4GWI A;  3SIS A;  2C1F A;  4BQ3 A;  3SEP A;  1G9D A;  1AZD A;  1YYN A;  2E51 A;  2XQX A;  2YB7 A;  3I7D A;  4FOY A;  3M4F A;  3IT8 A;  4LHS A;  2Q1Z B;  4IE6 A;  2WQ8 A;  1VJ2 A;  5FPX A;  5FUN A;  1RXF A;  3NO8 A;  3RNS A;  2JE8 A;  4AF9 A;  5A1F A;  3BOD A;  3KV4 A;  3RVH A;  4CEW B;  1XC6 A;  4XUT A;  4A3Z A;  2VQ0 A;  5FV3 A;  1TQ5 A;  3WQ1 A;  5FZ7 A;  2AEY A;  2KR2 A;  1Y43 B;  1LR5 A;  4D7T A;  4Z8B A;  3ZXK A;  5CKM A;  3ILN A;  4P9Y A;  4LIU A;  5DG2 A;  4YG0 A;  2W52 A;  3T3Y A;  3SH4 A;  3UKV A;  3N4M A;  4XDO A;  3E5Q A;  4LK6 A;  2XLG A;  3N7L A;  1LCL A;  3FLT A;  4QPG A;  2KA3 A;  2BOJ A;  2RM2 2;  4MXW B;  1GIC A;  1POV 3;  3CQO A;  2O1Q A;  4XJA A;  2W1U A;  4HFS A;  3WSO A;  4DMI A;  1EAH 2;  4R9A A;  2CY6 A;  1AR6 2;  1J58 A;  3K4Z A;  5F2W A;  3I49 A;  1ENQ A;  5FUI A;  3OPT A;  2TNF A;  1AL2 1;  1AR6 1;  2CNA A;  5FPZ A;  2BQP A;  2WR9 A;  3POB A;  4CDU C;  4XFB A;  1RUF 3;  3VBF C;  4DRR A;  3AP5 A;  3Q8B A;  1ZBE 2;  2VW1 A;  3IKW A;  5FZ9 A;  3WR0 A;  2JG8 A;  2R7E B;  2ZEZ A;  4X6R B;  1SCS A;  4UXA A;  2IXK A;  1YQ2 A;  3ZSM A;  1WW4 A;  1KJR A;  4EV0 A;  4EN8 B;  2ZHL A;  1ULG A;  2ZGR A;  4DXR A;  2VCA A;  2RG4 A;  3QOP A;  2ZAC A;  4EE2 A;  4Q27 A;  4XUP A;  4H2A A;  1ZZ9 A;  4R4X A;  1K42 A;  4XZP A;  1QXP A;  2QQN A;  1PX4 A;  4YVW A;  2CSG A;  5FY1 A;  1W9F A;  2VZQ A;  1ULO A;  3MW3 A;  4CE8 A;  1US2 A;  2DBI A;  4JHT A;  5FLI A;  1DYP A;  1SG3 A;  1YQ5 A;  4N7U A;  1APN A;  1FV2 A;  1PNF A;  1V6O A;  3DYM A;  4CZS A;  2FDI A;  1W2N A;  4YW6 A;  3JUU A;  4HKL A;  5IAX A;  1HQW A;  2DCY A;  2QQL A;  3HBZ A;  3ZFF A;  2IXH A;  1ZM1 A;  4FP3 A;  5I8Y A;  4NRM A;  5IK5 A;  1VBC 2;  4NJ4 A;  1TMF 3;  4LHK A;  2R1D A;  4HT1 T;  2RM2 3;  1KS5 A;  2NLR A;  2VVD A;  4W8J A;  5JOZ A;  2ZEX A;  4ORF A;  4XUN A;  3VBU C;  1DG6 A;  2HEW F;  2R04 2;  1DCS A;  4LQR A;  1W28 A;  2WFF 1;  1LOF C;  5DPN A;  3WXP A;  5F37 A;  4YW5 A;  1IQD C;  3KD4 A;  2WLP A;  5F5Q A;  2VY0 A;  2P3K A;  2DVF A;  5JI7 A;  1QJE A;  2GZW A;  2VAU A;  5D8A A;  3TN9 2;  4G4F A;  1CIY A;  1GZC A;  2PQQ A;  4K1Z A;  4QX0 A;  4LMF A;  3USU B;  1AXK A;  3KCX A;  1X82 A;  2FHR A;  4N9H A;  3ST7 A;  4OQ8 A;  5FMB A;  2XDV A;  1PGW 2;  5F9T A;  1JYN A;  5C70 A;  4KBB A;  2FDK A;  1N1T A;  2E31 A;  3ACG A;  2W1S A;  3MI8 A;  2ZOE B;  1VRB A;  1TMF 1;  1BLZ A;  3PUA A;  1EY2 A;  4IND A;  4ONU A;  1JUI A;  3LA7 A;  4GMP 0;  4RGA A;  4DNY A;  4FFH A;  1BEV 3;  3O5S A;  4AEJ A;  4XBN A;  4WZF A;  4KG8 A;  4AEM A;  3K46 A;  2Y6J A;  2BU9 A;  3NAP A;  3PTY A;  3POG A;  4QXK A;  1YCI A;  2WBK A;  5FXZ A;  3VDD A;  1OLR A;  1RHI 2;  1YUD A;  2Y6F A;  1VBA 2;  3B69 A;  1UMZ A;  3GGL A;  2OZJ A;  5EHD A;  2VTX A;  4OVE A;  2PHL A;  2VH9 A;  4FOW A;  4NRP A;  2P3Y A;  4BQ5 A;  4GB3 1;  2F4L A;  2A6X A;  2X5I B;  1Y9M A;  3A4U A;  3HPN A;  1W8Z A;  1OKO A;  2Z42 A;  1IPK A;  3S7E A;  3WNP A;  3DXU A;  5I0R A;  1S2K A;  3KSC A;  1CX4 A;  2JDM A;  4EN9 B;  5BYN A;  4GJZ A;  4F7Z A;  1UYX A;  2ERF A;  4Q29 A;  2JEM A;  2A1X A;  4RHV 2;  4Y1Y A;  3BI3 A;  1UPS A;  1AX2 A;  3THD A;  5F2S A;  4XAE A;  2GC2 A;  3T4V A;  3VD3 A;  2LRO A;  1JUH A;  3VBO C;  1LHV A;  1X8M A;  4QQO A;  1V9U 3;  4CDW B;  3RWN A;  4UF0 B;  2XJP A;  2ZMN A;  4BCU A;  1C8M 2;  3JCI A;  4H55 A;  4FCA A;  1PVC 1;  4LT5 A;  5L7O A;  5LA0 A;  1O59 A;  4Y24 A;  5T5J A;  5SV8 A;  1DGR A;  4WM7 C;  4FPH A;  3ZSL A;  3OSD A;  1ZBA 3;  5A1A A;  3HQR A;  2NMN A;  1ZZ6 A;  1S0J A;  2QNK A;  5E1R A;  5CB7 A;  1IQA A;  2QKD A;  4XQW A;  2AC1 A;  1LGC A;  3HIF A;  3ZSK A;  1RUI 1;  1AYN 1;  4YZ1 A;  1KEX A;  5FZE A;  5JSP A;  1JN2 P;  1H9W A;  4IE5 A;  4CCN A;  2WSU A;  1KS4 A;  1MS8 A;  1BJQ A;  1LEN A;  1UNB A;  1UQX A;  3CF6 E;  3KV9 A;  4OMD A;  3RZK A;  5KC5 A;  1X8E A;  4DXZ A;  4CUG A;  4GH4 C;  4M4P A;  3RJR A;  2J1A A;  4MGZ E;  1RUD 1;  2GDF A;  2NMO A;  4CCK A;  2WNE A;  1HN0 A;  3V0B A;  1H2K A;  4RYD A;  1R09 3;  4NMI A;  5FMO S;  3OB8 A;  1DYO A;  1AR7 1;  1N1S A;  1Z7S 1;  1R08 3;  2C6S A;  5B4X A;  4XF3 A;  4YM3 A;  1PO2 1;  2JKX A;  4QPI C;  5FZL A;  1RL3 A;  5C5T A;  1J83 A;  1C1F A;  1QH7 A;  4CEW C;  3D5O A;  4G9S B;  3RS6 A;  5A7P A;  3AYC A;  1JYW A;  5HBA A;  3KWV A;  3POF A;  1XQN A;  2JXA A;  4BA6 A;  1WCQ A;  1B35 B;  3DPR C;  2VMC A;  4QHZ A;  1CGP A;  3I59 A;  3ME2 A;  1QOS A;  3M7A A;  2RV9 A;  1QXJ A;  4ZON A;  1LUL A;  3GBF A;  1TG7 A;  4LO5 B;  3I2K A;  2Z69 A;  2A7A A;  4M4R A;  3JD7 1;  2V5D A;  1NG0 A;  1NUK A;  5FZA A;  4XXA A;  2DF7 A;  3PMS A;  3ZXD A;  3JD7 2;  1PK6 A;  3WF1 A;  1ZRD A;  1QY4 A;  3TEY A;  1CN1 A;  2ZHK A;  1PO2 3;  2W94 A;  3LKJ A;  1RIR A;  4LTA A;  4JKM A;  4NR1 A;  4QD2 A;  1NLS A;  3OUI A;  2YFU A;  1WW6 A;  4Z1V A;  1NQJ A;  2G4I A;  1CON A;  1RUH 3;  4P02 B;  4B4P A;  3D4K A;  4LKS A;  3T0B A;  4CDQ C;  2Y8K A;  4K8F A;  2D3P A;  4BPZ A;  4R9D A;  1AR6 3;  1OOP B;  1R1A 1;  3N3H A;  1GMM A;  1DZR A;  1ULP A;  1PO2 2;  2VOK A;  1VMH A;  4Q8K A;  1OHF A;  4OCT A;  2C26 A;  5FMD A;  1UX6 A;  2RJL A;  2VZP A;  3O1S A;  1RTV A;  5LA2 A;  1M06 G;  3I3Q A;  4AI2 A;  5FO8 B;  3M3C A;  4DPN A;  1OH3 A;  4GXL A;  3HAG A;  4IV3 B;  4OHZ A;  4CPB A;  4OHW A;  3LEG A;  3QAC A;  4R9C A;  1OT5 A;  3DYP A;  3PDQ A;  1QQP 1;  4N43 B;  2B7Y A;  2Q8O A;  3VBH B;  1NZI A;  5DZE A;  4AE2 A;  3ZFE B;  5HV4 A;  1DDL A;  1RJ7 A;  2WO2 A;  4OMC A;  4RQP C;  1VE0 A;  3UKN A;  5D21 A;  1JZ8 A;  5FZB A;  2Y26 A;  1AXZ A;  4E4H A;  3BIE A;  1ALY A;  3GHM A;  4YG6 A;  3RZZ A;  1HB3 A;  5FZ4 A;  2J1S A;  5A33 B;  2XLA A;  4S2D A;  2E7T A;  3KM5 A;  4NN0 A;  1UO9 A;  3LOB A;  4A42 A;  3M70 A;  3ZYF A;  2X05 A;  3DL3 A;  1OD3 A;  3BGA A;  4PI0 A;  2QTW B;  1AHS A;  2OVU A;  4B1L A;  1YRZ A;  3O1V A;  2K0G A;  1SDW A;  4YZ5 A;  1FAT A;  5IFP A;  4WBB A;  3WUC A;  1GFF 2;  1WZX A;  4OZO A;  4NWW A;  4FPL A;  3RZH A;  1O4T A;  3CNA A;  5JDB A;  2ZX3 A;  1UU4 A;  2WNU A;  1JXN A;  3H9A A;  3Q9O A;  2MEV 3;  2WLQ A;  4JKL A;  3PUQ A;  5LAS A;  4QU1 A;  4OI2 A;  5T5L A;  1H4G A;  1K5M C;  5KXD A;  4FPY A;  1ACC A;  1ND2 B;  1YFU A;  2JDA A;  4YVW B;  5JSO A;  1FOD 3;  2ID4 A;  4N53 A;  4WVM B;  3AKR A;  2VMD A;  1RUJ 3;  2JDZ A;  1H6Y A;  4QDS A;  3AXD A;  4DY5 A;  1OQ1 A;  5BNO C;  1YI7 A;  3PVB B;  4JQT A;  2OQ6 A;  4L8Q A;  2VQT A;  3VUO A;  4A4A A;  1NLQ A;  3T08 A;  2J42 A;  3N9M A;  3BOP A;  2JG8 B;  3UJQ A;  3KQR A;  4GB3 2;  2PLV 3;  4UFH A;  2PEL A;  2A3W A;  2ZGK A;  4D69 A;  1HRI 2;  4QKB A;  1YLL A;  4IGQ A;  5KR7 A;  3Q8C A;  5C33 A;  1H8V A;  2GH2 A;  4AHW A;  4XEZ A;  3WW2 A;  4P9J A;  3MZH A;  1AX1 A;  5C3S A;  2A6Y A;  4X8N A;  3FBY A;  5CZK A;  1A3K A;  1AL2 3;  1TME 2;  3AP6 A;  3III A;  4JGY A;  3R6S A;  4S2F A;  4A44 A;  1QJX 1;  2CWM A;  1QF3 A;  1AJO A;  1I9R A;  3GF6 A;  4IES A;  3THT A;  3WVJ A;  2WWU A;  4TLG A;  2XON A;  2IXL A;  1RUC 2;  2PLV 2;  1OH4 A;  5FRE A;  3WNM A;  1RUN A;  3LIG A;  2AR6 A;  3C8X A;  4LJH A;  1POQ A;  1VBD 2;  2QQW A;  4KWJ A;  4ZU5 A;  5A7W B;  5CAD A;  5HCA A;  2Q1F A;  4JQR A;  1YFX A;  2AEN A;  3VB9 A;  3OGG A;  5J3U A;  1IS3 A;  4IV1 C;  4K20 A;  2G1M A;  5JR7 B;  1ZZB A;  5DAB A;  1F4H A;  1GKB A;  3KT1 A;  1DYK A;  2RMU 2;  3DN7 A;  1DQ0 A;  2P34 A;  4IV3 C;  4E2Q A;  2IUW A;  1Y9G A;  1OA4 A;  5FAX A;  1BQP A;  1QJU 1;  1OLQ A;  3ZYB A;  3ZYR A;  4AFA A;  5FXX A;  3OYW A;  4QX3 A;  1QNW A;  4BYY A;  1HJF A;  2YUE A;  2BFU L;  3POE A;  5A3T A;  1IKP A;  2HWC 1;  3KCC A;  5FIX A;  3NL1 A;  5FYU A;  2BYV E;  1COV 1;  4B4R A;  1UY3 A;  2VD7 A;  1VRH 2;  3FC0 A;  5A3L A;  2P1B A;  2VNG A;  3AM2 A;  1DQ4 A;  3AB0 A;  1OBN A;  4ISQ A;  1LGB A;  1LU2 A;  5JR2 A;  2BTV C;  3AYA A;  4PBO A;  3HBK A;  2J1T A;  2GN7 A;  2BNN A;  2G9Z A;  3VBR C;  2VOT A;  4TZD A;  5AVP A;  5FZD A;  2RDQ A;  3T30 A;  3AC0 A;  4JAA A;  3GCX A;  2K2S A;  2D93 A;  2NZ9 A;  4JVA A;  3BPZ A;  3MPB A;  4QX2 A;  2OYZ A;  4QQL A;  1RUD 3;  1GQP A;  4Y22 A;  1O3S A;  1JYI A;  3UL2 A;  5FZI A;  3OPW A;  3ZIW A;  3RGB A;  1E5H A;  1BMV 1;  4E8C A;  1Q8V A;  4AXO A;  3UJO A;  5GKA C;  1ZRR A;  5BY5 A;  4NAO A;  5C4W C;  2GP3 A;  5TSW A;  2ZGS A;  1AUY A;  4RS5 A;  2MHF A;  4QQP A;  1O8P A;  2O0O A;  5FYZ A;  1AYN 3;  3AFK A;  3VZM A;  4EZ4 A;  1U5Z A;  2A6Z A;  3G6J B;  1UYP A;  4UAP A;  2VMF A;  1S0B A;  1W2O A;  4DUW A;  2LUW A;  4FPG A;  3VL8 A;  4CDU B;  4OHY A;  2CAV A;  3EQE A;  2BRT A;  4RR3 C;  5FZC A;  4B29 A;  2FZ2 A;  4H14 A;  1XNC A;  3WNN A;  5CG9 A;  4GH4 B;  5LA9 A;  2VOW A;  3MPP G;  2W92 A;  1YEW A;  4ES8 A;  3E5X A;  4BQX A;  2RM2 1;  5FCC A;  4CUA A;  2VU9 A;  2XVL A;  2MEV 2;  2IXJ A;  3DEC A;  4HL0 A;  5FO9 B;  1GLH A;  3AP9 A;  5FYS A;  3HWJ A;  3IZO A;  4YGC A;  2EAA A;  2XB6 C;  5C71 A;  1FMD 1;  2DDU A;  3MFA A;  3N9Q A;  3U75 A;  2HWB 2;  2RS3 3;  2R07 3;  1RUH 1;  1ZZ8 A;  5G04 L;  5LBF A;  2YPD A;  4ZY9 A;  3KVB A;  4NIH A;  3AMP A;  3BIW E;  1FX5 A;  2D98 A;  2QE3 A;  1MVQ A;  2QQO A;  4GAL A;  4BIF A;  1WD3 A;  4CCO A;  1QNY A;  1DQ2 A;  1RMU 1;  4Q4Y 1;  4FFG A;  1PZ7 A;  4I0A A;  3I97 A;  5FZ1 A;  3J7M A;  4FPO B;  4BM8 A;  1RVF 2;  3WP3 A;  3KHC A;  1V6N A;  3IAQ A;  1QJU 3;  2WO1 A;  3FHI B;  4MAD A;  3K2O A;  3FX3 A;  2VNR A;  1DLC A;  2EXH A;  4K40 A;  1PGS A;  5HCB A;  1K12 A;  4JX0 A;  1IPS A;  1W6N A;  5E88 A;  4JGZ B;  3CEW A;  1NA1 B;  4NWV A;  1OOP A;  3PIJ A;  1MR5 A;  1S4C A;  3PUI A;  1M4W A;  4CVU A;  2CWS A;  3RRD A;  3LF7 A;  3ZFF C;  4EWD A;  2D6P A;  3LFM A;  4LUK A;  2OKX A;  3ZSJ A;  2R0F A;  2WQ4 A;  1YFW A;  5LK5 A;  2R49 A;  2EF6 A;  3VHR A;  5EYY A;  5FP7 A;  1R08 1;  3O1O A;  2VCM A;  2DFB A;  3W9A A;  1W0O A;  2Y64 A;  4FO9 A;  1Z0H A;  2D7F A;  2XHK A;  3OBZ A;  3OPZ A;  1G8W A;  4XHB A;  4IEX A;  4X8P A;  4D7Y A;  3THC A;  1AR8 1;  3LE0 A;  2J1U A;  1ZX5 A;  3BKZ A;  2WFF 2;  5D8A C;  3LSD A;  5EJ3 A;  3IDC B;  3WDU A;  3FLR A;  4CEY B;  1VMF A;  3O7O A;  5JVV A;  1SMV A;  1NCR B;  1W6N B;  2P17 A;  1DZT A;  4Q4Y 2;  4QQH A;  1H1I A;  1CZV A;  5GAL A;  3VZN A;  4ATF A;  4K1Y A;  3BVC A;  1BYH A;  1W6O B;  2A3Y A;  4SBV A;  1GOH A;  1RUE 2;  3LEK A;  1RUH 2;  1S0G A;  4IUG A;  2K9Z A;  3B00 A;  1Q56 A;  4P9I A;  1IG3 A;  4BQY A;  5DMY A;  2JB4 A;  4JGZ A;  4N53 C;  3S30 A;  1UAI A;  3OEB A;  4OUM A;  1PMJ X;  1HRV 1;  4YGD A;  4N9I A;  3U07 A;  2OS2 A;  5A1L A;  3HN1 A;  3JD7 3;  3V56 A;  1WCS A;  4URT A;  1SBE A;  3J7L A;  3PTR B;  3WF4 A;  3LOI A;  4XJW A;  1G9C A;  2F17 A;  4YW1 A;  1EP0 A;  2EA7 A;  5I0U A;  3W58 A;  3GBW A;  3RPQ A;  1MZE A;  3C7H A;  2UU8 A;  4CA9 A;  1HRV 3;  1SFP A;  2DFC A;  1GV9 A;  1XJA A;  3AP4 A;  1LHN A;  1PZ9 A;  1F31 A;  4MSV A;  3RWK X;  5BPX A;  5K4L A;  3SNM A;  2GND A;  3J26 N;  4JGY C;  4MYE A;  4WVZ A;  2H6B A;  2OUH A;  2W47 A;  3I2D A;  1X7N A;  3VDB A;  1MS3 A;  1C8M 1;  2W2I A;  2YZ4 A;  3KVA A;  3SCH A;  4Y33 A;  3IMM A;  2B39 A;  5D1I A;  1W9W A;  4A7Z A;  3B5L B;  3ZXJ A;  1QJY 3;  2CGO A;  2OPK A;  3OGJ A;  1C4R A;  5L7O C;  2QQJ A;  3FMG A;  1XBF A;  1PIV 2;  1AYM 1;  3EMR A;  3H3L A;  3OG2 A;  3HNY M;  3PUH A;  2ZAA A;  2BGO A;  4DUV A;  1ND3 A;  5JXJ A;  5LW9 A;  3B9C A;  2UY8 A;  5J1X A;  1PM4 A;  4NUB A;  1IS5 A;  1NYW A;  5FPV A;  1HRV 2;  2R1B A;  4UI9 L;  4NE9 A;  4AVS A;  5J96 B;  2XML A;  5IAV A;  2BV4 A;  3THP A;  3UT0 A;  4ZKT B;  4CP9 B;  1NA1 C;  5ACA 3;  2VZS A;  1ZBA 1;  3D82 A;  1S2B A;  1FT9 A;  5KHG A;  4YFW A;  4YYO A;  1MZ6 A;  1HJG A;  4YG3 A;  4CDX C;  3FE5 A;  1CZT A;  2BOI A;  4XMI A;  1IHM A;  2HWD 1;  2WNV A;  3NNF A;  1VLN A;  2XR4 A;  1V6I A;  4GZ9 A;  4LKF A;  5KHI A;  2PN5 A;  3MFC A;  5F8P A;  3H8O A;  2YBP A;  4XIL A;  3O14 A;  4GJY A;  1GBG A;  1AR9 2;  2D6N A;  2XBO 2;  1XXN A;  4QXC A;  1SEF A;  3N35 A;  5IK4 A;  1BBT 2;  5DAX A;  2QUO A;  2PXJ A;  2XJV A;  1VAL A;  1YXW A;  5I8T A;  4FTS A;  5F7U A;  1W39 A;  5F39 A;  1RUJ 1;  5FY8 A;  2G19 A;  4HAN A;  1RUC 1;  3UYJ A;  3M3Q A;  3LPF A;  3AKP A;  1BBT 1;  2DCZ A;  4E4Z A;  1QJX 2;  1H4H A;  3E97 A;  4QT6 A;  3LFI A;  3BTZ A;  4UFM A;  2RJK A;  3FHA A;  4L11 A;  1OMI A;  1RHI 3;  5DAW A;  2D6O X;  1QJF A;  3NV1 A;  5C6C A;  3ZFG A;  4BZ4 A;  5C9A C;  5IJR A;  1FPN 1;  4YRD A;  1RUF 2;  1WW5 A;  5JXG A;  1PNG A;  1EPW A;  2HEY F;  1ODM A;  4W6Y A;  5A7O A;  4YPJ A;  3JBG 3;  3SKV A;  1CVN A;  4CPB D;  4AI3 A;  4YWA A;  1ULC A;  2Q8D A;  1GWL A;  1RUI 3;  1N1V A;  2I74 A;  1LHO A;  5HCF A;  1H1M A;  2HWB 1;  4AGR A;  5AC9 2;  2JDP A;  3ZOI A;  3O1R A;  3BUC A;  2VMI A;  2ZZQ A;  1IPJ A;  1B09 A;  4P9G A;  3ZIX A;  1ND2 C;  4R8H A;  3OJB A;  5JZG A;  4YLZ A;  1ZRF A;  1DQ6 A;  1RB8 G;  2ARE A;  2VL4 A;  3AK0 A;  2AZ5 A;  4M00 A;  5ISL A;  1XNA A;  1KXG A;  2CYF A;  3ORJ A;  2W9X A;  1AL0 G;  1PZ8 A;  2BZD A;  4KGG A;  5FZ0 A;  1JYV A;  1MEC 2;  3K48 A;  5AFB A;  1F8V A;  4EZH A;  5AC9 3;  3MW2 A;  4JV4 A;  5BXX A;  4M3C E;  2DUQ A;  4Q4V 2;  3JU9 A;  2XG3 A;  4H3W A;  5CIR A;  3POY A;  3LWC A;  1GOF A;  1MZ5 A;  2RS5 1;  5GZF A;  1KQR A;  2V4V A;  1XE7 A;  2Z79 A;  4OI4 A;  1RVF 3;  2QQU A;  1J3P A;  2ZX1 A;  4O9E A;  2ZBJ A;  5DUX A;  3UGH A;  2QQK A;  3VD4 A;  3GNE A;  1SDD B;  5K8S A;  3GJB A;  4D6R A;  4ERO A;  2W46 A;  5JIA A;  3VBU A;  1PMH X;  3HQU A;  2Y6H A;  1V00 A;  3E6D A;  1RIN A;  2ADE A;  1W9Y A;  2WFP A;  1PVX A;  1K3I A;  3ZFE C;  1W3X A;  2WZE A;  4QMA A;  4C0B A;  3DKW A;  1GZ9 A;  1DGW X;  1ZBE 3;  3CJI A;  1S0I A;  3OTF A;  2GU9 A;  3USU A;  5EIY B;  3RFR A;  2TBV A;  5KWR A;  2YG0 A;  4FXK B;  3VV1 A;  2QZ3 A;  4J6G A;  2WAB A;  1YIP A;  4BE3 A;  4D6Q A;  2RS1 2;  1N3Q A;  4PLO A;  1Q8O A;  3OD4 A;  2GP5 A;  4TYS A;  1W99 A;  4XUR A;  2CV6 A;  2GAU A;  2XJR A;  2W3J A;  2WII B;  4N43 A;  3ZN6 A;  5KHJ A;  3LEI A;  3WNX A;  2HYX A;  4D7S A;  5L73 A;  5AC9 1;  3VBU B;  2D5H A;  2UYB A;  2HH9 A;  2XXZ A;  3DYO A;  5EJZ B;  4BJ0 A;  4CDQ B;  2BUK A;  4BHP A;  3JXS A;  4Y4R A;  1XOY A;  3K77 A;  1WD4 A;  1HQL A;  4PF1 A;  1V70 A;  4B8E A;  4YZ2 A;  4IE0 A;  1W6Q B;  5ACA 2;  2LRP A;  3HT2 A;  4LBM A;  4E2G A;  1H8T C;  1NZC A;  5C8C C;  2F6B A;  1AYM 3;  1IOA A;  4FOV A;  3JBG 1;  3KF5 A;  1O4Z A;  3QD6 A;  4TN7 A;  5J98 B;  3UKT A;  5BNP C;  5JXH A;  4QPY A;  4ARX A;  4NVP A;  1IGO A;  5CFD A;  3POI A;  3NNL A;  2VUJ A;  2JIJ A;  4TWT A;  4CCJ A;  4DB5 A;  4Q1R A;  4Z92 B;  3NJV A;  3CJI B;  3MUY 1;  4TLF A;  5FY5 A;  3TB0 A;  2XUE A;  4GD4 A;  2PLV 1;  3T2O A;  3WIN E;  5A3M A;  1O4Y A;  1BEV 2;  5J37 A;  5JIU A;  1TZO A;  1XE0 A;  2VZO A;  4MO3 M;  3AMM A;  2E26 A;  2VUC A;  2RDR A;  4I2O A;  1ENR A;  2YBK A;  2AYH A;  2BVB A;  4P00 B;  4YFZ A;  1CAV A;  2GAL A;  2YXS A;  3NJX A;  4MXV A;  5IK7 A;  5C8C B;  1O3T A;  1SAC A;  1W8U A;  1FV3 A;  1OLM A;  2WZR 3;  3DEM A;  4PDW B;  1LOG A;  3L2H A;  4HSJ A;  4TSV A;  4W4Z A;  1Y4W A;  4FPF A;  4BH9 A;  3AL6 A;  4Y26 A;  4CXX A;  1D4M 3;  2VZ1 A;  1HXS 3;  5FPU A;  5LRS A;  1UXX X;  5FZM A;  4ZU4 A;  1UYY A;  4XQD A;  2EIC A;  4K7J A;  2VOX A;  1UOG A;  2NP0 A;  1H2N A;  1GP6 A;  2JG9 C;  4QB6 A;  2ARA A;  4Q2F A;  5E6H A;  3C7O A;  4LLO A;  3WQ0 A;  4CCE A;  5B2G B;  1K5J A;  3ZYI B;  3T0D A;  2HWE 2;  3NST A;  4Z2W A;  3CU7 A;  5FJK A;  1GAN A;  4ITC A;  5ABJ C;  2W08 A;  3VLB B;  2RHP A;  2YMZ A;  5FJH A;  4J25 A;  4OUL A;  3MV0 1;  3NNM A;  1I5P A;  3B7M A;  4OLL A;  4XDQ A;  4C0H A;  1LGN A;  3PLQ A;  4Q4W 1;  4V2W A;  2ZX0 A;  4IE7 A;  4DY3 A;  2ZX4 A;  3M3E A;  4XAB A;  3WP4 A;  1CWP A;  1FMD 3;  1UXZ A;  4RGK A;  2JDY A;  4WM8 A;  1W6M A;  4RHV 3;  1KIT A;  3EXU A;  4I01 A;  5CKN A;  4CDX B;  3MLK A;  3RDI A;  4WVW A;  4BK5 A;  1XPW A;  2NYY A;  2R6Q A;  5F3I A;  1D0G A;  4XOG A;  5F6K A;  4NHK A;  4FI9 A;  3KGL A;  4Y5T A;  1UY4 A;  1PVC 2;  1B35 A;  1ODN A;  4E27 A;  2OXB A;  4R9B A;  1X50 A;  1JHN A;  4HET A;  3POS A;  4COZ A;  1WBL A;  1W05 A;  5BNN B;  5L36 A;  2WAA A;  2ARB A;  2OZ6 A;  2VCC A;  2Z2S B;  4PIY A;  5FY4 A;  2C9K A;  3VKF C;  3ZSE A;  5J48 A;  1PK6 C;  1ENX A;  4F83 A;  5M0T A;  1ONA A;  1E5S A;  3MIH A;  2VQA A;  3WHT A;  5C5U A;  4XF9 A;  3AJY A;  3ASI A;  3VBO A;  1W9T A;  2UYA A;  3ZXL A;  1XYO A;  2UUR A;  4QKN A;  4CDW A;  1PMI A;  5I91 A;  1UOJ A;  2HWE 1;  5A32 B;  1LKN A;  1J1T A;  2EIE A;  5F32 A;  4Q4W 3;  1OI6 A;  3HT1 A;  5FLH A;  2XKO A;  1BHG A;  4CRQ A;  3OBR A;  3FFZ A;  2WJS A;  3SCG A;  4YM2 A;  4WM7 A;  1ZNP A;  4RFT 0;  4MOA A;  3KMH A;  4DXS A;  1RUE 1;  3IIA A;  4HVR A;  2BFU S;  4EQV A;  3K3O A;  2X10 A;  4AK3 A;  5BNN A;  4YW3 A;  5FKC A;  4YGE A;  4PBP A;  4LR4 A;  3LA3 A;  1WCU A;  1HV1 A;  5A7S A;  2DWR A;  3MID A;  4LOT A;  3QH7 A;  1IKQ A;  1XNB A;  2BGC A;  2Q5T A;  1MS4 A;  4AG4 A;  2XQR A;  3OF1 A;  2VJX A;  4FPJ A;  2ES3 A;  1JZ2 A;  4XET A;  4NPL A;  1AR7 3;  1D0H A;  1MS0 A;  1S0D A;  1Z7S 3;  3MUZ 1;  3BN6 A;  4N53 B;  2VM9 A;  5GZD A;  2ADD A;  1SLT A;  1VB2 A;  2HWD 2;  3MEP A;  2FD8 A;  4IV1 B;  4PI2 A;  5EJ1 B;  1W06 A;  3FZ3 A;  2VUD A;  5IYY A;  5F6L B;  2Y34 A;  2FDJ A;  3FL7 A;  1O5L A;  2R04 1;  3IAP A;  1NE4 A;  2J22 A;  3RI9 A;  4WM7 B;  4C90 A;  1GWK A;  4E4S A;  3HNB M;  1RUO A;  1RXG A;  3M2M A;  3OYW B;  2XL7 A;  1MVE A;  1QOO A;  1HKD A;  4JC1 A;  5FOB B;  2WZ8 A;  5JWP A;  1YQ8 A;  3B94 A;  4AGV A;  5AVA A;  4JTO A;  3VBF A;  3B01 A;  1LU1 A;  4I3G A;  2MEV 1;  3GHN A;  2YC2 A;  5FQ0 A;  2JG8 C;  1O3R A;  4BXS V;  3UGF A;  3KHB A;  1GR3 A;  4A3X A;  1AYN 2;  1FMD 2;  4AVA A;  2UWA A;  3PHM A;  3WLU A;  5LY1 A;  4FQ4 A;  3C2U A;  4JGZ C;  1R09 2;  5A70 A;  3VZL A;  2Q8E A;  1UX7 A;  5L7O B;  4YVW C;  1AF9 A;  1O5U A;  3ETQ A;  4M0H A;  1OQD A;  2OX0 A;  2R07 1;  3IB3 A;  2Q30 A;  5FZ8 A;  4ARY A;  3MIC A;  1YO8 A;  4A6S A;  3VDC A;  5A7W A;  2Y0O A;  2F4P A;  4QGN A;  4XPV A;  4DEV A;  5LK7 B;  3M3I A;  2BW8 A;  5K7P A;  5IVC A;  1LOA A;  2P5B A;  5FY7 A;  3ZN5 A;  5JAX A;  1YFY A;  4UFL A;  4XIO A;  2QQM A;  2XWJ B;  2D44 A;  4G3Y C;  3K4A A;  4IEQ A;  4YNI A;  1JOD A;  3H7Y A;  2RS5 2;  5FK8 A;  1EAH 1;  4PCR A;  4UFK A;  4B7E A;  5A3W A;  5FYT A;  1OC1 A;  1LHW A;  5EZW A;  3T2T A;  3J7H A;  1WGP A;  4HN0 A;  4XUQ A;  1Q8S A;  4JKK A;  3ZN6 B;  3TEW A;  4NIG A;  4Q4X 3;  1MQT C;  3I2G A;  3QLQ A;  2Q4S A;  4JDO A;  2RS5 3;  3AVR A;  4AQ2 A;  2YDE A;  4A45 A;  1GP4 A;  1ZRI A;  1VBB 3;  2YFZ A;  3NAP B;  2A75 A;  4Y1V A;  4DIN B;  1JH5 A;  4NPR A;  1MS9 A;  4AZZ A;  1W0P A;  4CXW A;  3HJR A;  3LB9 A;  2WYF A;  4WVM A;  3H8X A;  2VW0 A;  3BTA A;  1BVV A;  4K9S A;  4BQ4 A;  2VZU A;  3T09 A;  3OD0 A;  4ZU7 A;  1K5M A;  4K21 A;  5FQ0 B;  3JZV A;  3ELN A;  1JTZ X;  1VBB 1;  1QXR A;  5C3R A;  4NIA A;  1XNT A;  3OUH A;  5F5A A;  1C1L A;  2B4K A;  1FPN 3;  2I2S A;  4F3J A;  2ZGU A;  5FPB A;  1UKG A;  3ZN4 A;  4FT8 A;  3GYD A;  1NXD 1;  3PVO A;  2HLE A;  1XU2 A;  2XVG A;  3I2H A;  4Q4X 1;  1GNY A;  2DUP A;  1JZ5 A;  4GH4 A;  5IUQ A;  4PJY A;  2E6V A;  3BTY A;  4E8D A;  1HXS 1;  3Q8F A;  5JOW A;  4LBJ A;  1G9B A;  1H9P A;  1R1A 3;  2FMY A;  4QB1 A;  4J1W A;  1UU6 A;  3IPV A;  4OYU A;  1JS9 A;  1G86 A;  2VBD A;  1RUJ 2;  3NQH A;  5C8W A;  1WCD J;  1L7R A;  3DV8 A;  2UY9 A;  4LHL A;  1CAU B;  3E5U A;  1W90 A;  3ZO0 B;  5LZ6 A;  5KC6 A;  3ON7 A;  3U37 A;  1VBD 1;  2JB8 A;  3KGZ A;  1VAK A;  4LOR A;  4UW6 A;  4RS5 B;  4LHN A;  4SLI A;  3N9L A;  1N3O A;  4QPI B;  5I8S A;  1PO1 2;  3PUR A;  3SC7 X;  4D0Q A;  5JZG B;  1FNY A;  1SHW B;  4HZF A;  5DDJ 1;  4GWJ A;  5JOY A;  2YU2 A;  4QPG C;  3WZ1 A;  4FTB A;  4RA0 A;  3W5M A;  1V6M A;  1ASJ 3;  1C8N A;  1JMU B;  1R1Z A;  2ZA9 A;  2D43 A;  4R52 A;  4FOQ A;  2DVG A;  4BLI A;  4AFM A;  2XJQ A;  5T54 A;  3UET A;  2CHH A;  3C3V A;  1UU5 A;  5DAV A;  2GN3 A;  4CCM A;  1LOC A;  1EYB A;  3ALQ A;  5J7M A;  5FP4 A;  1RC6 A;  4B4Q A;  4LOS A;  3M1H A;  1DQ5 A;  1C28 A;  2YPJ A;  3OGV A;  1JW6 A;  2PAE A;  3O0V A;  5FRA A;  1EPZ A;  2PAK A;  3RZG A;  4OQ9 A;  4K6B A;  4CU7 A;  2WS9 1;  2B46 X;  4KWU A;  5FWE A;  2XJT A;  2D5F A;  1AYM 2;  5CFC A;  1KDM A;  4WM8 B;  2ORZ A;  2ZAB A;  3JQX A;  4MGY E;  4YZ3 A;  5CG8 A;  1XB9 A;  4XAC A;  1NCR A;  5T5P A;  5FDB A;  3I3D A;  1KDK A;  3WP6 A;  1H30 A;  4UT5 A;  2VZR A;  2VZT A;  2ZGO A;  3SHR A;  4L99 A;  1QDC A;  3V0B B;  4COU A;  4Q5O A;  5KXC A;  3DXT A;  5FWJ A;  2ARC A;  1W6P B;  1RUG 1;  4NRQ A;  3VBO B;  2QVS B;  4LBO A;  4AVC A;  5DUW A;  4IW3 A;  1WBF A;  5HCH A;  4LBN A;  4BIS A;  3K51 A;  4AHY A;  5JLV A;  2QJV A;  2KD7 A;  4QPG B;  1UOF A;  1RMU 3;  3MGU A;  1S0F A;  2VC9 A;  5A7Q A;  4AQS A;  1LOD A;  5L19 A;  2ZKN A;  5FUP A;  2G9F A;  4B1M A;  2WDB A;  2ET7 A;  4HK9 A;  4RHV 1;  4Q8L A;  3IN9 A;  1NCQ C;  2ATF A;  1REE A;  1UZZ A;  2PHT A;  4Z82 A;  1P8J A;  4CU8 A;  1NKG A;  3ACH A;  1SZB A;  2HKX A;  2J1V A;  3KT7 A;  2GC3 A;  1JZ6 A;  2HWF 2;  3O1T A;  1GYK A;  4PT6 A;  3VDA A;  2A5Z A;  3NNJ A;  4N90 A;  3DGT A;  1W04 A;  1XSQ A;  5DUV A;  3MIF A;  1QIQ A;  2OW4 A;  1JYT A;  1GOG A;  4XAA A;  3T0A A;  1JU3 A;  3RYP A;  4URA A;  2O14 A;  1SQ4 A;  3B02 A;  1C3H A;  1RIT A;  2K46 A;  1O91 A;  2R06 2;  1JYC A;  3WF3 A;  1VRH 1;  5DN2 A;  4H7L A;  4P14 A;  3M3O A;  4GMP 3;  3S0M A;  1TE1 B;  3UV9 A;  4I02 A;  2ZHN A;  5C3Q A;  2BWC A;  3MF9 A;  3ILF A;  4JGY B;  3GAL A;  2ETE A;  5L9B A;  5EQU A;  2AH2 A;  2B42 B;  4XHX A;  5FBZ A;  2VR4 A;  1X9T A;  4A2U A;  3VD7 A;  3C7E A;  2CGN A;  2X5I A;  2HWC 2;  4JDM A;  1F15 A;  2V5Y A;  3VZJ A;  4HVQ A;  2VW2 A;  2B5H A;  3AYE A;  3WQB A;  1JU4 A;  3MDP A;  2RR1 3;  1JOP A;  3OY8 A;  3NAP C;  3U4S A;  3ZMO A;  4A7K A;  4BMB A;  3O1P A;  2ZEW A;  3AMN A;  4X6Q B;  1C5I A;  2BNO A;  3WG3 A;  4Y1X A;  1HB1 A;  3LCP A;  3PL0 A;  4JZR A;  4K8R B;  1PIV 3;  4QM8 A;  2NPI A;  1YJL A;  3BPS A;  2VUL A;  3F2Z A;  3GXU A;  4E4D X;  3NMB A;  1O8S A;  1Y7B A;  1HB2 A;  2GH8 A;  2P6C A;  2B9U A;  3OEA A;  4Q0S A;  5ANN A;  4KH9 A;  4Q1P A;  2GMP A;  1DZQ A;  1LOE A;  4QU2 A;  2WO3 A;  5B4N A;  1QEX A;  4JDN A;  2NN8 A;  1D2Q A;  3FHQ A;  1GZT A;  1ULD A;  2JWP A;  4LIT A;  4XJ9 A;  4XZU G;  1MAC A;  2PAM A;  1OOP C;  2ZGN A;  3PIG A;  3SXW A;  4LO6 B;  1Q3E A;  3HD8 B;  4CCL A;  3AVS A;  2HBT A;  1ND3 B;  4UW5 A;  5IHR A;  5FP8 A;  1H6X A;  1OVP A;  2ZZJ A;  2WNU B;  2H6C A;  4DUX A;  1EUT A;  3ZYP A;  2R06 1;  4W6W A;  4P9X A;  3AL5 A;  2I07 B;  4ZPI A;  5E89 A;  5J09 A;  2ZKL A;  1IS4 A;  4IDZ A;  3TBD A;  3H7J A;  3J4U H;  4ATE A;  3AMQ A;  1Z78 A;  2Z4F A;  4XJU A;  1WUV A;  4PQ9 A;  1S0E A;  2JG9 A;  4GB3 3;  2JDN A;  2YC0 A;  1COV 3;  3J8F 2;  3RG0 A;  1TNF A;  4UWD A;  3WW3 A;  3SKJ E;  5CEH A;  4YW7 A;  1S2E A;  3D8C A;  2YV8 A;  3WCR A;  4AHZ A;  4AYU A;  4AI8 A;  4NHY A;  3LPG A;  3KZ4 C;  4QAW A;  3ZXA C;  5HI0 A;  1VR3 A;  4QHO A;  2ZGL A;  1W2A X;  2D6L X;  3ENR A;  1REF A;  3RI8 A;  4IEP A;  4BQ1 A;  3PVN A;  2OPW A;  1YNA A;  4XIK A;  1SPP B;  4AVB A;  2ZGT A;  1DGL A;  4KGQ A;  5T52 A;  4KWK A;  1HN1 A;  3TNQ A;  2BP6 A;  5F3C A;  1TEI A;  3LGR A;  2E33 A;  3DPR A;  2JG9 B;  5L9R A;  5DQ0 A;  3BU0 A;  2PHU A;  3URF A;  1OF3 A;  2DCT A;  1PGL 1;  2WFF 3;  1H2L A;  2RR1 1;  1W8H A;  4FVV A;  1V9U 1;  2DCK A;  1LEM A;  1O6U A;  2AGS A;  3TYJ A;  3UGG A;  1UZV A;  3KQ4 B;  3NW4 A;  3QH6 A;  3VL9 A;  4BQW A;  4RQP B;  5FMO L;  1UCX A;  5FYH A;  3IPV B;  4QXB A;  2BPA 2;  2GMM A;  3AJZ A;  3H42 B;  2E9Q A;  4RD7 A;  3U14 A;  4CDW C;  2Y38 A;  4NHL A;  3WG1 A;  1RJ8 A;  2WSV A;  2ZMK A;  4AAP A;  4GUL A;  4MGK E;  1JBC A;  4K3U A;  4LBQ A;  5DDJ 3;  5BUV A;  1I6X A;  1PGW 1;  2ZX2 A;  3S6P A;  5I0T A;  2XJS A;  3SCF A;  2H0B A;  3DCQ A;  4UBG A;  4UBH A;  1GU3 A;  3LAG A;  3HR9 A;  4HK8 A;  2RDN A;  3NV3 A;  4ASL A;  1JZ4 A;  1D4M 1;  2D6M A;  4BQ2 A;  1TVG A;  4KI5 M;  2PHF A;  3VD5 A;  4AQ6 A;  5T3N A;  4QM9 A;  3WG2 A;  4Q4X 2;  3U0Z A;  1E5R A;  3O12 A;  1QQP 3;  1I1E A;  4CP9 A;  3KS7 A;  3VD9 A;  4QPI A;  1OFN A;  1OF4 A;  3VGI A;  3B9I A;  1CAW B;  2CTV A;  2BWA A;  5CFD B;  1RUE 3;  1XE8 A;  3IDA A;  1AR9 1;  2XBO 1;  4Y22 B;  5KHK A;  4HPK A;  5BNP B;  1SLI A;  1YWK A;  5K9Y A;  3MBW A;  3LEM A;  1KFU L;  3ATG A;  5AFE A;  4AHX A;  3E6C C;  3MV1 1;  3OGR A;  4L0P A;  1TME 1;  1X33 A;  2E7A A;  3DPR B;  3K4D A;  5GZE A;  2DTW A;  1U12 A;  3MW4 A;  5FMC A;  5FY0 A;  2SLI A;  2WKK A;  1SBD A;  3D3A A;  4OUS A;  5CVR A;  4AFC A;  5FXV A;  1MQT B;  3WDY A;  5HV0 A;  3LD8 A;  1J1L A;  2DBN A;  1PVC 3;  5FBJ A;  4XFI A;  4PDW A;  2IZW A;  1XU1 A;  4PIX A;  1SCR A;  1BXH A;  3A0K A;  4LO8 A;  3H1Y A;  4KMQ A;  3H8R A;  3EBR A;  1AR9 3;  2XBO 3;  3NWK A;  3PJY A;  4TTG A;  5H9S A;  3FJS A;  4FAH A;  3U78 A;  4CDQ A;  1UMH A;  4D3W A;  3KV5 A;  3CZU A;  4LUM A;  3LZZ A;  4MGQ A;  1ZBE 1;  4EJR A;  2JD9 A;  2KXL A;  3LSE A;  1CD3 G;  2Q1M A;  2JKB A;  4XBL A;  4FAG A;  2VXJ A;  4NID A;  1ASJ 1;  1W6Q A;  4HOO A;  5IVV A;  5IVY A;  4HPK B;  5BNP A;  2VME A;  2NQY A;  1CR7 A;  4NHM A;  2J7M A;  3WHU A;  4AFD A;  3FUQ A;  4FPE A;  4C91 A;  5E16 A;  1S1A A;  3IMN A;  5I0S A;  3AKS A;  1D2S A;  3N9P A;  1Y3T A;  4A41 A;  4U36 A;  3A7Q A;  1A8D A;  1ZZ7 A;  2Y60 A;  4IEO A;  4P5Y A;  4FQZ A;  1OKQ A;  1W6P A;  1H1A A;  4BK4 A;  1A8M A;  1UL9 A;  1CAX B;  2X29 A;  5ANQ A;  3VKN A;  1WLW A;  4BU2 A;  4CU6 A;  4RN5 A;  4AED C;  1D4V B;  1OPM A;  2BNM A;  3KB5 A;  1Q5O A;  2YC4 A;  3VBS A;  2ILM A;  3INA A;  2HWD 3;  3LIH A;  2W0X A;  4Q4W 2;  4V1P A;  1Y9Q A;  2VBB A;  5JOX A;  4PLM A;  3BOW A;  5A6Q A;  4Y20 A;  4FSJ A;  1BMV 2;  1QQP 2;  1GP5 A;  1UZY A;  4CEY A;  3WF0 A;  4QDQ A;  4GIQ A;  5LY2 A;  2W68 A;  4BB3 A;  2WAO A;  1OUX A;  4CUB A;  2D40 A;  2EVX A;  3OY8 B;  4QKF A;  2RMU 3;  3GZE A;  4UOJ A;  2VO5 A;  1W6O A;  4LKE A;  1SLC A;  2R16 A;  1EV1 1;  3MIB A;  4YM0 A;  2JIG A;  3EB7 A;  3O0W A;  1COV 2;  3J8F 3;  4PF5 A;  1CQ9 A;  3WY6 A;  1FPN 2;  2YGL A;  3ZMN A;  2WNU C;  4EYU A;  5A3N A;  2E63 A;  5DDJ 2;  4CXY A;  1KJL A;  2Y6L A;  1JZ7 A;  2YHJ A;  3ZYG A;  1ND3 C;  3Q8E A;  2Q8C A;  4CSW A;  5EXO A;  1UIK A;  3NKG A;  4FPC A;  4BWO A;  3KF3 A;  1EUU A;  3KLS A;  4DXT A;  3N9N A;  4DIQ A;  5FO7 B;  3S7I A;  1RYY A;  3SH3 A;  3QBQ A;  1F4A A;  4NPM A;  4HKW A;  3TAY A;  1NA1 A;  2C9A A;  3I59 B;  1R1A 2;  3WX5 A;  3BCW A;  5A7N A;  4TXW A;  1U5Y A;  4QPW A;  2ZAH A;  2E53 A;  2LAL A;  2QDR A;  1FAY A;  4YW2 A;  3A21 A;  4I3P A;  5IT6 A;  2N7G A;  1SLA A;  2BEO A;  2WWS A;  3H3U A;  2C24 A;  5CYY A;  2P6H A;  5EPA A;  3ZKU A;  4XFG A;  3O0X A;  1V6K A;  3PME A;  3I8T A;  4LO4 B;  4QHB A;  1W2U A;  1W8N A;  2DUO A;  2IC1 A;  2ZJC A;  3OBT A;  1DLL A;  1UD1 A;  2RS1 3;  1FNZ A;  4Y5Z 0;  4IXL A;  5H9Q A;  1W6M B;  1J3Q A;  4QX5 A;  1NT0 A;  4XFH A;  5HXV A;  4RR3 B;  4GWM A;  3EHK A;  1US3 A;  3QCW A;  2WA3 A;  3PVE A;  4A6O A;  4O7X A;  4AI9 A;  4LO7 A;  5K0U C;  4JRL A;  1UKR A;  1MS5 A;  2DUR A;  5C4W A;  4YZ4 A;  1GUI A;  3WNL A;  2BER A;  2J1R A;  1BK1 A;  4XF4 A;  5JXI A;  4AVT A;  3RZL A;  1HDK A;  3UNP A;  1AJK A;  5LRR A;  4COY A;  3P3P A;  1CJP A;  1GZW B;  3M8L A;  2E7Q A;  1PGL 2;  1JI6 A;  5JMO A;  4LNV A;  3LDB A;  3NNG A;  5FTT C;  1FXZ A;  4ZS3 A;  3WP5 A;  3CZJ A;  2VE1 A;  2ZXQ A;  1BKZ A;  3VHO A;  4CYD A;  1PM7 A;  1LRH A;  4CU9 A;  5GZG A;  2AUY A;  2RVA A;  1PIV 1;  2W5F A;  1A34 A;  1WW7 A;  4EN7 B;  4XVH A;  2JDH A;  2IVJ A;  3OOX A;  1QDO A;  2XJU A;  1POV 0;  4IE4 A;  1DGR N;  1FYU A;  1PK6 B;  2Q0A A;  3RMY A;  3WDX A;  4BXF A;  1RED A;  4GKX A;  5BNN C;  2VQU A;  3AYD A;  3TRS B;  4C8D A;  4LIV A;  2KM2 A;  1W8F A;  4FPK A;  1RGS A;  3SQO A;  2JEC A;  3CDZ B;  2VTF A;  1IZ3 A;  3DUI A;  3AZV A;  2HWF 3;  5T55 A;  5LWB A;  5CAZ A;  1KRI A;  4RQP A;  3ECQ A;  2R07 2;  3LQC A;  3V0A B;  4P5H A;  3SIT A;  4E9K A;  3T4H B;  2EIG A;  1WMF A;  3H3Z A;  1W8T A;  3K75 B;  4NAM A;  5IVJ A;  1LAJ A;  4XE9 A;  2FCV A;  5DAP A;  4LE4 A;  4ZZ8 A;  3S5A A;  1OD5 A;  4AI1 A;  4MGI E;  2O8Q A;  3X29 B;  1W0N A;  2R06 3;  3ZXE A;  4XCA A;  4JHZ A;  3ZX7 A;  3V64 A;  4IQP A;  1HIX A;  1YIF A;  1SFN A;  4WM8 C;  3RMX A;  1XRU A;  3VZO A;  4CEW A;  3O1M A;  4LA3 A;  1QH6 A;  2D3S A;  4I09 A;  4O9G A;  3ZFE A;  4AEK A;  1PHM A;  3W20 A;  2IVI B;  4DO0 A;  1QOT A;  1RUF 1;  1A78 A;  4QKD A;  3BB6 A;  4P9L A;  1UW8 A;  4HXC A;  5CU1 A;  1JHJ A;  2G9G A;  4ISR A;  3HN3 A;  3MHZ A;  3FUO A;  4LE3 A;  4QGM A;  5FPA A;  5F1R A;  1C57 A;  1CJD A;  4EN6 B;  1LEC A;  2B45 X;  5LCW L;  5JPN B;  2EIB A;  1H2M A;  2QQV A;  1W8W A;  4MUV A;  3AZX A;  3I3M A;  3CJI C;  1F9K A;  3L9J T;  4PDW C;  4ZXK A;  3TEZ A;  1ZA7 A;  1O3Q A;  3WG4 A;  1TMF 2;  5FXW A;  1VBC 3;  4IL7 A;  3N9O A;  2A71 A;  2WC2 A;  3N7K A;  3NJZ A;  4PLN A;  5IVE A;  1GWM A;  5JI9 A;  2PTM A;  5FPL A;  4ASK A;  3MLJ A;  5FFO C;  1H8T B;  5ERL A;  3GM8 A;  4LK7 A;  2X5I C;  3ABZ A;  5FP3 A;  4AAX A;  5IAT A;  4LXL A;  2VEC A;  5FY9 A;  2I45 A;  4IER A;  4GQ7 A;  4XFA A;  4Y1U A;  1HX6 A;  1ND2 A;  2XKP A;  2YYO A;  1HXS 2;  3RZJ A;  5C7G A;  1D4M 2;  3R4U A;  2JE9 A;  3JBG 2;  1K5M B;  4XBQ A;  2QQI A;  1UMI A;  3ZDS A;  5JCT A;  4WVV A;  4JRA A;  2C5D A;  4MET A;  5EV7 A;  2FDG A;  4HBN A;  1JOB A;  5F5C A;  5JUV A;  5LBC A;  4IEY A;  3T2P A;  1VBC 1;  4XQ4 A;  3S5Q A;  3EJK A;  4NOT A;  2WT1 A;  3I54 A;  3I3E A;  5LBB A;  1G6N A;  3NVC A;  4IV1 A;  1VBE 2;  5EWS A;  3Q8A A;  4EN0 A;  3C7G A;  3NJY A;  1EV1 2;  4OI1 A;  4Q0V A;  4AGG A;  3PUS A;  3MIG A;  1J59 A;  1LOF A;  4H7M A;  2V09 A;  1X36 A;  4IV3 A;  5C3O A;  1MQT A;  3ZLI A;  1VBD 3;  1VAM A;  4HLT A;  2RS1 1;  3AKT A;  4BME A;  2ZEY A;  1XND A;  2WN3 A;  2L9L A;  3EYP A;  4XDP A;  3I2I A;  1SPP A;  1T6G C;  3CKH A;  3EO6 A;  2VCB A;  4I0W B;  4KBZ A;  4XF0 A;  4AFB A;  4XYX A;  3VBH C;  2BDR A;  1UY1 A;  1VMJ A;  5BNO A;  1Q8Q A;  4MHU A;  3AZZ A;  3D6E A;  1YHF A;  1UY2 A;  5A33 A;  4YAR A;  4D94 A;  2RS3 1;  4OUE A;  1NY7 1;  1QJY 2;  1RUG 2;  4COW A;  1QGL A;  1KGY A;  2ZHM A;  4FXG B;  4QXH A;  4UYB A;  3WNK A;  4W65 A;  5A3O A;  3W5N A;  1ASJ 2;  1CZS A;  3TWI A;  1JYX A;  3AKQ A;  3GBG A;  1UPI A;  3JB4 C;  4MZU A;  5FZ6 A;  1ENS A;  1GQH A;  1OPO A;  4CCD A;  2LS6 A;  1W03 A;  3FWE A;  2WS9 2;  3P3N A;  4QDR A;  5FZK A;  2CU5 A;  2HWE 3;  2GME A;  1OVS A;  3OUJ A;  3J9S A;  1QJX 3;  1VAV A;  2X09 A;  3PJQ A;  2PA7 A;  4Y4Y A;  4PIZ A;  5GLW A;  4AL9 A;  2EXI A;  4B3N A;  4W50 A;  4CP1 A;  1H8T A;  2VNO A;  4I0B A;  3TEX A;  2YBS A;  3NRU A;  4D6S A;  4DQA A;  4GAZ A;  4QWN A;  1VBE 1;  2VVE A;  4LBL A;  2W1Q A;  5IW0 A;  1R64 A;  4C1X A;  2WS9 3;  3AMH A;  5LA1 A;  5FZO A;  1HLC A;  2PHD A;  1F35 A;  1OXC A;  4XTP A;  2R04 3;  2YRO A;  4ZS2 A;  3T2Q A;  1LOB A;  1V6L A;  2GNM A;  4Y3O A;  1B35 C;  3VKO A;  4QX7 A;  3UK9 A;  2A70 A;  3VBS B;  2PFW A;  5EFU A;  2PYT A;  2XHN A;  1Q43 A;  5IVF A;  2FMD A;  4AI0 A;  2FQP A;  1I3H A;  5C9A A;  1DFQ A;  1E5I A;  1UOB A;  3H1W A;  4KNC A;  5APA A;  1N1Y A;  4W6X A;  1EV1 3;  1X9P A;  5GZC A;  1LJ7 A;  2WZR 1;  3HNM A;  2GC0 A;  3CJX A;  3ILR A;  3WEZ A;  1QJU 2;  3GZT B;  2QQP A;  3U1X A;  2JD4 A;  1OFS A;  2CGP A;  1UYZ A;  1I5Z A;  5CFC C;  2JX9 A;  2OQ7 A;  2RE9 A;  2ZTN A;  4L2N A;  2HWC 3;  4LLF A;  3FLP A;  4XJZ A;  3HEI A;  3NKT A;  1NE6 A;  3MLL A;  3R4D B;  2EXJ A;  5CNA A;  3VBR A;  4LPL A;  2PMW B;  3S57 A;  2ORX A;  1Q8P A;  2Z5W A;  5DUU A;  3B93 A;  1WLT A;  3WW1 A;  1RVF 1;  5I0D A;  1VB4 A;  2E32 A;  1S0C A;  2WNV C;  5J36 A;  5I93 A;  1KD7 A;  2W39 A;  2ZML A;  1BCX A;  3VHN A;  1DGW A;  1HRI 1;  2IXC A;  1RMU 2;  3CBN A;  2WZP P;  5FKB A;  3WT3 A;  5SV5 A;  3ZR5 A;  5JPM B;  1GZW A;  2JE7 A;  3POJ A;  2B9V A;  4MHR A;  2GNB A;  1XNK A;  4QQ2 A;  1QMJ A;  2PHW A;  4GA9 A;  4RS5 C;  4MVT A;  4ASM B;  2DYC A;  2D6K A;  5FYI A;  1UN1 A;  2RR1 2;  4O65 A;  2WO7 A;  1NXM A;  2C4X A;  1T2X A;  1OLM E;  1WA4 A;  2X8K A;  3B3Q E;  4HKO A;  3ZR6 A;  2HWF 1;  5A80 A;  2O8O A;  3AZY A;  4UW4 A;  5FZ3 A;  3VKL A;  2BJS A;  1W3V A;  3WNO A;  1QJZ A;  3E1F 1;  4RR3 A;  3ZPY A;  4L97 A;  2WNO A;  3I2O A;  4OI0 A;  2IFR A;  4ZXE A;  4RL7 A;  1RUI 2;  2R32 A;  2V73 A;  3UES A;  4CTE A;  4CP2 A;  2W1W A;  4S2H A;  4FTE A;  2HWB 3;  5EP9 A;  2CAU A;  2PHR A;  3RQ0 A;  2DVD A;  2D3R A;  3VBR B;  3HMY A;  2WA4 A;  1J3R A;  4J1X A;  2Y0I A;  4KL1 A;  1F2N A;  2EAK A;  3P5B A;  3I3B A;  4NHX A;  3R0R A;  4D8M A;  2WIN B;  3L2Y A;  3WDW A;  2WRA A;  1ZRE A;  2WQZ C;  2XGX A;  1WLD A;  4FFF A;  4GMP 1;  1S55 A;  1MEC 3;  1ULF A;  4XUO A;  5A3P A;  5IVB A;  1QHD A;  1W8O A;  1DP0 A;  1U0A A;  2UWC A;  3FFQ A;  1H0B A;  2WN2 A;  2P2K A;  4UW3 A;  3VKM A;  4BDV B;  3CMG A;  3I2J A;  4V2V A;  4AVV A;  4QB2 A;  4LEJ A;  2FDH A;  2RS3 2;  1DF0 A;  4KG0 A;  2WT2 A;  4ET7 A;  1CX1 A;  2LM3 A;  3ACL A;  3ZM8 A;  5A6X A;  3O1U A;  5A6Z A;  1YQC A;  3WOG A;  4Y20 B;  1VP6 A;  1W9S A;  4ZZ5 A;  1XSR A;  1N3P A;  5KHH A;  4OZX A;  3RSJ A;  2XPJ A;  1T6B X;  1NAE A;  1MPX A;  5A3U A;  1JZ3 A;  4YVS B;  3PU8 A;  5FYY A;  5CBL A;  2Y6K A;  4BIO A;  4EWE A;  4AED A;  4COV A;  2BGP A;  4Z07 A;  5ABJ B;  4QGL A;  4P9W A;  5CA6 A;  2FCU A;  1LNS A;  1PO1 3;  3ETP A;  2VZ3 A;  3T1L A;  1G9A A;  2DU1 A;  4YW4 A;  2JEN A;  1UZW A;  1NCQ A;  3BTX A;  2PQS A;  2VPV A;  2W95 A;  3TNP B;  1IG0 A;  2VGD A;  5FZH A;  1DIW A;  2ZGQ A;  5H9P A;  5JMC A;  3K3N A;  2QZ2 A;  3PU3 A;  1LB2 A;  4JTN A;  4YVS A;  3KCY A;  4IET A;  4FFI A;  4UF0 A;  1LTE A;  2EID A;  2P3J A;  1CAU A;  2RMU 1;  2IWG B;  2MPF A;  2VG9 A;  4XW3 A;  5FYV A;  4S2G A;  2JJ6 A;  4HVO A;  2XWB B;  3R4S A;  3VBH A;  4XC9 A;  4YSF A;  1WCK A;  2Y33 A;  3P6B A;  5IK8 A;  5E8A A;  1NLR A;  2BVV A;  2VZV A;  2CDP A;  2YY1 A;  3OCP A;  1W2T A;  4Q26 A;  3VN4 A;  2VTX J;  4CDX A;  3WDV A;  4AED B;  2Y6G A;  1NCQ B;  5FP9 A;  3AX4 A;  3V65 A;  1OSG A;  1QKQ A;  3ZFF B;  2YU1 A;  1KFX L;  4AWD A;  4LBQ B;  1CPM A;  3LDK A;  3GCW A;  2W87 A;  1WLC A;  5FZG A;  4BOW A;  5FZF A;  2WNV B;  4FP2 A;  4GWN A;  2DTY A;  4I30 A;  2OT7 A;  3W59 A;  2DV9 A;  3A23 A;  3ZXG A;  5FYM A;  1QWR A;  2HJI A;  4YGB A;  4R4Z A;  4F8A A;  1YC6 1;  4JCK A;  1AVB A;  2XLF A;  4L92 A;  3ZKY A;  4E2S A;  3IDE A;  1YI9 A;  3ZYH A;  1HV0 A;  2QFE A;  4L9B A;  1FOD 1;  5K0U A;  3ZXF A;  2LTN A;  4IEZ A;  3FN9 A;  1DU3 D;  4OHV A;  4IGP A;  5CFC B;  3H50 A;  3ZVX A;  2P37 A;  5LEJ A;  3HVD A;  3RJ2 X;  3ACI A;  2DCJ A;  4HON A;  4KQ7 A;  4NII A;  5GLU A;  1V9U 2;  1RUG 3;  2VVF A;  1N47 A;  2QBX A;  3H0O A;  4OHX A;  3MO4 A;  2JDU A;  3CLP A;  3RYR A;  1YQ6 A;  3D0S A;  1CIW A;  1HQN A;  2B8M A;  3H1M A;  3ZFG B;  2WUH A;  1LHU A;  4AW7 A;  3IBM A;  1K45 A;  1UF2 C;  3AP7 A;  1NQD A;  1L3J A;  2OUJ A;  2DVB A;  3A22 A;  4MX3 A;  1SBF A;  1NY7 2;  1QJY 1;  4CCC A;  1BZW A;  2A73 B;  2DVA A;  5H9R A;  5BV6 A;  3NV2 A;  3C7F A;  3LA2 A;  4WV8 A;  3J8F 1;  1VPH A;  4Q0P A;  4EWA A;  1AL2 2;  1TME 3;  3GZA A;  5JZG C;  1VBE 3;  1F5F A;  2VMG A;  5GJ6 A;  1WMX A;  3FBM A;  3PNA A;  2CDO A;  4LBK A;  1NX9 A;  4C1W A;  5HXM A;  2ZCW A;  1CAW A;  1O7F A;  4Q4V 1;  2GC1 A;  4HMZ A;  2XH6 A;  4DEQ A;  1OUS A;  1STM A;  3P1I A;  4RGG A;  3BAL A;  3F95 A;  4LBQ D;  5C4W B;  3E6B A;  4LKD A;  5G05 L;  4DS0 A;  2VOV A;  5DXD A;  5GLV A;  3JB8 A;  1ST8 A;  4P08 A;  3IDB B;  4DFS A;  5CKQ A;  3AXE A;  4ZHN A;  4Y1Z A;  1RHI 1;  1WA6 X;  1L7Q A;  1G9F A;  3TOJ A;  3RZM A;  2LW8 A;  2P3I A;  5FYC A;  1FOD 2;  1BVP 1;  1DQ1 A;  5K0U B;  4N7I A;  1RUC 3;  5FLJ A;  2A6V A;  1ZA4 A;  1NOV A;  1D7P M;  4LA2 A;  4M01 A;  4N8M A;  1XYP A;  2SBA A;  4HN1 A;  4GKY A;  4CUC A;  3WF2 A;  1ZYB A;  3CL1 A;  4Z2A A;  3G7D A;  4KWL A;  3ZFG C;  1MZF A;  4CDU A;  2TEP A;  2W91 A;  3DKQ A;  4PHZ A;  1BEV 1;  3ROU A;  1ZRC A;  1VIW B;  1OA2 A;  1WMD A;  1F5J A;  2FBE A;  5FZO B;  5C9A B;  2J1E A;  2RJ2 A;  4WZC A;  5GLZ A;  2A6W A;  2AAC A;  1BK0 A;  5F3G A;  5F5I A;  3WD5 A;  3SMH A;  1U5I A;  4Q4V 3;  3WW4 A;  1G7Y A;  2IFW A;  3WUD A;  2WYS A;  4UFI A;  3N36 A;  1AX0 A;  1AXY A;  3D0J A;  4QX8 A;  1L7L A;  4XFF A;  5DZF A;  3SEE A;  4BLJ A;  4MGS A;  1OA3 A;  1UZ0 A;  1DHK B;  4XF1 A;  3RYK A;  5LAT A;  5EYX A;  1YJK A;  2BBA A;  3I2F A;  3AZW A;  4IEV A;  4KU7 A;  3VDD B;  5KXB A;  2BBV A;  2H0V A;  1SLL A;  1XYN A;  3HQX A;  1OQE A;  3IM0 A;  4M0N A;  4IEW A;  2VXR A;  3GZU C;  3R05 A;  1JOJ A;  1NCR C;  4XFC A;  3VHP A;  5ACA 1;  5C8C A;  2QDN A;  3CHX A;  1AR7 2;  1Z7S 2;  4B7K A;  1POV 1;  5D8A B;  3OGS A;  1UY0 A;  5LBE A;  1LED A;  2XOM A;  3SH5 A;  4O61 A;  1RUD 2;  1TNR A;  2X53 S;  1ZBA 2;  5BNO B;  3VBS C;  5C3P A;  1V6J A;  1QU0 A;  2GNT A;  2YGM A;  5KBF A;  5GM0 A;  3N7J A;  1GSL A;  4HG6 B;  1GNH A;  2JIC A;  4KU8 A;  4M3C B;  4U2A A;  3WQ7 A;  4MV2 A;  1CAV B;  1ZVF A;  2R0H A;  1WKY A;  2V4A A;  2R30 A;  3IWZ A;  2WWJ A;  3HOB A;  4NO4 A;  1URX A;  2WT0 A;  3USS A;  4MGT A;  1EAH 3;  2FCT A;  2PHX A;  4NRO A;  3ZDV A;  4FBF A;  4Q0Q A;  3U10 A;  4LUL A;  2HBU A;  2QCS B;  3VBF B;  2VMH A;  3A0N A;  4DOU A;  1A6C A;  3I4I A;  1UIJ A;  1BBT 3;  1HW5 A;  3LDR A;  2C0Z A;  5LEK A;  4IEU A;  5DAQ A;  5BNQ A;  3BU7 A;  4AOC A;  2ET1 A;  2ZGP A;  2RDS A;  1HB4 A;  2EAL A;  2TUN A;  2IXI A;  1VRH 3;  1WME A;  4RFR B;  2FZ1 A;  5FYB A;  3WCS A;  2CL2 A;  4M3C A;  1WWY A;  1GNZ A;  3KV6 A;  4MH0 E;  3W21 A;  5ABJ A;  2XL9 A;  2UWB A;  1OUR A;  5T5O A;  3VDD C;  3WDT A;  1ZZC A;  3POW A;  3ES1 A;  4XXP A;  4YM1 A;  2OA2 A;  2HEV F;  4XCB A;  2EXK A;  4YVS C;  1SLB A;  2JDK A;  5LB6 A;  1LES A;  2VNV A;  3CO2 A;  3DF0 A;  1R09 1;  3GJA A;  4UFJ A;  4N43 C;  1IS6 A;  1GQG A;  4DRV A;  1E57 A;  1MEC 1;  1FI2 A; 
#chains in the Genus database with same CATH homology
 1W0N A;  4XUQ A;  4JKK A;  4JHZ A;  5C71 A;  2DDU A;  3I2G A;  5G04 L;  4A45 A;  4ZY9 A;  5HPO A;  2YFZ A;  2QQO A;  3GDB A;  3ACF A;  3HJR A;  3I97 A;  1JHJ A;  3HN3 A;  2VZU A;  3T09 A;  3IAQ A;  4MAD A;  2WO1 A;  5LCW L;  4PQQ A;  2EIB A;  1DLC A;  1J84 A;  1XNT A;  2B4K A;  1K12 A;  4JX0 A;  2HLE A;  3PUI A;  3I2H A;  4CVU A;  1GNY A;  4QX1 A;  1JZ5 A;  2OKX A;  4E8D A;  1PX3 A;  4QB1 A;  4OYU A;  3GM8 A;  4AAX A;  3NQH A;  3ABZ A;  1L7R A;  2Y64 A;  3OBA A;  2V72 A;  1UWW A;  3CIH A;  3U37 A;  5C7G A;  5IFT A;  3THC A;  2QQI A;  3LE0 A;  4GWI A;  2J1U A;  1UMI A;  5JXJ A;  4D0Q A;  1SHW B;  3SEP A;  4GWJ A;  2XQX A;  2YB7 A;  1CZV A;  5JUV A;  3W5M A;  3T2P A;  4LHS A;  2WQ8 A;  1GOH A;  3I3E A;  3LEK A;  2JE8 A;  4IUG A;  3UET A;  1XC6 A;  4XUT A;  4A3Z A;  5DMY A;  3C7G A;  3OEB A;  1PMJ X;  3OGV A;  2ZEY A;  4CU7 A;  3WF4 A;  4KWU A;  3EYP A;  2L9L A;  2WN3 A;  3I2I A;  2ORZ A;  3CKH A;  2VCB A;  3C7H A;  3I3D A;  1UY1 A;  2VZR A;  2VZT A;  3WSO A;  3CQO A;  1UY2 A;  2W1U A;  4OUE A;  3K4Z A;  5FUI A;  1KGY A;  3WNK A;  3W5N A;  1CZS A;  2KD7 A;  2W47 A;  3VDB A;  1JYX A;  2VC9 A;  2R7E B;  2ZEZ A;  2WDB A;  1YQ2 A;  2LS6 A;  1W9W A;  1P8J A;  4QDR A;  4CU8 A;  1NKG A;  3ACH A;  4DXR A;  2VCA A;  2J1V A;  2X09 A;  1JZ6 A;  2QQJ A;  4PT6 A;  4XUP A;  3VDA A;  4W50 A;  1K42 A;  3NRU A;  2QQN A;  3OG2 A;  1PX4 A;  3HNY M;  1GOG A;  3PUH A;  3T0A A;  2BGO A;  4DUV A;  2W1Q A;  2VZQ A;  1JU3 A;  1R64 A;  1ULO A;  5LA1 A;  5J1X A;  1US2 A;  4UI9 L;  3WF3 A;  1SG3 A;  5DN2 A;  3DYM A;  3T2Q A;  2VZS A;  2QQL A;  2XHN A;  1CZT A;  2VR4 A;  4W8J A;  3VD7 A;  3C7E A;  4GZ9 A;  2ZEX A;  4XUN A;  4LQR A;  3WQB A;  1JU4 A;  3HNM A;  5DPN A;  3WEZ A;  1IQD C;  2ZEW A;  1UYZ A;  1CIY A;  4QX0 A;  5F7U A;  3F2Z A;  3GXU A;  3HEI A;  1O8S A;  3LPF A;  1JYN A;  5C70 A;  2E31 A;  3ACG A;  4LPL A;  2W1S A;  2ORX A;  3FHA A;  3OEA A;  2WO3 A;  5I0D A;  5B4N A;  2E32 A;  3FHQ A;  5IJR A;  5JXG A;  4XZU G;  2B9V A;  3K46 A;  2Y6J A;  4YPJ A;  3SKV A;  2WBK A;  3GGL A;  5IHR A;  1H6X A;  3HPN A;  2C4X A;  1T2X A;  4DUX A;  1EUT A;  3WNP A;  3WNO A;  3E1F 1;  2VL4 A;  4ZXE A;  3UES A;  1UYX A;  1XNA A;  2W1W A;  2W9X A;  2BZD A;  2Z4F A;  1JYV A;  3THD A;  3VD3 A;  3I3B A;  1GOF A;  3SKJ E;  4D8M A;  2V4V A;  3VD4 A;  3LPG A;  5LA0 A;  2QQK A;  1O59 A;  4QAW A;  1SDD B;  4XUO A;  2W46 A;  1W8O A;  1DP0 A;  1PMH X;  4BDV B;  2WN2 A;  5A1A A;  3CMG A;  3I2J A;  2Y6H A;  4QB2 A;  1KEX A;  4ET7 A;  1CX1 A;  1K3I A;  1HN1 A;  3ZM8 A;  2WZE A;  2E33 A;  4OMD A;  5DQ0 A;  1OF3 A;  5EIY B;  1W9S A;  4ZZ5 A;  2YG0 A;  2WAB A;  1NAE A;  1MPX A;  2DCK A;  4M4P A;  2J1A A;  4XUR A;  1W99 A;  2Y6K A;  2BGP A;  2W3J A;  4RYD A;  3OB8 A;  1DYO A;  3LEI A;  5B4X A;  2HYX A;  1LNS A;  2JKX A;  3ETP A;  2VZ3 A;  3DYO A;  5EJZ B;  4BJ0 A;  1J83 A;  3JXS A;  3K77 A;  4PF1 A;  2PQS A;  2W95 A;  1JYW A;  1WCQ A;  2VMC A;  2RV9 A;  1GU3 A;  1TG7 A;  3I2K A;  1JZ4 A;  4M4R A;  2V5D A;  1NUK A;  5JXH A;  4ARX A;  1TVG A;  4KI5 M;  2EID A;  3VD5 A;  3WF1 A;  3NJV A;  3MUY 1;  3T2O A;  3P6B A;  2W94 A;  3VD9 A;  1OF4 A;  2VZO A;  4JKM A;  4MO3 M;  2E26 A;  2CDP A;  2VZV A;  2YFU A;  3IDA A;  4P02 B;  2Y6G A;  4LKS A;  3T0B A;  2Y8K A;  3MBW A;  1GMM A;  4P00 B;  1ULP A;  3NJX A;  2W87 A;  3MV1 1;  3OGR A;  4L0P A;  4W4Z A;  3WNM A;  1JZ3 A;  2C26 A;  3A23 A;  3K4D A;  2VZP A;  5LA2 A;  3D3A A;  2VZ1 A;  1UXX X;  1UYY A;  3LEG A;  2EIC A;  4QB6 A;  1OT5 A;  3DYP A;  3C7O A;  3FN9 A;  3T0D A;  4KMQ A;  2WO2 A;  4OMC A;  1JZ8 A;  3ACI A;  2DCJ A;  4TTG A;  2QBX A;  3MV0 1;  1I5P A;  1UMH A;  2J1S A;  3CZU A;  3MO4 A;  4MGQ A;  2JD9 A;  4A42 A;  2WUH A;  2X05 A;  1UXZ A;  1OD3 A;  1K45 A;  3BGA A;  2VME A;  3A22 A;  2J7M A;  4BK5 A;  1XPW A;  5IFP A;  4OZO A;  3C7F A;  4A41 A;  4FI9 A;  3A7Q A;  1UY4 A;  4P5Y A;  4JKL A;  4BK4 A;  4CU6 A;  2CDO A;  1NX9 A;  4RN5 A;  5HXM A;  2WAA A;  2VCC A;  2YC4 A;  2C9K A;  2JDA A;  4DEQ A;  3P1I A;  2ID4 A;  2VMD A;  1H6Y A;  4QDS A;  5G05 L;  3WF0 A;  4QDQ A;  1W9T A;  4P08 A;  2WAO A;  2VQT A;  4CUB A;  4UOJ A;  4A4A A;  2VO5 A;  1L7Q A;  3T08 A;  2EIE A;  2LW8 A;  1BHG A;  3EB7 A;  1D7P M;  4MOA A;  4DXS A;  2Y6L A;  1JZ7 A;  4CUC A;  3WF2 A;  2X10 A;  5CZK A;  4Z2A A;  1EUU A;  4DXT A;  3III A;  4A44 A;  1RYY A;  1F4A A;  2W91 A;  2XON A;  4TXW A;  1OH4 A;  4QPW A;  4AG4 A;  3C8X A;  2J1E A;  2RJ2 A;  3A21 A;  2VJX A;  1JZ2 A;  5CYY A;  2WYS A;  1F4H A;  3SEE A;  3MUZ 1;  3BN6 A;  2VM9 A;  4MGS A;  1UZ0 A;  1W8N A;  5EJ1 B;  2BBA A;  3I2F A;  5IYY A;  4QX3 A;  1US3 A;  3FL7 A;  4A6O A;  3IAP A;  2J22 A;  1GUI A;  3HNB M;  1UY3 A;  3WNL A;  2BER A;  2J1R A;  3OGS A;  1UY0 A;  2XOM A;  5JXI A;  5JR2 A;  3UNP A;  2WZ8 A;  2J1T A;  1JI6 A;  5JMO A;  4HG6 B;  2VOT A;  3NNG A;  1WKY A;  2YC2 A;  3AC0 A;  3CZJ A;  4BXS V;  2ZXQ A;  3HOB A;  4QX2 A;  4CU9 A;  1GQP A;  2RVA A;  2W5F A;  4E8C A;  4XVH A;  1UX7 A;  1O8P A;  3IB3 A;  4ARY A;  2VQU A;  3VDC A;  4DEV A;  4UAP A;  2VMF A;  3CDZ B;  2VTF A;  4DUW A;  2QQM A;  3ECQ A;  3K4A A;  3LQC A;  3WNN A;  3K75 B;  2W92 A;  4CUA A;  3DEC A;  4ZZ8 A;  3J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...