2CDRA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cdrA00
2XYPA 4N5DA 3EDQA 4DCJA 4DCPA 3DEJA 2XZTA 3K7EA 2CJYA 4EHFA 4ZVUA 3KJQA 4ZVRA 5I9TA 3GJQA 4PS0A 2Y0BA 2J33A 1BMQA 1QDUA 4JJ7A 4N7MA 3DEKA 2FUNB 4JJEA 4NOMA 2CNNA 4NOKA 4DCOA 4EHKA 5IC6A 4EHHA 1GQFA 4EJFA 2H4YA 3H13A 1RHJA 1RHUA 1K86A 3D6MA 1RWNA 4PRZA 2C2ZA 2HBYA 3QNWA 4HVAA 3R5JA 4AWBA 5IANA 1NMSA 2QLFA 4FXOA 1CP3A 1NMEA 3GJTA 5LUAA 1PAUA 1SHLA 1PYOA 3EDRA 2QLJA 3GJRA 3SIRA 4NBLA 2QL9A 2H5JA 2FQQA 4PRYA 3H1PA 5IAEA 1I4OA 1RHMA 2K7ZA 1NMQA 5IAJA 3ITNA 3V4OA 3KJNA 3R7NA 5LUBA 4QUGA 4JJ8A 5IBPA 3V6MA 3R6GA 4JR2A 1RWMA 4HQRA 2H65A 3UOAB 5IASA 1ICEA 2CNOA 2H54A 4QULA 2QL7A 4I1RA 3V6LA 4QTXA 5LU8A 2H4WA 3D6FA 5IBRA 1RE1A 1RHQA 2H48A 3V4LA 1SC3A 2Y1LA 5IC4A 5K20A 2AR9A 1RHRA 3BIJA 1RWWA 3GJSA 1RWXA 5IABA 4I1PA 4NBKA 2C2OA 4QUHA 5LU9A 1SC4A 2WDPA 3H11B 3E4CA 4HQ0A 3R7BA 4LSZA 1K88A 3PD0A 1I51A 1IBCA 4JQZA 4QUAA 4D3YA 2C2MA 4QUEA 1RHKA 1RWOA 4IYRA 4EHLA 4QTYA 3KJFA 4JQYA 1KMCA 4QU0A 4QU8A 2CDRA 2J31A 1JXQA 1GFWA 3V3KA 2XZDA 2HBQA 2DKOA 4AW9A 4FEAA 4QUDA 5JFTA 3SIPA 3H0EA 2XYHA 3NR2A 3R5KA 4QUIA 2C1EA 1CVRA 3IBCA 3D6HA 4NOLA 4PS1A 2H51A 3NKFA 4N6OA 4EHAA 2XYGA 3NS7A 2H5IA 3OD5A 3S8EA 3P4UA 1NW9B 1RWVA 4JB8A 3H11A 3PCXA 5H0IA 4N7JA 1QX3A 3IBFA 4N6GA 2NN3C 1QTNA 2HBZA 4D3XA 4AWAA 4JR1A 5IARA 1I3OA 3S70A 4NBNA 4ZVPA 3V55A 1F9EA 4QUJA 4IEFB 2HBRA 3UO8B 4D3ZA 4N6NA 4EHNA 4QU9A 4JR0A 4ZVTA 3DEHA 1RWPA 1RWKA 2FP3A 3P45A 3RJMA 2CJXA 2J30A 2C2KA 4EHDA 5I9BA 3R7SA 4ZVOA 1SHJA 4NOJA 3R6LA 4FGUA 5IBCA 2CNLA 3DEIA 2QL5A 2CNKA 4QU5A 4M9RA 2P2CA 2J32A 4ZVSA 1F1JA 4QUBA 3PD1A 1I4EB 1M72A 5IAKA 4ZVQA 2QLBA 4FDLA 5IAGA 1SC1A
chains in the Genus database with same CATH superfamily
3BWEA 4YLYA 1LI5A 3N8DA 3LC1O 4MVJH 2WUDA 2YHUA 1C9EA 1F8GA 4YAUA 3LC0A 5KTTA 3EVDA 1RLTA 2XR1A 2Y6UA 3KJXA 3MRTA 3PLNA 5TLSA 5C4GB 4P0PB 3W2EA 2GBGA 2O8DB 2A1UB 4RPLA 1HY3A 1JHOA 4PX5A 4OQ4A 2PCLA 3TW8B 1DKNA 1UQTA 1FQWA 1L6IA 2CJFA 3HDGA 2DC1A 1Z68A 3GJYA 2QT9A 3SF0A 3GLTA 3D2LA 2CXSA 2OM6A 2R2AA 3DOEA 4G81A 4XWWA 1P33A 4BC1A 1IB0A 4E21A 5BN4A 4FONA 5CAEA 2J4FA 2V0CA 4R0NA 4PLCA 5DLPA 1H3NA 1KJNA 2GCEA 5DP2A 3EA5A 1M1YB 1WTAA 5FX2A 2DR2A 4HNGA 2VUIB 1O6CA 2JARA 4G1VA 1ZM3A 1KSGA 1N6NA 1ISFA 1QGYA 1THZA 1NI4B 3IUMA 4DYVA 1PV1A 3G5UA 4J16A 4V2IA 1I5OA 1X70A 3H0KA 4DIOA 4HFNA 4R8RA 4AO8A 3U6BA 1AURA 2I1QA 2I66A 2Y1EA 4CTJA 5AVWA 2C59A 4B3GA 2FYTA 1JNYA 4Q19A 4KLCA 4PXAA 1P4SA 1VPEA 4YHHB 2IYEA 1N6OA 4RVUA 5CA1F 2EKZA 3FFWA 3LYLA 4XFDA 3SN6A 1W9HA 3OZRA 5D5HA 1QJCA 3EARA 3M2TA 3R7WB 3BMOB 3AR7A 4RFSB 4IZIA 3OX4A 2J6CA 4P3OA 4PXSA 2C9CA 2Y27A 1LVUA 2L69A 3NT4A 1UJ5A 2Q5LA 3PNVA 4DQVA 5HZGA 3BD8A 1BXGB 2WYWA 4RIFA 1OX4B 3ILYA 3CG4A 2VQ6A 3KJFA 3W6NA 3EQ7A 1V5FA 3QRWA 3I12A 2VF4X 3M5CA 1L1EA 4HV4A 1YS9A 2GEKA 2NWQA 4IM7A 1L5QA 1W25A 3T3IA 3LUBA 3AY3A 2HZ7A 2OQIA 4O02B 1ZMTA 2H2HA 3QF4B 4O1HA 1FDIA 2JIDA 3GOQA 4KE6A 2GZMA 5DGIA 3H1GA 1R8XA 3DMPA 1QG4A 4IFTA 3MJVA 4L8LA 2XQFA 1NE2A 2JCVA 3CFYA 1P5ZB 1T4MA 1BN7A 3OZTA 1BS2A 3L7BA 4QBTA 2J0UB 1QJ4A 1GYRA 3E9NA 4BB6A 4BNUA 4CKCB 4YREA 2XOKD 3M4XA 3ZCVA 1P80A 3L1UA 5ESXA 1YS4A 1VPVA 4L6IA 2AHOA 4AG3A 2XT6A 4PIVA 2EQBA 4FE3A 3ZJTA 1T2NA 1ZN2A 2IRWA 3ESBA 2W4IA 1VI6A 1HDIA 2DH5A 3L41A 2RFLA 4IJWA 2QD3A 2AT1A 4UPVA 3B1FA 4Q1VA 3KSMA 1R6BX 1VHQA 4XD7A 2QJTA 3M0EA 2OA0A 3OF3A 4P8RA 5JMWA 4WECA 3MQ2A 4QEDA 1UJCA 1B93A 2O5VA 5EP3A 2I7TA 3D4BA 4LVCA 3C4QA 1XTUA 4QOFA 1CEEA 3LKBA 2P2ZA 4H7KA 4QGHA 3OCZA 3MT0A 4RIEA 3N6VA 4GNRA 3PEVA 3C6QA 4FNGA 4K88A 2MIIA 4N54A 4CVNA 1BTOA 1O89A 3FNHA 4MV6A 1KOGA 3BIWA 3LY5A 1UBCA 2P0YA 1YRLA 3EAQA 3E9QA 4I1YA 4KR0A 2PQ0A 4QXRA 3VNBA 4G0OA 2E49A 1F5SA 3BUSA 1TX4B 2G8LA 4FLFA 4MAFA 3L06A 5I7OA 2WKRA 4N47A 4AUNA 3WMXA 2HWWA 4EUKA 2PHZA 3BF8A 1J2RA 1P1JA 3H8SA 4NCIA 1IHYA 3WISA 3ZY5A 3M9LA 4Z1MA 3TYXA 1XDDA 1ZVKA 4JBWA 5AVQA 2GNPA 4YJ2A 1WMBA 4MPRA 4MGIR 3M6WA 1VECA 2OO5C 4CHGA 5AR1A 3KQLA 2PUAA 2HLHA 1C0PA 2X13A 5JAPA 1ZXLA 2XQGA 4KIJA 3NOQA 1SHLA 2AN9A 1XZNA 3V8BA 4ARZA 3MGAA 1ZN8A 1LA2A 2XITA 4R83A 5I01A 3TB4A 4MX8A 3U13A 4TKVB 3TLYA 4YCLA 2V3VA 4H3VA 3SQWA 1T1EA 2VYFA 1JR3E 2VHUA 3L6BA 2C5LA 1UDWA 1Z5ZA 4OM8A 5DCLA 2FFQA 1YBFA 2G9VA 1O3YA 1ESDA 1EUDA 1IZ8A 1DG3A 4KQGA 1H2FA 1ZJ6A 3OE7D 1OAOC 5ICMA 3SXJA 3V6LA 1WUIS 5IW8A 3EIHA 3LBIA 3T34A 3ZTTA 2QK4A 2BHRA 2RBGA 5JXGA 5K20A 3SQXA 3EBLA 4QDTA 3TVTA 2PPLA 3AFOA 1MABB 4UNNA 3F78A 5LOVF 3MJTA 1IN6A 3C3PA 3PA6A 3SSMA 3WDSA 1VCIA 1YCDA 3GRKA 2H7CA 3IOMA 3EXIA 2R1ZA 2XZPA 1WSWA 1XEXB 4DA8A 1NZFA 2YJZA 4UU0A 2AVDA 5ERGB 2ZUWA 1U3FA 2TMYA 1VL6A 3K8ZA 5DM60 2FEAA 1Z63A 1I94B 2XI4A 4FZ5A 3N5KA 2ZSJA 5A3JA 5BW8A 2Q8PA 4LK2A 1F8UA 3NBYC 4B3SB 1I7NA 3A7DA 5AVRA 3O2JA 2W8BA 2X7XA 1FFSA 2Q45A 3HUDA 3FPJA 1WETA 4MR8A 1H1LA 5K8LA 1QIHA 2B4TO 3W3AA 3NYQA 2HAEA 4RVGA 1E5VA 4JQSA 3VX3A 3K0SA 5HMLA 1CEXA 3OUUA 4DMCA 1PX0A 5LDHA 3DYBA 2FN3A 1LWNA 5G02A 1QO7A 3P20A 5BURA 3HCFA 3P19A 1NUSA 2AFHB 4O2AB 2FPXA 3IEIA 4AF6A 4QPPA 3HXLA 3KWJA 4Q34A 3GBSA 3BEOA 4UVHA 5D8DA 5E4TA 3W8DA 4C7BA 4NAUA 1JB1A 3S2IA 2QBYA 3N0RA 4TSFA 1X8KA 2PZEA 2YJNA 3MSXA 2C9BA 4NHOA 2XX3A 4UNSA 2BTEA 3WGLA 2ODQA 3G2HA 1PJ8A 3EASA 5KTMA 2ONZA 1WLSA 2NVOA 2OXIA 3AY6A 2PKQO 2E6UX 4GO1A 3PSAA 4TL7A 4ZT2A 2H07A 3B1YA 4L78A 5B1SA 4UD6A 3K70D 3QQPA 2QXTA 2D62A 3QU9A 3OHSX 1YZLA 4QJIA 4KQJA 4LZWA 1E2EA 1R8QA 2H8KA 4CL2A 3Q5GA 4EUSA 4FSHA 4B81A 5A4DA 3B6IA 4S1TA 4TZ0A 4KC0A 5ALVA 1GL7A 2IEDA 3BGIA 4Z4GA 2NU9A 3LX5A 4NL4H 5L9AA 2V7EA 4ZOQI 2C4NA 1RI5A 4AI6A 4ICIA 3RWBA 5I48A 5KYKA 4UHDA 4FNMA 1NVFA 1PZEA 2PBFA 1XVLA 2H7VA 3WO0A 5JATA 1Q57A 1TZJA 3HV2A 5K6AC 3ZHQA 5KBYA 1VMAA 1AY0A 1C0LA 4JEIA 4JEUA 1EWVA 2C2ZA 2GJSA 1R6DA 4YMGA 4RGVA 1S8OA 3U4HA 1U65A 4TTQA 3RUHA 4GS5A 3MCVA 4GNKA 4JDPA 3MZ0A 3V2IA 1UBFA 2ZAMA 5HVNA 2IP1A 3EHDA 3I2JA 4G1UC 3LOQA 1NUTA 3DFMA 2QXYA 2CSXA 1WW3A 2FMXA 3UK2A 4MVJD 4Q00A 2JGNA 4MW0A 3PI7A 3PTAA 2FRDC 1GP2A 2VHWA 4K6OA 1Y8RB 3EIUA 1VMKA 3HI4A 3WHLA 1C7JA 1JYFA 1T8UA 4HQRA 4V0RA 5EJ5A 4KDCA 4H7IA 5BR8B 4GWGA 3R5FA 1Z33A 2UYHA 4WACA 4NDZA 2H48A 3WXBA 4M0LA 4YC7A 1E1KA 1AM4D 2OUIA 1EUQA 1NYRA 3OPYB 3CPEA 5H81A 4MIKA 2QKYA 2X2PA 4NCBA 1RLIA 4UBJA 3SYLA 3HK2A 4IUDS 2Q6OA 1GPDG 3ABOB 5CX1B 2HD4A 1H1DA 4RTOA 3MWJA 4HVCA 3CV3A 3W34A 3SZGA 2RGDA 2BMJA 5F2EA 4D9MA 1TGYA 4JLOA 5EUBA 4LF8B 1L5VA 2GWRA 3BWYA 5DM70 5JQGA 4FINA 4CIXA 4OMCA 4MA5A 4RY8A 4TVBA 3KJEA 4IHAA 3KAKA 4Y9RA 1TEVA 1V7PC 1ZJZA 4MTCA 3L1IA 5FWXA 3U49A 2R25B 1TTHA 5JNUA 2DWPA 3ECSA 3TLMA 2PMKA 4JBIA 1IHDA 1PJTA 1S7GA 3WWPA 2XMCA 3WV5A 4CLOB 2XWBF 4D9NA 1EFUA 3UAOA 1JHZA 4MQEA 5KHLB 4L3VA 4RGBA 1OI3A 1JG3A 3IXMA 2OAGA 1LJ8A 1SG0A 4PYKA 4QYTA 3W5CA 3U4QB 4FK8A 3EVNA 3AM5A 2IHTA 3M4NA 3IH5A 5BSMA 1JZQA 1P73A 3MERA 4P22A 4CXMA 5D00A 3L7DA 5DYYA 4N7JA 5TT1A 1NLYA 3RQSA 3BA1A 2DFNA 1XTJA 1GEEA 3V8NA 3AESA 4DY6A 1O6GA 2FEXA 4NU6A 2IEYA 4CQMB 3I61A 1Q44A 5J40A 4CKWB 2NOAA 3G5TA 1KI4A 1RLJA 2B5OA 3G2MA 2R8XA 1PVDA 3HH8A 4Q7JB 3JATA 5CVUA 1JEYA 1EBBA 2VTEA 3GA7A 4CFSA 2O3TA 5KQMA 2X8LA 2DPMA 1FYXA 3SC2B 1AHIA 3OCWA 1W52X 4QIHA 5AICA 4QHSA 4W7SA 1FMFA 4EG4A 2H0RA 1D1PA 2I33A 3DZIA 2IDMA 1OE0A 1Y34E 4CWAA 2FUKA 3C6ZA 4XAQA 2P6RA 5BV8A 2D3TA 2GZRA 1J7JA 3G2OA 1QDUA 2ACKA 3BE8A 1Q50A 3BREA 3KPJA 1BDHA 1G2QA 1O57A 4KLRA 3ZK8A 4EFKA 4JLDA 2G9QA 1QP7A 5FR2A 1NVGA 1KJ9A 4XCVA 4JK3A 1AQ6A 2P75A 3DDWA 2ZDQA 3C4JA 3TF5A 1LLUA 1NQ5A 2OKCA 1BQ4A 1KYTA 1YR9A 4FMDB 3HG7A 5JW6A 3FF4A 3IUJA 5MN4A 5KYUA 1IEVA 3ZS9A 2ZT8A 5B3AA 4AT1A 1Z38A 2BKEA 2WAMA 1YTLA 1KAEA 4R6WA 4YMIA 1IK6A 1DC6A 1ZCZA 2ZWIA 4XSVA 2FMIA 2I4NA 1XQ6A 1MEOA 1C80A 1YE3A 1ZG3A 4G89A 4LHXA 2PSSA 2NGRA 5BR7A 3SM3A 4KO1S 3A9UA 2A88A 2F9LA 4HZUB 1N7GA 2RKWA 3TX6A 2XUAA 1ZIYA 4HDRA 5ESWA 2P4UA 4M9CA 5ITZA 3LKZA 1TVCA 4RIHA 3PX3A 2HCBA 4UCQA 2V0NA 5LA6F 4NSNA 1REQA 4D46A 3ZY3A 4DQ0A 5KQLA 1DHRA 3KFVA 1AUPA 2NUPA 3A4VA 5LBTA 4TKMA 4XUEA 5GM1A 3HP4A 3V33A 3K0EA 2FK8A 4QGFA 1IQUA 4CL0A 1Q0QA 3PNQA 2JLAA 2BCGY 4TX1A 4LJAA 4TL6A 1KDOA 4UPEA 4CIAA 4X61A 5DNUA 2Q2OA 4MEBA 1S2GA 2QQEA 2CHVA 5A3VA 4F45A 4Y1GA 2DQKA 5B3LA 2G63A 3KZXA 4ZGGA 4EHJA 3BB1A 2PXAA 3CLKA 2FSVC 1PHRA 2XVAA 2YOHA 2GTHA 3CKYA 3MBOA 2HCRA 2ZSFA 3L8HA 3Q9SA 4M1KA 5E6SB 1SJ9A 4KO4S 2EF1A 4Q3CA 1KJZA 4TXLA 3RBZA 4ENVA 6GPBA 3ENZA 5D6NA 3WA7A 4FS8A 4L9AA 2AN4A 2WTXA 3OZWA 4GBGA 2ATVA 4LTMA 1SXJC 1LLQA 1V5IA 3SEAA 3CSDA 3A7EA 4CMKA 1ZO8A 3U3XA 3EDMA 4G37A 2G36A 4OBXA 4ND1A 4ZFNA 4H4EA 1T4CA 2ZBUA 2ZJFA 3LQRA 4Y6SA 4URVR 2PV0A 1B6GA 2I34A 2Q27A 4PS1A 1TO6A 5KJ1A 4DR7B 3A28A 4NAVA 2SKDA 1RXVA 2C82A 4XTRA 4XIJA 4XX0A 4B3XA 4HAOA 1SUEA 4RMIA 1OH5A 3SQMA 2ZUBA 4LVOA 3JVUA 2D2EA 2A30A 3OU7A 3GDFA 2IOYA 3V2HA 5JG7A 4GYJA 2I8CA 3TINA 5COQA 3LRXA 1P2DA 4CUZA 4HC4A 3IUEA 4X54A 3TTSA 4F21A 2W58A 1CUAA 5GZ3A 4RULA 5IHXA 1DUVG 1JE0A 4J4BA 3GFTA 2ZIVB 3O26A 1GZ3A 1P29A 1QH0A 3FSGA 1NBMA 4XD2A 2O52A 4I4CA 1LTKA 5HBRA 2G77B 2BOVA 1DBWA 3MGBA 4OAPA 3I45A 2JGDA 2JIMA 2CW5A 3NKLA 1HO3A 5CVVA 1HV8A 1SHJA 2QTCA 5IN4A 2TRSB 2LE0A 3JQ8A 2JI4A 2GCNA 1HYGA 4RTLA 1RC8A 1X2BA 2PNJA 4ENRA 5BN4B 2A6PA 4AKHA 3A3OA 4MW7A 4FD2A 1DGQA 1H6CA 2ALJA 2IYFA 2WU3A 3FWPA 3QY9A 1L5KA 4AO7A 3H4TA 5BRNA 1COZA 4AY4A 1QRSA 2RONA 1VYVA 4N4AA 4OPMA 2R4TA 4ZWNA 1JYSA 1XMJA 1T3ZA 2EGHA 2HWXA 1VP3A 3CB4A 3FPHA 1Y80A 4ZIRA 1X86B 1LTHR 3WSWA 2X40A 3ZCUA 5I9LA 5A4FS 4YMVA 1E1RD 1XSEA 4I8DA 5FUMA 1COWA 2WAXA 2G1UA 2WHXA 3GLRA 4IO0A 1V47A 1QV9A 3BXHA 2QR5A 5ILOA 5TX7A 2N3ZA 1CIVA 3PZRA 2QE7A 2XHEA 1RAGA 1IDOA 3T1NA 2XCUA 1O9BA 1JKJA 3KBOA 3U44A 2FWNA 4DC0A 1ODKA 3EIXA 2MWMA 2C9MA 4RK1A 1ORIA 3AUUA 3HB1A 3WL8A 4BO1A 4CQNA 1KH3A 1AO3A 4ZDWA 1JXAA 1OREA 1TB4A 3P9RA 4NNJA 4I3GA 3VO8A 4PGAA 4DDKA 3G9UA 1YO6A 4WWHA 1FNBA 3KKOA 2QRQA 3GRUA 4UU1A 2IYOA 2QRGA 1LZLA 3KKZA 1MO6A 1CRQA 1M7HA 1E2UA 1A5SB 1ACLA 5E3IA 1NXOA 1SO8A 1QORA 3H9BA 4BVAA 1T3GA 3WIUA 4W9RA 1T3HA 4NCAA 3SDZA 4HDOB 2QLMA 3H1BA 3OOYA 1QGZA 4C08A 4LAFA 1WXDA 1G5RA 3BIJA 3I3SR 4KLZA 5AD1A 2P27A 2VHEA 3CLTC 2O8FA 1VE6A 4HOYA 5BN1A 2LTAA 2KS6A 3BYZA 2QVBA 3INNA 3LDAA 4BFWA 3DYIA 1CK4A 1I51A 2QUIA 3P7MA 2E55A 3FDXA 2R66A 5IT4A 2ENUA 2OBBA 3DNMA 5HF6A 4B6EA 4F2WA 5KX5A 3DONA 1CE8B 2F1IA 5HFAA 1N8NA 3QVMA 3AWIA 3F1KA 3MUFA 4E09A 3OOJA 3H5LA 1V5EA 5LD2C 3JQGB 3KSBC 3KALA 3LLMA 3EPJA 3QPVA 4DHWA 5KU1A 2CVPA 3UCEA 2Y99A 1P1IA 1E2GA 4JIMA 2W7TA 3THXA 2IHKA 4XFJA 3UT5B 3BSWA 1U1DA 1US8A 1OI2A 1R8SA 3FBWA 2PZAA 4WUTA 1QB8A 5AYVA 3WLNA 4PYQA 5I7HA 5KNCH 5THKA 3GVPA 2P40A 4BWYA 2BM9A 1UUFA 3NH6A 3PFFA 3R23A 1C1YA 2VYNA 4HFRA 1Z6GA 2P9JA 4NJMB 2P6OA 3THWB 1EBUA 5ECWA 2A3RA 4Y2UA 3ZCSA 3GH3A 2R44A 3IR5A 1UEXC 13PKA 1P4HA 4OIMA 4BQPA 3IA7A 3QNMA 1L7OA 2OHIA 1PL8A 2C94A 3GWZA 4XFKA 1ZD9A 1PT9A 1NLUA 1RWKA 3H19A 2WF9A 3DT8A 3LX4A 4TS3A 3BXPA 4WK0B 2NT4A 4KE8A 4A36A 1IXZA 1YQWA 3N75A 4KQCA 2F9FA 2Y0EA 3M34A 2RC6A 4TROA 4U8HA 3V7WA 2YXLA 4LEIA 3RB8A 3ZTWA 2JKVA 3U7GA 2PEYA 4FHEA 5AW5A 4A23A 4CE6A 3O9ZA 1NBOA 1G6HA 1W2GA 2QYSA 3DCJA 4GKVA 1NF3A 1Q92A 2PMWB 4EHBA 2UYYA 2HRDA 2NZUG 3CQ9A 4LMAA 5JMPA 4JYPA 5F7OA 3T7KA 4EY8A 4YV7A 3IQWA 5KJEA 1K27A 2WTUA 1E7SA 1QHXA 2DECA 3AEXA 3AY0A 1GZVA 5H59A 4ARUA 4NZOA 3ROPA 3FZYA 5AJTA 1EUDB 2QMQA 2J4CA 2QZZA 3CJQA 4GC5A 3U48A 4C89A 1B23P 4PSAA 2IUYA 4UOQA 1DARA 3D6MA 1S7CA 2XNDD 2LDXA 2X8BA 3HJCA 1HQDA 16PKA 1WZIA 2A33A 4ND7A 4CKEA 3NJ4A 2IOFA 1U8EA 5CGZA 1K6JA 1W87A 1YB6A 4E32A 1X7GA 3LL7A 1XVAA 1W94A 2OFXA 3FGPA 4WK2B 3ZN2A 1APBA 1H1TA 2AOUA 4GMFA 5F1PA 4FGWA 3UWKA 1I3LA 1PSDA 1TM7E 3H1AA 2VJMB 3QTLA 4FHZA 1SULA 1ULSA 3I2GA 1KO1A 3Q10A 1Y6RA 3NHRA 1KYYA 1FJHA 1J99A 2D59A 3CZRA 4MKHA 3UNXA 1TVMA 4NEQA 3QE3A 3IKMB 2GARA 5EHGA 4BB0A 2QVYX 4XWOA 2CUNA 2WTEA 3OWHA 5BT8A 4BGUA 1ZI6A 2W8BB 1UC8A 2XOKA 4HNAA 4BCBA 1PE0A 1QB7A 4MR8B 2NZXA 1R10A 3WNBA 3LD9A 4B71A 2PMBA 1VOTA 2ZYVX 2I2WA 1JBKA 4YJGA 3H8JA 4LHYA 4CG3A 1OFIA 1P91A 4S0ZA 4ZHQB 2XGOA 1P1CA 3GQBA 2VAVA 1I01A 4M7OA 5HF9A 3ETNA 4KN6A 3RGGA 2HJ9A 3TIGA 1E1CA 1XZHA 4JEHA 4LDNA 2IEAA 2OCLA 2NNLD 2ZYSA 4XQ0A 1DQZA 1E6MA 4AKIA 2Z5FA 4FHFA 3AR5A 3FFAA 1LB1B 5BPFA 4DUYB 3IDOA 1NASA 3UYLA 5JEEA 1AX9A 4H7PA 4DTCA 2X3FA 2QBYB 2DLCX 2D0DA 1BRTA 2W6CX 2JHGA 4TUYA 5DCYA 3R3XA 4AS1A 2DFDA 4KJZA 3B9BA 1VL5A 1NJ2A 4JXXA 1BYIA 1YQUA 4QWMA 3UJ9A 4E5UA 2GR9A 5JSQA 3ELUA 3P71T 3L6CA 3LCJA 4YMSA 5EXEA 5JS7A 4V3BA 2QT0A 1VI5A 2H17A 3I2FA 5ALTA 4YUXA 2BUAA 2H51A 2X23A 3H9UA 4RZUA 5JH7A 1JWBB 2GZ3A 1JXMA 1T8TA 2H5IA 2B1IA 3KFXA 4LYFA 4UVGA 3RV3A 4B4DA 4INJA 1PTKA 5BSEA 5J2TB 1QU3A 3P52A 3NC1C 3PCXA 4YQZA 4BEJA 3WAGA 3L9WA 3NVMB 4IRXA 3OMWA 2WICA 3UHPA 3TL6A 3I2IA 3W1VA 2OY0A 4BNTA 4G8BA 3L4BC 3W5AA 4U3JA 4HLDA 1XTIA 4JAVC 2ZJZA 4XVRA 2ZWMA 1M67A 2O2CA 3GP3A 1AZLA 5IJWA 4LWPA 2PMFA 3JWHA 4DCSA 2GTIA 1T9DA 4UFPA 1YDHA 4L4XA 1I32A 2EZ4A 4IZ6A 4MUYA 3H5OA 2V59A 2FUG1 2JLWA 3G5MA 1QMPA 1S2LA 3W9BA 1E62A 1LPSA 3QVXA 3KO8A 1C3LA 1BX0A 3LLVA 1U7TA 1X7XB 1LVHA 5I8WA 2QTZA 4DN6A 1SKBA 1ZONA 1YC2A 3DT6A 5TXGA 1BGXT 1XXHE 1U9JA 3OBBA 3Q6MA 4M1WA 1TYAE 2OFOA 3A6LA 1RIFA 3QI2A 4FR2A 2H4XA 5GM2A 4FGLA 2Q2QA 4J9VA 3ZHVA 3KOYA 1JDJA 5AW4A 4G0WA 2XE4A 3B3JA 1FLNA 2CBZA 2IZ0A 2HEGA 1XLUA 2V7UA 3CMCO 3IEUA 1H23A 1WKBA 4PBSA 5DH9A 2CMKA 2P9GA 1QRRA 4CLXA 5E9JA 3TJZA 1E8DA 4KYUA 1T4BA 2GD2A 2VZ8A 1RS0A 1Q6ZA 1VA5A 2AG0A 2JI8A 4OQMA 5CUQA 4ZREA 3QEAZ 4JJFA 3EG5A 2NUAA 2XQIA 4XUDA 4ZV4A 2E5LB 3BCUA 4KREA 1T8WA 1QH8A 3KDSE 3OM1A 2RHBA 4EKYA 2EAUA 1YJQA 5ER9A 3I37X 1N6HA 5HA5A 5JXWA 3RC8A 5M7EA 3EDRA 5DGCA 4L9WA 3FCAA 1R16A 3BMNB 3EQ8A 5A03A 3AVUA 2GRJA 4GGMX 1KQNA 1J8YF 4W5HA 5M2QA 4LYDA 4P58A 1Y81A 4Z5XA 3C5WP 3B1JA 1MH9A 4MMYB 3ZNPA 1EHCA 5JQGB 4UHCA 1KXJA 3SMVA 3VR0A 5EE0A 1DC3A 4Q7MB 4OFWA 1FRQA 4NJOA 3V1LA 4EFLA 1INLA 2CUTA 2W2NA 4DSOA 5DIFA 5CXQA 3KSAC 1DE0A 1CDDA 2DT5A 2VJCA 2VR1A 3E23A 2QS9A 4KJXA 1UMCB 1W6UA 3FDJA 3O82A 4MI6A 3EZ2A 1SEPA 3OSZA 1FTGA 4NHEA 4ANFA 3CZPA 2IE0A 1AUVA 2VJLA 1E77A 4IGAA 1CQPA 5SYAA 5KVQA 4EZIA 3I8SA 3VVBA 1CNEA 2H1RA 3WLQA 1A50B 4K3VA 4ZVLA 5IAAA 4DR6B 3T1TA 2FOXA 1Q74A 1UXOA 1KZ4A 2BJWA 2ZZKA 4FJ0A 3UB2A 2OSBA 2R1VB 3LW8A 5E6UB 3DLBA 1GFSA 2OPBA 2NZVG 3AF0A 5HK9A 5E7MA 1DTEA 1NVVQ 5A06A 4II3A 1JEYB 1FRNA 1NFRA 1QSGA 2FQ1A 2JG3A 1ORTA 3V8QA 4JVNA 4I5EA 5C7IO 1NN5A 1ZMXA 3H5NA 4YLEA 1EWQA 3WS7A 1BOFA 4BJ1A 4DG5A 3AHGA 3ESZA 2O2IA 2JDID 4FYPA 3G5LA 4BWGA 3AJEA 1NOKA 2YQ4A 1A88A 4JLVA 4YJDA 1I6LA 5GONB 2HHAA 1VXOA 3C5EA 2GHQA 2X77A 1KWKA 2C2HA 2JNWA 1Y3DE 1EFTA 2N9UA 4TYYA 5EG5A 4CZ2A 5IYZF 1R6AA 3SE0A 3IKJA 3KWLA 4MWEA 5EWJA 5BUQA 4LSGA 4HD8A 2A4MA 2HREA 4X64B 1N8SA 3IVAA 2ZXUA 1ACMA 1N4DA 5TPZD 3VH2A 1SOVA 1TLTA 1WEHA 2W2XA 5ALZA 3FROA 2F62A 4ZPJA 4DLNA 4EZEA 1NONA 3C5VA 4MVJA 4DZTA 2FWIA 4KLNA 1PR1A 1U8YA 1QG0A 3R4VA 4ESVA 1T0UA 5K0EA 5C2JB 1NWCA 4IV0A 4K9MA 1XLTC 2GO7A 1RYBA 1Z6ZA 2WABA 2WWGA 1L4YA 4JSTA 4PNZA 4C4OA 3CLRC 3IMGA 3CZAA 5E8RA 4CLHA 1BE6A 4ZEVA 2CLFB 5I6DA 4MUMA 1K7YA 5KNCD 1IN1A 2HRCA 2R86A 1YMVA 3UA4A 2Q21A 5ITZB 3WL7A 1F4PA 2EEPA 3TAHA 5CT9A 2FEMA 1KAQA 1REQB 2NZYA 3SYMA 2J3DA 4C4XA 1V7QA 3C85A 2JHAA 1UT6A 2ILTA 2F43A 2FG5A 5K8UA 1LNQA 4F96A 3NNSA 3JQ9C 4FFBA 1NX6A 1XA0A 5GZ1A 4HVAA 3IC5A 4CIYA 1R3DA 1QHNA 3II6X 1O95C 1H6BA 4LXYA 5LMCA 1GSOA 3Q5DA 4E5DA 4AG5A 1O4WA 1NMEA 3Q8MA 4CTMA 3THRA 5BSRA 4EUEA 4HNTA 1CJCA 1FYWA 4NYMR 1GZSA 4XQEA 1TMGE 4RETA 1NBHA 4BDTA 3L04A 4FZVA 1AQUA 5KNDH 1CZHA 1M2OA 1NW3A 4WD3A 4JC0A 2J87A 3UAXA 3UK6A 3PUXA 4DV7B 1DEOA 2YNMD 4RA6A 2O2EA 5TEVA 2CFCA 2D4HA 1AK1A 3C3JA 3R7NA 2WIKA 1WXEA 2IPLA 5IASA 4G4JA 4KXWA 1Z2DA 3CVYA 3U7JA 1JT9A 3AERB 4AYTA 3NHLA 2MMGA 2YJGA 3AFIA 1DO8A 2XGMA 2RDMA 1T6YA 1T4CB 3QI7A 4IFEA 5EUQB 3JZIA 1HG0A 4MRMA 1VKHA 1HNZB 1AXRA 4CV3A 2B83A 4KUEA 5EJIA 1U1GA 2BGIA 1N2IA 2Q1WA 4O4JA 2FQWA 1D7AA 2HU5A 2NSHA 4F9FA 1PK9A 5L45A 9GPBA 2A7XA 3I5MA 3HB0A 4S3MA 5EQTA 3RRJA 1NG9A 2QTGA 3HR4A 2RGYA 1KP2A 4F5DA 5U4XA 3I72A 5J4VA 2O2ZA 5F5XA 5H1YA 3R20A 2QRUA 4G65A 3T5AA 1X8XA 2EFJA 1PU2A 4H59A 5AHRA 5FV7A 2FVYA 2JGDB 2WE8A 3G7SA 2IYXA 1R3UA 4YUAA 2IS1A 2AG8A 1T1SA 2JBAA 2A5FA 3AHEA 1RRVA 1S9HA 2ZB8A 3ITDA 3QPWA 3JYNA 4F4UA 3LWBA 1W5AA 2FX2A 4NBTA 1SZJG 5KVCA 1LBEA 4JVSB 1GTMA 2AXPA 1E32A 1VJ0A 1JDVA 4DLYA 2O0MA 5AQ1A 1SQSA 4IIJA 2H1VA 1KY2A 1WOMA 2JS7A 4PQYA 1A9QA 3ITEA 4QELA 2OXTA 1PR9A 2ZLBA 3CT6A 1JEOA 1FRFS 4RHUA 4BFSA 5IAOA 3D5EA 1J97A 4V0MA 1CF2O 3IUNA 1UOPA 2DKFA 3RIGA 3R6WA 3V2UA 5JD5A 1BDJA 2CLOB 2CLDX 1K63A 3BULA 2NP7A 3VJMA 1I5EA 3WK8A 1HUQA 1T15A 2HIAA 4QKQA 2BGGA 2C07A 2IHZA 4A2WA 2XE7A 2ZSAA 3Q1KA 5DXJA 1KJIA 1MO3A 3M6MD 3PQ3A 4OU4A 4C7VA 2WG2A 3ZQ4A 3DEIA 2E6KA 3FMPB 4TMFA 3TI9A 2ZSEA 1M2WA 2RGWA 4FDAA 3TQQA 1JKJB 1T2UA 3ESYA 5ELLA 3WP0A 1UFVA 2AUMA 2QPTA 1EEHA 1NZDA 4P08A 3EUAA 1BVUA 1AKVA 1DJNA 1Q0ZA 3L7MA 3GFQA 1YJ8A 3CTPA 5FOWA 5FT9A 3DE6X 4JUDX 4YRTA 4P3XA 1E7RA 3GLGA 1NFQA 5LWQA 2XLCA 3I5YA 4D8YA 3GDHA 4KVGA 1OX5A 4YCNA 3IUBA 2YV2A 1TZMA 3DBHB 3IIIA 1MB2A 3ITKA 4UBMA 3RBVA 3GFSA 1PJ3A 2X0NA 4BYMA 1ZK3A 5LLDA 2R2GA 1JPJA 4AJPA 4Z8YA 1DDOA 2ZBPA 2JAWA 4IXTA 5EGSA 3RT7A 3WX0A 5K8IA 4RJ2A 3X43A 4UQLA 3PJRA 1E5QA 3PGLA 5C18A 3LGAA 4G63A 4LJ5A 1YZTA 2XUZA 4HNUA 2AN3A 3HKEB 3X1KA 4MLDA 1XGKA 1ID1A 3ORSA 1HWYA 1RC1A 2SICE 1NATA 2Z2IA 3KEQA 5JVDA 2WJZB 4ZCQA 4MEAA 1URPA 2VOJA 3KC2A 5I47A 5FUVA 3WSVA 5JY6A 4Q48A 4AJEA 1TUBA 1DS6A 3V8EA 1DHTA 3ZGZA 1ISIA 4J43A 1K97A 2IEGA 2AFIB 3QLJA 5J63A 5HNKA 1O2DA 2Q4BA 3UFXA 1JBQA 4R3NA 1TCVA 5D51S 2G0NA 3RSGA 1DKLA 1XXLA 3ZQKA 2CUKA 5D3ZA 4QXAA 3CNHA 4F12A 4LBYA 4QJ4A 1DRJA 4U0JA 4AURA 4E4TA 1PV4A 2IXDA 4L4UA 1ZH2A 4DA4A 1M2JA 1K3UB 2VK4A 3F7TA 1ZCBA 3QLTA 4PCAA 2UV8A 1M6YA 3PB3A 3UKOA 3MBKA 1DDGA 1OYOA 1TIKA 3CX3A 2KB0A 1L4BA 1Y6JA 2X7HA 3HU3A 4W4TA 5I7WA 2VATA 4PC2A 1K8XB 1JQAA 3BWVA 3STYA 1EP2B 2O0KA 3TOSA 2AC2A 5CU7A 2MR6A 2B21A 2CDRA 1U4NA 2Q3EA 3E7PA 4XJSA 1JEDA 4Z6KA 2BFDA 2A9RA 1UXGA 4NCXA 4RENA 5T4FA 1FFGA 2BFWA 4Q37A 2IE8A 3S6JA 4CLEA 1FU8A 4G5QA 2OESA 4IL5A 2BBSA 1OBFO 4MP3A 5DWVA 3BXGA 3VC2A 4QM7A 3IBCA 4Z3DA 1THTA 1NOJA 4RESA 3RLFA 3CPJB 3MRVA 3HDJA 2OB1A 4ZZ2A 1VMIA 1BWRA 4OLHA 4M76B 3TR5A 3RTAA 5K6TA 3PA8A 2NP6A 2IYZA 2Y4OA 1OKKD 2Q28A 3HBMA 4EW3A 5FUXA 2OUKA 1ZITA 2WWWA 2XQKA 1E3TA 1PEAA 4QNRA 3UATA 4DSZA 5KYYA 1B8NA 4HTFA 2H85A 5FOSA 3O4HA 1RRFA 3COJA 4GZ6A 5HJ7A 5CB4F 2NTVA 1IMJA 1XTQA 2C0PA 5HQ3A 1VP9A 3RNLA 3T9CA 4GOJA 3P9SA 4RY2A 1SRQA 5AFSA 3QHQA 1NLMA 2POQX 1E0DA 3A4YA 1N0IA 1AC5A 2DULA 5EGNA 4NS1A 4P31A 4WZBE 1DFHA 3HEAA 4HYEA 5SY6A 4QDXA 4CKEB 1N78A 5AUPB 1DMRA 1CUDA 4FDVA 5HUJA 3S68A 1ESMA 2PKEA 3L7OA 2I4OA 2AOUB 4TSRA 1ITZA 5LQAA 1LXCA 4ERXA 1QHEA 3DUWA 5CG1A 3VZSA 2EHJA 4IR7A 3RD5A 2X5OA 3S7TA 4OJYA 3NU1A 1XUOA 4DMKA 2GK4A 4LDZA 1SQ5A 4WXRA 3CH5A 4ZARA 4TT8A 5IP5A 4YO7A 1EPUA 1YQGA 2RGRA 2G4VA 2Y67A 1JAXA 1HI9A 3AOGA 5K0TA 1B0ZA 1C8LA 1GQFA 2QZ4A 2YDXA 3C8UA 3GMSA 5K0SA 5DNYB 4ZO7A 4NULA 1G8HA 4YJGB 1S8NA 3C3EA 4IIGA 4YJFB 2BR4A 1AZWA 3OH8A 1SUIA 5IWCA 2FVXA 3GQBB 2QQ0A 4ZYYA 3FBGA 4LS3A 1TCBA 1YC5A 1Z4IA 5KQPA 2ZJ7A 2X22A 2ZIXA 3G5AA 2Q3CA 3SIRA 4BE9A 2WV7A 4KO2S 4KMOA 1B1AA 4JEMA 3L8YA 1KH2A 3GB9A 4FKMA 4B3BA 5DGDA 3SICE 1E3LA 4EI2A 3ORHA 2BGRA 2GF9A 2QP4A 2ZKIA 3GLHE 4TUYB 4PIPA 4CMJA 1I4LD 5A1TA 5BSVA 4DE5A 1DAGA 4NZZA 4ASUD 4DABA 5A5VA 3CNNA 2X86A 2HRRA 1SEVA 1BW9A 2P35A 1AN9A 5SYMA 5IVPA 5B6IA 4TTPA 1ZRSA 4URXR 1Z8DA 5HF5A 2HMTA 2ZBRA 1R9JA 3GGDA 3N2LA 3UOWA 3VYUB 3WB9A 5CMLA 1MX9A 2B61A 2GZHA 1PR2A 2ZSUA 1RWWA 1B41A 2MSNA 4K2HA 5CK4A 2WNIA 1Y9ZA 2N42A 1I9GA 4X24A 4JBHA 1IUKA 2GPYA 3D3JA 4NYIQ 2FOIA 4Q6BA 4C0LA 1MQ9A 3Q12A 2PT9A 1UXJA 5KNDD 1LUAA 1UDAA 3NWJA 4HAXA 4UNQA 4U3JB 5AWFC 3ZDXB 5KVSA 3IPYA 2VHZA 4GOLD 4KWHA 5GJVC 5D6OA 3PRYA 1JKMA 1O08A 4MDEA 3W7VA 3MD9A 1R64A 4EUFA 4Y2YA 4L57A 2PL5A 3CRVA 5A4KA 4S1WA 2PX5A 5ECYA 3RUDA 4AP5A 5L4NA 1EJBA 3IP5A 4F9EA 4EMTA 1N5DA 4CFYA 2PZKA 4TOIA 2II6A 3G9QA 1UWVA 1GDTA 3E9RA 5GPBA 4DCUA 3MG9A 5L4LA 1NPYA 3RRMA 1TZBA 4BRZA 8GPBA 2CF6A 4ZI7B 1VFNA 4YS6A 4D2IA 4MQFB 3V00A 3OC0A 3VR5A 1SXPA 4L8YA 1R0ZA 4H35A 3HM9A 4JBLA 4M89A 1WQ3A 3AM4A 1KO7A 3IOYA 1N8TA 3KTAA 1UBGA 1RRPA 3ENWA 2B9EA 1RWQA 2ODNA 4MS1A 4XQ9A 1CFJA 1XMXA 5AW0A 1X2EA 1HDEA 1M2HA 5HFNA 2IEBA 4IYJA 1JDUA 2RBEA 3OP4A 5DHQA 4ESOA 3OT1B 2B6NA 2WDZA 4KB5A 1R0BA 4B5KA 5CM2Z 1MAHA 2C8LA 4BPBA 3P45A 1YD7A 3U7HB 3EMVA 1L5NA 3FPLA 3IV9A 2J9GA 3UK1A 4FGUA 4FN5A 4GLJA 5FORA 2VHXA 2BMEA 1QH8B 5C35A 1N9ZA 2ZJ2A 3ELYA 4N3AA 3I9LA 4Y2TA 3RH0A 2C1XA 1A8SA 2PE5A 5EIXA 4M22A 3DP7A 5CT8A 2CVZA 3AVTA 1DT3A 1T5DX 3EGVA 3GGSA 4W5WA 1XALA 4AECA 1HTWA 4KXVA 2Y68A 1JFLA 1DC5A 4HAUA 3O03A 1R7RA 1YQEA 2RHLA 1P6UA 5ERYA 3HFSA 2Y8EA 1SCUA 3IIJA 3PKZA 4KPFC 5JMOA 4J0GA 4H6VA 4RK6A 3P0RA 1RTTA 3JD3A 2NSYA 2Q3DA 3PTLA 4IKEA 4PHGA 4QQNA 3IL2A 1KY4A 4LNHA 3OQ1A 5K3OA 3V4FA 2V98A 3B1ZA 2OGUA 4GMXA 4U4AA 5CT4A 1I3MA 3UGKA 4JI5B 3ENVA 1BYUA 3DMHA 5KDOA 4EA6A 4RMNA 4HB3A 4F4FA 2FN8A 3IHLA 3FJOA 1CZLA 3OZSA 1PYOA 3L0SA 1Z0AA 4HFMA 4FFRA 4MJLA 3DS8A 3TCNA 1PWHA 3EH2A 3O74A 4TLBA 3K70B 4RKFA 2Q1TA 1KE2A 2XDQA 1JR4A 2O2XA 1XAIA 3Q98A 2FPLA 5BYKA 4KGVA 5CTJA 4F0JA 4DQUA 1Z5WA 2GPJA 2CXOA 3PQ7A 3RTEA 1OR8A 4QUKA 3JPYA 5K4GA 3TCXB 3S3TA 1R0XA 3KT3A 3D31A 2KW5A 5KWIA 3FX2A 1EDEA 4AKGA 4P7JA 1YFJA 2PKWA 5HKAA 5C53B 1HZZA 2YWDA 4KODA 1JRLA 2Z4TA 5AUOB 5BV0A 5LLTA 1QKKA 1J56A 1RHQA 2HK6A 3T15A 3BSFA 3PD7A 4G25A 4E7PA 5CA1A 3N74A 1YUMA 1TKBA 3DFUA 2NLOA 1RWXA 5FHRA 4E5VA 4I1PA 5HEKA 1Z36A 3TZEA 1V1RB 2BTQA 3EXHC 1N75A 4BX9A 4EECA 1QNFA 1SBHA 2CNBA 2O5EA 2E37A 2VO1A 2W2TA 1BE8A 2AH5A 4IXDA 3K0AA 4J0JA 3OICA 4OI1A 4DV5B 1Z0IA 2HQ1A 2VWPA 4QUEA 4QTYA 3IP6A 1XVTA 2X9GA 2X1LA 2Y66A 3UUFA 7GPBA 4URYR 3WXMA 1NU6A 3Q2IA 5A02A 2ZJYA 2XRYA 3D7KA 3P27A 2J48A 4BXOB 1P9WA 3MUNA 4JJ6A 2GB4A 4NCJA 4Y9UA 5BV1A 5UKDA 1MKYA 2PUVA 2GAAA 1HEIA 2ZAOA 3OZGA 4TM8A 2A0FA 2CDAA 4FYIA 3X1YA 1G63A 2WOOA 4V38A 3FWHA 2DPYA 4HL6A 1K98A 1XU9A 1XZMA 3HQ4O 1E18A 1C14A 4XRGA 8LDHA 1JSCA 1XZFA 3F5FA 4ND6A 2AK3A 3KB1A 3EE6A 1E94E 5JAMA 1O0BA 3TZKA 3TE6A 1C41A 3KTOA 1WHSA 2NZ8A 4NU5A 3T9EA 5A6VA 1GEGA 3KZKA 4U5QA 2HLDD 2IU4A 5KSPA 1ZEJA 3GA5A 3EFOA 3GZ4A 4GPAA 4KI0A 4N49A 4N6NA 3R6DA 1FUYB 1AKEA 1LY1A 1MB0A 1O94C 3CRQA 3D8TA 4CM9A 4CGZA 3G0DA 3M1YA 1WQ4A 3EMKA 3PV0A 4V03A 1ABEA 1IXRC 2FEKA 5DBFA 1G9XA 3ETCA 3CW2A 3HR7A 3ON5A 3LQ1A 5B1EA 3KWMA 1TKAA 3ZOZA 1TM1E 3ORFA 1V8PA 4WDQA 4DF3A 5MN5A 3O73A 5JSZA 1LSJA 2KM1A 4AJHA 1XZEA 2FUG6 2PKRA 2HDNB 1H2WA 3GYBA 5EJ6A 2BMAA 4DQKA 2DLNA 4WKBA 6ABPA 2WJJA 2VSOA 1FQOA 3OZIA 4WOPA 4BBAA 4X1YA 3PDUA 3RC1A 2ZGVA 4E08A 1F0YA 1S2OA 5SYNA 5BSFA 4RA6B 5FPYA 4Y7DA 5TJ9A 3K0CC 2F8SA 3VSEA 2FUNB 4G9BA 5C8YF 4HI0E 2JGKA 1OWMA 1YBHA 2HMWA 1EVLA 1XFDA 5CR9A 5LP6C 1RHUA 3JQDA 4WXYB 2P5TB 3M6XA 1GGNA 5DX8A 2IPAB 2EGGA 2QLTA 1SOWA 4MVXA 2BYTA 3IEVA 3ZY6A 4KRGA 2JJ1A 2NU7A 3COYA 3AO0B 3KM0A 5TPWA 1IATA 1GR0A 2PUWA 4PEVA 4BPRA 2BEUA 3FLEA 3STHA 1F6DA 3JZDA 3WO1A 1JZTA 1P0MA 3DAPA 4HRYA 2BP7B 1VBNA 3ZI0A 1UAAA 4ZAVA 4K6CA 1WY7A 2F3RA 3IJPA 1BEZA 1WMFA 5JECA 5KREA 3U1BA 2G4CA 1VJCA 4K5QA 4C0SA 3EZYA 4O29A 3CJTA 3ZH9B 2JAHA 1THMA 1NXXA 4C2UA 4IVPA 3ED5A 2GDJA 4V02A 1ECCA 1YNSA 1YT5A 4JOBA 2LCFA 3EGEA 1XKQA 5TGDA 1ABFA 4L28A 4OAQA 4I0WB 4J3NA 2CHGA 3PQ2A 4TT3D 4CKYA 1WB9A 1CS4C 2A1TS 3K5HA 3Q11A 3V46A 1FTSA 4C1NA 3TLZA 4QRHA 4GXTA 3WZLA 1C81A 1NYQA 3L0ZA 5TPZA 3O8OA 4D8UA 2HWUA 4CTOA 5GIOE 3VYTB 3D2AA 1DAIA 3KLPX 2B2XA 1YNOA 3MFYA 3GYGA 5LOVA 2MSKA 2IDKA 4IIJB 3CGGA 3T41A 4BP9A 1NI5A 4MGHA 4AJKA 2TMKA 4KMMA 3MJ4A 4P93A 5MGBA 3IJ5A 2VDRB 1U81A 4LMBA 1B1CA 2ZUDA 2JA2A 3PGKA 5GADl 2HADA 5HBGA 1AHPA 3TUJC 3OTWA 3DA8A 5C1IA 4LN1A 4HWSA 2HU8A 3NXKA 1UP6A 4FYVA 2NPOA 4LRTB 2J09A 4NV0A 3U0BA 2F8LA 2OV2A 3IDQA 1RYEA 2G76A 1KJQA 4M0FA 2HV8A 1FP4A 2DJIA 4ITVA 2P9TA 4XJVA 5HPYB 2YBEA 4MVJP 5DIZA 3S5JA 4RXTA 2IYSA 1R4MA 2FZWA 4Q9JA 5PGMA 3UJ7A 4FGSA 1YI0A 2FR1A 2XB9A 1ISSA 1OROA 3AXSA 2JLCA 3N2YA 4XKJA 1ZCFA 4L50A 1G20E 5AP9A 5FPSA 3FYCA 3QVGA 4ZD6A 3T94A 4E31A 1GTRA 3AMVA 3BL6A 3FHJA 3L0OA 4PRKA 3KK0A 5FBVB 2H6EA 3WNDA 1XHEA 1G21B 2ISQA 4Z54A 4MQMA 1P5FA 3T9AA 4F97A 3GLGB 3NWEA 1E2NA 1JUDA 1OXKB 1JI3A 1M6VA 1NY6A 2GCGA 2PAAA 3A9TA 3I42A 3PICA 4RYLA 3BQ9A 2P6MA 1A2KC 5AT1A 2RSLA 2QQGA 4JR0A 4JUBA 3AT1A 3HRHA 2AX3A 2I76A 2CJXA 3MMNA 1HFWA 5J5CA 2ZYWX 4YRSA 2V3CC 4NOJA 5JI2E 2FN7A 5F35A 5ANRB 3UYKA 3C1TA 2Q3LA 4QVKA 4WI1A 4ECAA 2J0EA 3ZZNA 4ZYTA 4R69A 3GT7A 3KQUA 4TVOA 2BFOA 3I9KA 1SK9A 2RGBA 4NONA 2BGMA 3NPMA 4BAGA 5JVDB 3TD2A 1U5AA 1Z2NX 1XL0A 3EAGA 3L8FA 4HEQA 4ETWA 4IGKA 1FOEB 4JNKA 1HZJA 3U17A 4BVJA 1YZNA 5CVCA 1TUBB 1KI8A 1RLUA 1CX9B 2B99A 3E9ZA 3GAMA 3H3JA 5JIBA 3NDIA 4NXNB 3M3HA 3RJ9A 2I2XB 3VHQA 1U1EA 1TZ2A 4IV5A 2RI1A 3DQPA 4FB5A 1M1NA 3DGFC 2IGTA 4JUCA 1M34E 2RHJA 3QK7A 4CT4B 3NH9A 4GRIA 4LYEA 1DRVA 1UKZA 1SUDA 5IANA 3DM5A 2ZYGA 5CD9A 1X42A 2CKMA 3W9UA 3GLSA 3QU5A 4L3OA 1DKRA 3ZWOA 1SUFA 1I4TD 3DDUA 1SD1A 1KVUA 3T0IA 1G98A 1WTCA 4OEHA 4O33A 2PFSA 1XK6A 3GF4A 3OU2A 3QBJA 5FBQB 3W77A 3K2IA 4EI7A 2PGAA 3N2ZB 4BFYA 4K6KA 1GM5A 4QD3A 1VE1A 1H2AS 3EWSA 4MH0R 4OG2A 4CIVA 5IXSA 2VJBA 2F4VB 3NIBA 3I9NA 2QR2A 1ZLXA 3B5IA 3CZMA 3FRIA 2PQ6A 5JDIC 2AEJA 5K8CA 3VZDA 4CDRA 2HYIC 4EPVA 2H9IA 1K92A 2QUAA 3K9LA 1UM9A 3EVFA 3SVZA 2B6HA 4WY5A 5K5EA 3WHKA 3N05A 1NW8A 1PRYA 5AJZA 4EW2A 3A2MA 3G0CA 3EPKA 1OUMA 1C1HA 3AKEA 3EXEB 5C8XA 1FVFA 2YYYA 1JIJA 3LUDA 5ESRA 3VR6A 2RHWA 2Q8NA 2XF8A 2DCUA 4GQAA 4ZQCB 1KDYA 2HIHA 2CGEA 2LNDA 5EZYB 4XWGA 2UDPA 2OMKA 2J0SA 2Z3ZA 2P78A 2ZB2A 4KH0A 3QFSA 1PNOA 4HTFB 1XRJA 4QXQA 4E5KA 2HPHA 1MORA 4PLVA 1SXHA 4K9PA 4GDMA 1ETHA 4NBVA 4HNSA 1P4RA 1YOVA 5HQ3B 3I53A 1SB8A 1QP4A 3EEOA 1O54A 1ODIA 2R96A 1U0SY 5L7TA 2VTBA 1VDZA 3GEDA 3GT4A 3CX6A 4QASA 4W99A 1P9LA 4Y1EA 4EO9A 2JIBA 1ODSA 1EB9A 3PFGA 3LGSA 2HPAA 1P3DA 3W5SA 3RFXA 2YBDA 4RAQA 5JARA 1HDCA 3NGLA 2PUGA 2GFHA 1QZXA 2ILVA 4DR5B 4FGKA 2MU1A 4R16A 1W73A 2X2OA 3AI1A 4Q21A 3HBAA 1HSZA 1UOEA 2RKBA 1XZLA 3LQFA 4Z9XA 4BNFA 1MC5A 3ZH2A 3TZLA 2X1HA 4OX9B 4YP0A 3NDBB 2WK1A 4BQOA 1UT5A 1XP5A 1NURA 3ZJVA 3AFGA 5GP1A 4Q1CA 2X42A 3PVSA 5A5DA 3LHIA 1PZHA 2ZRMA 2BAGA 1EIZA 3VNAA 1L7VC 1D4AA 3SYKA 2GYYA 3NBAA 5AKIA 2W6QA 4DVJA 1TEZA 1AKRA 3PXEA 1Z39A 2HDWA 2WYIA 3NZEA 4TV9F 1E58A 5I9BA 5JISA 5IT9A 2CNKA 1XCLA 4NE7A 5COBA 2AF3C 2QZ9A 5L51A 3EUWA 4ZVQA 5B55A 2X76A 1XB2A 2ZIXB 3E35A 3F97A 4WVLA 3ZHZA 5EKSA 2JHFA 1UKVY 1OXSC 4B80A 4G0ZA 4UHEA 4F2GA 3E5NA 5ERXA 5G1OA 2X6QA 2X9LA 1WY5A 1XQVA 2I7VA 2NO7A 3QE4A 1IUOA 4QYWA 1IOVA 5FTJA 1R1DA 3I2HA 4TTIA 3OG9A 2IZ7A 5FUQA 2YYZA 1EVZA 1XD9A 2XMPA 4UASA 4ACAA 4BAZA 4U7PB 3TXAA 4OJTA 3OFJA 4JYMA 1VA4A 4HYQA 2D2IA 1EG2A 3LA6A 3LWZA 3NBUA 4OSPA 3MUOA 4YAFA 5F1KA 5YASA 1YUBA 4N8SA 1ZNQO 4DA6A 1QKIA 2GN0A 4GAEA 1QQAA 3D8RA 1U6JA 3U5ZB 4E5PA 5F5NA 4YMWA 5AM2A 3FCCA 3TM5A 1SBCA 3H16A 3EEYA 4ARSA 3PQ6A 4C3UA 4QATA 3AETA 4U7GA 1W6RA 3K1AB 2HT1A 4QVIA 3A25A 2QSYA 3OT4A 1TYZA 4TKZA 3Q0TA 5LA6A 3T9FA 4AF8A 5KPDA 4D8VA 4PZLA 4DYDA 1DJLA 5HP4A 2H65A 4TMWA 2BH2A 3D7MA 2GXUA 2VPYA 2W6MA 3D1VA 3WLMA 2JPDA 3FMVA 1ZIXA 1HA3A 1O96A 3I09A 3D6FA 4CEIB 1ESCA 3RFFA 3NT5A 2X0FA 2Z2YA 4YMLA 1Y42X 1N5MA 1NP3A 2B8JA 1QYVA 3CO5A 3JYLA 4CTNA 4J0HA 4S1NA 4DLSA 3H9GA 4LFCB 4URUR 4CI9A 3B1VA 3LVBA 5C5CA 4Q3NA 4DWWA 4ETIA 2WHEA 5AVUA 1Y5LA 3OOHA 5LZ5A 4K46A 2IY8A 1G4HA 3F9IA 5AM4A 4B83A 1U5BA 3PD0A 1T4GA 3KTAB 4G1MB 4MW5A 2Z6UA 1YA6A 4RD2A 1OTHA 4EKIA 2EATA 1XNGA 2OZLA 3U40A 2PD3A 5T4BA 3UBMA 3U56A 2A9KA 2C7QA 2QZPA 3BGDA 1P2SA 3B8EA 2IUFA 2ZBQA 3PL1A 4CM4A 1ADYA 1X9IA 2HQRA 3B52X 3LF1A 3OLVA 2NYAA 3EQ2A 1S96A 4HH4A 4TLDA 5BQ3A 3DVAB 2D6FA 4P3KA 4JV5B 3UAWA 2I78A 2YINC 4HUJA 3OIUA 4QDJA 4ZAYA 2FFHA 3HEBA 4S04A 3DMRA 3OJEA 4JB8A 3IHKA 4YP9A 2UUBB 4C3OB 2WZBA 4EQ6B 3NV7A 3AF3A 2IJGX 2EVWX 3C1UA 1NJGA 2C96A 1A9YA 2PU7A 1W85A 2LKCA 3L46A 3M83A 5DHTA 1Z26A 5K8TA 2BSAA 2D8MA 4J7CA 3H5TA 4F4DA 4RD6A 3RYCB 4FWIB 4C6TB 1SC9A 2OENG 3QF7A 4QU9A 1M3SA 5IJAA 3HB9A 3RKRA 2GPNA 4JLBA 5CX4A 5F9FA 1CPYA 3H2BA 4OHXA 3KPWA 2JHCA 2I2AA 3ZC3A 1SXJD 1FCJA 4HRXA 1N5LA 4HYTA 2PN1A 2WUWE 2XYQA 1F1JA 1CR4A 5KNBA 4RVHA 4O25A 1YSCA 1PZXA 2WP8J 4XVHA 1U2GA 3Q8LA 4J6EA 1PJBA 3KB8A 3OJ0A 3W0LB 3EDQA 3AR9A 5U4QA 2DBQA 3DE4X 2PU5A 5CXXA 6CHYA 2XDQB 3R6TA 3G6KA 3OQOA 2J85A 2ACEA 2QX7A 2H2GA 3N59A 1ELOA 1UBTS 1QTRA 2PT6A 1AKNA 2H8GA 2VF7A 4KFRA 3CH6A 3TQFA 1JDNA 2UVPB 4ZQIA 4A8JB 1S3IA 3AUXA 4MHOA 2FPKA 3QX8A 3QVUA 1OJLA 1RMTA 1KH1A 3OKPA 3NBKA 4Q93A 5IKOA 4DB4A 1GGJA 3QXXA 3BAZA 1H3FA 4GU5A 4NICA 3AR4A 2H63A 2CCKA 3UANA 2CWWA 3BTSA 3N87A 1Q0UA 5CA1B 3WA6A 2ZDHA 5HG0A 3IBGA 4JB3A 1JVSA 3WRWA 4X1OA 2ZTUA 3DBIA 3O75A 4NEGA 1A4UA 2FZ4A 3J7TA 4W9NA 4EGSA 4PN3A 1KMNA 5ALGA 1EXVA 4BMYA 4YRLA 3DLPX 2QTNA 3K0AB 4NESA 4PG6A 2ZYHA 1SURA 2QMHA 5IAEA 4TMVA 5G4KA 5HTOA 5KQGA 4WGFA 5A4JA 2G1PA 3P2JA 3QLUC 3W5DA 3PIIA 3BMXA 1HNWB 4OOFA 4AJ4A 2I0FA 1C30A 2O2SA 3BILA 3E7FA 2VK2A 3MD0A 1ICEA 1S3FA 1K7SN 3M5DA 3C7AA 4Z51A 2BELA 1WQ1R 2Y3IA 2ORYA 3MS2A 3OJWA 4X20A 4JI8B 1OT5A 3RWOA 4BQSA 2CYAA 1NC3A 3LBNA 4N3GA 4C43A 5FAKA 1KMQA 3TRHA 1GAWA 2BSQA 1GPJA 1QOQB 3DWEX 1NULA 2G5CA 3NONA 5ABPA 2WQZA 2D1FA 4NH4A 1N25A 1PWYE 1S2MA 1U2DC 2VI5A 3IEMA 2Z8YM 2I7DA 1XEWX 1F48A 3SJAA 1FLAA 3SNHA 4EPXA 3NWPA 4O2LA 5B57C 4MDYA 4HDKA 1WV1A 3ZY2A 1WXXA 3HS3A 5LXTF 1EUCA 3T5TA 9LDTA 1WHSB 4KQFA 2BDEA 3R09A 2GD0A 2FV8A 3M82A 4NZYA 4BQNA 5BN3B 2OZPA 2ZRHA 4C5BA 4J90A 1V8OA 2PRIA 3EFOB 3V7YA 4M9XA 4N7RA 2DKNA 1T13A 2DQSA 1KQGA 4BUCA 3FKJA 3PEYA 1K8RA 3LQKA 2V7TA 1V6CA 3HBJA 4FEAA 3KZMA 4IS2A 4I5FA 3T5MA 4OX9Y 2IYWA 1DIGA 4RJTA 5TT0A 4BJHB 4JXZA 3AOEC 3EMBA 721PA 5CLHA 2ID4A 2M32A 3NBFA 2GPTA 3I9JA 4HS4A 5AJUA 2I9PA 3E2PA 4L2IA 1JTEA 3WLPA 4FS3A 1JALA 2EX1A 4V0QA 3L8MA 3R77A 3OCVA 2WU0A 2Y2VA 4GIBA 3CLTD 3HNOA 3IULA 3MEQA 2IXEA 5IARA 1DCFA 1ZA2A 2BZGA 3CZ9A 3KCNA 2J3LA 2JIQA 2OP0A 2EOAA 3PJEA 1T91A 1KFJB 4XWKA 4N3NA 4I1OA 3OX3A 4UMDA 3X2EA 1IM5A 1XTPA 2NQ2C 3AZQA 4RD3A 1DJMA 5IBCA 1D2CA 1R27A 3NBXX 4ZAXA 1V7ZA 1ONOA 1RZRA 4ZDIA 2NU7B 1MVOA 1C9JA 1N6KA 1FF9A 1NX9A 3MT8A 2JFNA 4MR7B 4GGOA 1N2BA 2BEUB 4QUBA 3WIDA 4RBNA 3OKAA 1AGPA 5H68A 4FDLA 5KDDA 5F3WB 4KXLA 3F8TA 1BWPA 1GILA 1JIXA 3EQ6A 4CN9A 5P21A 4MMXB 3T95A 2AI2A 2WTBA 4D79A 1AA9A 1E9EA 1A7UA 3C7CB 3CM0A 3F5QA 2AWNA 3O8QA 5EHQA 3TGWA 5B7QA 1NR1A 5AVOA 1NRXA 2J41A 5LB4A 4MW9A 2ZPAA 4GSLA 3QWHA 3A9RA 1OTYA 4UTPA 1YU6A 2BFBA 2IYRA 3WYAA 1GUBA 4EHKA 1YTUA 4DA0A 5T8KC 1ULUA 3MJHA 4DGQA 5HE8A 2JFHA 4I66A 1JMYA 5HFJA 1U7ZA 1KY3A 4QOHA 2QENA 4E1BA 3GVXA 2RC5A 3SKXA 1GXSA 1JA0A 5LOVB 2ZAGA 1IEXA 1MENA 3PX2A 1O6FA 1SQGA 2GM5A 1AUQA 4RPJA 1IY9A 1JDBB 2OC9A 3FNRA 4UJ5A 1XRLA 2RAPA 2QG4A 3ILVA 2BRUC 4W5JA 2GN2A 4KIWA 3WMGA 1GPH1 3QXCA 1K7CA 5CW2A 3D0QA 5ITWA 5CTAA 5ALSA 1O9HA 1YL5A 2CE7A 3KEMA 4FCWA 1UPXA 1CU1A 3KSRA 4J2HA 4YASA 5LQKA 4OHKA 1A0OA 3G0OA 4M1OA 1XBTA 4W8OA 2O8CA 1CZOA 3DAFA 3KR1A 1XTBA 3DMDA 5LVAA 3LLUA 1RM4A 4MB2A 3PC2A 1BHO1 1V0JA 4OL0A 3HZRA 1XDZA 3S2SA 1LDBA 1I8TA 3AUKA 2EWVA 3ZW8A 2HLDA 2VJYA 2CV2A 3ELBA 4MGKR 3DBOB 1FW6A 2XB2A 2GXAA 1PK7A 3VSCA 3BRQA 2VKQA 4D0NA 1GQ2A 4INZA 2DUWA 3PDIA 4IEIA 1ES9A 4NYJR 4C0WA 4AWXA 1UAGA 3SDSA 3WZ2A 4ND4A 4Z9AA 5T3YA 1SOUA 3CXRA 2JGJA 1D7OA 1LH0A 2HRQA 3RRNA 1M2KA 3U1TA 1VCMA 1JE1A 2HMVA 2GLXA 3RNOA 1KS2A 3DMYA 2OXEA 1OT3A 1YB5A 1M6VB 3IMKA 5KQSA 2JW5A 5F9HA 2VDUE 2YYAA 4BKUA 4TRJA 3V3KA 5I9NA 3L07A 1QK3A 3A3NA 1QHHA 1UJMA 4V2UA 3RYHA 1E5XA 3P2YA 4BGIA 3O90A 4A4DA 3DBRB 3Q3VA 4ZGBA 1CJUC 1PG2A 3E58A 5TQ0A 3LRPA 3EY4A 3V97A 4AM8A 1EXMA 2EJWA 3BBLA 2OLKA 1TM2A 4B6JA 1J5EB 2XZOA 1EGVB 4FP9A 2HT6A 4RKYA 3PXGA 4OXYA 1M33A 5C8VA 2XIQA 2O0JA 1R12A 5JAZA 5LZ9A 1PD0A 5E1BA 2VNJA 1T36A 1K2WA 1YR8A 2VUSA 1GFIA 2AIRA 2YIDA 1W47A 3AF5A 3K8QA 5GGYA 1N1EA 1Z0UA 1DBPA 3D0RA 2A0UA 2VHQA 2HV9A 3ZK7A 1EJ6A 2CC2A 1U2PA 2L18A 3AC0A 4FNOA 4I9NA 5TARA 3T7EA 4KE7A 3VDXA 2YZ7A 3IB6A 3ZHCA 4ZVTA 4CMIB 3CJRA 4UPDA 4YAJA 3I28A 2FFJA 4NABA 1C1DA 4KI7A 3W4KA 4CNBA 2FZGA 3LBAA 2L2QA 1L8AA 3PJDA 2FPWA 1H5UA 3B85A 2REXB 2GZ2A 1R4NA 1R2QA 2I3DA 3CUSA 3Q3EA 4M9RA 4D9GA 1FTWA 1MCZA 4QQ8A 3IFSA 3SXUA 3QE0A 1N33B 3S8YA 1CY0A 4R41A 4YT5A 4TZTA 1D2NA 4TT3A 1G291 5KIAA 3HWWA 3TGPA 5EXDA 4QG3A 1MGPA 4TTTS 2HFJA 4X9XA 2OM2A 5DXAA 3RAPR 5LP6F 1PKEA 3E8SA 3VKWA 1T5OA 1L5RA 4ZYWA 3KL2A 2WE7A 2Y9PB 3JARB 3GJ5A 2YX1A 2B5VA 3OZUA 5I3CA 4RFVA 1E3DA 2OO5A 3HN6A 3R5HA 2JJMA 3ZXUB 3ER8A 1I2BA 2C8KA 4HKTA 1FDWA 3T3PB 3NEYA 1NVUQ 3KOOA 4MR9B 2FZCA 3CF2A 3MLEA 4B3FX 2IUEA 1SZDA 3X2FA 1Z0JA 2ASVA 3VC7A 4ZOLF 3I9FA 1WSBA 3PT5A 2BMDA 1AQLA 1Y5MA 2UZ1A 3C1OA 3MN1A 1N2HA 4QSMA 1ONPA 1XU7A 2C2YA 1FU4A 1P75A 2CE2X 2ZYTX 4FU0A 4P3NA 4KNYA 4F3TA 3B3QA 2PRSA 3UN1A 1OAOA 3MQ4A 3RSCA 5G41A 1MJHA 1ULZA 4Q3KA 4F06A 4AJ1A 1YOVB 3UZUA 3WVNA 2VNSA 2NTNA 2FKNA 4K7JA 2DPLA 3LUFA 4I1RA 3TW6A 4EGJA 4P84A 1G2PA 2IW1A 1KR2A 5EL0A 4XYLA 3ETEA 2FMKA 2WUEA 4JT2A 5JHHB 2WQ6A 2D0PB 2ZSBA 4Y98A 5KJFA 4AY2A 2IYUA 1NA5A 1XOIA 4BVGA 1EK1A 5KEIA 1BSVA 1G7RA 1G8JA 2B0CA 3C87A 3EWNA 3QBTA 1RPTA 3OZFA 1U7DA 4RVNA 2AJCA 1WCIA 3K0FA 5TRTA 4F8YA 3TMYA 3FOCA 1U8XX 2XUIA 1DRKA 3FOAA 5EJ8A 1QE0A 2Q5FA 3WOHA 1BOOA 1HKUA 4MKXA 3ZWBA 4QLOA 4KHZA 1Y9AA 2AR0A 3JALB 3P9XA 4E07A 4LGYA 1RHKA 3OLQA 4BN0A 2WKWA 3ZI7A 4DLKA 1QLJA 3LECA 1ZISA 3PUIA 1H2BA 4TTAA 3ZV6A 2Q2WA 3D3QA 3R7DA 2HJGA 1T8RA 4IVRA 3KEOA 1NBAA 3SHWA 3KQTA 2L82A 3CRW1 2JRCA 2Q0XA 1J23A 3H0EA 2VH1A 1RJEA 5E0KB 3RO7A 4D26A 3RBXA 1WPRA 3K16A 5JJBA 3DKPA 3EH1A 4PX2A 1TQDA 5JJCA 2C00A 2IHBA 4Y0VA 3FCSB 2OZVA 7ADHA 1RCFA 3JAMA 3G9ZA 4MVJI 3CBQA 3S2YA 4BY9E 3RCBA 5JLJA 5IYZA 3EXG2 3JQ7A 2CD9A 3L1HA 4NATA 1RJ9A 5J5VA 2O2JA 1K5GA 3GGGA 5K1ZA 4AWAA 1A9TA 1G41A 1LBHA 4EPTA 4EO4A 3BKXA 1A97A 3FCXA 3L8EA 4A3SA 4AKEA 4ZYXA 2BY4A 2RJ3A 3FUUA 3MTAA 2BW0A 4LJ7A 3FZGA 4RACA 3KUCA 4NE9A 4X94A 4HDNA 5DYIA 2B4YA 2FPRA 2JHPA 5AOVA 4YMUA 5DTIA 1KEEA 2XMSA 3Q72A 2IHJA 1WSAA 4RK7A 3D59A 3UMMA 3MTIA 4D0LB 1AVTA 2PUJA 2XADA 3FKSA 3E7WA 2VLBA 1QWOA 3C14C 3FZNA 4WKGA 5D85A 1SVUA 3Q3GE 3JAWA 1SBYA 3U0VA 2B4AA 3AETB 3O4VA 2QPOA 4M86A 1IFXA 1ORHA 1DPFA 1VHLA 1FLVA 5K6AA 2YOFA 3VPHA 4KPUA 5LA6B 5C5EA 2O7RA 4GC9A 4D9IA 4REQA 4C03A 4KL8S 1QFYA 1ZVMA 2PXHA 3RGWS 1GCOA 3HU5A 3JZFA 2VTVA 3AIMA 2EP5A 4WK6A 2OAQ1 4TTSA 1O96B 4EATA 2OQ2A 3NWBA 5G53C 4CMEC 1NXVA 3DCYA 3JASA 1U9IC 3U19A 4OQZA 1CEYA 4FXOA 4J07A 2FRDA 3RANA 3NWOA 1Q7EA 1ZD1A 3QFCA 1AO0A 4Q4JA 4ABTA 2H1SA 2VF8A 2NIPA 1I9CA 5KSWB 2Q4TA 4RLSA 3FZQA 4FILA 2KLBA 4KDEA 3TOCA 1E1YA 3R3HA 1WO8A 3E6AA 3IDAA 2R7KA 4Y2HA 1PLJA 1FVHA 1QANA 1MBZA 1MTZA 2W98A 1OXTA 2OZLB 3GCXA 1P19A 2FI1A 3TMAA 5JI3E 1VE3A 2PBLA 2JLQA 4IGEA 1XO1A 4IDQA 2ZZNA 4KWCA 4OGLA 3DW1X 5ALYA 5GINE 2CLSA 3MMPA 4FZRA 5H02A 4B34A 2PJZA 1XC7A 4WN9A 5FADA 3HRKA 5L3QA 3GLIE 2DAPA 5C1PA 1EFVA 1KP3A 1SM4A 3ZPXA 2HXSA 1E2FA 3GRVA 4JT4A 2LPMA 4UAJA 1RPJA 5CDGA 1RQ7A 4HWKA 3ENNA 1EAYA 1NDQA 4ZT5A 1PEYA 4BN5A 1Z25A 2O1SA 3ZW7A 2WEKA 4WNAA 3A32A 5EUCA 3HN2A 1N2CA 2B8EA 3T3GA 3QBDA 3WB0A 5I7VA 2JAQA 3VAAA 3TFOA 5JQWA 1W85B 4I7EA 3RC3A 4BE4A 2ZWVA 4BCDA 2JIOA 4HX2A 2BD0A 4FSXA 3BFKA 4CKZA 2QRZA 4NKRA 4J1TC 2NSJA 1I2ZA 4GX1A 3G7UA 4RF5A 1LSUA 4RELA 5AI5A 4LISA 3TEMA 3V1TC 3OF2A 1GGMA 1JHUA 3NVKI 4RHTA 1DG9A 1JJFA 1GQYA 2G6TA 3UB4A 1PF7E 3GEIA 4LCBA 2WUGA 3RFTA 2MSWA 3OTGA 4IV8A 1W4BA 2ZI9A 1L8XA 2HJWA 2P1ZA 4Y6QA 3MMSA 4D0RA 4KXFB 1P62B 1UPTA 2G28A 8OHMA 5JHGB 2VDMB 4OXKA 3DOFA 2AZXA 2NT3A 3ZWCA 3HRIA 2XLBA 4OKNA 1KP9A 1W46A 1MV8A 3EG9A 3HABA 5TMDA 2YUTA 1YOBA 1QGDA 2OD7A 2Y1DA 3HL4A 3O1IC 4ZZ1A 3CKMA 1LSSA 2A59A 1UJ4A 2C4UA 2YHBA 1N2ZA 3BFPA 1J70A 2C8VA 4RM3A 2OZKA 1QYXA 2K2QB 1F0KA 1P0PA 1FRVA 2WP0A 1XJCA 3IKLA 1IWBB 5AK4A 4A7PA 4YP7A 3HDHA 2OBMA 5DP1A 2ID8A 3HUUA 4O63O 3SR3A 4DCMA 1M5RA 1P0CA 4N0EA 3PDJA 1BMFA 4ENPA 4WJKB 1I0ZA 4RFLA 4S05A 4O4IB 1KXZA 1MEJA 3TJMA 2X58A 3NCHA 4Z4IA 5D2CA 3ZIDA 2AW3A 4IBOA 3K0KA 5CNIA 4L95C 3DMGA 2C7RA 2VHVA 4K6MA 2VQFB 5G4KB 4JYZA 1KAGA 3B8HA 3EOZA 2DTDA 4NY1A 4ETNA 4DSAA 1FFEA 3DQZA 3FUVA 5HF8A 3DWIA 1ZM2A 1NXSA 3C7DB 3OJXA 4GLLA 5CCDA 1E0KA 221PA 2F59A 2CNNA 4RQBA 4LV5B 4XB1A 3A14A 4X7BA 3ROGA 4ZCRA 2P3QA 4X20B 5DZSA 3ADCA 1EX6A 1G8MA 2QQ5A 3M5WA 1SIOA 4WX2B 4HWOA 3RF7A 1AUOA 2NYVA 4UHHA 4D9KA 3FMFA 2EKPA 1A4RA 2QRHA 1YRBA 4ZJPA 2OOSA 3TNDA 3HKCA 3H1TA 4D45A 1FQKA 2CLIB 3RG8A 2UYCA 3NOOA 2J5RA 4UU8A 2I4LA 1W0KA 3D8SA 4TWJA 5EC8A 4B17A 2DT8A 2J9FA 2OHGA 2W37A 3E9CA 3WP1B 1Z8NA 5EJ9A 3HLTA 1EUCB 4BBJA 4J76A 4IX1A 4M7WA 3NVAA 3DKKA 1BKDR 2F64A 3OZDA 3DHWC 1B3RA 1CUWA 3JRXA 4I1SA 3FCEA 5CT5A 5DRTA 3MCAA 4BEVA 3FMOB 4EI8A 5KSOA 5GZ6A 2X8AA 2P30A 3OO1A 1QUEA 4DLPA 5IKMA 2CVOA 4TXJA 4I4TF 1TFUA 1XYYA 1K5DA 4MYUA 5B37A 1K4KA 1YIOA 1QVRA 3CCFA 1RT9A 4KP7A 4LJYA 3CRRA 5BORA 2NU8A 5TMPA 2FSVA 1DB3A 1X0VA 6PFKA 4PTZA 1U0LA 3JWPA 2H0AA 3EPLA 3H9JA 4MYCA 1L4FA 1E1NA 1W35A 1J4AA 3PNOA 4YP6A 1J06A 2JD0A 1SXJA 4GXQA 4DZZA 3H2SA 2Q3HA 5BUZA 3LU1A 3VOAA 1NHGA 2F8MA 4ARIA 1EK0A 1HGXA 1X74A 2VDWA 1J00A 1Z5OA 2C58A 2Z5VA 1AG9A 1FTQA 3F3SA 3GJ0A 3IQDB 3K9NA 3SPXA 4JU9A 3OQIB 1YULA 2K5UA 4IJUA 1TADA 2GDZA 4JY7A 1FP2A 1O6ZA 1A2BA 1YJ5A 5DEOA 5DM2A 5ALUA 1E3IA 5FYDA 1NQXA 3TIXB 1VBFA 3OQNA 3WKBA 4FR5A 2F3PA 4EY4A 1A27A 4OKSA 1VSUA 1RJFA 2XOEA 3OUTA 3RUIA 1PYDA 1ZJWA 5B53A 4RVOA 1C9MA 2G9NA 4R9RA 3R8XA 2ZI4A 1C9DB 1P8AA 3GDGA 3IQEA 2C99A 4M9QA 2XSZD 5TQ2A 3V34A 3ZV4A 3I62A 3HCPA 4XEHA 2QA5A 3O8QB 5HDQA 1WDTA 4HXGA 4TTJA 3GPCA 4MAMA 4BZZA 1E2LA 3DVQX 4L08A 1U04A 2ZITA 1HFEL 1EUYA 1I1NA 3TAUA 4URHA 2BFAA 4B7ZA 1N0HA 4P4GA 1R5OA 3ZK9A 5CB4A 4WPGA 1ZR4A 1JQBA 4AZ3A 4GZ3A 1X87A 4YAGA 3PX7A 3PWKA 1WRBA 2O2YA 3KQSA 4G41A 1Q1ZA 1Z4KA 2H7XA 4JT8A 4UDYX 1XZKA 3WNCA 4PNEA 1SN7A 4BLOA 3QE2A 2P2CA 5DRYA 3IMCA 3P5SA 2XMRA 3HYRA 1EG7A 1SGWA 2C7BA 4MLCA 4NEHB 5FUBA 3ZVRA 3OTIA 1WG8A 3KVNA 2AMVA 2XCOA 2JZNA 1ZICA 2CSUA 2GBLC 3IOBA 4DM4A 4XYGA 2Z08A 1RAEA 2ZYUX 4QPZA 4DT1A 1CY7A 5HKOA 3FPEA 4PC7A 5AHKA 1H6AA 1NN0A 1SFRA 1UMKA 4EUNA 1SUPA 5JD4A 4YUYA 2WIFA 1YS1X 3Q7RA 2O8CB 1J8MF 4C0QC 2AOXA 3BVPA 5KI6A 3NLLA 3ND9A 4MPTA 1P31A 3C4VA 2WWIA 4TQ9A 2OG2A 2D2VA 2MINB 4CG0A 5JCOC 2O8BA 2X6RA 4IJKA 3ND7A 1C4KA 1H2ZA 1GPMA 3A58B 3OJCA 3VV2A 5G2OA 4B32A 1HNXB 3IJRA 3MYYA 4POAA 5TR9A 1SVIA 3QQ5A 4HGQA 2NU6A 4OSEA 4RIIA 4ML3A 4DPLA 3I8XA 4LFBB 4EDHA 1L5WA 2QN7A 4RSGA 1BAPA 2P69A 3KXPA 5J47A 3ZI4A 3L7AA 4Q3EA 2PV7A 4Y67A 3V80A 4CF5A 2GA8A 1FDVA 4R4JA 3VNUA 2VRBA 4LECA 2NTEA 3ZDRA 5LQSA 4JLJA 1GVNB 2JCBA 1NJ5A 2HSGA 3B1WA 2Z3WA 4HR7A 3L3BA 4OP3A 4LSWA 1ZOOA 1QHHB 4UW9A 4F9TA 1W0CA 2ADMA 2BI8A 5JAIA 5ECGC 1TF7A 3Q3IA 4HNVA 1LF0A 1WZNA 3NTRA 1BXKA 2L17A 5TQ0B 4AX4A 2IPMA 5FTWA 4GSYA 2GPAA 4I9FA 3ZNQA 3BFXA 3HCWA 4HATA 1C1XA 4P35A 1Z0KA 2IHVA 1GWNA 2BFPA 4J0EA 3AHDA 1LZKA 1DQYA 3C5CA 3ULKA 1CLEA 2YWJA 4GD3Q 4YRFA 5JBNA 1V3QE 4ZVMA 2P9YA 1Q0TA 1T36B 4UFOA 2VRCD 2AHRA 1JG6A 3OIFA 3WSTA 3TIIA 1FNMA 4KUHA 1DXQA 1GSIA 4QFCA 5DB4A 5AVSA 2MT9A 1CZNA 3L05A 4FDTA 4OQQA 4FQ7A 3QA9A 2BZ0A 2VHTA 1WD7A 1OASA 3KU4A 4HAZA 4Q1AA 1NVXQ 4BO6A 5BSUA 1Z82A 3TPZA 4YJ3F 4DMGA 1I30A 1PJLA 2WM9B 3WK6A 2CDBA 3I0MA 3HA2A 1LPNA 3BCSA 1R4NB 3BHJA 4MK4A 3BWBA 2WV9A 5FI5A 2BONA 2PMEA 1X7WA 3CU5A 4D3DA 4F4CA 4Q02A 5HRCA 5DBOA 2IX3A 2Q6LA 3FNQA 3UMJA 1EXWA 2OC4A 2WFZA 2E4ZA 2LBPA 4FCTA 3ZU5A 5LQJA 1A8IA 1V25A 1DIAA 3AB8A 3NUGA 4ZAFA 1RNLA 3L6OO 3R3ZA 4Y6LA 3LWNA 3VH3A 2O5CA 2W6JA 1GHTA 1YKGA 4IHQA 3WMFA 1QRUA 2ZEJA 2XUJA 2C9ZA 4OLJA 1Q7GA 2KLHA 4EY7A 2HR1A 3AHFA 4G86A 2XZLA 1ZSYA 2VYCA 1PWEA 3BRCA 1G55A 3J81A 1KSHA 4JU8A 3F98A 1OY1A 2ZBFA 3ADPA 5EZSA 3K0BA 2WWXA 1EE9A 2ESRA 3U4GA 3ZY4A 2E4AA 1J2UA 3U80A 4P7KA 1UJ2A 5IUJC 4PZUA 4EX6A 3LHFA 2HX1A 4EYSA 3LUPA 2VOEA 2UZ1B 5DT9A 1QYIA 2CWDA 1G9TA 2X4DA 2YZNA 2RAFA 3IVGA 2BEJA 4HFJA 3RK0A 4DSNA 2JLZA 2A94A 2I91A 3O95A 1TCUA 4C4TA 2XYRA 2C1ZA 4PS0A 1YZ3A 1ZBQA 3AJ9A 5EWMA 3UEOA 4Q4AA 2J0VA 1QR6A 3HXMA 1K6EA 1F6WA 1NVDA 3G0IA 4YPOA 3IUSA 3ZU4A 4YXWA 3PF9A 4QBHA 4H60A 5JALA 1NQWA 1IOZA 4OLFA 4MO9A 4RC9A 3S29A 2XCIA 3UWSA 4D4GA 3IXQA 1GVHA 5IDVA 1QYDA 3LO5A 3RS3A 4DLVA 1V2GA 4QOJA 4UULA 3QNWA 2IF2A 5EIAA 3O1HB 4ZKEA 3SI7A 5B58C 1O5OA 4CT0A 2Q0QA 3J81k 3GH1A 3U4DA 3LZDA 3PPYA 4L15A 5A6SB 3G1UA 1KR5A 3MWDB 1FSZA 3DLTA 3FYUB 1WCIB 2VT6A 2GBIA 3GDOA 3GL9A 3OTQA 5CHEA 3S1AA 3VR2D 5JZOA 5BT9A 3EF1A 4A8HA 4YRJA 1G64A 5AVVA 2PZ8A 3HO6A 1H42A 1WCWA 1VXRA 2IYAA 4YVFA 1MJFA 2VCEA 4D02A 1L7QA 1VLZA 3EF0A 1K7XB 2GXSA 4R9SA 1ZJ4A 1YB4A 2A9OA 1F1BA 1L7AA 4AP6A 4GMKA 3B3FA 5D3QA 3TUZC 1NW4A 4B3RB 1HLFA 1UR5A 4O59O 4OHMA 2AR9A 3REGA 1QQTA