2CDRA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cdrA00
4N6OA 4HVAA 4EHAA 2Y1LA 1RHMA 1BMQA 2C2MA 4JJEA 4AWAA 4DCJA 4JJ8A 4N5DA 4QUJA 3V6MA 2CJYA 5IBCA 2FP3A 4FXOA 4EHLA 1NMQA 2J32A 4NBLA 4PRZA 4QU5A 1I3OA 3PCXA 3D6MA 1RHKA 1QTNA 4ZVSA 2QL9A 2CJXA 2XZDA 4ZVTA 3KJNA 3H11A 4AW9A 3NKFA 3V4OA 4DCOA 5IC4A 5LU8A 2XYHA 3QNWA 2C1EA 2H48A 2CNNA 2HBZA 3KJQA 4NOMA 1RHUA 2H4YA 3V4LA 3R5JA 4QUBA 4EHKA 1PYOA 2H51A 2H65A 4LSZA 2XYPA 4ZVOA 4PS0A 2H5JA 1NMSA 2XYGA 1SC3A 4NBKA 1RE1A 1I4EB 5IBRA 1RWPA 4N6GA 5H0IA 3R7BA 4JR2A 3RJMA 2C2KA 3S70A 2FUNB 4EHNA 5LU9A 1RWOA 4QUHA 5IC6A 4HQ0A 4IYRA 1KMCA 2WDPA 3GJTA 5IASA 2QLJA 3PD0A 2QL7A 1CVRA 5IAJA 5IAKA 4EHDA 4N7JA 4NOJA 1RWKA 3H0EA 5I9TA 3SIRA 4EJFA 4M9RA 1RHRA 2H4WA 3EDRA 5LUAA 2H5IA 4FEAA 4PS1A 2CNLA 1RWVA 3D6HA 3IBCA 5IANA 1K88A 1RWMA 3DEHA 4QTYA 4D3YA 4I1PA 3V55A 3V3KA 2HBRA 4ZVUA 3NS7A 3OD5A 4QTXA 1K86A 1PAUA 2CDRA 4QUEA 3NR2A 1I51A 4N7MA 4NOKA 4QU9A 1NMEA 4QUDA 3D6FA 4JR0A 2DKOA 1GQFA 2Y0BA 3GJSA 1QX3A 4FGUA 4HQRA 1IBCA 3PD1A 4NBNA 3R6LA 1JXQA 3E4CA 1SC4A 4QULA 4JJ7A 3BIJA 1RWXA 1RWWA 4QU0A 2H54A 3R5KA 4JQZA 2P2CA 1RHJA 4QUGA 3P4UA 2J30A 4NOLA 3SIPA 4D3ZA 4DCPA 3S8EA 4QUIA 1CP3A 3DEKA 1F9EA 4I1RA 3H13A 1I4OA 2C2OA 5K20A 2C2ZA 1F1JA 3P45A 3V6LA 4EHHA 1SC1A 5IABA 3EDQA 2FQQA 4ZVQA 5IAGA 2J31A 4JB8A 3GJRA 5JFTA 2J33A 3ITNA 3H11B 5IARA 3GJQA 1GFWA 1QDUA 3IBFA 5IBPA 4QUAA 1NW9B 2HBYA 3K7EA 4QU8A 1M72A 2AR9A 4EHFA 3H1PA 4D3XA 2NN3C 5I9BA 2CNOA 4AWBA 1RWNA 2XZTA 3DEIA 2QLBA 4IEFB 4JQYA 3DEJA 1SHLA 3R7SA 4FDLA 3R6GA 4PRYA 1SHJA 4JR1A 1ICEA 2CNKA 3R7NA 2QLFA 4N6NA 2K7ZA 3KJFA 5LUBA 3UO8B 4ZVPA 2HBQA 4ZVRA 2QL5A 5IAEA 1RHQA 3UOAB
chains in the Genus database with same CATH superfamily
2FEMA 3ZE9A 1LCIA 4BNXA 4V0LA 1Y6ZA 4L4XA 1V45E 3K4HA 5HKOA 5C5DA 1S9HA 3HKBA 2UV8A 3NHAA 5ECDA 1Z7WA 2VEOA 3GEGA 3M1LA 1ZL2A 3P2IA 1J0CA 1FA9A 3LCRA 4ZQIA 3OZIA 5KQRA 2FZCA 1FSFA 1RKQA 4JBNA 3BSSA 4TS3A 3CO5A 4EW2A 4GSLA 4KP7A 2I67A 4XH9B 4BMNA 1Z2NX 2ILTA 3PC7A 1QSGA 1WXFA 3SY8A 3VBCA 2C94A 1R6UA 4FEEA 4XARA 1YCFA 2GDJA 3ABSB 3ZHQA 4DMFA 1Y80A 1O5IA 1FXUA 1SQFA 1ZC4A 2NXCA 1UBEA 2DBQA 2OPBA 4JT2A 3HI6A 3U9TA 2ZIAA 3EXAA 1ND5A 2Q46A 3DYIA 4KW7A 4R2HA 2WJZB 2WIFA 3PPVA 4DV2B 1CY1A 2FPMA 1L4KA 1THGA 4FZRA 3RS2A 1MX1A 1EX6A 2MSWA 3LXMA 3PNPA 3ZGOA 3ZJ5A 1DTEA 2ALJA 4MH0R 1SOWA 2PCLA 5AM5A 1Z12A 2HPVA 4OLHA 2YMPA 5T67A 3D4IA 3LT5A 2Q49A 4LZLA 1RJDA 1E99A 1YUNA 3AILA 1BG6A 4L9SA 4YREA 1Y5MA 4IXWA 3C6YA 3L06A 4X64B 3CVWA 4RY0A 5JBIA 5KHAA 4H31A 1T36B 5CA1A 2O2IA 3H04A 1FFEA 1G8AA 3N53A 4E88A 1Y1SA 2WZDA 2YWGA 3O4FA 1QK5A 4NHEA 4X8MA 3SF0A 2Z04A 3G79A 4E4TA 4ZHQF 3WJ2A 2DAPA 2R0QC 3ZCTA 3EGXB 1E98A 4EI2A 1WO8A 2XQKA 3BEDA 3WYCA 3O4IA 4YV7A 3RSZA 5B4VA 1EDZA 2P79A 2RBGA 5FPSA 5KEIA 1NMEA 3QVTA 3EEQA 1P3DA 3IBTA 3D5QA 5DO9A 4QO7A 1RLIA 1XZEA 4TYYA 1FRFS 4QAQA 1IBCA 1Z34A 2PDAA 3LPMA 1L4NA 4L2IA 4BWVA 5KKNB 3F49S 1GDDA 3IBYA 4E5YA 3C8ZA 4EFDA 4HGPA 4IDFA 4KE9A 3FGNA 4JWTA 4DMLA 1SG9A 3EZGA 4NCIA 3WOHA 4PG4A 5AXCA 4B6RA 3OJEA 4AQYB 1ZG3A 1ZGAA 3GZTB 4JGBA 1GG2A 2RHDA 4KN9S 3EDCA 4C01A 2XA9A 3BTOA 1DADA 1YNOA 4I99A 3STXA 1GV1A 4OQFA 3ZQ4A 2HLPA 3A1UA 3ETGA 1JEYA 3WZMA 2FWJA 3LWBA 3TBHA 1XJ0A 5BUQA 1MR3F 1J0XO 1QVRA 2BJHA 2Z2XA 2HUNA 3DDHA 3OEEA 3P9NA 4M0PA 5EMLA 3UH1A 3ZZ1A 2FLVA 3IP8A 3P0IA 5G0UA 2QRPA 5DW0A 4K0RA 3RRZA 5BPFA 1KDTA 4JJKA 3KOMA 3DT6A 2WU3A 2YXDA 4YMUA 3OM0A 1SXJC 2QTLA 1RWNA 3A3OA 1U28A 3TQHA 1HYEA 3DE6X 1TKRA 2NPOA 1E79A 4NPAA 4A0SA 4DWVA 1VG0B 5ALFA 3FG9A 1AC5A 2ZB4A 2ZSJA 3GZNA 1TCCA 2ODBA 1NLMA 1PG0A 3SKXA 1CQXA 3ZV3A 3EQ2A 3VU9B 1DOHA 3K0HA 1YS1X 1EM6A 4IWNA 4QXPA 1HZJA 4MCJA 5DYTA 1EDEA 3M2TA 4YCLA 3BBPA 4B71A 4CQLB 2GEJA 3ZJYA 2BVNA 1NDUA 2V0NA 3L7CA 5FL7A 3BTVA 1E9RA 5M7EA 1KZ1A 2QW0X 1XZFA 3L3BA 2BFEB 2BONA 13PKA 1LNZA 3IP6A 4F5WA 3CT6A 1VA5A 3NNDA 3PVZA 3T9AA 2A88A 1WCWA 2XIJA 3OICA 1QHSA 3TSWA 4W5RA 1V1MA 4J0CA 3HJRA 1WABA 1ML3A 1N2ZA 3OCUA 2WKRA 1E1LA 5BR4A 3N59A 1W581 1ULBA 3O8CA 2YRXA 5A71A 4KPUA 3DL2A 2GCOA 4Q3EA 1JDBB 3C70A 2E1RA 3OPYA 4XB1A 3VI3B 1NULA 1T5SA 1X1AA 2BGGA 1BSVA 4NHOA 1FNMA 2WJPA 4GUAA 4G0OA 4JNCA 5F78A 2ZCVA 3RUPA 2FI1A 5C34B 3CINA 4EPWA 5CB4B 4JL5A 4P4GA 3UK2A 3AHEA 5JG7A 4WK2B 1FX0A 3HUUA 2PU5A 4JLAA 4DIEA 3IHTA 3FFAA 3OLYA 2HUPA 3NM6B 1G60A 4DUGD 1KE2A 3WAGA 1O97D 1SVMA 1MNQA 3B1FA 1CZRA 4Y1GA 4GGOA 4M0UA 5CAEA 3OQPA 3L0SA 4MRSA 5A3JA 3U16A 2OC4A 3GCGA 3GP3A 3OFNA 4GI3A 2FEKA 1XPUA 1CDZA 1GARA 1I13A 4TXJA 1X9GA 2C4HA 5ITVA 3L84A 3X0DA 4J75A 2GESA 1GLNA 5AI9A 3ZNQA 1E2DA 1ZU4A 3O7WA 4OM8A 3SJ7A 4EQ6B 1XVTA 4TS1A 4H3HB 5LP6F 5JR3A 4L4SA 4EZBA 3SAJA 3D59A 4U4AA 3ZWKA 1N8SA 1ZWLA 3LRPA 2CUNA 3OE5A 1BNCA 4WY5A 2V7VA 2XGMA 1PBNA 2ZRQA 1KI1A 2FSUA 1PAUA 3N2NA 3CKMA 1UIMA 3F3SA 3TGPA 3NCHA 2AZXA 1AKMA 3FRJA 3N2ZB 4O1IA 5E7QA 5IN5A 2A5GA 1GM5A 3RRNA 4BO2A 1W93A 3KPYA 4GX0A 2OCBA 3EQ8A 4IVNA 4NAUA 1EFLA 4INPA 4CKWA 5J23A 3NJ8A 1ZJ4A 3RO7A 1QVAA 1B26A 1TZBA 2QRNA 2CLSA 4H1TA 4LRUA 5EJFA 4YYZA 2GD1O 3T3MB 1HKUA 5AJHA 1ZRMA 2C0PA 2VP6A 2HK8A 1QAOA 1UEIA 3SZUA 1IBRA 2Z4SA 1EH5A 2N46A 2Q5IA 3GVIA 3PXCX 3KAJA 4NBWA 4MO9A 4WXRA 3UT0A 4H6PA 2D00A 2GLXA 2O0MA 4D6XA 5L6LB 1C0IA 4DJ5X 3C5EA 1M6EX 2F3SA 3N6VA 4EI9A 4RSRA 3WNDA 4OGLA 3TL6A 1E1QA 1EA5A 4O2AA 2Z5FA 4QDUA 5IDVA 2AA3A 1DAGA 5JAMA 3TG2A 4G5QA 4GX5A 1M1YE 1KU0A 3BPSA 2EOAA 2HA3A 3QVLA 1ZR2A 1EIZA 3MWKA 3NHMA 3OURA 4LZZA 2FOLA 1YRLA 1SPBS 2VHQA 5J4VA 4QOHA 4Q0MA 1D9ZA 3P9RA 3A70A 4BC0A 5IH7A 2CE2X 3ZOKA 3ZXIA 3AVYA 2MINB 1G8FA 4G1FA 1HE4A 2DRIA 3KM0A 4WZBA 2BGUA 2BZSA 1YI8A 3AVOA 4KX5A 2B78A 4DB2A 2IV7A 2GERA 3A6EA 1V8OA 3KZNA 3RC7A 3VGJA 3FUVA 4E6EA 4DV3B 3WY9A 1MO3A 4TRMA 3UAWA 1QNFA 3R24A 1Y8RB 2XDWA 4B17A 4ZCTA 3MJVA 4KZKA 2YS6A 2R3SA 4BX8A 2V8OA 2WAMA 1LTHR 1H6AA 2AC4A 1S0UA 3ROPA 2D0OB 5CNKA 1JB1A 3PNYA 1TF5A 3DBIA 4RMJA 3DL4A 3FGOA 3BG5A 5B64A 1MUUA 2PWZA 2P4EA 4HMQA 1FFDA 2WAXA 2B6NA 3GQBB 5G53C 3FNGA 1BXZA 2YJGA 4HS9A 5EWLB 2QV0A 3EMVA 4ZDIA 3CKLA 5FUMA 2B4RO 1Z36A 2ES4A 1TU4A 4JJGA 4PO8A 4PQEA 2GNPA 7GPBA 1HA3A 1Y42X 1N1GA 1NZFA 1YCHA 3WQQA 4HGQA 2WTAA 3ST7A 1T29A 5JMWA 4QOGA 1XZHA 2OZPA 5HM6A 1H9CA 3IQZA 4RELA 3GH1A 2RE8A 3QTLA 2MDTA 3PE4A 3EUEA 4N01A 3CH7A 4NV3A 4KYIB 3KSZO 1UDXA 1ZKDA 2NUAA 1F8XA 5IASA 1H65A 1P1HA 1PWHA 1UT8A 2A3RA 2KS6A 2XNCA 2QNBA 3KHSA 3LC1O 4PNZA 3AL2A 1AUXA 5AI4A 1SHUX 3HZRA 4FONA 4ZC1A 3ZHOA 3RIHA 2A1UB 3EVCA 1XTQA 5EUMA 2FZ4A 2Y1KA 3OCZA 2BMFA 1BCSA 1H3NA 2GRUA 3KJXA 4JS0A 5J5VA 2R96A 3JAWA 3FKSA 3SHFA 1A27A 2JIRA 2P9CA 4R0VA 4G26A 4C0HA 4D3YA 4DPKA 1V2HE 4F86A 2IW3A 2BRUC 2HQBA 1FJHA 3FVTA 4TQ9A 4H7PA 1WNTA 5EJAA 5LP6B 4B7ZA 1QC5B 3EGEA 2OXCA 1BIFA 5J1TB 2YIMA 3GY0A 4XDGA 3NEJA 3N05A 2Q7OE 5BY2A 4MRNA 1UP7A 2FQYA 2OXFA 1J4AA 1QB7A 3LUKA 1Z47A 1SHKA 2PG3A 3H9CA 3B1YA 3Q3HA 5KWJA 2HSDA 3SR0A 4CM6A 2I7CA 3BB3A 2IYAA 3JZDA 3KB2A 1VCIA 2WSSA 1T24A 2H2AA 2W70A 1PT7A 4JZKA 2POQX 4J3JA 4XQGA 3G9ZA 1DRVA 2FP4B 3DB1A 3QVSA 3NU1A 5DWVA 5BQPA 5EJMA 2WV9A 3LFTA 4QO8A 3Q7SA 3U4QA 4JYAB 2OUIA 1AQ6A 1MEJA 1Y1RA 2PT9A 3ESQA 4J0KA 2PUVA 2R47A 4TLBA 2FQQA 4DJDC 4XKJA 5BYJA 2IHKA 4ZOLA 3AM1A 4L08A 2XB2A 2BTOA 1ISIA 4C0XA 4OFBA 1FNCA 4MDHA 5D6NA 4UU8A 3IP9A 4O2AB 3CRQA 4RKWA 2E3JA 2G1JA 3VPFA 4BBZA 4EH1A 6NULA 5IFLA 5J4HA 2O0JA 1OAKA 1ISPA 1G6OA 1HORA 1I0ZA 1ZSVA 2B7LA 2BDUA 3CRZA 4HAYA 4JLJA 3RROA 1J2EA 1RFGE 1U0NA 3I73A 4P22A 3EVFA 1DS6A 2AXPA 3LH5A 3LKBA 3PRYA 4KFUA 4KBFA 5CH3A 2ZRDA 3IQXA 1YCDA 3VKWA 4ENUA 3R7NA 4Z2YA 2KQUA 1UKYA 2P6MA 1E32A 1K0FA 5E3HA 4JUFA 2GJKA 4AJ2A 1U04A 3U6BA 3RR2A 3P32A 3TGLA 1YJQA 1ZGGA 2V96A 4BMSA 3BMQA 4BKPA 4TYMA 1PO7A 3N5CA 4Y7CA 4IXTA 4BKUA 4UVDA 3AFGA 3DFZA 3ET5A 4WEQA 1BOFA 4DM4A 1LS6A 2EBUA 1NXWA 1Z5OA 4A26A 4P54A 3MQFA 1X39A 1DIBA 1ULUA 1GRVA 3VISA 2F3TA 4JASB 5KU7A 2UAGA 1QGUA 2QZ4A 1E6UA 2E2WA 1F3OA 1JJ7A 2EGUA 3I58A 3M1IA 3P7MA 1QGED 4BE7B 2JKVA 4U2DA 3EUWA 4H27A 2DFTA 3Q7TA 5JEEA 5KB3A 3PVCA 5L3RA 2PH3A 1X7ZB 2ATCA 3OJ0A 5DBGA 1ZHOA 2P62A 5DHQA 2HMYB 4L75A 1ZSNA 4NI5A 2C5GA 1ULSA 2PRJA 3GMSA 1V96A 5BVHA 1SM4A 4HDNB 3ZUGA 1TO6A 1C3OA 4RHEA 4UE6A 4LJAA 3PD0A 4LUCA 4C5BA 3OEED 4BO6A 1M6WA 4ZFNA 2X5XA 4I1YA 3U3RA 4AKHA 1I9GA 4RY9A 2A9PA 4NBSA 1NV8A 1MAVA 1YIOA 1O9BA 5COAA 3ZHVA 2FUG6 3G5TA 1EUYA 4NNJA 1IZ8A 1QYIA 4EG6A 2R8YA 1SU6A 1IQ0A 3CO0S 3ONNA 5CB6A 1IJKA 3ZUPA 5ULLA 3FSJX 4QA9A 3UAGA 2OV4A 3PHBE 4EUEA 2QJWA 4D9BA 3QBEA 2O5RA 4GBGA 1BD3A 1SHTX 2QMEA 4DCCA 1A9PA 2HJRA 4N3CA 3FYTA 3GZJA 5GONA 4EF6A 3W5VA 3ADDA 3N2LA 3EGCA 2P7IA 2XLCA 4BB6A 2W8BB 2G67A 1Z5UA 1N77A 4CQLA 2DY0A 1I2BA 1CS0B 3AFOA 3CNHA 4GI7A 3HA7A 2DVMA 4GXRA 1ISSA 1LV7A 2QLNA 3PEEA 2V7BA 2YINC 3CW9A 5LP6C 1JEOA 1USWA 1FQWA 1Z6XA 2F59A 2FP4A 4I3FA 3WGJA 3KYBA 3FMOB 3KQPA 4RZ3A 3P9YA 3RVLA 2I7VA 1ATIA 3D54D 2PGLA 3LAWA 4UFOA 5DK4A 4KWCA 1LBHA 4DE5A 1EJBA 3ZQJA 4BFLA 2YZMA 1MT3A 5G3ZA 2IHUA 2PJUA 1WV1A 1C9MA 4BGEA 5J4YA 1LF5A 3R44A 3PUVA 4FSXA 4B4DA 4P84A 3RHTA 4DRXA 1NN0A 1YASA 2JDIA 2R8EA 3T5BA 2GNOA 1SCQA 4QDXA 1VCHA 1KVUA 1ZMBA 4J7XA 1U2SA 2FEOA 4WXPA 5TQ0B 4BS9A 2C9CA 1EBFA 4YXFA 1UZLA 4UBOA 3VZRA 3K5IA 5IFKA 3HJNA 1QH8B 4WADA 4TRNA 5GM1A 4MGZR 2AZDA 5BWLA 3O38A 3RBAA 1A76A 3TW4A 4N5NA 4EFKA 3UC9A 4UC0A 3RW9A 4EY3A 1JIUA 2FMXA 3KJFA 1RPZA 1X7WB 1Y33E 5F3RA 3EPLA 3GF4A 2ZE5A 3AFMA 3E5NA 3Q5GA 5GONB 5SY4A 2OGTA 1GPUA 2CXHA 3I9V1 2D2VA 4X61A 2WD7B 3KKMA 5G0SA 5HFJA 4C04A 2V5VA 1X0XA 2JHFA 1OPXA 2Z6QA 1YZVA 2RC6A 2J9RA 1ENOA 2I1LA 4EEXA 3LX8A 4MIOA 1YL5A 5CLQA 1FNBA 1Q19A 1DC8A 3K6KA 4GQAA 4JSRA 3WGLA 4NPHA 4A1FA 3JWGA 4ZCRA 3E7PA 3WXMA 4EHIA 3LPLA 4YMIA 1AM4D 3OZBA 4HRXA 2OL4A 4ZQGA 2VOEA 2YKGA 4MLDA 2JGLA 4AJEA 3NKFA 3GW8A 2D5LA 4Z3KA 2YNMC 4MVYA 2G3YA 4EHKA 4LSZA 3W3AH 1P73A 3FSRA 1AKVA 1N2CB 3OE1A 2O7SA 3C4QA 3U0VA 2BKLA 1QFSA 2IKSA 1SU8A 2GBGA 4TLMB 5I8ZA 1W88A 1GRRA 3NOQA 4PC6A 4YASA 4ERXA 2Z8YA 1F2UA 1DJQA 5H0IA 1M34A 4K9PA 4AAYA 1UBJS 4FMDF 5HE9A 1IFXA 1XIVA 5F1YA 4ZZ2A 4E1BA 4LBVA 4C3OB 4FBMA 1QGUB 2HQ1A 1KBOA 4ZT5A 1AN9A 1L5QA 2EW1A 1GIAA 3UXHA 5C37A 2NQ2C 1U9IC 3E15A 4ARZB 3KIPA 1JG3A 3K1AB 3CNBA 2FQWA 2VDQB 1CUZA 1GG9A 5COQA 3GNLA 2W48A 4HTFB 2AQ8A 4R54A 4CG3A 3HSYA 4WBNF 3FTEA 3RFXA 1I4DD 1W85B 3EPPA 3L7LA 1BAPA 2Q0SA 2PIAA 3LQ4A 2XHEA 3VMMA 4AIRA 4TQAA 1LBEA 2F8MA 4O25A 4RVCA 3TTTA 2EBFX 4UQLA 3JYPA 4NVRA 2Y0EA 1YS2X 3LHDA 3FYUA 4JB0A 1ZJ6A 2FW1A 1J2TA 1I5OA 2G09A 2IUSA 3QUSA 5HBGA 1C1XA 2LWIA 5KOJB 1D6SA 2HK6A 3TNDA 2YIJA 3F98A 2V55B 1E3TA 1W75A 1IXKA 1YRBA 2LV8A 3OTQA 3PKZA 4M98A 5F35A 2RARA 1GQFA 2C9YA 3HKCB 2LE0A 2PD6A 4E5VA 1BGWA 4JJIA 1LY1A 4YDHB 4ASUA 1NASA 1ESZA 1RAAA 4XIIA 2UXDB 4FB4A 3I28A 1CUXA 1J8QA 2GN0A 4FNGA 3E3MA 4UMFA 4DDVA 2ZI4A 4YECA 1J70A 3EGXA 3H8VA 2PS1A 3SQOA 3JVUA 3ZWAA 1SU4A 3BBLA 1D4ZA 5CVVA 1R10A 4R8LA 5F7JA 2GN4A 2AK2A 3LOPA 1BU5A 4JI1B 3MNFA 4YUXA 2O14A 5AVXA 3OJLA 2ZRAA 4HZUB 4KXWA 1HE5A 3WRYA 4DYVA 3DC7A 1U3UA 3TL2A 4BNWA 4DS3A 3UYLA 4C29A 3DM5A 4E07A 4U7HA 1JP7A 2OFXA 4BVBA 4LOHA 2AHRA 5KUTA 4DLZA 2NTYC 4NV1A 1M6HA 1MORA 2PT7A 2DFPA 4KQMA 4TL6A 2NWQA 4CKEB 2VYVD 2WIBA 3L7KA 3MT0A 5I9BA 3GFOA 3TVYA 4BATA 1QR6A 2AR7A 2AE2A 3MERA 4ZU6X 5LA6A 2BM0A 4BEJA 1SUDA 4ZI2A 5I3CA 1VI6A 5HIAA 1UBNA 1EZZA 4G6ZA 4IGFA 4XCXA 3U4CA 4BRUA 1I8TA 1VHDA 3C8UA 3ASUA 3JQDA 2OGZA 4BN0A 3A58B 3CA8A 3ANMA 3L8ZA 4DC0A 4R1NA 2OYSA 3AUUA 2DPMA 5CT8A 5FOSA 1JR3A 1AGRA 4F2WA 3DMYA 1P7CA 4ZPJA 5BQFA 1QE5A 2EX0A 2GBFA 2REOA 2VUSA 3GEHA 3P20A 3P9IA 4BKQA 4FB5A 5CDGA 4JJ8A 1UDCA 3B5EA 4EGAA 1XZGA 4FNOA 2GTIA 4ML3A 1FB5A 1RACA 4INOA 3RG2A 5TIIA 1T5IA 2DSNA 3ZX4A 5JSZB 3NBXX 1EFDN 1M6YA 1TQ8A 1I1OA 1SXIA 3QFTA 5CVEA 2G1PA 5DK6A 4D43A 3QTBA 5E1BA 3BK1A 2XE8A 2HA4A 3OJCA 5K8TA 1X9HA 1NFQA 2IE0A 5IVIA 3RVRA 3VR6A 4OX9Y 3RABA 1J00A 3LBNA 4BNZA 4CV1A 3H11A 4DA7A 2QZPA 2ONKA 2JA2A 3NUZA 3KXIA 5FF9A 3BRCA 3E0XA 4MQEA 2CNNA 2RCYA 3QU2A 1C3EA 1U9ZA 4JIGA 4DA8A 3GG2A 4UATA 5J4KA 4LDNA 2FOIA 3QJGA 3VU3A 2WAOA 5JSHA 1KO4A 2D4AA 3EXIB 3QSYA 1XRRA 2BFWA 4O8ZA 2PZMA 4C0BA 1G20E 2PPLA 5JISA 3M49A 4Z4QA 1N3YA 3NORA 3GG9A 2J41A 1LSJA 1UC8A 2O23A 4OYRA 3RVSA 3VR2D 2VJOA 2OBBA 2XRFA 4EO7A 2Y4NA 4QJIA 4IQ4A 3NVKI 1KXJA 1ODCA 2PMFA 1D7OA 4D80A 3HLKA 1RKUA 4JHXA 2BFCB 2I1VB 3FVVA 3IQHX 5B2EA 2R65A 3K9GA 4YHHB 2IL1A 2YDYA 4GX2A 4MWSA 3TCKA 3UW3A 4D4GA 4HK4A 1CUAA 3TKYA 1J2UA 2BAGA 4UTRA 3M1YA 2VZ0A 2REBA 1VYTA 4WNAB 1WY5A 4WKOA 1PJZA 4D4KA 3TLGA 4CKBA 1FFXB 3OX3A 2HX1A 1YZNA 2PKRA 2XHZA 3T5CA 1MJ5A 2PX2A 3V4PB 1BWPA 4V3CA 4DDTA 7ABPA 3TQSA 3G0HA 3WIDA 2ZE6A 2W58A 4JYCA 4DWOA 2WQ6A 2R8PA 1Z88A 2WT4A 5DP2A 4YAWA 1JEYB 2ZYIA 4GWLA 1UBRS 1HURA 2DKFA 4K81B 4TTRA 3HR8A 2R48A 4UBKA 4IP0A 3AM5A 2O19A 3H75A 2NM0A 3LVQE 2FTKE 1NBMA 4O4JA 3GFPA 1JDVA 5DV9A 1DELA 1DRUA 4YJ3B 1U8ZA 1ZA2A 4Z4GA 5FWYA 3N2IA 2GSWA 3HXTA 4NG5A 3K8QA 1Z07A 1PX0A 2X0DA 1DAKA 4CTMA 2J46A 3UANA 1DPFA 2ACWA 2ANCA 2EAUA 2H1HA 2OEPA 4CG2A 5JAOA 4V3BA 4NAVA 2QX6A 1JWLA 2NZ2A 2ZTVA 1DBWA 4YUZA 2P68A 1Q50A 2NU7A 3DKVA 1KS2A 2J33A 3GRKA 2WIGA 4COOA 1V9SA 1X13A 2E4AA 2HIGA 4MOWA 4JL8A 5F5XA 3M34A 3UHAA 1QDUA 5ITZB 1QUEA 3BS4A 3D8HA 5AM2A 2ZIFA 1Z5VA 4JB2A 1D6JA 4F1JA 1P7PA 3GNQA 3O5AA 4F2GA 1IZ7A 3WL3A 4KFRA 3TINA 1GZ3A 4ZO4A 4LIPD 1C9EA 1O0SA 1PUJA 4Y9TA 1BFDA 1IN8A 3C85A 3CZ5A 3JQRA 1PR1A 3KBBA 4MI3A 2P9TA 2AFRA 4FYHA 1ZJWA 1NVMB 2CDBA 4GZ3A 4C4ZA 3H2IA 4OY3A 2CVHA 5ALPA 4XGIA 4YFVA 1HT0A 3TW6A 2ETXA 3R74A 2P9GA 1JT2A 2M6RA 1FK8A 3TBKA 5JECA 4JC5A 1BGXT 4C22A 3QVXA 4IF6A 2Z3ZA 5KJEA 1A3CA 3SBDA 3PZBA 5MN6A 4JI2B 2PY6A 1FNNA 2O3TA 1P81A 2JLZA 2ECOA 3GHHA 4LTDA 1T5DX 3FOEC 1XEAA 4ZVSA 5HMMA 4C2TA 3DWGA 3ITEA 4A2WA 2EG5A 3A37A 2RIPA 3H6HA 2WFAA 4D97A 4MMYB 2F67A 4TXLA 4BO3A 2Q3EA 2ZKIA 4RUKA 4XM2A 5EMJA 1U5AA 5JVDF 1W1WA 2AWOA 3DE4X 5DSZA 1IE3A 2PKEA 3LQFA 3OCVA 1GL7A 3IAHA 1E79D 4JQSA 3WIOA 4CF4A 4DRYA 2O0KA 3QVVA 5DI3A 5BWNA 3HXKA 1ORRA 1U11A 2Q29A 3AETB 3BH7A 4FW8A 2V3WA 4NBKA 1KDRA 1M1NA 3IUEA 3M5PA 4J7CA 2J9XB 4MPDA 4RD0A 5K1ZA 4B45A 4ZIRA 2Q5CA 5CX1B 2ZG6A 2YHUA 1SBCA 3ZWPA 5AVWA 5KVCA 3K9FC 2EW2A 3P9CA 3TPCA 4IYRA 1I3LA 2ZJYA 1JIQA 4LFBB 1GT6A 3K1AA 2VHEA 3B52X 1XFAA 1WDTA 2FOXA 4BQQA 2GO1A 3TFOA 2FR8A 2CK3D 1PI3A 2AOTA 2HJ9A 1RWQA 3F1LA 3LT0A 4G1VA 2JCSA 2CY0A 1B8NA 4M76B 4MI9A 1JSZA 4ZEOA 4RKFA 3IL2A 1OXUA 3MHPA 4I19A 2Q9AA 2WOJA 2YJ6A 3O94A 4IHJF 3ZXXA 3TLBA 2OK8A 4J2HA 4JEHA 3VAAA 2WFZA 1B0AA 1D07A 3IFSA 2I8LA 3ZZ0A 4QUKA 4HSEA 2D5AA 2QR2A 4DJAA 5JASA 3MWEA 3ZGLA 1JQ3A 3B3JA 5CJJA 2PLRA 3CVYA 1JIXA 4AZ3B 1FRNA 3NBKA 4CM8A 3NALA 3R0JA 1EGHA 2I4MA 4MUKA 1K63A 1DDGA 2JK0A 4EF4A 3GJZA 3OM1A 3EC7A 3KZ1E 1ULAA 1E77A 4AL4A 1K98A 4ZODA 2ABWA 3AYXB 4S12A 2QT1A 1ZJ5A 4E30A 1OWMA 2BIFA 2F9MA 2SKDA 3GJ3A 1GUFA 1LNSA 4ER3A 4WBNB 2NYVA 2E6KA 1RXEA 2X0NA 1PWEA 3FNEA 4NBUA 4P34A 2XOKD 3NONA 2WIJA 2DCUA 4FXPA 4KQFA 3G5UA 4OU4A 1O94A 3NT4A 4A8HA 4BP3A 2ZJ1A 1V16B 3NAQA 5T6MA 2VZ9A 4L4ZA 2GUWA 4JI8B 2CD7A 3JALB 3GXBA 4O59O 3R5SA 4DLVA 2OAP1 3DOEA 1U31A 4DQLA 2J48A 1DQPA 1KH3A 3A6KA 5E9AA 4FDMA 3U56A 2FZ5A 2I34A 3CH5A 5TY0A 4RIFA 2R84A 4M9SA 4A0HA 4CLOA 4M88A 5L4NA 2ZBQA 2WTMA 3Q6MA 4HB3A 4HXGA 4D3XA 1WB4A 2VPIA 3IUJA 1EJ2A 4W5JA 3RFTA 4C1NA 1M67A 2A9RA 2DETA 1ESMA 1LLFA 2FN8A 1Q16A 1ZIOA 3N7TA 4HXFB 4XWKA 1Q14A 3KQUA 1USIA 3M6IA 3UQZA 4PX3A 1XVLA 3DWEX 3VR6D 3ZJVA 1F2DA 1LJ8A 1VHLA 3B70A 3JTMA 4Q4JA 4UD2A 3SQWA 3NYRA 2P6OA 2Y0CA 4LY3A 1P2FA 1CEYA 2IXTA 1RVDA 4YXWD 3SU8A 1DNPA 3IQEA 2WWGA 5D5HA 4Y6LA 5JROA 3FPKA 2Z3VA 1YRQA 4BGUA 1RYEA 3RH0A 2Z43A 2F64A 1YBMA 1YGYA 4I0WB 3PTAA 4FEYA 4TTVA 1T36A 1B1AA 1UAGA 2ZYAA 3ZWOA 2BRUA 4Y7DA 4QBTA 4QU5A 1W4RA 3C97A 4DV0B 2EKLA 5DKFA 2W2OA 3G2MA 3ENQA 1TJ3A 1WCXA 4PTZA 2LBPA 3EUFA 1SIBE 4NMLA 4ZCSA 3RBXA 1LBSA 4URFA 3ZCUA 1H2RS 5IKXA 1E0AA 3AUXA 1YRAA 3DZ8A 3DD1A 4GPTA 1H6DA 1TIBA 3K05A 4ZV9A 4EZIA 1KZ7B 4X1KA 4ICIA 4DSNA 2KJQA 1VKOA 1WW8A 1GITA 1P91A 1PJCA 3DMRA 4WBXC 5E3JA 5BQ3A 2UUBB 1HOXA 1MDFA 1T8RA 2ZUEA 4IS2A 1NBME 2JLSA 5B58T 1GAJA 4S1NA 3A1WA 4B1FA 4PEVA 3LQYA 1P6UA 1EX9A 1MVLA 4NCXA 4DMUB 3LLMA 1UQTA 3DAGA 4BL5A 5CDFE 3GLIA 2NU6A 4ZOQI 1M3SA 1UPFA 2GWHA 4M9RA 5AI5A 4LHVA 1ZONA 2MSDB 5IWAB 3EJ6A 3TSCA 1Z16A 1MKYA 3TJMA 1KY3A 2V6GA 5BMOA 4LBZA 2Y68A 2MOKA 3IMFA 5K0EA 5IDXA 1FYEA 1RI4A 2YC4C 1AGNA 4DNQA 3LWDA 3T1OA 2XH8A 5DGHA 7ADHA 3QBVA 1L5OA 1TEXA 4JYPA 5I4CA 2W42A 1KDZA 2Q27A 2VHZA 2JJ8A 2CD9A 3CLVA 1P77A 1DIGA 1Q15A 2W83A 1N9KA 3J7AC 1TVMA 1W52X 2E0IA 3AHDA 2XWJI 3E4CA 1IZ0A 4YHBA 3VC2A 5T8KC 2AD1A 3UB4A 1GKKA 4HV4A 4XLLA 1A8IA 1WUIS 2QN8A 2H54A 4QJ4A 2DXIA 8MHTA 4QXOA 2P0EA 2YVUA 1VHQA 2JJ1D 3IIEA 3D81A 2GM5A 2PVPA 1MH1A 3S8EA 3RAEC 1F8UA 1KKMA 1R5JA 3GL9A 4C7KA 4DBVO 5EKUA 4K46A 5CB4A 1QAMA 3V80A 1W2GA 1XHFA 3D3WA 3JD0A 2ZWPA 1A88A 4G5OA 4L9AA 4QDOA 4YPFA 5K2MA 4WXYB 1KJJA 2Y92A 2XPCA 2Z6VA 5GJBA 2C95A 4BB0A 4ETIA 3BTUA 1YI0A 3DKPA 5A5EA 1UJCA 5BNWA 3W6OA 5LZ9A 1QIMA 1TTQB 3PDIB 1VIAA 4P35A 3RIEA 1DUIA 4KODA 1JQBA 3JYNA 3FLMA 4ZK6A 2P8SA 3V1UA 4UJ5A 3O9MA 1V71A 5KQPA 1QHYA 2I3DA 4H1WA 1P72A 3ZWNA 3ZHSA 1MXHA 3U13A 3RU7A 3FLEA 4AX4A 2FZVA 4XJVA 4M36A 3P94A 1ZS9A 4X6XA 1J06A 1PT9A 3F67A 3F96A 3PENA 3AWIA 3M6WA 4RDIA 1DAEA 2QX9A 4MVJM 1A7KA 1RBMA 1T3GA 3ESBA 4MP8A 4WEOA 1QLWA 3GPDG 4B09A 5BSGA 4JOCA 3GP8A 4LMBA 1UXGA 5GINE 4F3KA 1ZN8A 3L8FA 2C9OA 2X4DA 4WECA 5HA5A 1W46A 2QAIA 4DYDA 5B1YA 4QXRA 4RTLA 5CFNA 3PEVA 2HIAA 3FCCA 1WSAA 2GA9A 3HB9A 4LYHA 5LCXA 2IOFK 1K92A 4AY4A 2I7DA 2OHVA 2GXQA 4M7RA 4RSMA 3F6RA 2YJZA 3ICWA 3HS3A 4OBWA 2YBEA 1SBHA 5EYPA 4ZO7A 2VRCD 3RSLA 1MQ8B 2HHCA 4ZHSA 3M4NA 1Q12A 3AEQA 3SG0A 2FPUA 2FUEA 5FXMA 3V4OA 3VJMA 1MGPA 5EQTA 2PVSA 1FPQA 1IZZA 4MCAA 4YJ2A 1G41A 5JXIA 1T5HX 2CXPA 4H1VA 3NHWA 4MINA 4C7XA 1QHGA 4O3MA 1C7EA 5KOHB 2BR5A 2JFXA 3P9ZA 4DQVA 5EIBD 4LC0A 1VGRA 3INNA 4IDNA 5DT2A 3EULA 2OXEA 2D5CA 1ZY2A 3SMVA 4GXQA 1I7LA 1YQXA 1CUVA 2HWUA 2O3SA 3DMPA 2I03A 2O2DA 3NVMB 2RGXA 2QNIA 4MV8A 4U6SA 1ECBA 3LZDA 2E49A 3IIIA 4MCHA 1MB3A 2NU9B 1V37A 1UKEA 4D0SA 3BQNB 3IULA 1OT3A 1U7PA 2Z2ZA 2Z0MA 3VTKA 3WJ1A 4BAZA 1B6RA 1VG8A 4BMXA 2EGHA 3IPRA 4J9UE 1RRFA 4FM9A 5IS2A 4DA4A 4B83A 1TTPB 2R79A 1RHRA 2WT9A 3N2EA 3G9UA 3SXJA 3ML1A 5IM4A 3KJZA 2QUJA 1FMCA 1CR6A 2C04A 1OAOC 2BCGY 4H7FA 4FYJA 3QEMA 3W6UA 3GP5A 4CRWB 4WAUA 4RCVA 1BXGA 4I5EA 3HZHA 2HU7A 2C4MA 1U0TA 1R9NA 4GPZA 5DSXA 2ZVJA 3CU5A 3JARB 1ZFNA 3FR8A 2ZRJA 2AKYA 3NHFA 3JQGB 1D03A 1FP6A 3OZWA 1SOAA 4DABA 1WBBA 4DPLA 3ETJA 1N78A 1OJLA 3RAJA 3R6TA 1YR7A 4W5WA 5KWSA 1NVTA 2AOVA 1OX4B 3GCXA 3SEAA 3BWYA 1OXXK 4PC7A 2L69A 3TTXA 5CT9A 2NW6A 1CR0A 1FBNA 1R27A 3MIIA 5ICEA 1LU9A 2PNFA 2WKQA 3VR2A 2P2ZA 1RXSA 2QMZA 2BKXA 2W2KA 3CR8A 3VNSA 4WINA 5FPTA 3OJFA 5J5CA 3SKVA 4DT1A 1JHYA 1ONBA 1NNSA 4W82A 1QOPB 2EP5A 2PD3A 3MFYA 2AL7A 2JW5A 3LC7O 1MD9A 5K3CA 1TO1E 1U8UA 3ZHCA 1VLJA 3DQPA 1A9RA 4XVHA 3RSFA 2H06A 4HVCA 2BBOA 4MARA 3VR3A 3L4KA 3PC3A 4ZJZA 3IEVA 1T6BY 4BTVA 1VJ5A 4YRPA 4XD2A 5FJIA 4QPPA 1K7EB 2EFDB 4R1TA 4RGVA 3RUIA 2OENG 4CV2A 5KPJA 1MJGA 3RDPA 1L4FA 3QXCA 3UT5A 4E5UA 1R0CA 3TSOA 2QD5A 5B3LA 2XUHA 3VNBA 4LF5B 3EWAA 5I7HA 2XVAA 4ZARA 2HDNB 5BSKA 4IF4A 3VYRB 5LD2C 2P3OA 2VOJA 4NEGA 4Q9NA 3U7RA 5CYOA 2WJJA 4Y6PA 2IEGA 3MOGA 3SYNA 2IH5A 4I3HA 2O6LA 3A9CA 3GEMA 1Z4QA 1KR2A 1U8YA 1UJ2A 1ZH0A 1TM3E 5TQ2A 3O2QB 2AYXA 1JVBA 2QG9A 3ILYA 2OSBA 4IXDA 2DWQA 2BR3A 3C3MA 3D6NB 4WKGA 5FUWA 5J47A 1PJ8A 2QVZX 3BULA 4HDRB 3I34X 5C3UA 7AT1A 3OLQA 3N3AC 4EG0A 2FN3A 1PL0A 3AUYA 2WYIA 3HP7A 3QVJA 4PZYA 1V6AA 4FBGA 1SN7A 1YCGA 5G0VA 4K9SA 2IV3A 3UOGA 2AJDA 2R1TB 4PXYA 5B37A 1SIUA 1CX9B 4FDUA 4HQOA 5F1KA 2ZR0A 4IGAA 1OTXA 1NYTA 4L8VA 4WOPA 1V47A 3U4QB 2NYAA 2OV1A 3OIUA 1IHOA 2IVZA 2OB1A 3KB1A 3OMWA 3PT5A 5DZSA 5JZ9A 4RMIA 3WYFA 3M89A 3AV0B 4DMGA 4H7JA 1BKSB 2WA1A 4AP6A 1B4DA 1UOPA 2D1YA 3SXPA 3AJ9A 1OFIA 3DF9A 3SZOA 3VU0A 3DOOA 3HCFA 3KEFA 4LECA 2W2NA 1HEIA 2V4MA 4U0KA 2P9JA 3E8MA 4LE1A 1KPGA 3LUHA 4EQ6A 1PNRA 4FIZA 4PZAA 1L5HA 4RD2A 2PR2A 2NZVG 3ROKA 4EY8A 4GMDA 1PWZA 5H80A 3S99A 4MUBA 3AKCA 1FX1A 2GB4A 3M9LA 4ZZ0A 5DMHA 2D1RA 3L9XA 4LPSA 4RD6A 4QYIB 3DDUA 4PGFA 4IMRA 2VWGA 5FB3A 4F4FA 3WGHA 1H8ED 2F1HA 4IDAA 2WYWA 3CEPB 3K1JA 5IP5A 3E9RA 1LC0A 1CU1A 4WLEA 5BN1A 4ABYA 3G1UA 4EUFA 3HABA 5ECGC 3DLCA 3KQVA 3BDIA 4PWZA 4Z4HA 3I2FA 2E9SA 1SJ9A 2H5EA 4W5HA 1IY9A 1Y89A 3DAHA 4ZEXA 1AMOA 5ISMA 1HDEA 4G25A 3D6FA 5EFOA 5LQRA 1JSCA 5DLQC 3WK7A 4BNVA 1VE1A 5BRJA 1B93A 5LWHA 1XNHA 1NXTA 3I6ZA 3PD1A 5G4KA 3QI7A 1G7CA 3OUUA 2WP0A 2EG9A 4G37A 2WKSA 4N5IX 3O1HB 4OB6A 1EZ4A 1RZUA 1UINA 3IE2A 1T1IA 5EFZA 3MRSA 2C9ZA 2QSYA 2QQEA 4LJ6A 1OXVA 3QPAA 3JQGA 4TKUB 1PQYA 4H18A 3OCJA 5HZMA 4JKYA 3CRVA 2XE4A 5ER6A 4N40A 2WSSD 3HM9A 4WVFA 3L2OB 1DHRA 1D6NA 2WI8A 2HZBA 3ASYA 1VIYA 1Y0BA 5CGZA 2GBLC 1CUFA 3EXHC 5BVHB 2VCYA 5IH3A 4Y2YA 3FNBA 2JVJA 3GFQA 1NX6A 3PITA 3QF7A 5ARDA 3H1AA 4IJKA 5C9ZA 1A77A 3DOHA 4FR0A 4PX2A 5DN9A 4C0QC 4EYGA 1N3IA 2J6BA 3DOFA 4OYLA 4EB8A 5ALKA 1E66A 5ALEA 3MTIA 3ANXA 4I9HA 3T7RA 1P8JA 3SGLA 5L95A 1YK0A 2E48A 4OH1A 4FD2A 3SICE 1NI3A 4Q7MB 2IOFA 4IX1A 4K9DA 4MR9B 5FFFA 2ZETA 1JDJA 1SVSA 4GICA 1QANA 4FD3A 3ZU2A 4WZBB 2B3DA 5KCZA 3TE7A 1AQLA 3PR1A 3PUYA 1GFIA 1QPGA 3QV2A 4JBGA 4Z8YA 4H16A 3W9SA 4ER6A 2FDXA 1DOZA 3NEYA 3SHVA 4KWHA 5I01A 5LM3A 4D44A 2B4QA 3C1UA 3GDGA 4TX1A 2IZ0A 4WK6A 3IT3A 4HFNA 4PZ9A 4QWMA 5EJGA 1DV1A 2IUFA 3I04A 5TT0A 3TCXB 4BNDB 1JA9A 4QFMA 2CMHA 4PANA 4PSDA 2A7QA 2N0SA 1CEQA 2JAHA 3D43A 2BZ1A 2ZU6A 3H2GA 5EP3A 4RS4A 1QV6A 4LWQA 4RGBA 1GL6A 1LWNA 1Z7EA 5KU1A 2PX5A 1AHIA 4JLDA 3BF8A 4MR7B 4M9CA 4WACA 1QFJA 1KERA 1D09A 1TVKA 3GU3A 3T4EA 2IXFA 3BXGA 1RHUA 4IOMA 3FFWA 4IY1A 4M9QA 3TPFA 4HRYA 1ODKA 2HSJA 2K5UA 2QPTA 3N9IA 1WQ3A 2A4KA 3PI7A 4TWIA 5SV2A 1P2BA 4HX5A 4MS4B 4BNHA 4ZXFA 3STYA 3IPYA 4IIEA 5F52A 2YY5A 1QCZA 1RABA 4WKBA 1QF6A 1BXRA 5CFZA 2C1XA 3K32A 3NDRA 1CY8A 5DYYA 4P0PB 4IDBA 4E51A 5U4XA 4CLHA 4F3YA 4S3MA 4PIVA 3WO1A 4DCMA 2C83A 2SKEA 3FCXA 3MUFA 2DLDA 3HXMA 4BYGA 2FLKA 3QU9A 3IUPA 1EFPA 1J99A 2H9YA 2HRQA 3U9LA 4UOQA 3D6HA 1YKFA 3CY6A 6LDHA 2FZGA 1K9SA 1KJ9A 1PP4A 4WZAA 4AF7A 4CG0A 3DVSX 2O1WA 5IHXA 1V8FA 2NU8A 3EIEA 3N7AA 1L8AA 3CRW1 1CJCA 1CR2A 3B6ZA 4HWOA 4E7OA 4QSHA 3GRYA 3AF3A 5IZ4A 4CF3A 5EPEA 2DFNA 5AK5A 2GX6A 1XRQA 1MEEA 4RH1A 3REFA 4BRWA 4BE9A 3FWPA 3FSEA 3IVAA 5JCJA 3HU1A 5L7WA 1CUUA 1K68A 4B81A 1V39A 5F2NA 3CW2A 2QMUA 3HFJA 4ZRDA 2G1UA 3TS1A 3EMDA 4ERNA 4ZZIA 1HFKA 4QM7A 3WJ7A 1GPYA 3VPDA 4OGKA 4CKYA 3ICVA 4RTKA 1RLJA 2B98A 3DZHA 2B8NA 2WHPA 3F7TA 4Y30A 2BMWA 1QVVA 3SBOA 3M81A 1GN8A 5HOEA 2ZUVA 3R3UA 1FQKA 3L6CA 4L6CA 1OFUA 1U8EA 4HEJA 2WVJA 5FIUA 4BNUA 4DMRA 2Q0QA 3QLUC 1XK6A 4Q05A 3SDBA 2NVUA 2FETA 2V7QA 1P7ZA 2ZITA 1T9AA 2GCPA 3NOVA 3FZEA 4BNGA 1L7AA 3D7MA 4JP3A 3GLIB 2O2EA 3AHHA 1TX4B 2Q28A 4EYKA 3BQMB 5EL0A 1E62A 1JXMA 1L5YA 2QHXA 2VHJA 3CE9A 4HX9A 4F85A 1Y1LA 1DPGA 2PK3A 2Y2VA 4R31A 4XASA 5G0WA 4BWYA 4ZYYA 4RCYA 3WBKA 5G1PA 2XBMA 4AI6A 3AFNA 1H69A 3F6EX 1ABEA 1NSTA 4UBMA 4PYMA 1F0NA 4YCNA 2BGJA 1YXMA 1O6CA 5IVPA 2MSCB 3HZOA 2AOUB 1L6RA 1GUDA 3L1IA 3FZYA 1LX7A 3BMOA 3S2EA 1Q6ZA 1ODTC 1Y3BE 1N6NA 1V5EA 4RU1A 4DADA 4JBHA 1EK6A 4A36A 4B6GA 2FRXA 2OWEA 1GZSA 1SWVA 4C05A 3HB5X 3UT5B 5AW2A 1Q0TA 1OE0A 3PQDA 2JFPA 3SEFA 1QP4A 3AK4A 3W1EA 1XZDA 4I8XA 2HKIA 1ADYA 1PV1A 3N74A 4BUCA 4W5OA 4RHTA 7REQB 3IVRA 2DM6A 3ICQB 3HJCA 4G4SO 2E21A 4DDUA 1J07A 1YE5A 1JTFA 2BI8A 3TGWA 5CFRA 5J2TA 1XV5A 5KYVA 1NU6A 4QZVA 5A7FA 2QP3A 4IIXA 3UCXA 3RSOA 1DXOA 2G9RA 3X3HA 3QOFA 2GWRA 3RVBA 2ONJA 1IWBB 2DOKA 2CMGA 5FPKA 1FVFA 2VTVA 1TVCA 4D41A 3R09A 5DB4A 2AV6A 4PS0A 2DLNA 1XXHE 2D6FA 3JX9A 3CH6A 1RYDA 3BJZA 3EIUA 1ELOA 3OVMA 3GN1A 4U2KA 1P5FA 3NRBA 2GASA 3FCAA 4PAWA 3HU2A 2E18A 5D2CA 5GZ6A 4PLYA 3MTEA 4UZSA 4EARA 3JD4A 5HZGA 4D56A 3N2KA 3K0CC 3T7TA 3VU1A 2BHRA 3K96A 1LPOA 4CL2A 3WWPA 1C2TA 2RHRA 1JKIA 2UVDA 2XGSA 3AI1A 4HYEA 2OM6A 4LBYA 4M6WB 4R3WA 3CX7A 3FAKA 4OMCA 1UK6A 2JGKA 4YV2A 4RZHA 3GLTA 3KQTA 1T2FA 2AMLA 2PRIA 1JLRA 1E9FA 4S1TA 4B4KA 2PV0A 4A1OA 2BHTA 2VLIA 3GC6A 5KTOA 5BVGA 1DL5A 1R8QA 2AW5A 2FSPA 1RADA 1ODJA 3H1EA 5FV4A 1MJGM 1OWNA 1BJRE 1YC5A 4LWPA 4QX6A 3E27A 4RLHA 2CNWD 1JXQA 1RS0A 4MVJP 4JKIA 1FYXA 2RGCA 3CLUD 2AQHA 1I2AA 1ISRA 4QPZA 4TYPA 1R6VA 1ZUHA 4ZCIA 1HE8B 4NOLA 5EWLA 4HEA6 3AVPA 1B23P 1XALA 1N2JA 2IYZA 3E7WA 4RVSA 4O4LF 3HNRA 3DE5X 3C6QA 5EZYA 2GJAA 2ZTUA 1L1FA 3M33A 4KWTA 2ID4A 3SNKA 1NR7A 2ADMA 3GLHB 1LRLA 4JB8A 3A3NA 4BGDA 4V0MA 1NXVA 4HR7A 1JDSA 4LMPA 2QVCA 1TYCA 3AEQB 3E48A 4FX5A 2Q9UA 5IARA 1K08A 1CQWA 1OR8A 5CYPA 3KTAA 5ALUA 1T5BA 4G4JA 4CEJA 1U1FA 4HF7A 1XVAA 2YNMD 3LIPA 1C41A 3B7PA 2BTEA 3G9QA 2C59A 4FYPA 4O4JF 4UVGA 1T9GS 1C1DB 3U37A 1XMIA 1DWUA 1WHTB 4M21A 3C3YA 1XRNA 4X6UA 1HSOA 4AY6A 3K9BA 3TDNA 4UHEA 4US2R 2MSLA 4ME6A 1S8OA 1OZGA 2YR0A 2H9IA 3WRYC 4AQ7A 1EWTA 1WUJS 4QXQA 3ZU6A 4OF4A 3VJLA 2FFQA 2NSLA 1M66A 4R8RA 3T38A 5C8YA 3WWZA 3FTPA 3JVDA 5EKTA 1CUCA 4G2TA 3L77A 3JPWA 1EMDA 4P4TA 2TYSB 1T2DA 3KVVA 4UUMA 4ZRMA 4HL6A 2IGBA 4YBRA 2RKBA 4AZTA 1Y4SA 2ZB3A 1KI2A 1JEQA 4NCJA 1CNMA 4NU8X 4RABA 1QIFA 1QIKA 1N1EA 2QZSA 3PHHA 3U4IA 4LXGA 4ZYWA 2NP6A 3E84A 3QF4B 1YVRA 1QFZA 1VJ0A 2WINI 3HDTA 4Z1OA 2QE7D 3SVTA 1K89A 3ZIAD 1F4LA 1DCKA 4OQLA 3UJ8A 5D87A 2HNBA 1B16A 4KNVA 4MB2A 1Y48E 16PKA 4BNDA 3C1AA 3OX2A 2Y1WA 1QDLB 4JXKA 4DCVA 3E03A 1KYXA 4DA9A 4EYOA 1G8GA 3K0BA 1JHUA 4W9MC 1GYRA 1XVIA 4TZ0A 3ZWDA 3R7BA 4ZALA 4L85A 2Q6IA 4IIJA 1Z3IX 2OLEA 1ZI9A 1ZD2P 4TWBA 3OLVA 2VLBA 1DTWA 2WW8A 3D4NA 2YXNA 1ARZA 3UPTA 5A06A 2NTJA 1XN4A 2JIZD 2ZJ5A 3KTAB 4KJXA 8LDHA 4UAGA 1LZLA 1H2FA 2QUAA 4GOMD 4Q66C 1L5SA 5AXDA 4ZEWA 4OXQA 4F6RA 3KT3A 2RG1A 1THMA 3BXZA 4J4TA 3TAXA 5AQ1A 4OL0A 1UDBA 3VDNB 4D98A 3CRNA 4RAOA 1H85A 1JT9A 2IELA 5KTYA 2PZBA 1O7JA 1XDDA 3GOQA 3JD3A 5FTWA 1XC7A 3UJAA 1S3IA 4M8IA 1PJSA 1KQPA 4G5FA 4MULA 1VKZA 2ZJZA 3W2GA 1KEZA 2PSHA 1SZDA 2QZZA 3REQA 3WXBA 3I23A 4KEAA 1KARA 3E1KA 4UEKA 4HPXB 2XKBA 4IFTA 5FYDA 1J9GA 1ZGJA 1NJ6A 3CUTA 2AUMA 1E92A 2JEYA 2JIMA 2ZSFA 4TUYF 3T35A 1XMQB 3A4YA 2MYPA 1QO9A 4HFRA 4CMJA 1ZW1A 2W4QA 3E5HA 5DYIA 4QT4A 2VPTA 5LQMA 3MPUA 1CLEA 1YS7A 2PIDA 4GXNA 2W0SA 4BFCA 4DUGA 1JHZA 4P6VF 4IUBS 4N39A 2C8KA 3DTVB 2P1ZA 2C2XA 3K15A 4KAFA 2XW6A 5BVGB 2ZZKA 2XTNA 3EB9A 2WA2A 4CEHB 4DG5A 3NYIA 1N75A 1Z83A 3MGAA 4I4TF 2D5IA 3CPHA 1OROA 1OVGA 4O4LB 1F1JA 2XWPA 4EW3A 4DXHA 4HDAA 1NJSA 1CP2A 3RKUA 3AKDA 4MGYR 3UA4A 4RZUA 4N7BA 1MPXA 4PAGA 3RYIB 2J3KA 4F12A 1WETA 4JP2A 1H2EA 2A35A 4ND8A 1OT5A 3KHKA 2CXNA 3AR3A 5JJBA 4FCVA 5KMGA 3VU9A 4Y18A 3RUDA 4B8ZA 1QS0A 2HFJA 1W8DA 1WOYA 2YZ7A 2MR5A 4Q3OA 1HZZA 4MRVA 1ZDMA 5CXSA 3BICA 4IJUA 2ZB2A 4JCOA 5C7IO 2QBYA 3CUYA 1NMXA 3OPQA 4QARA 1B0UA 1N9GB 3IP5A 5C1PA 4AMVA 2I0FA 3BSWA 3NJ4A 4B43A 4LJLA 3AHGA 4WOJA 3V97A 1IZYA 1Q5PA 2NSJA 3ILVA 3ZDFA 1KEPA 5IAEA 1U1DA 1DKLA 1L4LA 2ZREA 1E5VA 1G18A 4FR5A 4YLEA 3D7KA 3O9ZA 4FYYA 3TLEA 3V2HA 1ZVVA 4GG1A 2QXTA 4EM6A 2QRZA 3I3OA 1PK8A 3OCXA 2OSVA 3TZ6A 1AG9A 1KAMA 3T7AA 4J0JA 4NBLA 5LQUA 3KELA 4JVSB 1JLMA 4P4UA 4B85A 2WWRA 2CXRA 3W2TA 2AMFA 1FU8A 1OIVA 1Q1GA 2QSJA 2GRJA 3O03A 4PFSA 4BQPA 5L40A 4I6JA 1O8BA 1P18A 2QAJA 3GCZA 4IXNA 4OLJA 4L7VA 3SBEA 3PR3A 3SC6A 4F2DA 2VNAA 4BZXA 5LU8A 4MDYA 3C1TA 3ZD6A 2D1TA 2ZSEA 4YRCA 3HN2A 1GDTA 4XYBA 4YT8A 2R6HA 2OXRA 3RLIA 4ATNA 1QMGA 2WF9A 5A4MS 3QPUA 2CXTA 2C7QA 3R1IA 1N8TA 3TVDA 2BHSA 1LD3A 1F51E 2B21A 1E7YA 3GX1A 1NQVA 2OG2A 1HNNA 3UV7A 4BV9A 1PDOA 2FHPA 4EIWA 4EW6A 1V2GA 4EJSC 1ABFA 5A0TA 2X8LA 3IV7A 3AXSA 2JCYA 3KUUA 3MVEA 3KETA 1WXHA 121PA 2KW5A 4Y2QA 5LBUA 4D0LB 3ZWMA 3Q88A 4CMBA 1G3RA 4N65A 2Q4OA 1PFGA 1NNUA 5JARA 4JC8A 3AUTA 4HAZA 4MKRA 3RIMA 2JCXA 1LVGA 2OBLA 1PEKE 1SZPA 4R2XA 4EVQA 3BAFA 2F9FA 2L19A 1VIMA 2X5JO 1G5FA 1DCFA 1H2HA 3HKEA 1BEZA 1JS1X 5FWAA 3X1KA 3R5FA 2NO7A 2QS9A 2PSDA 4LY6A 1GTSA 2O3RA 5JHHB 1ZH8A 4UMVA 3NPMA 1CY4A 1NKSA 3B6KA 3VZQA 4QDJA 3KSDO 2J0UB 4YWJA 1GPBA 3EZLA 1ZM3A 2JCBA 4KPEC 2AVNA 3R6WA 4HDMA 2R85A 3KZMA 5DM70 1CZNA 1UBLS 3V48A 1PNVA 3KXPA 4HQNA 1M75A 4I36A 1N4DA 4FJ0A 1UP4A 1IATA 4D9EA 4AMGA 2R97A 2V9CA 2ZIXB 3LNCA 1OBHA 3VOTA 4Q03A 1YULA 1UQUA 2CB9A 4RFSB 5AM0A 1NW6A 5ESWA 3HWSA 3R5TA 1ZNQO 3KJIA 1TGVA 1VSVA 1MXFA 2VZLA 3GLKA 4TTAA 3OF2A 1P2DA 5JRJA 1RPNA 5CEJA 4CETA 3LBHA 5HNKA 3LHKA 1BKDR 2JNWA 2OILA 4HAIA 5H3HA 2IYPA 4AG5A 4MHOA 2QD4A 3PL5A 5GZ3A 5GAJA 1NHWA 2KB0A 5HGJA 1BDIA 3IR5A 1A82A 1NVVQ 2XUKA 3U3XA 1WBJB 1XLWA 3IEKA 3C3CA 4K9RA 2ZI5A 4DCTA 1AQIA 4EUSA 1OXKB 2ID9A 2Z58A 3Q85A 3IYLW 5I4BA 2J09A 2E4YA 4NH0A 4YONB 4CDRA 3PSAA 1JYEA 1KAHA 1GSAA 1YT5A 4BUZA 3CPSA 1CZHA 3KT0A 3TM5A 4BLVA 3L1VA 1SHLA 5C1OA 4AECA 1ZM7A 3GJ5A 4WX2B 1CQIB 4HADA 2F43B 1Z5ZA 1THZA 5CTJA 2HC9A 1NYLA 1KRHA 2INGX 3UCEA 3UO8B 3HKEB 1O1YA 4NMXB 3CLRC 2ECPA 1U65A 2R5WA 4ENTA 4WLNA 3GQVA 4ZAGA 3JQ7B 4A27A 3F7OA 3I72A 3AR8A 1N0VC 4YAJA 4EEZA 2GJSA 2ZT5A 2BEUB 3FVQA 3H4VA 5HUHA 4I4IA 2BDTA 4MV6A 1LBQA 4EABA 4Y2JA 1CUWA 3L7OA 3WTCA 1NUPA 4Q01A 1NDQA 2GCEA 1YDEA 3HBAA 4X54A 4DLUA 2F17A 3BL8A 2OVFA 1GQSA 4G0WA 1TJ4A 1LW7A 1FSGA 1MQSA 2ZATA 1KYQA 3RPEA 1ECPA 1P1CA 3AU8A 4IFIA 4DMKA 1EK2A 5BN4A 3EZ9A 5KYWA 1PRYA 2XYHA 3DR5A 3H17A 3PKIA 3HXPA 3LJKA 1EIWA 3DZKA 2RGEA 4KWIA 4ETMA 1QG6A 2IF2A 4HLUA 1DV2A 5GGXA 4HWGA 1YI1A 3MAJA 1NN1A 4OJNA 5DHAA 2B1IA 4AN0A 5BSMA 3PHLA 5IAAA 2G4CA 3HCPA 5DRYA 4UTZA 3MCWA 5LDHA 4FMDB 3ZWCA 4D9KA 3GEDA 2V7WA 4Q12A 3VDRA 3S70A 5BOSB 3JAWB 6Q21A 1Y7IA 4XGRA 1D0VA 1HPLA 5DM2A 4QUHA 1JZQA 5E6SA 1NVFA 2G36A 3ABZA 3TIVA 1EXWA 1RLOA 2H16A 4MV7A 1QFXA 1C3LA 3QVMA 4NARA 3K0AB 1DTSA 1XNQB 1S1CA 3EF0A 4Z4CA 4BLQA 1T91A 1C50A 4MVJE 2QD3A 4JLBA 1PQWA 5CXUA 3UYKA 1GNSA 3FB4A 4Y0VA 5JMOA 3GLUA 4ALNA 1KFJB 3D31A 4Q4AB 3ZE6A 5J43A 1VFNA 3SC4A 4XM0A 4ZOEA 1EVIA 3ROQA 3AB7A 5FWNA 1GWNA 3GFBA 3RVNA 1S8AA 3OE4A 5TX7A 2FHSA 5EWMB 1EVLA 5F7XA 5IF3A 1F5NA 3I09A 1YJ5A 1F4PA 1I51A 2B1JA 3AL3A 3H8WA 1P39A 3MD0A 4IPTA 1PGJA 4KQ1A 4CM8B 3OZGA 4CMCA 4HEA1 3ZIDA 2VN8A 3AJ8A 3QWIA 4UE2A 4DLTA 2K4MA 2QVBA 4X90A 4CV0A 1CS0A 3DEFA 4ZI7B 4BMPB 2B7BA 2OPHA 2BKEA 2ZUDA 1OFVA 3BCUA 2ZLBA 1AQYA 3PFFA 4C0JA 3NGLA 5H9WA 5J58A 2DUMA 4XGQA 3QJYA 4KV7A 3G0OA 4Y1EA 1H05A 3B1VA 3QW4B 3EXIA 4IVRA 4LXTA 4Q1CA 3V8NA 3ZCSA 1PT8A 2IHTA 2Z57A 2VDWA 2IRWA 1I2CA 2Z30A 3BE4A 3VX3A 5K7SA 3MT8A 1P1JA 3QU7A 3OPMA 4FDAA 2JHCA 3CWCA 2JI6A 1PL6A 2P2SA 4FYIA 1KP9A 1ILWA 2AFHE 3OAAA 3H11B 1HNXB 1U4NA 4ECAA 2HNAA 3RFCA 1PN3A 5JRZA 4XCQA 1QTIA 4CKCA 2HBYA 2IHYA 1EE1A 1U3FA 3ZVLA 2OBNA 2X0RA 2WF6A 4AS1A 3KNZA 3RFVA 1E9DA 4UXJA 4Z3DA 3S44A 3OQ1A 5AKHA 3R76A 4K86A 4RW0A 4OG2A 3U62A 2EFYA 5ESRA 4INAA 3KALA 3VRHA 2NMVA 4B6JA 1TCBA 2XCSB 1HGXA 1ZHHA 3RC9A 3SHWA 5FBQB 1YZFA 4HBGA 3S1AA 4MW9A 3H65A 3DZFA 1UBHS 2O1XA 2Z2JA 2H7CA 1W36B 1KA9H 2BP7A 4QHYA 1ZNYA 2CL5A 1KRXA 4BKMA 1FF9A 4FOPA 4MXDA 5FBWB 4YRIA 5HM8A 3LY8A 3SYTA 3TD9A 3KPJA 4UHJA 1NJ1A 2DWUA 1QKJA 3B9PA 1KRWA 2GF0A 3RRMA 4BV3A 1Y4DE 4I81A 5ERYA 3R3YA 3DT8A 1TPZA 4MVCA 4TRRA 3CEMA 2VQFB 2J0SA 1XTVA 5M3BA 4BCBA 5KAMA 3MXOA 3OTHA 3HL0A 1EX7A 4CKWB 4OHYA 2P5TB 2ZWMA 5C1DA 5M29A 2BEWA 3O95A 2P40A 2XMQA 4MJLA 3ZGYA 2B2XA 4B3TB 5KREA 3YASA 2EGGA 5LLSA 2OZEA 1XA3A 3LDFA 4O5AA 5LLTA 3RC3A 1YA4A 3GMIA 4LDZA 5BQ5A 5C4MA 4U2EA 5DXAA 3RGGA 4ZDJA 5AVYA 1NMSA 4KSCA 1QIHA 2X0FA 5HKKD 1Z2DA 1DRJA 1O6ZA 2ZPTX 4ILKA 2BFAA 1ZAYA 4M1QA 5CCDA 3PJFA 2ZTLA 5IVKA 4QM6A 2QVXX 1K7YA 1R7RA 1RJEA 2JAOA 3L7DA 1T2VA 2NP7A 1E2NA 5IX8A 2DC1A 3ZWQA 3SIRA 1NKVA 1KP2A 2R00A 4DLKA 1E59A 4QBHA 2QNRA 3LQKA 1VDZA 3CRRA 3TX2A 4E12A 4UNRA 3DCNA 5ALQA 1SVUA 1X1DA 2JFQA 2QYSA 4OQXA 5IUJC 5AVJA 1NA5A 2WU1A 4IW3B 5AICA 5CA0F 1ULHA 3KAPA 4I1IA 3JWEA 1V8BA 3KR9A 4N5LA 2O3JA 2QTRA 3BK2A 4HP8A 4C2AA 1W0JD 1T43A 1YOBA 3AR2A 4WFKA 2OOKA 5JHGB 1PR0A 1A2QA 2DECA 2JIOA 3V4RA 3EZYA 2IIPA 2C20A 4GRAA 4HMPA 1XEWX 2FPIA 3A05A 4ONEA 4DARA 2VNHA 4AF8A 3CKKA 5JNVA 3L4BA 3Q8KA 4ETNA 1JNYA 2P6PA 3D3QA 4GUDA 4KO3S 4RK4A 4CPDA 1K1EA 4F9TA 1GGHA 3OZTA 3R5KA 1OAAA 1Q22A 2YHSA 5D84A 3UJBA 1QNLA 4IO1A 2R1TA 4G0ZA 3WB2A 1PZFA 2OCLA 3BKXA 3CXRA 2CW5A 4GU5A 5EIOA 3X1ZA 4D8XA 3AESA 2Q8NA 1NJ2A 2NVOA 3OBBA 5LBTA 2XJ4A 1HYGA 4MKZA 4EELA 2BFCA 4HMOA 4EHHA 4PO9A 2A30A 3FD8A 3E82A 4JT8A 2ZYSA 1JIVA 1KI9A 3UG6A 4L28A 2RONA 2JBAB 2RGGA 2WIDA 4BWFB 3K4QA 1FBTA 3CZPA 4LYGA 3E61A 5L7YA 3N8IA 4D45A 4YMVA 7MHTA 1Z08A 2DQ4A 2BI4A 1EFRA 1Y8CA 2NXEA 2P0AA 2WNSA 1ADCA 3FBWA 3D3EA 3L0DA 4NK5A 1YA6A 3C0KA 3U1VA 1JECA 2BGIA 3ZZNA 1L5KA 5SZIA 2NPIA 4POAA 4CGZA 2QGNA 5GOTA 1I3MA 1Z6PA 5CIWA 2DHRA 3U80A 3WWDA 1OV4A 1G6KA 3KQOA 4N12A 1WU7A 1M2EA 1K8XB 5I51A 5TMPA 4BBPA 3CE6A 2VNSA 4Y9SA 3IDOA 3VVBA 4MWZA 3A1FA 5EHGA 5LDGA 2C7PA 3Q15C 5JFOA 1OWLA 1JRLA 3ZHXA 3O4GA 1HG1A 2GPJA 3IEUA 5B6PA 4I55A 5TGZA 4WTOA 5HEKA 3P2YA 5CB4F 3AG5A 5LZ2A 1WSBA 3AIKA 3SI7A 2CXOA 2JK1A 4OM7A 5EKSA 2WSLA 2PQ0A 5CCBA 5A4FS 3ZQUA 1ZGZA 4DCGA 3UAXA 3NHBA 1ZIXA 4CLOB 4XIGS 2D0IA 3D2LA 4GL4A 3DFFA 2FPXA 1V3QE 4BX3A 1G9SA 1FW6A 5AXBA 1FZTA 2FFJA 4PSKA 4MGEA 4H6VA 4R1PA 3D1VA 1LRKA 4B3XA 3MPOA 5KNDH 1BROA 1OILA 2X7HA 2JIBA 5AFSA 3KEMA 5FNVB 1XT6A 5IT0A 2Q3CA 3W4IA 2XAUA 2QTFA 3ANNA 3TD2A 1WMSA 3GJ7A 4KN8A 4DPMA 1N33B 4M0MA 3ZE0B 1TM7E 2OWDA 4DZTA 5J4LA 3LGXA 2DUUA 5FTNA 1FFXA 4DVJA 2UUCB 5CLIA 1YFKA 5E9WA 3LX6A 1M8JA 1UC9A 2NUPB 1Y3HA 3A7EA 3KZXA 4HDSA 1ZEMA 4R8MA 1A8PA 3A7DA 5EIWA 4BJ6A 3FJ1A 1AIPA 1C1HA 4MUAA 4QSMA 2YL2A 3O31A 4PGMA 1K88A 3P0EA 3E81A 3ZGVA 3BCSA 1DVRA 4MV9A 4LGYA 3E18A 4QODA 1ADGA 1LSOA 2VBFA 3C1OA 3GUHA 3EGDB 5HS4A 4LNAA 1MRSA 3UKOA 3N1UA 3C16C 2HU8A 5BNZA 1U9JA 3QJ5A 2R8XA 4UU1A 4YCDA 5CEEA 4WDRA 1KETA 2P5UA 2ZFUA 3TTSA 2IQIA 4QYIA 2C2BA 4ZT2A 3GYBA 1BVUA 3L1KA 3PRJA 2G07A 5AUNB 5KNDD 1AS0A 4TM7A 4F04A 2H2IA 3PX7A 2J3HA 4G0MA 1QIDA 2GLTA 1DXHA 2OD9A 2PA3A 4MEBA 4HNRA 4PLFA 5FEMA 4AKIA 3ZBTA 1VXRA 3MLEA 2IEAA 1BEEA 1XDSA 3SXUB 2AR0A 5HRCA 3MEQA 2R1UA 5F2OA 1FDWA 3CG0A 4OHUA 2PGDA 4S35A 2IV2X 1HYHA 5AM3A 1GUAA 4DCPA 4KXQA 4X91A 5JCZA 5SZKB 3EPHA 4LHZA 1P45A 2G9VA 1LEHA 1X7ZA 3FSGD 2QQFA 2DYKA 3D6UA 4QBGB 1ZIYA 3ZH2A 5F4BA 4H35A 1TT7A 1XROA 3B7WA 2ZB8A 4IOKA 2I9KA 3P26A 1CJUC 3G8DA 3MCVA 4FLEA 4MYDA 1CHDA 1J7JA 2KLHA 5AOVA 1Z2PX 2I99A 3CEAA 1ZHFA 4IDQA 3C3XA 1EINA 1YB5A 3LC2O 1JLLB 2NXJA 1MAUA 3G8YA 3TSZA 2OHHA 3K7EA 4Y2SA 3ZQKA 2OQRA 5LXTB 1DLJA 3GLRA 1Z06A 4F4IA 1S3FA 8ADHA 3B78A 2Z8ZA 1XZLA 3LWNA 4PZLA 2YOFA 3MM4A 5JZVA 4KIFA 2AZMA 5LOVB 4L5CA 3RYCA 2FMIA 3IQGX 2NUTA 2REXB 1DKNA 2JARA 4Z99A 4ISBA 2CWDA 3Q41A 1LKZA 1MF7A 3GGJA 5HCNA 4EFLA 1SCJA 1XXLA 2DT5A 1RPAA 2K7ZA 5JBNA 3NDPA 4MYCA 2VH2A 2X6RA 5I47A 3C74A 1V1JA 2CHGA 2LGJA 1ST2A 3QF4A 1XZJA 5FL3A 3B2NA 4JJEA 1Y9ZA 1YIAA 1R0ZA 2KI5A 3FR7A 4O02B 1TJPB 4PG6A 4RIHA 4G1BA 3QXHA 1XO1A 4WK0B 1XX6A 3JVVA 3ZDRA 2AN5A 3PHJA 5AOAA 1E9VA 2OECA 2GZSA 3PCXA 1PZHA 2PU7A 4U7TB 1DKRA 4YP6A 1KFEB 4B48A 1JDZA 4HZGA 5JAPA 1HNWB 3FJOA 1NT2A 1ORIA 2P67A 3HPRA 5EJ7A 4MW7A 3OWOA 2HGSA 1P44A 5JNWA 2D8MA 3EMBA 3FM9A 1X19A 2WZQA 1GZ6A 1G5PA 4S2EA 1RWBA 3L01A 3AF5A 3CV3A 2EFEB 1TUBA 2QRMA 1M0SA 3RG8A 4JA2A 2R7KA 1HYQA 4QQNA 4D6YA 4QNMA 2YMMA 3FKJA 2Q1UA 3K9WA 4EUNA 1L9XA 1RE1A 3TSAA 3O84A 1QPZA 1IXSB 2BE7A 4Y0NA 3RQIA 2DH6A 3PIRA 3DFKA 3DV2A 5H02A 3D4OA 5IC6A 3UWPA 1PWXA 1NQXA 4XUCA 5KKAA 4C4RA 2Q5LA 5P21A 2JLVA 1WKCA 1UBMS 2CMKA 1YVUA 2OAQ1 3L1JA 1NL3A 1TYBE 3OIVA 3S55A 1UXJA 2FEPA 3GUZA 4MK4A 2PMWB 4WHMA 4C7OA 3LCUA 5LA6F 2PUDA 2GT1A 2IEYA 1Y3FE 3GFVA 5ELMA 4XZ3A 4R68A 1IOVA 2J85A 1XHLA 3NASA 5EUQB 3MB5A 3V2UA 2P65A 4EGQA 3L04A 4LOKA 1MC5A 3BD9A 3IDSA 1C4XA 2HJVA 4FHEA 3D5EA 1Y8AA 1UOEA 3WA7A 3LA8A 3PD7A 4GPIB 5ALYA 3S2FA 3LUDA 3I62A 4MDFA 4BE4A 2CJFA 2EDAA 4IJMA 2H0AA 2D1QA 3EA5A 5CH8A 3UG7A 3SHQA 3LM8A 1Y81A 3EARA 4LRQA 4CFYA 4F7DA 2F43A 4K9LA 5EHNA 1IHDA 1EQ2A 1M2VA 3I1JA 2ATVA 4Y6OA 3DDSA 4BFTA 3PK0A 4GYKA 5KTNA 1YU6A 3BGWA 5L3QB 1J8YF 1M7HA 2FAXA 4R98A 2OV8A 1W6UA 1U7ZA 3EVAA 2HWXA 1R0RE 2WVHA 2XCQA 4J0HA 3I32A 3R75A 3I4LA 4QVKA 1RQPA 2C3PA 1XDWA 3PT9A 1ZD9A 1T9ZA 1QXSA 5HFNA 3SF8B 1QHEA 3AVQA 3WGTA 4AXBA 4RKQA 2ORED 1Y5IA 2UZ3A 4LZWA 1VBKA 5IJAA 3P2OA 1FYDA 4CLRA 3NDIA 5C2JB 5HKLA 1D4FA 3IALA 4DBLC 1N6IA 1NF8A 2FF5A 1DKPA 3H2JA 3KAKA 3N75A 4LISA 1CPYA 2VR1A 2EKDA 2XLBA 1CF2O 1NOKA 1PHPA 2ZJFA 4MS1A 4BLTA 4D7AA 1S01A 4E4RA 1HTTA 3H83A 2H07A 1R9GA 2ZUCA 3OZFA 1IWOA 1ONSA 4O29A 2BCJQ 3PU6A 3PUHA 1CHNA 4GEGA 2YRFA 1MP0A 4ZAVA 4JMPA 4ZGGA 1W1UA 4B3BA 1XTKA 2WEKA 2BTQB 4LF7B 2WF8A 1SEVA 4KYVA 1S96A 2V4UA 3OIGA 1AB5A 3RSGA 5LOVF 1K6MA 4DV4B 2VAWA 4OHXA 3KVOA 1W30A 2ESRA 4OK5A 2XUOA 4HQ6A 2PFSA 4Q16A 4RVNA 3U7QA 1ZUWA 2CEKA 2I1WA 3JQAD 3HGQA 2IXBA 5GMOA 3LW8A 2XMBA 5EXPA 1ZVKA 4OK6A 4DCJA 4QRDA 2IFTA 3OJXA 4K9QA 3ZW9A 3MTQA 3T06B 1NJ5A 1G6Q1 3V1YA 4FZ5A 3DPSA 3HY6A 3RS4A 3GLVA 2IH2A 1UWLA 2ZSIA 1Q95A 3KWMA 2GCGA 3MQ2A 4OHMA 4PIMA 1O96A 4IS3A 4L9RA 4EJ0A 3UWOA 3TIFA 5FBVB 1UBOS 3A6ZA 1SD5A 3E70C 5T4FA 4A5OA 4QXAA 1AGYA 2JFFA 3L7YA 4F6LA 5IC4A 3RNLA 4MO2A 1CVLA 5C52B 4QFCA 3KJQA 4NOMA 2P30A 4GECA 4X41A 5FPHA 3K71B 2EWVA 1R4AA 1CZLA 1WXGA 1U6KA 2DFKB 2JVKA 5DBOA 2Y1EA 5K3FB 3TMYA 3U4GA 4YPVA 4YV1A 1TK2A 1WZEA 3IXQA 4XEUA 3FPSA 5DGXA 3W5AA 1Y1QA 4R6XA 1XCGB 3Q9SA 1F7UA 4W8GA 2OLJA 4N5HX 3CH4B 1CRLA 2AX4A 3LSYA 2QM8A 1RWPA 2WQZA 5LMCA 3OZCA 4I46A 1GAQA 1Z4MA 3X2SA 4AP9A 5JSFA 1TT5B 4FU0A 3E1SA 3QEAZ 1CZUA 2PGNA 2ZJBA 4JT9A 4JEUA 5C53B 1JKJA 2FCAA 5A0FA 1GQRA 3C3JA 5J2UA 1TYEB 1AURA 2HPZA 1Q6YA 3SOZA 1K8QA 2F3UA 3A1DA 3QLJA 3OQBA 4Q3CA 3EYAA 1NTRA 2EJUA 1MDBA 4MA5A 4G0YA 2HT6A 4A8JA 2E5LB 1WHTA 1R4NB 2VXCA 2L82A 3NHYA 4AQDA 3HEMA 1RNLA 4WCFB 4TQGA 1KI6B 2QW8A 4DR5B 4E0BA 2C5EA 4POOA 3D64A 4QWWA 5JT1A 4D02A 5CLJA 5HKAA 3EVDA 3FDXA 1CUGA 2C1ZA 2GFQA 3F3KA 4XVQA 4DIMA 3X1WA 3L92A 4HQRA 1KS9A 3K8OE 3QW2A 1GEGA 3CRMA 3MS7A 5JEDA 2FPPB 2I4OA 3U4AA 5JXHA 2PWAA 3I53A 5CLHA 3HFSA 4O0MA 3TQCA 4EKDA 2IYRA 4Q1EA 5ESXA 3QNMA 2FG7C 4MAMA 2XE7A 1EXMA 3ZC3A 2Q2QA 1SBYA 2BGNA 2AEEA 3C14C 2CCGA 2VT6A 3JZMA 5AM4A 3GA0A 3GCWA 3PUZA 4A0RA 1YE8A 1JHPA 4ZO6A 5ALIA 1B8OA 4Y1FA 5E9JA 3EOBI 4GMHA 1GZDA 4KGXA 2YVLA 2HIHA 3D0QA 3OTGA 4FP9A 4JUIA 3AI3A 1RFLA 2JFYA 2QM3A 4PHHA 3A1NA 4MA4A 3V1KA 3IB3A 2A8YA 3KUDA 4IHJA 3SLKA 4GPEA 2VTKA 4R41A 4LJSA 3HB7A 2V7EA 4OX9B 4RDHA 1TZKA 4MS4A 3O8BA 1X80A 2QTBA 3BWCA 2RHOA 4Q4LA 3WAJA 3LCJA 5CT4A 4B46A 3ANYB 4OKIA 4TXNA 2XAAA 4M60A 4IWXA 2P4HX 4XWGA 5K2OA 3ORYA 4OQYA 5SZJA 1JDTA 4JUAA 4U5XA 4R9SA 1CNFA 5A4JA 2FMHA 1CQJB 1E8MA 3JYOA 4TVOA 2B2CA 1KGSA 1VL8A 3V1MA 1I7SB 5GADl 4B3DA 3EY9A 5FCDA 3PNLA 4WY2A 3RC2A 3JCZA 4PX9A 4G0PA 3VPHA 3OQHA 1PT6A 2HSGA 3QVGB 4I2VA 4CCYA 2W2VA 4F7WA 1XMXA 5FHRA 1F20A 1VMIA 5DBEX 1PK7A 4X65B 4EVIA 4JB3A 2X5NA 2IVFA 5EMKA 3CWZA 3QX7A 3TQFA 5BOSA 1OXMA 3KUCA 3IRVA 2QTMA 4TKZA 4DLBA 5CBKA 3OPYI 3LT4A 1J2JA 4Q82A 3W3AA 4AB1A 3KSMA 5LYJF 2WJAA 3R7LA 2YDXA 3GGCA 4HC4A 1K8RA 3HG7A 1NBAA 1R2QA 1TDJA 3IKVA 4IHKA 3CUVA 1J39A 4OSEA 5T8KA 5IDQA 4MDEA 1QF9A 3TEFA 2HXYA 3QVWA 2BWJA 4MR9A 3UBMA 4B3HA 5C8ZA 2C2WA 4ZCMA 2QUIA 6PFKA 1G8PA 3MK31 3ADCA 1X1SA 1PG5A 2CVPA 2IF0A 4JC0A 1ZGBA 2DFLA 1PL8A 2PXXA 5E8JA 1RYBA 1W0KA 2HQRA 2OV2A 4X93A 1F8FA 4HY3A 3ER8A 1QRAA 2XEXA 5FQOA 4A7PA 2Q0HA 4MI1A 5I9TA 4IICA 3QKTA 3GA5A 4P1ZA 2JASA 1H2ZA 1QS0B 2IYXA 1I3NA 2C9DA 1TZCA 4HSGA 3ZE8A 5IT5A 2P9BA 2R5NA 3WHKA 1XXHB 2VJCA 2AG0A 3A1CA 3ESYA 4QYWA 3DE7X 1IBLB 2MU1A 5AK0A 3NHJA 1GLVA 1V5WA 3ENWA 4Q4HA 4MKFA 1J22A 4U8HA 4G9BA 1V1RB 1FFAA 2VYQA 4W6ZA 1G8HA 1RQ7A 1VHJA 1Z35A 1IXRC 3NR2A 4GOKA 2EZTA 4TKMA 4C6TA 5EP2A 2LP4Y 3UXMA 2XF8A 1UDAA 2A94A 2CBXA 5KNCH 3HV2A 1MOPA 4TMYA 1OAOA 4I4TB 2WAYA 4LE2A 4O08A 4IQ0A 2GCNA 2CXUA 4ZDWA 3DJFA 2GFHA 4QXMA 3JYLA 4LE0A 3HO8A 2VDMB 3VR6H 3OKCA 2ZJ4A 2P2CA 4AXXA 5FDFA 4MUFA 2YFYA 1KSFX 4D3SA 3OTIA 5JE8A 3LXXA 3BZWA 1NUSA 3BMNA 4Y2GA 1U2QA 1JFSA 4KV9A 5I7EA 4KHPB 1AKQA 3V1TC 4DR3B 1CW2B 2YN2A 2BEVA 1JWBB 2WWIA 3DO8A 1A1VA 1GL3A 1UJ5A 2AB0A 1EFUA 2BBTA 2ZAYA 3CCCA 3HN6A 3LCCA 3Q72A 3VVMA 1ENZA 3KT8A 4CIWA 2ZYUX 4AP5A 4NYIR 3T12A 1KYIA 4CW7A 3UF0A 1E4VA 1NR5A 2XF2A 4HWKA 1T34A 4UPDA 3U7QB 1Y3IA 4XD7A 1M83A 4ARZA 4PN7A 1MB9A 1TC2A 4XB6B 1G21A 3GD7A 1L4YA 4OQEA 1LJUA 5E4TA 3NVDA 4HDMB 4IEFB 4MLCA 3K0FA 2Q1YA 3IV9A 4NCNA 5EIFA 4FFLA 4LQCA 2GBPA 4KYTA 1VKJA 2LKDA 4JA0A 2CGEA 2QLFA 2MINA 5AW0A 1VKNA 2X58A 1NVWQ 2OGWA 3TG8A 5EZQA 1OHHA 3OM9A 7REQA 3SX0A 1W4BA 1EGMB 2AC2A 5E8RA 3RSSA 5AJZA 3SXUA 1VHWA 1U0LA 5HJ5A 2N3ZA 3SQMA 2A5JA 4GEKA 4U6QA 4PG8A 5ILQA 3KWLA 3GELA 5C8XA 1N25A 1RHMA 4MW1A 4JJZA 1N6PA 2VSYA 1T3LA 2AHOA 3DKRA 4MKIA 4BVAA 3JD1A 3OIDA 2ATXA 3IURA 1QK3A 1MVOA 1ORTA 2BI7A 1XRLA 2GJ4A 3WK6A 3BEOA 3FAZA 3PFGA 1QHNA 3