2CDRA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cdrA00
2QL7A 2K7ZA 3P4UA 1K88A 3IBFA 1QX3A 5IAEA 5LU8A 3H1PA 3SIRA 4QU8A 1I4OA 1SC1A 3DEHA 1NMQA 5IC4A 1RWVA 1SHJA 1M72A 2H65A 2QLFA 4QUIA 1GFWA 2QLJA 4NBKA 3PD1A 4AWBA 4D3YA 3PCXA 3R5KA 4EHKA 2J33A 3GJQA 2HBYA 2CNLA 2H54A 2C1EA 2XYHA 4NOKA 2FQQA 3E4CA 3V4OA 4NOJA 4IYRA 1RWXA 2H5JA 4PS0A 2AR9A 3IBCA 3DEJA 5IAJA 2HBZA 1RWWA 4LSZA 4M9RA 3PD0A 4ZVOA 3R7BA 2Y0BA 5IANA 5LUAA 5IC6A 1SC4A 2XYPA 4AWAA 5I9BA 3GJSA 4ZVUA 4N6GA 4JJEA 4JQZA 4JJ8A 4N5DA 5IABA 1RHKA 4PRYA 3S70A 4NBNA 3V6LA 1SC3A 3KJNA 1RHUA 3V4LA 2QL9A 3NR2A 4ZVPA 4N6OA 3K7EA 5IAGA 3QNWA 2H51A 5IAKA 1IBCA 3V6MA 1RWNA 1PYOA 3H13A 3ITNA 4PS1A 4HQRA 4JQYA 5I9TA 4NOMA 4ZVSA 4QUBA 4JB8A 3RJMA 4QUHA 4HQ0A 2CJYA 4I1RA 2WDPA 1I4EB 5IASA 3SIPA 1CP3A 1RE1A 5H0IA 4QUEA 4ZVRA 2XZDA 3GJRA 1RHQA 3R6LA 4QULA 4I1PA 3DEIA 5IBRA 2P2CA 3OD5A 4N6NA 2CJXA 2CDRA 5JFTA 4DCJA 4QUAA 4JR1A 4QU0A 4EHDA 2J32A 4PRZA 4AW9A 4NBLA 3EDRA 3D6MA 3KJFA 4FEAA 5LUBA 2J30A 5IBPA 4EHLA 4QU5A 1NMSA 3V55A 2H5IA 4N7JA 4JJ7A 3R7NA 4EHHA 1I3OA 1RWPA 2C2KA 1KMCA 3NS7A 3P45A 3H11B 4JR0A 1RHMA 1K86A 4N7MA 5IBCA 1RWKA 4FDLA 1NW9B 1RWMA 1QTNA 2CNKA 4ZVTA 4QTYA 2QL5A 2J31A 3D6FA 4DCPA 3R6GA 4QUJA 3BIJA 2C2OA 1ICEA 1RHJA 4EHAA 4IEFB 3R5JA 2NN3C 1RHRA 2H4YA 4FGUA 3V3KA 5K20A 4QU9A 4D3ZA 2Y1LA 1PAUA 2XZTA 3NKFA 1F9EA 2FUNB 3EDQA 3R7SA 1GQFA 3H11A 1CVRA 5LU9A 3UO8B 4EJFA 2CNOA 3UOAB 4DCOA 4EHFA 4JR2A 4NOLA 1F1JA 3KJQA 1RWOA 2H48A 4EHNA 2DKOA 2HBRA 1NMEA 2XYGA 2C2ZA 2QLBA 3S8EA 4QTXA 4QUDA 2H4WA 4FXOA 2C2MA 3D6HA 2HBQA 4HVAA 4QUGA 1SHLA 4ZVQA 5IARA 1QDUA 4D3XA 1I51A 3H0EA 2CNNA 3DEKA 3GJTA 1JXQA 2FP3A 1BMQA
chains in the Genus database with same CATH superfamily
1ZQ9A 2CF5A 4L8FA 4YQZA 3SF0A 5FWXB 5AUNB 2FUG6 2IK8A 3M49A 1TK3A 2FDRA 1GLGA 1I2AA 1LB1B 3I01M 5TQ2A 4FW9A 4RHTA 3QUAA 4EY5A 2R7AA 5KC8A 2Q99A 4HDAA 1BHO1 4TKUA 1TYBE 4IOJA 3WXBA 2ATEA 1KDTA 2FMKA 4G5HA 1CCWA 1U4OA 3L40A 1LU9A 4BB5A 4L4XA 5K99A 5JCJD 4BMYA 4LYYA 2RK3A 1MO2A 2XMDA 3WDKA 3WLOA 4K9NA 4X8MA 1C1HA 4PYOA 5DNCA 3KSAC 3ZD6A 4GDFA 1UMCA 1RFLA 3NIBA 5F5LA 5K3CA 4CLRA 3NB0A 5KKNB 3DOIA 3W8NA 4IF6A 3R5SA 3TSYA 1JL3A 2AC4A 4XCQA 2ENUA 2YFKA 2BP7B 3V4SA 4RJJA 1VQ1A 1PR2A 1UBHS 4IFBA 3VGPA 2ZSBA 5KJCA 4NCIA 2F90A 4NZPA 2G1JA 4FS8A 2JKYA 3NHSA 3O9MA 4R1SA 1CJCA 5J4VA 1E66A 1ONNA 3ODPA 1UKCA 2UZAA 3KR0A 3PCRB 4DR5B 3H8VA 4FYHA 1RJWA 4GI3A 4J9UE 5BW4A 5F77A 3WKEA 1XJ0A 2Y27A 5ALIA 1P7CA 1Y89A 5A4AA 4KAXA 4I36A 5DULA 3R3VA 1BSVA 2WZCA 3OMLA 4FQ7A 3ELDA 2XADA 2OOSA 5CLQA 4C4SA 1AGNA 2JGFA 2NSHA 1F8GA 1XD9A 1VBFA 2R8OA 4HGZA 4AULA 1F4LA 3DEFA 2G5PA 1DRUA 4MQLA 5AOBA 4CZ2A 3OQVA 5T4BA 3PQ8A 3F4KA 3DPUA 1AGPA 1YL7A 2PZBA 4UU1A 2PMFA 3SQNA 1QHGA 4OKSA 5H02A 3WSTA 8ADHA 1TLFA 1PZFA 3NH6A 3G5MA 4RENA 3AHEA 1UPBA 3Q88A 1Z6TA 3TEMA 4WV3A 2PKQO 3GAAA 5F3DA 1MUUA 1G2QA 1TK9A 3VAAA 4QOHA 1NVWQ 2JIBA 1G8KA 2XA9A 5FX2A 1D1TA 1NW4A 1CUYA 2XT9A 1A96A 2QD5A 1UZLA 1FP7A 3TMYA 3C8DA 1HYBA 3G6WA 4X20B 5E8JA 2OZLB 3FPSA 3MWFA 3TQRA 4AJIA 2EEZA 2QJTA 2I4IA 2YDXA 2QTNA 2YIMA 4QPPA 4WIAA 2J3IA 2J6IA 4IEFB 3IMCA 3U19A 2WB2A 4H7FA 1DBSA 3IYLW 4LYHA 3B2QA 1V5EA 2JCGA 4II7A 4JOBA 4FMDB 3IAAA 1EX7A 3FBTA 4IHKA 2XIQA 4YMIA 3QPBA 4QHYA 3UHJA 4CL0A 3WK6A 3JARB 1JQ3A 2R6JA 3ZNPA 3QNMA 4BVJA 5K8LA 2BR4A 4KLCA 1KJWA 4UCFA 4Z54A 5EFZA 5BV7A 3RYHB 1R6UA 3HNRA 1YVUA 3VKGA 4KJXA 2XA2A 1IY8A 1WXHA 4QJBA 3IEXA 4PIPA 1SD5A 3I64A 4LY9A 2V1XA 5IHXA 4UULA 3MQFA 2DFPA 4GPBA 2YJ4A 4ODIA 1LUAA 1T1JA 4HDNB 1R10A 2D2XA 4MX8A 3WS7A 2JL1A 2IBSA 2SKEA 1NQ5A 1SIOA 1U65A 4MRNA 4O4IA 4FHDA 4QXQA 4Z0TA 1CUIA 1OV6A 3IOCA 4IHJB 4AO6A 1N8KA 4MWTA 1YZHA 1GT6A 1W44A 2W98A 4EBBA 1QNLA 4OA8A 2BMFA 3GCDA 3T7TA 1IJBA 1E3LA 1EWVA 3K3PA 3R0XA 2C61A 3SYKA 1BA3A 2AOVA 1CF9A 2FWAA 1E79D 1LF5A 1W0CA 2W2PA 2XWJI 3IAEA 1JJBA 3R5KA 4HWRA 4QDXA 3VMFA 3W4KA 3K0SA 2ZJZA 4DKXA 2A9FA 2WMDA 3WZ2A 3ZI4A 1C1DA 4HB2A 1A4RA 5AVQA 5DYGA 1OFUA 3ND5A 4IUDS 4NLLA 4QWMA 4KBGA 3KSDO 1E69A 2D1SA 2A4KA 5CT9A 2QLNA 4MQ4A 2FPGB 1L7QA 4FINA 1DV1A 3M9XA 1JVNA 2QNIA 4YI3A 4G5RA 1SWWA 1T25A 3GB9A 3OE5A 4BO9A 5TS2A 2Z5FA 2LPMA 2W43A 1D1QA 3F47A 5FNVA 4JJZA 3UJ6A 1KOLA 4LRUA 2PANA 4DRYA 2ZS7A 4U7GA 3HJRA 1OZAA 2I2XB 4UZSA 3RHTA 2JGKA 4RL4A 4HZGA 1IIRA 3GFFA 1MZPA 3GXOA 4JQCA 1DAPA 1Y6JA 1DBWA 3UC5A 1O94A 2C7VA 2Y93A 2B83A 4PC7A 4FYMA 3L77A 1VIMA 5DIFA 1YD7A 1W4BA 4AXBA 2VAWA 2CLLB 2RMKA 3KTDA 4HAZA 3IP6A 2A58A 4KFSA 4AM8A 2C7QA 3BHMA 2IUFA 2PZEA 3I2HA 4QUHA 3CG0A 1E6UA 4W7IA 1HDIA 3OTQA 1N2CA 3G2IA 1MJGA 5KNDD 3KQWA 5EUBA 2GZDA 4HH3C 4P7KA 3HP1A 1GPBA 3SOZA 3BQNB 4N7BA 5B1DA 2GA8A 3N2KB 3AF2A 1HFWA 3PHGA 1NURA 4IXDA 3F6EX 1X1AA 3Q98A 5IUJC 3CUEF 2ZJ6A 2BSXA 3AV3A 1XJWA 4FP9A 4OREX 2F3QA 4DV0B 1DKQA 4FBLA 1YQEA 3MNFA 2KW5A 1IDOA 2VPPA 4YLEA 2E1RA 3GQBA 4UBMA 5B3JA 5DWVA 1SIUA 2HHAA 4CMKA 1SCQA 3DLCA 1TEXA 4XWYA 1J0EA 3QELB 2NXNA 2ZT7A 1V7ZA 1CUHA 3CZ5A 1E1YA 5TEVA 1JH9A 4Z4QA 5G40A 1TPYA 2EKDA 1BGVA 2NQ8A 1N2GA 2Q1SA 1DBRA 4HGRA 2C2GA 4ZHQA 2CEAA 5FP0A 3U4IA 3A6PC 3GUUA 4Q1FA 1ZHOA 3H4MA 1FYWA 4IUBS 2FR0A 4G97A 3CG4A 4JODA 1IBSA 4S1NA 5SYAA 1IWOA 4AMGA 1N6LA 3EPJA 1BOOA 1ZSYA 2G67A 3IQXA 4M1TA 4Q3DA 5HJ5A 1NQAO 2CCGA 1L5VA 2CNOA 3KL2A 1GRRA 1DWPA 3QMMA 2AFHB 3OQ6A 4NSNA 4X7RA 4E5UA 4ER6A 1TKCA 1BVHA 5CFOA 1E5QA 1NJ5A 4XD7A 3WMWA 2JGIA 4ARSA 4LK3A 3BK2A 4KPGA 4U5XA 1G3UA 1Y33E 4U00A 4C7JA 1XHEA 4ZO8A 2BW0A 1Q1GA 2AOUA 2DX7A 1JG7A 2WIGA 1X1EA 4JL5A 1ZN8A 3GNQA 4WOCA 5GZ6A 4D3DA 3RANA 3VU9B 3KSUA 3GLFE 5KSWB 2IHVA 2QEQA 4PWYA 1BMQA 3ON5A 4ZAGA 2FAXA 2QF7A 4HAXA 2CDBA 1GZ6A 3G0IA 2IVFA 1R4ZA 2QVYX 3O2SB 4YRZA 4Y6QA 5HP4A 5ADHA 4WVLA 5SY9A 5AHKA 4CM6A 4RF3A 2B94A 2GCOB 1SKBA 4DIFA 2HQ1A 3TECE 4JL8A 1W0JD 5J63A 3GFVA 3EDMA 5JDIA 1JFFB 4IYRA 4FIDA 4PO9A 4MVJP 4Y9SA 1CUBA 3HNPA 3GJZA 3RT7A 3A4LA 5JUWA 5KNCA 4G0UA 3LDFA 4MW0A 3BGIA 1VCHA 3JR7A 3Q41A 2MSWA 3GP5A 3OZGA 5FBWB 2WQ6A 2GH1A 2GD6A 1S89A 3LKZA 3NIFB 3NANA 4LHWA 2AG6A 3IT0A 4V0RA 1XKXA 3FCYA 2JIZA 4BNLA 4F3CA 1ZUD1 3U7FB 2BYTA 4B7UA 3L6BA 4RF2A 3UW3A 5JEDA 1BKDR 2IY9A 1IXSB 5CCDA 1NUTA 4IHQA 4Q1DA 5CP8A 1IHXA 1BRTA 1LWNA 5DGHA 3ZY6A 1I4DD 3N0XA 4GW3A 4GZMA 3BFPA 1UC5B 4U2FA 3TTTA 5L3VA 1EK2A 2AFIA 3ND6A 3DMTC 5J4KA 3KTOA 4DS3A 2FHSA 3KQMA 4FU0A 1VBNA 5EOVA 3JQ8B 5TGDA 6YASA 3ZY2A 1AKRA 3H4IA 3O91A 3ILSA 1WP9A 4DTIA 1OH6A 4NS1A 4Q1VA 4DJFC 4G1VA 1ZN7A 3F90A 4NHEA 5L3QB 1TADA 4DMCA 4HUTA 2NSYA 3HYSA 4G5QA 4UHJA 2QJWA 4I81A 4JYBA 4J1QA 2WWWA 2JJ1D 5AW0A 5C2JB 3RWMB 4TYNA 4KQ2A 1FSPA 1TVKA 5LSAA 1Q7RA 1JSZA 4UHDA 5JYDA 3RU7A 3I5YA 4HS9A 4I19A 3F71A 3E5HA 1W25A 2PS9A 4MO9A 2IHNA 4AJOA 4DOMA 3SF8A 2WNSA 5KYVA 1TECE 1WB9A 1LVGA 1RLOA 4PO3X 3O4RA 4Q05A 2TECE 2QYTA 1D07A 1EJ0A 4UFPA 2PKWA 1ZGHA 2YV1A 3FCSB 4YJ3B 2G9NA 3A9SA 1T3TA 4MWZA 1DTSA 3ZE8A 3NUZA 2ADFA 1E62A 4MW1A 3D9QX 1XAGA 4JVLA 2Z6AA 3C3YA 2YVQA 4EABA 1XYYA 1PZXA 3O8QA 3ILYA 1KJ8A 1NRXA 2QWXA 4DYDA 3T3MB 1R5NA 4RH1A 4LCEA 4AMYA 5KYUB 2G8NA 5HKKD 2HF8A 4HWKA 3I2IA 4KDEA 3GAFA 4OQZA 4NENA 5ALLA 3WJ7A 1CUWA 3DZ8A 3NASA 2YZNA 1XEXB 2I99A 2GHRA 3BZBA 3FR7A 2Q8NA 5KCZA 4DBLE 4KXNA 4K9LA 4CCYB 3RTCA 1Z8DA 9LDBA 1BQ3A 1NV8A 4N5HX 2C2HA 4REOA 3AW9A 5DWDA 4DIMA 1IM5A 1XDSA 2Q50A 3KAQA 4FE4A 3SYTA 2BCEA 5KBYA 5IULC 4IIVA 3MRXA 1WETA 4ZDIA 2A6PA 1MH1A 2GK3A 1TMKA 3HYLA 3KJIA 2GJ8A 5F23A 1EVEA 1WG8A 4JYZA 3IAS6 5LL6P 3RAGA 1DAMA 3GZNA 4HPWA 1OZGA 5C5DA 1SKUA 4XX0B 2ALJA 1I9GA 1IN1A 2LWIA 5A5VA 4V0NA 1GZVA 4WCDA 1EXMA 1QHFA 4WFJA 2J5XA 2UZ4A 1QF9A 2X6QA 2JGDA 1NFFA 1PS9A 4B0PA 3DLIA 4K03A 4C3OB 4EATA 3LVRE 4QTUB 3WDMA 5HILA 3RHZA 1P1HA 2DE0X 3L0IB 4UNSA 3JSXA 1F2UA 4QTZA 3KXDA 1J4AA 3A10A 3AT1A 2ZXUA 3VDNB 5BORA 1NXXA 5TV2A 4ENQA 4U0KA 1A9YA 4TVOA 2B9VA 1SQFA 1OLOA 1F51E 1CUSA 1DELA 2I6QA 3N7AA 2HADA 1BJKA 4ESOA 2PKQP 1E9AA 4E4RA 1DINA 1IOZA 2CXTA 2BTQA 2QUJA 2PGJA 1RVV1 1XRRA 2HLDD 4J0HA 4PZUA 4QAJA 3ZOZA 4D44A 5BSVA 3TNYA 1NJ1A 3E82A 5T3UA 3AKZA 4AQDA 1QZ3A 3U40A 3RASA 3BL5A 5AM4A 2IP1A 2HWKA 1OQAA 4GEGA 2JAHA 1YQGA 5LLSA 3ZU6A 1GTJ1 3DF9A 3K09C 3FJYA 2WWRA 5GV7A 3NEAA 4XUDA 4TXHA 4TSRA 3UBTA 1G3QA 3T7SA 3OWOA 4J4HA 4OMUA 4N5NA 1BFUA 1JDPA 4OGWA 4PC6A 2LDXA 2Z3WA 5BSKA 1RRVA 2DAPA 2J3DA 2P2YA 4HCJA 4YRFA 4RDXA 1H66A 3DBRA 4MDFA 3LY5A 3BGOS 1FS5A 1P4JA 5ICSA 2BCJQ 1KQFA 4JITA 3AJEA 5EIXA 2ETXA 3EPLA 4NZMA 3LC0A 4WCFA 1XNGA 2GHTA 4PC1A 2P2CA 2A5LA 2PGOA 3IJPA 2CDRA 1MF7A 1U7HA 1ZK2A 2PKCA 4TV8B 2IRWA 3DE7X 2G1PA 2QP3A 3V1NA 3PFFA 3WHLA 1A4IA 4P81A 3X44A 1GNQA 1UXJA 1I6WA 1OU4A 2PTGA 3UMRA 1PL7A 2PN1A 4U7DA 2P0YA 3AEYA 3CVJA 1SCAA 2M9MA 2Y4OA 3SSAA 3TUZC 4TTTS 1OFGA 2DHRA 2ZT5A 5EXSA 3S2IA 1KORA 3EIOA 1MX1A 3IKLA 5JAQA 1E18A 3H2IA 1BQEA 4G01B 3V1YA 3VR6A 4ASUD 2WWHA 4O1MA 4ZGGA 1L6RA 1MBZA 3KQSA 4S1VA 3RKUA 2UYYA 2H1CA 2O50A 4BAGA 4Y0NA 4CKWA 3G8DA 2VQDA 2JFGA 2C4UA 2BMVA 2VPWA 1J39A 3MOIA 4J2OA 4RWEA 1Z6ZA 5IM4A 4BKQA 3ZDBA 4TXNA 2VPYA 5J5CA 2A94A 2OB1A 4QM7A 4KB5A 5E6RB 3HXKA 4K9MA 1PE0A 1YZLA 3B6EA 1AVTA 1Z33A 1FJHA 4PCVA 1LLUA 4I9FA 1ZVMA 2GKGA 1Q95A 2X0RA 3NTQA 5CB4A 1FP4B 5AI4A 3THXB 2Y0CA 2NU7B 4R8MA 3SIXA 5IKEA 2ZR0A 1Q1NA 5KINB 4CG2A 5I7SA 1I7LA 4KWCA 4NAUA 2YS6A 5EPOA 3RVSA 2ZSKA 1W2HA 3ICCA 3KKNA 4MRPA 4F4HA 2VQEB 4IJUA 1SBYA 4Y1RB 2FFJA 3UAWA 2EDCA 4L57A 3ABRB 1DHTA 2AMVA 2QT9A 3ETDA 1IATA 4CNQA 1DC5A 1VA4A 4LF7B 2QL7A 2ZBQA 1FTSA 1LBQA 1E2QA 4K9SA 3RS8A 1CD5A 4D43A 1OLXB 3N3AC 1UR5A 5A71A 2HSGA 3THRA 2V6MA 5H80A 3O5AA 4C4AA 1C3OA 3RRMA 2GCPA 3NNSA 3ZQJA 1ODCA 1YI1A 5HTOA 4GKKB 1GFWA 1P4RA 3KE8A 4ES6A 1U5CA 1C7IA 3QVSA 3LBNA 5JPDA 1AHNA 2L42A 3I32A 1LLCA 3CR3C 3HQ4O 3IAM6 1QTRA 3O6VA 4IKOA 4OV6B 5M04A 3FTEA 2QX6A 2ZYVX 4QVGA 4ZHQF 2CNWD 2IKQA 1T8RA 1RWXA 3KJXA 3ZCRA 2ETVA 3REGA 5JRJA 2WSLA 2CXOA 3C24A 3EA5A 2IPXA 4TKUB 1XN1A 4DMUB 2B30A 2X5JO 3NQ41 4LZPA 2I1QA 2WJWA 3K32A 5ES4B 5D6NA 1EE9A 2QI9F 3EPHA 1V3UA 5EPUA 4FTWA 1J2YA 2E7ZA 2GJKA 4E6EA 3BX1A 5A2GA 3HSKA 1EFRA 1ZGJA 1BFDA 3DM5A 2ZM5A 4W82A 3PWKA 2H9IA 4V0ME 4ZAVA 3L41A 2HB6A 1UMCB 2VXOA 2XNHA 3FMVA 3OCYA 4P93A 2XXBA 3PS9A 5F4ZA 5I5EA 3KVYA 4XYBA 1V16A 3HEBA 3U13A 3VR5H 2W8BA 2YXDA 5FLXA 1GKLA 3NUGA 3OTOB 3DTNA 5CB8A 1AK9A 4PCAA 3TDKA 3CPJB 1HM5A 3ICWA 3S99A 4BFVA 5K01A 4IF4A 4FR2A 4DW8A 1NSTA 3ZK7A 1W34A 2D8AA 4MWEA 4BMCA 5ADWA 1U7ZA 1CUVA 1ILEA 2OILA 2Z8YM 3M83A 4TTQA 5CK4A 1QO0A 3L4EA 3PC8A 1Z0DA 2VFAA 3TZEA 1G59A 3TL3A 2BEUA 3AUUA 3QPUA 5G3ZA 3U49A 2N0SA 3ZYZA 5CHEA 1PJBA 2C94A 4P9NA 3T9BA 1E20A 1E1QD 1P73A 4BJ6A 4HYEA 4I2NA 5ARBA 1RRCA 3U4MA 3QEKA 1VPVA 3FCAA 3OIUA 1VP9A 3EGXA 1H2ZA 2QZZA 3CR8A 3O1JC 2GMWA 5DH9A 2HPHA 1NSYA 2OWEA 3AEQA 1MPXA 3ZCSA 5LLDA 1VE3A 4B83A 2OLJA 4MINA 4BVEA 4BFYA 5EJ7A 1DARA 3AIIA 4M99A 1JFTA 2GEUA 4IDHA 3RSLA 1C1XB 5AP9A 3D6FA 3ZJ5A 5K6TA 2JZCA 2YVLA 2ORVA 1VJTA 1RHJA 2D5AA 3GVXA 3MJFA 4K7JA 1RADA 1CV2A 3DDHA 3N0VA 1I2MA 2EJBA 2EJVA 3EZFA 2P62A 1W581 5ED0A 3WRYA 1ACLA 3H0KA 3N76A 3TW8A 3VGJA 4WJKB 1HNXB 4URYR 3HA5A 2HIHA 3PVZA 5ENVA 5K3FA 1AXGA 1ZJWA 4YCDA 1JPVA 3HUTA 3PR3A 3EYAA 2M6KA 4J2TA 1NW5A 1N9ZA 4NOLA 5BV2P 2Z58A 3MHPA 5FF9A 5DM60 1JNXX 1DOHA 1X19A 4CF4A 2J4DA 1FP1D 3C6YA 2IF0A 3PNLA 3II6X 4JEHA 2QZPA 1PG0A 1XK6A 2VYVA 2C2MA 2FSFA 4RPCA 5BYJA 1M1ZA 1YVPA 3W3AD 4HUQA 3AZQA 4K2HA 3JU3A 4X6YA 3STUA 1IXYA 1JA0A 4AQYB 3GJTA 3KALA 4YRJA 5LWQA 4FILA 4FONA 4YPFA 1SGWA 3BA1A 4IJMA 4MV3A 2NZYA 4G65A 5BYAA 3DBOB 2V7QA 1R6DA 3NRCA 3PJFA 3W7AA 2MMGA 2UAGA 2EZTA 2NUBA 2WYIA 3H8SA 4FEEA 3F6PA 5HRAA 1A7AA 1MB2A 1DI0A 1P72A 2D5LA 2RJ3A 2VBIA 2ZIVB 3NHJA 3P1JA 4H77A 4O4IB 4R3UC 5I7OA 5JXWA 2DJIA 2OE2A 3DC2A 2X2PA 5K0SA 4Q4AA 1SUPA 4IUYA 2V96A 4Z0PA 1ECGA 1TD1A 1QH9A 2A57A 4MEAA 5A4JA 3ZVNA 1EQAA 4KW7A 3G0BA 5DLPA 2XOKA 1TVEA 3ADOA 3BKXA 3LUDA 4J49A 4X44A 3UUWA 3NV7A 4LWPA 5ECDA 3WLRA 1GZDA 1W35A 2GO1A 2GKOA 3BAFA 3ZU5A 4KDRA 4AJ4A 4D0SA 1LD3A 1ZVJA 3CF0A 4R8LA 1GHTA 4X71A 5D84A 2FSGA 4P98A 4I08A 4U2KA 2CYAA 1C1DB 2OYSA 3WLEA 1VCNA 3P9PA 3TQQA 1RHUA 3OOEA 4RJKA 4K9DA 3RD5A 5E9WA 2H57A 1N6PA 1Q0UA 1C3LA 4NMLA 3C43A 1UFOA 6NULA 4HF7A 1AH2A 3EUAA 2L19A 4AP5A 1OXUA 1I7QB 5FAKA 5FNVB 3TIFA 5HK8A 2JIQA 2IE8A 2AYZA 5FQOA 3WGOA 2C1ZA 5K9ZA 2O6HA 2WTBA 2P6UA 4DDHA 1HT0A 2CKDA 3WNZA 3QK7A 1JYEA 1ZD2P 2FSHA 5CNKA 3COZA 2VR1A 1UMBA 4LIPD 1N7GA 3TGLA 5KHOC 1VLMA 2FQXA 4DCJA 1Z4OA 3NNDA 2JCXA 3KYIB 3ANNA 3TNJA 3BILA 2Z30A 4KKXB 1XYGA 2FETA 4Z1MD 1BH2A 1JBQA 5EP4A 1KU0A 3G6KA 3NIGB 1QLJA 4NVRA 3I5AA 1TDJA 4H4CA 3T0FA 2XDAA 4GI2A 4DSOA 3PSHA 1KXZA 1KZ4A 2VJLA 2XQKA 4JLWA 5AK4A 5EJFA 1B76A 3FUVA 5FYDA 3W9BA 4MA4A 4CQMD 5IBCA 5JMOA 3SFVA 1AQNA 3UMYA 1FYDA 4X1IA 4JC8A 1VE7A 2ASVA 1FJ2A 4FXPA 1UBUS 2PBRA 3GQBB 5I7EA 3O8OA 2GSWA 2WT8A 1J8VA 2PUTA 1N7JA 2WWIA 1EU1A 3WSWA 4EL0A 1GKKA 2YWCA 1OXTA 4CGZA 3CUUA 2EWMA 1Z5GA 3N2LA 4RZXA 4RSRA 2IS1A 5D5PA 5K2MA 3X1KA 1EWTA 4BJHB 3VOTA 3LGSA 4WH0A 5ALEA 3W2IA 1EVZA 2FWNA 2WOJA 3DYVA 3PC7A 4I9NA 4Q12A 2DHDA 4YCJA 1KPGA 4UJ5A 2ZVPX 5DSXA 3G82C 2Q6IA 4NYMQ 3TKYA 3B12A 4FIZA 3LFHA 5JAUA 2H1IA 1E1DA 3UY4A 4EPRA 2D0IA 5TGZA 4F5WA 1I10A 2B1JA 1T0UA 3C3CA 2FV8A 3L07A 4GX5A 4OQLA 2OYCA 4UBOA 4DUYB 2AOUB 2RGAA 3EXEA 4U6SA 2VHWA 3BE4A 3GUCA 1UXKA 3VZCA 1L4KA 2IGTA 3C87A 2XWBF 1DOAA 1YC2A 3BWVA 1GPDG 3OM9A 2JAUA 4IGKA 1FRVA 4ZOQI 3HR4A 2GBLA 3QA3E 1Z0SA 3TRHA 4WD3A 2KLBA 3HMQA 2HBYA 3CLTD 1GL9B 1D6NA 2BBOA 3UOWA 2VYFA 4MRVA 1A2BA 4WXHA 1O0CA 1XTUA 5IM4F 1XXHA 1HLGA 3ONWA 4HXGA 4BCCA 2OHGA 3E1GA 3W3AH 4F04A 4B6FA 1SC4A 2HO5A 3CMMA 3TTSA 5M34A 4O5OA 4QHTA 4QPZA 1H5QA 3RUPA 4ZCTA 3BS4A 3QWAA 2DUUA 4N6GA 1K92A 3F8SA 3G9ZA 1RBYA 5EIFA 3EXFA 4CFZA 3Q7SA 1XZDA 1A4XA 2N42A 3SMVA 3PFCA 2GM5A 4HFRA 1B6TA 2GM4A 4LXIA 1O97C 4WMLA 1D3AA 3NORA 4ZXPA 3D7KA 5AJXA 2A0KA 2QORA 3I37X 5JCOA 4BQNA 1YKGA 3O4JA 4Q37A 5DNWA 1RACA 2Z6QA 1NXVA 3SYMA 3DGEC 3RARA 1PK9A 2GARA 3E8MA 4ERNA 3MC1A 3NW9A 1RI4A 3L9WA 1ONPA 4Q9HA 2ZPAA 1DG9A 2QDKA 4FOTA 4R5HA 5DSTA 1NU6A 4DLKA 5CITA 2VXBA 4HXEB 1E99A 2C88A 2AFIB 1ZGGA 2GXSA 2PL1A 5IH7A 3MINA 1IEVA 3FFXA 1BMFA 4J6FA 4Q4DA 3L6OO 4YCMA 2X8AA 3HH8A 4A5OA 2PSSA 1PGNA 3RS0A 1OBFO 1QPGA 3GPCA 5MDHA 1QQBA 3SY8A 2BGGA 4EEKA 1L7PA 4G0QA 4XQ0A 2QGNA 4EGSA 1SHTX 1KQNA 5IMBA 1T6XA 2ZWPA 2G08A 5D6OA 1MQ8B 2YV5A 5FPKA 1S0UA 5DI9A 1F4VA 2ERXA 3MMNA 3W5CA 2IA5A 4Q3LA 3IPAA 4NCJA 3KD3A 2YN2A 3H11B 1JBEA 3FHTA 1ECPA 1I4WA 3WGIA 3JALB 2WJ3A 2A1IA 3EZ9A 2Q3HA 3DE0X 1A9RA 1MAVA 4ARCA 2H4XA 3SF8B 2VDKB 3R8CA 1RI1A 2JJ2A 1EFVB 2O2IA 3HUDA 4UAJA 5FR2A 2C2OA 3EH2A 1WSWA 3JYOA 2R68A 3V3KA 2P3LA 3KUUA 3T3GA 2OHOA 3VISA 5JZ9A 1WKVA 5K51A 2ZULA 4JBNA 4JGGA 1OF1A 1BYUA 4TTPA 2APJA 3SP1A 2GEVA 1FUEA 1O96A 2H29A 3KFLA 5DDIP 1OV4A 4J91A 4F2HA 3Q40A 3GRCA 4JBGA 4DLTA 1PT8A 1MHTA 5JFOA 4BAUA 4I1IA 3O8QB 5T4EA 5LP1A 5EHIA 1WVGA 2REQA 2BUBA 4K28A 5FTNA 1DIRA 2IBTA 1RIFA 4PFQA 2D7DA 2HQRA 2XBLA 5C7LO 1V6SA 3L4JA 2UXDB 3G5AA 3D4LA 4NENB 2XB6A 4O5AA 2HJGA 4M0CA 4UVDA 1U0JA 2ZRCA 1H2HA 4PRLA 5FO0A 1XMPA 4D3SA 1SXJC 2ZWOA 3FTFA 3P9SA 1KVUA 3K1YA 3KQOA 4GO1A 3WTBA 1JHDA 1EJ6A 4D45A 1A69A 3LBFA 3SS8A 4UPEA 5EHZA 4WBXC 2JKZA 3UK6A 1V6CA 5DHRA 3UPDA 3Q8KA 3BT7A 4W5TA 2L69A 1ORIA 4MVJM 3QH4A 1TUEA 5D3ZA 5KKAA 1OH7A 3VH4A 4R8VA 3IPXA 2ZZMA 3P2KA 2HV9A 3C4VA 1UPUA 2V0NA 4II2A 3HJCA 4ZI2A 2QE6A 1KO1A 1WMAA 1QYDA 3OEYA 3GZNB 1TI7A 5K3OA 2QSZA 3QFCA 4HN9A 4PS0A 2Q5LA 2QM3A 3U3DA 2KS6A 3OT5A 5CDFA 1XU7A 2HUPA 2HK7A 5IJ9A 1UINA 2C8LA 4BX0A 2JGDB 3O38A 1SXGA 3O8NA 2E82A 3KDSE 4H08A 4LJRA 1E5DA 1ODKA 2P4SA 1CETA 2WWFA 1G6Q1 2IP4A 5AESA 4XR9A 3KYDA 2PYIA 1ADCA 1N4AA 1R64A 2Q3JA 3MVEA 5AJHA 4LDAA 1YU9A 1U0OC 1JIQA 4WHMA 3A7EA 4KH1A 2DOKA 3I6BA 2AI3A 2OV6A 2VLBA 3DTYA 4R98A 2IYFA 3LY8A 4YYZA 1SVSA 3HFSA 1VG0B 5BW8A 1GDTA 3IX7A 2VXYA 4FMBB 4PZYA 5L40A 1WF3A 1IEWA 2BTQB 1QVAA 2QQ0A 3B9QA 1SVWA 1GADO 3C8HA 2RGXA 1UJ6A 1Z26A 8OHMA 8MHTA 3A7DA 3JQ7A 1XP8A 5H7XA 3SR3A 1F3OA 1J20A 1JR6A 1GARA 2D59A 3DVAA 1ZM3A 3H3JA 1BE8A 4QUBA 6LDHA 3JQDA 2YHIA 1P62B 3VU0A 4ZOLA 5IASA 4BY9E 5KDOA 4DY6A 1GZUA 1K9VF 2AS0A 4RFSA 1ID8A 4ALMA 4ZT4A 4QULA 5F51A 4X9XA 4ZVVA 1TM5E 4G0WA 4N8SA 2M6RA 1RD4A 3OOJA 5AOCA 3UHOA 3ZLJA 1C3JA 3ETCA 1B73A 5JYBA 1I36A 3ZHXA 3EG5A 1NTOA 3SK0A 1NPTO 4US0R 4W5HA 1JFVA 3WNVA 1RQNA 2F3PA 4IICA 1I5OA 1IN5A 1UMDA 1OT3A 3AVQA 3QKTA 1PEDA 4WCFB 1KMNA 1SBQA 4F9TA 1RWQA 3CWZA 1I7DA 1T2NA 2XKKA 1G6KA 1F20A 5U1PA 1CQXA 1KMCA 2C95A 5ALXA 3NP7A 1ZFNA 3G13A 3VH1A 2PXXA 2QTFA 2GF2A 3DL4A 4P80A 2ORIA 3OICA 3N5KA 4WDRA 4IDOA 1KI3A 1NDQA 2GN2A 4FFDA 4J0JA 1DOZA 3A2NA 3IT3A 3REFA 1XCBA 1WZNA 1T9DA 2WU3A 3DLPX 4ZAFA 5K3BA 4GKJB 3D7LA 1UDCA 3AUYA 2DWOA 1YQWA 2W4MA 3LUGA 3FUTA 2E0IA 4B87A 4YJHA 3IVCA 2IH5A 4O0MA 4BX3A 2FPLA 4CKWB 1RXVA 3DDOA 4EHFA 4LOLA 1TW2A 2HNBA 2CXNA 3NYIA 3G59A 3LD9A 5LR6A 2CLCX 4LYJA 5JAPA 4GLJA 3W2GA 4FDUA 4TSKA 4XYEA 1U3UA 1VSVA 2LZ0A 1OD6A 2QMHA 5DCLA 5GINE 3NU1A 1DC3A 1G64A 1S3GA 5A4MS 2QAJA 4CEIA 2ZUCA 4EO9A 5CB4B 3EMVA 1YMQA 2AB0A 3H0EA 2HEIA 2BR3A 1LBSA 1O58A 2QW1A 1N6KA 3A0RB 5SZKB 2E1PA 3ZXUB 1OYVA 4G07A 3S0JA 3TD6A 3ZK9A 4K6MA 5A03A 4QLOA 2D7CA 3QENA 1QYRA 3PF8A 1GTMA 5KIAA 4XSHA 3QVJA 4JLSA 1YL6A 1V25A 1VE1A 4D0GA 2MT9A 1KZGB 4RK1A 4IJVA 3RVQA 3PPWA 3NOXA 3BCHA 4ZC8A 2YINC 3VQTA 3LQ2A 2XW6A 4FYYA 3USES 4CG1A 1YB4A 4FT2A 1WRBA 2O3TA 4KLNA 5JANA 1L5OA 5F7JA 5ILGA 2J45A 3G8AA 3JZIA 3E4CA 3FSRA 1C3OB 2OEPA 4C7OA 4LBYA 4JVSB 4JASB 4BPRA 2WVAA 3A4TA 1GFSA 1SK9A 2V59A 1SO8A 1HL3A 3ASVA 4P34A 4PNZA 3T1OA 4EELA 1ZA2A 1Q7EA 2FSSA 2XQJA 1JIJA 3EVGA 5H3LA 1D2EA 1N34B 5HF5A 3RF6A 2ZQZA 4MDHA 4G36A 2GTPA 5IABA 1JG6A 4NJEA 5AVRA 1W87A 1KQGA 4M9QA 1VGRA 1ZHFA 2XTNA 3AINA 3A4YA 3BDIA 4G85A 1WPRA 4QWWA 4RADA 3GAZA 1YA4A 5EE9A 4ZVPA 4UPDA 1C3EA 1OT5A 1MGPA 2EHDA 4MV5A 5CJPA 3W4IA 4LJKA 4QBKA 1II9A 1E2JA 1V8FA 1CJMA 3NO4A 5H4GA 2JEZA 1EM6A 5K4GA 3OZXA 1QHYA 1XLTC 5GMOA 1AKTA 1UBMS 3HCOA 1FYVA 3QGMA 4L9SA 3RT1A 5EA2A 1RKVA 2BEJA 1R8QA 1VKZA 1IB0A 1ZMRA 3UXEA 2R0QC 1MXHA 3OA0A 4FR0A 2H3EA 3UHFA 4H9GA 2W8BB 3EBLA 3U4GA 5THXA 1I1NA 2JJQA 3OJCA 1D2MA 3FOAA 1E2PA 2VBFA 3F5DA 4JMLA 1HNWB 1O1YA 4WXPA 4E2XA 1UXOA 5G0WA 4EECA 2FPIA 3IULA 3U9SA 1FTGA 1AGRA 1M6YA 2XMRA 4U39A 1VE5A 1A9ZA 3AHFA 2EDAA 3GDHA 4A0GA 1CUFA 1MP0A 2CWDA 2X0EA 3NWOA 3HE3A 4JI8B 2FWIA 4TS3A 3M1IA 2P40A 4GPIB 5F12A 1J8YF 2MSLA 2BEUB 3AF5A 3ETJA 3JQ9C 4KZPA 4D8TA 1TUGA 4LYEA 3TI9A 4NCAA 2D00A 4YP0A 3NDBB 1YK1A 2V5VA 3ZWCA 1P2GA 3JZFA 1DAIA 1QIMA 3OUTA 1OMOA 1SCKA 1WHSB 1UK7A 2F8MA 3C8ZA 3E7FA 4MGHA 1O94C 3MERA 5MN6A 1R0SA 3EGXB 1JIUA 4G81A 3GP8A 1BJRE 2FXVA 2GS9A 5FLYA 4Q9LA 4D42A 4H2DA 2DF8A 1QHXA 2PRKA 4G4JA 1VTKA 3OVMA 3W04A 4B4KA 3EDQA 2Y1OA 1AZWA 2OBBA 1M2FA 3K5HA 3NBQA 4AJNA 3RAPR 2B6HA 2QOEA 5IRCD 3BCRA 3Q7TA 2FW9A 2ZU6A 1VGQA 4QBTA 2B2CA 3OJOA 1WU8A 1SVIA 4NMMA 3W7VA 4GFDA 3E3NA 4GICA 1OC2A 4OQQA 3TW8B 1Y1RA 4HYYA 1PT5A 4GX1A 5K3FB 2HSWA 4G09A 5K8VA 3COWA 2BC9A 3RKRA 4FFVA 4ZVQA 4EYEA 2VP6A 5LZ4A 3DG9A 2Q9AA 3EDYA 5GJBA 4QOEA 1QMGA 5FI3A 4EW1A 1EKXA 3IP9A 1HH4A 2ZJAA 3IJEB 3ZOKA 4ZYVA 4CODB 2BI7A 3PWSA 2ACVA 1P2BA 1UDWA 1NYRA 2I80A 3HP4A 3U9LA 3NUQA 4EUNA 5KVCA 2PQ6A 5KWIA 3C1OA 2ZIFA 1G0NA 3BFXA 4HUQB 4DYHA 2VWHA 2WIDA 4JP3A 3CRMA 3R44A 4N5LA 4KXMA 4F5DA 5EZYA 4O3MA 1QIGA 3OIGA 1QG6A 2G40A 4JMPA 3HLYA 4EEZA 2G7MC 1KARA 3TMAA 1XD2A 2W2XA 2ZI7A 2QTVA 4PM4A 2R7NA 4HL6A 4LCJA 2FGKA 1V9SA 3CNOA 5FUBA 4ESHA 1G3MA 2QTLA 4CVNA 3KQLA 2HA4A 3QX3A 4YXWD 2QI9C 1M2KA 4KWEA 1UADA 4NWIA 3UB3A 4A6EA 1ZCBA 2Y0EA 4H6WA 3EQ8A 2YW9A 3OE7A 3OZTA 4OKIA 3EVAA 3T5BA 4C4TA 2FEAA 4NU8X 4EK9A 1VYTA 4YROA 3R76A 3G5LA 4PGGA 5IW8A 1ZMTA 2EX0A 3MJDA 1DCKA 1F4PA 4UDXX 1H2AS 4QKQA 1PDOA 2YV2A 5AVTA 4B35A 3HBJA 3STTA 1I94B 4HSGA 1R6XA 1P7VA 2CVHA 2ID4A 2HK8A 1OXSC 1WE2A 4D0RA 1AMOA 2QUZA 4EARA 3FOEC 4EW6A 3MB5A 3DHYA 2IDZA 4OQXA 4UM7A 2PMKA 4CDRA 3AL3A 2GYWA 2BZ0A 3PPXA 1BD3A 4KN9S 1PG5A 2HFKA 1MB9A 2I6FA 3LS2A 1Y4DE 4EI2A 2EC5A 3QXCA 3DMYA 5DO9A 1VP3A 4DC0A 3P7MA 3KQUA 3PBKA 3AP3A 3BMOA 3AV0B 5JDIC 4ZZ1A 4DZZA 4WY8A 1IVYA 2B2XA 2CXXA 2G82A 2WM2A 3A3NA 1ECJA 3IAHA 3IUNA 3ZCXA 3BMQA 2ZUTA 3HB4X 3I39X 1YS6A 3RJ5A 1QH0A 4JP8A 4G0VA 5LQNA 4OO3A 4D9FA 9LDTA 1H0SA 2J9FA 3FDZA 5T7BA 2I7CA 1WOMA 2PX6A 5CCXA 1UMBB 2D6FA 4JJ7A 4YRTA 1CRPA 2ZJBA 1FNCA 4IH4A 4MYUA 4YDSA 2JFUA 3DXFA 3JZMA 4LMRA 5FUXA 3NBZC 4UD6A 3SOPA 2G7ZA 1JJFA 4K6GA 4M54A 4I5EA 4GYKA 3TUIC 4HGQA 1NM5A 1J97A 1Z5WA 4M1EA 5AHRA 3KDAA 5B4TA 3A11A 5CLIA 1ENYA 5TARA 4FDTA 2IYAA 1ONOA 2Z9BA 3QBJA 5CBPA 5JYEA 4DHWA 1N75A 3KQHA 2AK3A 1YWGO 5HKOA 3ULKA 4F1JA 2JBWA 3ZDCA 1YA6A 1PN3A 4LDZA 1J9EA 4KP7A 4D99A 2Q4OA 1WX1A 1OIVA 1TMGE 2QW8A 2G4LA 4ZOLF 4RTJA 3O8OB 4BECA 1PBNA 1N0HA 3KJQA 3WLQA 1GRCA 1IMJA 5JD4A 4LE0A 4ZI7F 1JP7A 2W2MA 5TXGA 2CL6X 1NA5A 3AQ4A 3HCPA 4UAUA 5D1HA 5CIYA 3IQHX 1YBMA 2IU3A 3BIFA 1NBHA 4BLOA 4PQGA 3ZTTA 1CR2A 4F60A 3OH8A 3FIJA 4G8CA 3HZZA 3EF0A 4LGMA 2HU2A 4MS3A 5EJ4A 3TSZA 1JECA 2OL4A 3KOUA 5IN4A 3H2SA 2BRUC 1NZFA 3CRW1 5LQKA 3CH7A 3OP4A 1FFHA 5EJMA 3B9RA 3HABA 5BMVF 1P91A 2FDXA 1QDLB 4HLNA 4JI0B 2VNSA 2WKRA 3OTGA 4KGZA 1R4AA 1D6JA 3Q2IA 4D41A 3LI2A 2FKNA 2NTVA 2H59A 3ETEA 3UJ7A 4JQOA 2YVAA 3PD1A 3K2IA 2JFOA 3OAAA 1QQ7A 1A8UA 3PXCX 5K0LA 5B57C 3GLUA 1U0TA 3GT3A 4NOKA 1WO8A 2Y8EA 2NYRA 5BW6B 4A7PA 2JATA 2X0KA 3EXEB 1TX4B 4FT4A 2WWGA 4PSCA 5HEKA 3FOFC 2ZB3A 3AH8A 1R4MA 3KELA 4J76A 4N49A 4LHEA 2IIVA 4G9EA 1IQUA 2ZSFA 4UNQA 1Z2PX 4ZJZA 5DASA 2B1QA 5JFGA 4TZ6A 2W6JD 1YRLA 1RI3A 5TMEA 2LR0A 2Q29A 3B70A 4EMTA 4NYIQ 3MA0A 1MG0A 5IKMA 2R7MA 1RABA 1XTPA 1XXHB 3EVDA 4NRDA 2O3QA 3ISJA 5ALWA 5GJWC 3TZKA 4YBRA 1L7EA 4CUJA 1Y1QA 3DOUA 3FTQA 3GGDA 3B1KA 3UMMA 4Q24A 4DLZA 4HNVA 5LMUB 1UBKS 3I4LA 3OEWA 3B52X 4LAFA 1G2IA 1ULAA 2C8JA 1RAEA 2X6RA 2NPIA 3B48A 2QZ9A 3EXFB 4MQEB 1O89A 2DH6A 1RWNA 3GRVA 3KEGA 4MV1A 3W77A 2NP6A 5FLKA 1G55A 3A1VA 4DLAA 2GERA 3WP0A 5CYOA 3PIDA 4HFMA 1F1BA 2DETA 2GPJA 2XAUA 3T4XA 4OAQA 4FZRA 4CHTA 3INTA 4EBFA 4KREA 3LHIA 3H9UA 1NDUA 3SICE 2NVBA 1F6WA 4WUVA 1H05A 2O4CA 1V6AA 2B5OA 2JAXA 3H5NA 3WLSA 5B58C 3ER8A 5KPJA 4HRAA 4IIJA 5J5AA 1L5KA 2ZT6A 1JJAA 1KAHA 2H4HA 3BAZA 5HZKA 1JDNA 2E5WA 2Z4TA 5FOSA 2CCJA 4DDVA 1AQYA 4C0XA 4XGQA 4P32A 1IMOA 2XWSA 1OWPA 2VDNB 3MINB 3TTYA 2RE8A 4OK5A 1Z15A 3DZBA 1NUUA 1C9EA 4EYOA 3IVRA 1QR6A 2F3SA 2PA0A 3N2YA 1K8QA 4DV2B 1FIUA 4HX9A 2C2BA 1ZVKA 1Q21A 1EFLA 2H1LA 3FFTA 4TTVA 3SQMA 3VPGA 3ZZTA 3UICA 2Q6TA 2FN4A 3BJRA 3UAOA 4RIFA 3J80A 4HADA 5KDDA 4O2AA 2FWBA 2Q4TA 1N0UA 4PSKA 3UG6A 3QYPA 3C7TA 3CX6A 2WNIA 3AXSA 3IQDB 1YRWA 4JVOA 4KO1S 1TIKA 1D1SA 4B09A 4OYLA 4LE1A 3SDBA 2PCJA 1T5HX 1XDGA 2WLTA 4KTTE 5LZ9A 3P0IA 5JS2A 2E4VA 4DUPA 5IWAB 5C8YA 1N8SA 4WCFC 1Z0FA 1M2WA 1O6ZA 2J3QA 3TBFA 4LC0A 1Q7BA 3WV4A 1C9KA 3MXOA 2EGHA 5AT1A 3AHDA 3TOSA 1KP3A 1G60A 4BVLA 2C9BA 1CVIA 4PC3A 1XNHA 4FUQA 2IIQA 3VTAA 2QVZX 4KQ1A 1W9HA 1O96B 2BJHA 2WP0A 3FBGA 3L92A 3PQFA 3V32A 1TM7E 2YMMA 3PFBA 3OFKA 3BJMA 1R8SA 1HT3A 5EKDA 1A97A 1UK9A 2REQB 3JRXA 4L4RA 2IH2A 2XZLA 4YDHB 3P96A 4YRSA 1ZM9A 4ZYWA 2XMCA 1T9GR 4YVFA 4WJLA 3VJKA 3PB3A 4BO5A 4EYSA 5GTDA 2NLOA 3CRZA 2CHGA 4TKLA 4D8YA 1X9HA 3TSOA 2BFNA 1O97D 4PQRA 1N6HA 1XRPA 3C48A 4FD2A 4O1IA 2IYSA 3ESBA 4RSHA 4PO8A 4RYDA 5KAMA 4BNDA 3WGVA 2IU4A 4IX1A 4R2KA 1AKNA 3K70B 1A7UA 1TT7A 3C6ZA 1QUEA 4EUFA 1OY1A 5PNTA 5AUOB 1G8MA 3JPYA 2X15A 3AR7A 4R9RA 1KJYA 2JLSA 1VLZA 4WOJA 2E9SA 1YJ8A 4NP6A 4MULA 3TJMA 1VG9B 4JT4A 3R0JA 5AI9A 3PVSA 4F92B 1FB5A 1Q0SA 4HEJA 2ARKA 1C0EA 1SAYA 1ZD5A 2G3YA 3A37A 5IJ9B 3AVTA 2J0QA 3K0FA 1A2KC 1Q3HA 2P4EA 5KVAA 3UCFA 1VSUA 1UM8A 3TZBA 1CDZA 3C8UA 3S28A 4YASA 4E08A 1GPAA 4UHBA 1OLSB 1GV0A 3KYDB 3AVPA 1Z7GA 3WY9A 1EXDA 3ZWDA 1PF7E 1CIVA 3K2BA 1QK4A 5KWVA 4XUCA 2G63A 2WIBA 3Q9UA 3TLEA 1JLRA 3LE8A 4MI1A 3IAXA 1TMYA 1NE2A 3MS2A 3MUEA 2EFDB 5LDGA 5AM2A 1J21A 3WJ2A 4XIGS 3JQ7B 3TDMA 1CZUA 2RGNC 5EZYF 2IHJA 4RPIA 5HBRA 2GXAA 1QWOA 3FVTA 4C7BA 2W2LD 3I30X 5SYNA 4N9WA 1KNXA 1P17A 2RGBA 4QZVA 4ZOLB 1JAZA 1Q7GA 1E6MA 3N5CA 4OHZA 2PT5A 3TCKA 1E89A 4DWOA 4L74A 5BT9A 2FMHA 5E7IA 1L7MA 3LQ1A 4Z49A 1N5RA 4Y6GB 4IIHA 1RWPA 3W90A 1LGYA 2V6BA 3QMVA 4GP9A 2C78A 4HQLA 4LVUA 5DTMA 1NW8A 3AEKA 3AVWA 4P4NA 4MI3A 4QQRA 4OUDA 1G42A 3OQJA 1SQ5A 1UMDB 2DWUA 3WADA 3SR4A 1WQ3A 4PLZA 3WDSA 1J23A 2EGUA 4C89A 5C32A 1C0KA 2UYQA 3BIJA 3PC4A 4IXMA 3MPUA 1JDSA 2Z3ZA 3KWMA 3H05A 4ZQFA 3QG1A 3QXSA 1ODSA 2WVGA 4DG9A 3B6MA 4JYMA 3WVNA 4RD2A 1KTIA 3ZBUA 4MQUA 3WAKA 1Y34E 4TWJA 3T6KA 4P5PA 4O4HA 4OXNA 3IIIA 1CNFA 4QOIA 1PHRA 1R88A 4ZYZA 2VF2A 1B42A 4L5IA 3RTDA 2C20A 3PC8C 2WWTA 2YS7A 4X8LA 4HVCA 1J7JA 1JPJA 3PTAA 1BE6A 4RTQA 5FL3A 4YJHB 2FLVA 1YCDA 2OENG 1FVXA 2Q4EA 3KDPA 3N07A 1UQUA 1A5SB 4MPRA 4N3NA 3TFQA 4EVQA 3MTEA 4JA0A 3P71T 4HAYA 3ZGLA 4Q7EA 4P0QB 3VX4A 1KETA 1EM8A 1MHPA 3VOAA 4DILA 1TO6A 2R79A 3L93A 3E22A 4YRMA 3V8MA 2ASEA 1OGIA 1Q74A 4NYJR 4HXFB 2IZ5A 2REXB 3LGXA 4QYIA 4I5GA 1SNYA 1DCMA 1Y3IA 2E4YA 2HCFA 2J3EA 1RBZA 2RONA 1ZONA 4XVQA 1J8QA 5EKXA 2AMFA 3ROKA 4EW2A 4EO4A 5IC4A 1AKEA 1M54A 3T7DA 2CXSA 2IZ6A 5ERGB 1YASA 1NASA 3I2KA 3PNSA 4GXNA 4J7UA 5A0TA 1PVDA 3RSFA 2HA7A 1N2CE 1WCIA 1UT8A 2DT5A 3PTLA 1CHDA 1JG2A 3HCFA 3KKKA 2C1EA 1QIHA 2FPWA 3G1WA 3OE1A 1YE3A 3WRYC 4F6LA 1PV4A 4WPGA 4CLXA 2QYHA 1N92A 4ZAXA 3HK2A 1CY0A 4PPQA 2QAGB 2JH9A 2DQZA 4NE2A 1T1SA 5HS4A 4QDTA 4RTLA 4XQGA 1WXWA 4XJVA 1HV8A 1HLPA 1JYFA 4MUGA 4RNDB 5CLLA 2RAVA 3WXMA 4CTOA 1RXUA 5HJ7A 2WUGA 5JV5A 2XV1A 4IGFA 5EPEA 3ZGYA 1UEIA 4C7OB 5DBIA 4MW4A 2WZBA 1NQVA 4B3XA 1EA5A 2AFVA 1NKSA 3G9XA 2YC4C 4JI6B 1ZNZA 4LBZA 3UWDA 2AHOA 2JFBA 4C0SA 3LFUA 4IH9A 4IOKA 2O5RA 1JXAA 4OP1A 1PX2A 1Z4MA 3U61B 4D2IA 2XMGA 2Q2OA 4NJEB 2ZETA 3M6XA 2YNMC 4X63A 1OBVA 3GA5A 1Z8NA 4HMPA 4H60A 4JT2A 2QXYA 1I3CA 1ZC3A 1GR0A 1Z82A 2PGNA 2EQAA 3O9VA 4GX2A 4L3OA 3RROA 5JJKA 2IPMA 2VXCA 3TIIA 1YTUA 1L8AA 1R8YA 1DIOB 2VJDA 3B3JA 3OM1A 1K5GA 4CR8A 1BAPA 3ANYB 3MZ0A 4AIRA 3GUZA 4P0PB 2J46A 1TRKA 3MILA 3MBOA 4FCCA 5EI5A 3LPAA 3ENNA 4M89A 5KOJA 2EAUA 3KUKA 1LSSA 5JFTA 5I5GA 4C2AA 1G8YA 3QBVA 3V8EA 2AL7A 2VF8A 1H4VB 1UP4A 1JIVA 4DM7A 4PRZA 3HR7A 3W1EA 2K6GA 3EDRA 3QVWA 4KN5A 3EH1A 3FOCA 2DYKA 4XX1A 3Q3VA 1KZ9A 5JMWA 3C70A 1G21B 5JI2E 3EW9A 4V3BA 4DUZB 4BN0A 3N9IA 2FPIB 2DJ5A 4MP6A 3TDNA 1FW8A 2CB9A 4G0PA 1DZIA 1Z7BA 2P3QA 2P1ZA 5KQSA 3LG2A 3W9YA 2J31A 4XIIA 4PO1A 4DN6A 1HE8B 4HAUA 4HV4A 5C7OO 1J09A 1YFLA 3OM0A 1PEKE 1HYHA 1SU7A 2HRRA 5J5VA 2YJNA 3U26A 1W5EA 2QJFA 4RVSA 5JALA 5BPFA 1KO8A 3LLVA 4HNQA 2CF6A 1D8AA 2HTEA 4N7RA 2A1UA 3V2IA 3AU8A 3VR0A 2X14A 3PYXA 4H7KA 5JXIA 1K4KA 3DE3X 16PKA 4V39A 1N5OX 2R84A 4O8CA 2Z08A 5DJ5A 4IV8A 3VR4D 1CZRA 4B6SA 3MJHA 2F8TA 4TVKA 4FFMA 3IUJA 1QJCA 1NC1A 2Z9CA 5BR4A 1QU2A 2FW1A 3A58B 3DDCA 3WGGA 1E58A 3IOEA 3GA0A 4GPTA 1QDUA 4IV0A 4CLHA 4DCCA 2LKDA 5EZSA 4BJ3A 3X1YA 1B93A 1CWUA 4LJ9A 5C1PA 3ANMA 2PKYX 5HZMA 3EXHC 821PA 3F7OA 4M7PA 1SXHA 3QLUC 3IP1A 3TR6A 3GUYA 5BN4A 3RYIA 4ZCRA 2VUUA 4B76A 1K68A 4B46A 1ST3A 2EBWA 1SCUA 1ULTA 1MO5A 1L1EA 2FWJA 3KVRA 3KL4A 4C4XA 5JAMA 4IXTA 5KYXA 3HPQA 3IP8A 3VHQA 3NVAA 2BOVA 4D6XA 4UM9B 1I0ZA 2ZYWX 4O2AF 3CZRA 2BTOA 4BVGA 1FFGA 2VC2B 4YMHA 2XYHA 4ZEVA 1XTIA 1ZITA 1I3KA 2IE0A 3DT8A 4AG6A 3JS5A 4BFZA 2RD2A 2IYRA 1M9NA 3C3DA 3OF3A 5JH7A 4LF5B 1N8NA 1YTLA 1XD2B 3L49A 2OY0A 4V1CA 3X1XA 3AILA 3VVLA 4DJ5X 1X87A 1UL1X 1R4NA 3LYUA 2QP4A 1YFKA 4D8VA 3FJOA 3QKRA 1OB2A 2VAXA 2BFCA 1U2EA 3CVYA 3PHLA 1ZGAA 1PGJA 1N33B 2IV2X 2Q2QA 2OBXA 4KOEC 4ZOBA 1X1BA 1DX4A 3VC1A 1TLTA 3BOSA 3QV1A 2GTIA 2JZOA 4V24A 3B8EA 1J1ZA 3E9NA 3PRHA 3PU6A 3E7XA 3OZWA 1M83A 3PFGA 5I7HA 4MV8A 4BGEA 1F0KA 3BB4A 1Z6YA 2XMPA 1MJNA 2HYIC 1X7GA 3C5CA 4R6XA 1NLFA 4E7PA 2OHHA 1JFLA 5DYTA 5JAIA 5DLDA 4YJFA 1GCGA 3DLHA 1YZUA 2JIMA 1U3FA 3WYFA 5EXXA 4L95C 3AKYA 2O3RA 3DAGA 4PSDA 2AQHA 1K8YB 3BXZA 4XQCA 2G1UA 1RPAA 3I2YX 4KE6A 4GF5A 1LLDA 5G0UA 1AV7A 1AN9A 1KEZA 1YR8A 2C4NA 3B38A 2G9QA 3G7SA 3WLJA 3G0DA 3BMOB 2AW5A 4Y1GA 3W5SA 5IFLA 4KNYA 3BPSA 1OHHA 1JMVA 3CNBA 1GPWB 3W9UA 4FNGA 4H15A 1WBBA 3ESQA 3BMQB 4IGEA 3MWGA 2X0DA 1TTTA 3ZC3A 3Q9LA 4N7MA 3OPXA 2X1LA 2W00A 3EC2A 2YWBA 3P94A 1T4DA 3JAWA 2J9FB 3FDZB 3J7TA 2TS1A 1FNSA 2O1XA 2K2WA 4ILEA 4BLQA 3O4VA 2GRAA 4G1UC 2J5KA 2RH5A 3HDYA 3ORRA 4QUJA 5HSGA 1BS2A 4JJIA 1WD5A 2Q6VA 4QNRA 3F0TA 5GONA 1HG0A 3RRBA 1ZJYA 3WIVA 4B6QA 4V38A 3F5FA 3MW8A 4AYWA 1EVQA 1M5UA 3CFYA 4DVJA 2E3JA 3DSRA 3RREA 4FYXA 4M1KA 5GGXA 3JYNA 4Q6WA 1UC8A 3PEWA 4MGKR 2PT6A 4CTKA 3SC2A 5CBPB 2FK7A 4RMJA 2Q6LA 1QH1A 2I87A 4KYTA 2X3UA 4IZOA 3J81A 4FMPA 4ALKA 1KKLA 4RA6A 1MAAA 3ZHZA 3MOSA 1V5WA 2DBRA 2AK2A 5EQDA 2OESA 1KI1A 1G9TA 1GWNA 1R9NA 2YJ6A 3EAGA 2OORA 4FJ0A 3EWSA 2VP4A 2BZGA 5G2OA 5TQVA 4BU1A 4MJXA 1IC6A 1PYDA 2MWMA 3C5EA 1LBIA 4E4YA 3MMZA 3K53A 5DOVA 2E21A 4MS3B 4PLWA 1SG0A 1KYXA 2BKLA 1DJQA 1AS2A 1HQDA 3MQ4A 5KYWA 3K9BA 4F21A 1SVUA 1UBEA 4QG7A 4DKJA 1D03A 4BVKA 2X9VA 4EFMA 5D01A 2FA9A 3VR4H 3U80A 2NO1A 4RJLA 1YR6A 1AKUA 4ND1A 3ZV7A 2GWRA 1X7DA 1Y7IA 1ZM4A 3BBLA 4KX3A 3GLSA 3GQVA 2PCLA 1EINA 3HCRA 5A4KA 1E2IA 1T3ZA 1ZK4A 4UBKA 2FCAA 4O4HF 4QQ8A 1OLUA 4QYWA 4UMEA 3ZW9A 1QGZA 4BX2A 2HK9A 3NGXA 4NBNA 2JFPA 2VIIA 5TE9A 1R4MB 5K09A 3Q8LA 2VPQA 3V4LA 1PFUA 1FNDA 2ODNA 1L4FA 3LUAA 4Z3DA 3C1AA 1V35A 1WMEA 4LGVA 3UV7A 1UCFA 2I8LA 4B31A 2VP3A 3L8YA 1GQRA 1KJZA 1R6AA 3C97A 3D1JA 2D1YA 3PJEA 2X4DA 3S81A 5CJJA 1CPYA 3OLVA 1ZEMA 3HV2A 1RAFA 4X95A 2CUZA 2D2VA 4KPUA 1L9KA 1GZSA 3BIXA 5FNZA 4A3SA 2ZSJA 2FN9A 5L7TA 3K70C 2HMSA 4L22A 5EIAA 4BNWA 3ICVA 4IDQA 3BDVA 4TLAA 1Z16A 5KAPA 1JKJA 4E5VA 1YUBA 3GVIA 1N5KA 2BBTA 3FYCA 3DZCA 4JC0A 4OFBA 4IO0A 3G2PA 1LH0A 3HBMA 3ZKAA 1Y1TA 3ILXA 1T5TA 2WSYB 1GUYA 3O4HA 5JJIA 1K6IA 1PO7A 5IUKC 2O8EA 3HN6A 2GRJA 4JBIA 2P35A 1BVUA 1L7DA 2HKIA 3CSSA 2I6TA 1DS6A 3D5EA 4QGHA 5DHSA 3LECA 4XYLA 4ITRC 1XTBA 1DNPA 2WHQA 4IIJB 4Q1CA 1PHPA 1NJGA 3ITDA 721PA 1PFVA 2FSUA 2IGBA 3BD9A 4ZYLA 5HIAA 4ID3A 2Q1XA 5JCJA 1GTZA 3KE9A 3T8YA 3H8JA 4TMZA 2NOAA 5T67A 4C4RA 3GPLA 1DKPA 2VK8A 3AB8A 4BZQA 2JLYA 3EFOA 3I2GA 2Q5EA 2QX9A 4J7XA 2GGSA 3M4JA 3UXMA 5JWRA 4A8HA 4INPA 5BNTA 4I1UA 2J9ZB 3P9IA 4IXNA 3SZGA 1RS0A 3TQSA 3VOSA 4R7TA 5CXSA 1QGUB 1V2HE 1B23P 4UHHA 1AE1A 1PEAA 3GL9A 4KXLA 2JB9A 3P27A 4O2AB 1P9WA 4L0DA 2HN9A 3H18A 4GLLA 4LA4A 3DUFA 1B4DA 5EKSA 3N2EA 2QUIA 3L6EA 4KITB 1R37A 4B3HA 1JN0A 3IP3A 1YJCA 1TQ2A 4TM7A 4W6QA 3GBSA 1IIBA 3DL7A 1G38A 4MH0R 4CEJA 1KFCB 2NV6A 3RFUA 5LMNB 5C8YB 2AXPA 4U5QA 3OLCX 4W5QA 1PJTA 1VHTA 1ZIXA 4CIWA 4DM3A 5A0VA 3RS2A 1FSSA 1J5EB 3ANSA 1COZA 5BVGA 1J2TA 1PG2A 1Y0BA 3CX7A 1RJ9A 3E70C 3HEMA 4WFQA 2FW7A 5ECWA 3UV6A 4YAIA 4XWOA 5B1IA 3WGMA 2OBLA 2Z2JA 3H5VA 2QE7A 1YULA 4HLDA 4GD3Q 3U7HB 3TL2A 3CIFA 3P0RA 2IODA 3PIIA 4N3GA 1L4BA 2FF5A 5EAIA 3OO0A 3R0QA 1AB6A 3RRNA 2WQZA 3T7IA 4D96A 4PFSA 4IGIA 3IQGX 3D7SA 1Z06A 1NJ8A 4YO7A 3CGWA 4EG6A 3ASYA 1QG0A 2VDUE 3PTZA 3RS3A 2R6FA 4CMGA 5EHXA 4B9EA 2ZXFA 1T0JB 1DBPA 4PPGA 1RYBA 2VTKA 2Y9PB 1TKAA 3AJ8A 4EMSA 1E5VA 4HPXB 2LRHA 4EKYA 2A5GA 5ELXA 3D3QA 4WN9A 4TTRA 3E3LA 1A8QA 5E4YA 3U3OA 1JHXA 2QP9X 4BNDB 1XCMA 4C3VA 4DDWA 4ZMBA 2J7PD 4KFTA 5F3WB 5ALZA 1PJCA 5A4FS 1MNAA 2H1RA 4YPVA 1PTKA 3NHUA 5B64A 1JR4A 1SR8A 1E9CA 2Q8QA 4CFYA 4CI0B 4Q4LA 4A0HA 2X1VA 4QRIA 5JR3A 4KR2A 4GBED 3ROMA 2X7XA 3D7MA 3OI7A 1H1DA 2NIPA 4NECA 4E30A 3RC2A 3WKBA 2FB9A 2D8MA 3N7UA 4B3JA 4CT4B 5BSFA 3QFFA 4CM1A 4DLVA 2FN7A 5FADA 5IDWA 4UOZA 2RI1A 3CRRA 1NQUA 1RYMA 3PQ7A 3U1BA 1NYTA 3MBIA 3AWIA 3OO1A 1RT9A 4ZZ2A 2VAPA 2P65A 5BRJA 3RUAA 1Y6RA 2QLTA 1BDBA 2HK6A 3ASUA 3E3AA 3ZWQA 1Z68A 1JG4A 3FYUC 1R3UA 3AIKA 4A73A 3H9BA 5IBRA 2R62A 1HFJA 2L0XA 3C3EA 1NBAA 4BX9A 1GD1O 2OBMA 4F96A 2A5DA 3U5ZB 1K66A 3AUKA 4QU0A 3G9TA 2XOEA 3A3OA 1KKMA 1GM5A 4RK5A 2JIOA 3OX3A 4QBIA 4OB7A 5JJCA 1M76A 4QXAA 5A05A 1LC0A 1U6JA 1FFWA 3RSGA 3AUSA 4GSYA 4QFCA 4EUEA 1S3SA 5A3QA 2VT3A 5JH7F 1E0JA 3PX2A 3QVVA 2VTDA 3IALA 3BMXA 2EZ8A 2O2CA 3FW1A 2J67A 4JXKA 5BQ5A 4G0OA 2KHZA 4LJ5A 1PD0A 1E79A 3P2YA 4TWAA 4F93B 4NK4A 3L1UA 4ZKEA 4QM6A 4JZKA 2V6GA 4KAFA 4EUKA 1Y8QA 1J2UA 1YKFA 3AM1A 4KHPB 2X6TA 4TVSA 1A3CA 5KSOA 1W59A 2RGGA 2VHUA 3VMMA 2PBLA 1FFYA 1AUVA 1PJZA 3MTIA 3OC0A 2XUJA 1QRTA 1KXJA 4OUDB 2R65A 2QTRA 2GK7A 2D2IA 3TEFA 1GVHA 1OXMA 4J7AA 4JD5A 2J6HA 1TVCA 3KP1A 3VO9A 3P9XA 4O08A 3HCEA 4JL6A 5FT9A 1FL9A 4JGIA 1ESCA 2GBCA 4BX8A 1WZUA 1SVMA 3MM4A 1Z07A 1OFVA 1ATIA 3EFHA 1O54A 3EQZA 3MB8A 4PIMA 4X62B 1M34E 4N18A 3QNUA 3WHKA 5A5EA 4Q3KA 4O4HB 2CJFA 1TQ8A 4A15A 2KPOA 2ICAA 5T64A 2XDQB 2CNNA 3DMNA 4YCNA 1XMXA 2RIRA 2Z2YA 1GZ5A 2W6MA 2J48A 2QUKA 3H1EA 3NXKA 5KNDA 3U16A 2C9YA 3E0QA 4UREA 4E1AA 4X45A 3UA4A 2X0JA 2IU6A 3FIUA 2A1TR 4G67A 4OP2A 2P77A 4PPNA 1ZD3A 1QOPB 3CX4A 3QVTA 1XQ9A 4QAQA 1EM8B 1P6XA 2EV9A 3SIWA 3V1MA 1CG6A 4YTEA 2XCQA 1KRXA 1NXSA 3E22B 4G63A 4AWBA 4C7XA 4D4JA 3AESA 1L3IA 1FK8A 2E4WA 3JYPA 3PNOA 4LXHA 3MLAA 1DJNA 4PG6A 4QPCA 3L7DA 4QYIB 1Z13A 5HZHA 2B35A 3ZHTA 1V26A 1GPKA 2XEDA 1UWLA 4IYJA 2IL1A 2QBYA 2NM0A 1P19A 1U7PA 1NNLA 1PNVA 3H5AA 2ZAYA 5DFAA 1GAEO 1Z0JA 4ANFA 5F98A 1G41A 3A31A 4JLNA 3NHLA 4AO7A 3U7EB 4M1OA 3E05A 3NHRA 2WINI 1JSCA 1VL1A 1PZNA 4J07A 3GZJA 2YMLA 3C3AA 5A3RA 4OFWA 4LF4B 5B6JA 1E3QA 3MUFA 4HAIA 4WL0A 3NTRA 1ZY2A 5IP5A 1B0AA 4JOQA 2PPVA 2PUJA 2VOEA 3P2EA 4ISBA 3NCHA 3C3BA 1RM0A 2UZ0A 2F43A 4YRKA 4ZEWA 3GCXA 1SULA 1FFCA 3Q5DA 3ET5A 1T8PA 4B6EA 4DJTA 4XKJA 1SD2A 3VKUA 3ZGNA 1UJ2A 3A9UA 4H4EA 2BTEA 3QEAZ 2GPYA 4ZEXA 4A10A 2QSUA 3WQBA 2O8FA 4PCUA 2C03A 4BNNA 1Q6YA 4QFDA 3OEED 2W6PA 4DY4A 4U02A 2JD0A 3L4BA 5A04A 3JVUA 4H18A 2WABA 1YF3A 3NVMB 1ZG3A 2YJZA 1KA9H 5DNAA 3CU5A 1M1YE 4IG9A 3RTGA 3NYQA 1AU9A 1R66A 4I55A 4LXGA 4QDZA 1WBJB 2IDMA 2KBEA 3PXUA 3BTVA 4R9NA 2Q0XA 5KOJB 1WXDA 2RBGA 1R50A 5LIPA 2DMRA 4AP6A 2VDLB 2C2KA 3G88A 1FUUA 2PNFA 2Y67A 3NAQA 4HGPA 2R9VA 4HJXA 4MR8A 2MMCA 4A0RA 5FOQA 5LXTA 2QTZA 4EDHA 1Z6XA 2HGSA 1ZK3A 1C8KA 2DFNA 5AKKA 4GBMA 2BL4A 2BEKA 4B6JA 4RD0A 3VUFA 2WR8A 4F4JA 1WW3A 4TWIA 4EG5A 1S2MA 1NI4A 1T15A 1F8XA 2XT0A 4HH4A 2LXNA 2O07A 2PX3A 2IW3A 4MO2A 3NTVA 4NONA 4L07A 2Q2VA 1NXPA 1SBIA 2BJVA 2JGAA 1UAYA 2WIAA 2YMQA 1A76A 5A4DA 4X7PA 2H1SA 4MUYA 1GGFA 3TG8A 1H3EA 5CT5A 3CUVA 4KN8A 3V7WA 4GRAA 4DFDA 1YQXA 3QU4A 1SZCA 1FXUA 1DFIA 3HWWA 4OATA 4YRIA 1VIAA 3DE4X 3JASA 3Q4GA 4G8BA 1XZLA 2XX3A 1MXFA 2XUGA 4GGMX 4CKZA 3OZEA 4KOAA 7MDHA 1JIXA 3I92A 2BV3A 5JXGA 3ZYCA 3LIIA 1M0TA 2A1UB 3LHFA 4LHVA 5IARA 2A0FA 3B7WA 3FGNA 2WM3A 1W4ZA 2G09A 3DBHA 3N87A 3PVCA 3FTDA 4NI5A 2ZJ7A 4XUGB 5EJEA 2JLBA 3WWZA 3GN2A 1E1RA 3OECA 2B25A 3NAZA 2M6LA 3AR6A 1XFAA 2JLAA 4JLUA 1B8UA 4XZ3A 4PSAA 2JJ1A 1RWVA 3MG9A 2PAFA 5DCWA 1NM5C 1Q44A 4J94A 4PZZA 3SJUA 1K0FA 1GTRA 1NBIA 3K9HA 1DJPA 4TVBA 4BEBA 2B1IA 3NC1C 3EBOA 5BN4B 3L8CA 3RYIB 3K0AA 3R6WA 4OY3A 4F2PA 4EVIA 3T35A 1WXEA 2R6HA 1V3TA 4OOFA 4G1BA 1W5AA 4DIKA 1SCUB 2ACEA 4WW0A 3F96A 3LUBA 4KO4S 1KWGA 3KBBA 3M5WA 3RWBA 5CDSA 5DX8A 1P4AA 1MX9A 1AY0A 4R1MA 3WI7A 2YNMD 4JKYA 4IOLA 4CKYA 4E2YA 4AWAA 2NMVA 4JP1A 4W1QA 3K1JA 2QHXA 4DQDA 4H3KB 4MMZB 5AKLA 3NH9A 3T06B 4G5GA 1R74A 2Z6VA 1AKQA 1DP4A 4OH1A 3WV5A 1ZU5A 3N70A 3U81A 3DF7A 4EJSA 2RGYA 4N9QA 4TKZA 3VNRA 1YRBA 3L1JA 4FS3A 4LYDA 4BEVA 3VNUA 2O0HA 4R2MA 4GLBA 4UJ3A 4Y6SA 2A5FA 2H1VA 3RTAA 4B32A 4BGUA 2QN1A 3INNA 4V1CB 3V2GA 4URVR 1G291 4L75A 1CS0A 4CTNA 1V8ZA 2C3PA 2VJBA 1J2RA 4G37A 1W36B 3EGDA 3QKRB 1OVMA 3K9FC 4ZVSA 2OFXA 1H9CA 4FJ2A 5LD2B 3Q7QA 1SVOA 2PZLA 1E2NA 1YGPA 3DT9A 2Q07A 4ZGWA 3RVRA 4YV7A 1ICIA 3CUYA 3MLBA 1E4EA 4YP7A 1ZBQA 2GN6A 4NZYA 2B61A 4KR3A 2X13A 3D8NA 2CNBA 3GRYA 5FXMA 5EHQA 2FZGA 4CV3A 4HT3B 1KC1A 1PD1A 3IT2A 4JCCA 2DBYA 3F7NA 4R7GA 2IP2A 2OMKA 1P80A 4YJFB 3CMCO 3K16A 1U1FA 4S1OA 3TPCA 4NFYA 3KRTA 3WL8A 3UAXA 1QRRA 4WEQA 1XJQA 3CSDA 3O4FA 3THYA 1WXFA 3NYRA 3AFIA 4YAJA 4EM6A 1N3IA 1K86A 3KPWA 2TMGA 3PNQA 4WASA 3DDWA 4ZAZA 3PC3A 3GPIA 3DBVO 3FPAA 2H7CA 3EMBA 1DB3A 4HBGA 3V1KA 1GGEA 1TM3E 3BKWA 5IC5A 1L4LA 1X8KA 3WMXA 3PR2B 1NXTA 3DDSA 1KDYA 4BHTA 1KOGA 4TN1A 4FGUA 1KBQA 2JA1A 3H65A 3TM4A 4F4CA 3VJRA 3L7KA 4PBRA 3O93A 5TPZA 3RJTA 2YASA 3KIPA 2CT8A 1EVYA 4FGKA 4RZ3A 4EA7A 3JAWB 1HDYA 5FV4A 4RHEA 4R3WA 3E9RA 1HRKA 3GRKA 2HLDA 3QUQA 1VJ5A 1GGVA 3ZE2B 5LZ8A 4QUKA 4GLOA 3IOMA 4OD0A 5ERYA 3DYIA 1YONA 1K9SA 1YJAA 2E49A 2Q9UA 5H9VA 4N76A 5ER6A 3BSYA 3GA7A 1AOXA 5GONB 1N2BA 3UH0A 1IUKA 2CMKA 1EVKA 4PFKA 2OQVA 2GAFA 1U3VA 1KVSA 1UWCA 2Q6OA 4MWDA 2EZ4A 3D0KA 2DHQA 3KD2A 2AIRA 1GNSA 3ZDYB 1DDOA 3SC2B 4YR9A 1PZEA 2I33A 3RG8A 1FUYB 5FKJA 1QH1B 2XCSB 1ZAKA 2C4HA 4OI4A 4RA6B 1DRWA 1O6CA 3FNGA 4RQAA 2CV0A 3LPMA 3SEAA 2WUDA 3FMGA 3W05A 3TX6A 3GLFA 1BA2A 2B4YA 3D2AA 2WRZA 2PDAA 2CBGA 2H65A 2JK1A 1U0EA 4LOHA 1H8ED 1L7AA 3E18A 4MPTA 4JDPA 1E6LA 1N2XA 4PLTA 1JNYA 2JFYA 1C8LA 1NWHA 4KGXA 4PYRA 3F9CA 5JS8A 1WQ1R 5A1JA 5FIUA 2DWQA 2XCLA 5J2TA 2GAOA 4P3NA 3VHXA 4B47A 4OG2A 4Q9AA 5IKPA 4DLSA 2F4VB 2YZMA 1GKUB 1KK0A 1O87A 2O06A 3DEYX 2Q8PA 3PD7A 4KKVA 4KV9A 4QGBA 2FI1A 5KYWB 3FGPA 1EP3B 1NZJA 4F5YA 2V3CC 3JVDA 4K1LA 3UJAA 1CUXA 4ZCIA 2ZTMA 4HR7A 4ASUA 4U7WA 3UHPA 3BXXA 3KJZA 3U7QA 2RG1A 1RXWA 1KRWA 2TMYA 1SB8A 3K9NA 3N59A 4IDPA 3OWHA 4BE7B 4PAQA 4DIBA 1C7RA 4NATA 3B3QA 2XIJA 2R8EA 3K6KA 4G1EB 5AK0A 4ZTUB 5IBQA 3ZCVA 1UC4B 3K4QA 4X6UA 1QRAA 4A26A 5J4HA 1L8XA 2BGIA 4JZYA 2WJZB 2XUQA 3NT4A 1P1FA 4GSLA 4MCAA 1B8PA 1U28A 4L78A 1Q0HA 4IIXA 5KNBH 2JFZA 4GPD1 3OHPA 4TMWA 3DXXA 4LZLA 3ZWVA 1FMTA 1P33A 4CN8A 4DQKA 5AJWA 3OFJA 4CV0A 3AY0A 3BL6A 4QYMA 3WK7A 4I1OA 4B82A 1JX6A 3CTMA 4XH9B 4G1CA 5A7GA 5HGXA 4LS3A 3AF0A 1CW2B 3FPFA 3H83A 2A86A 3CF6R 3I3SR 3R24A 3UK1A 1S8NA 3GOQA 1VPDA 2CL7X 3DAPA 2WW8A 4LVNA 2EOAA 4R51A 4ZT5A 3CCCA 2A9KA 1GDHA 1Z17A 2OFPA 1JKJB 1ISIA 4RO0A 1J90A 2VJMA 5T3YA 5TQ0A 3WMGA 4GIBA 2FSPA 4ZMRA 3FVRA 4B3DA 1KK3A 2OVFA 3OEHD 4UDOA 2XQVA 1MAHA 4MUIA 3O82A 3SHFA 1A71A 2HMUA 1IDN1 1I6LA 2FEOA 4J9VA 4ZO9A 4D7AA 1QX4A 2VF4X 1NW9B 2WWXA 4I8IA 2NAFA 3RUIA 1IFXA 5CG1A 5LNK6 2CNWA 2DUJA 3CN7A 3FFAA 2WHRA 2ONJA 3L7BA 4B2IA 1NNUA 2VAMA 3IEVA 2VZ0A 1E2MA 3ESRA 3EVCA 4WNYA 3WL3A 1PJLA 2GF0A 1OYWA 1T9ZA 1RBMA 4KXXA 3MYYA 1N7IA 1E64A 1J56A 2NO9A 3TUJC 2HDOA 2ZB2A 4EA9A 2ZJ5A 1U81A 2WSMA 3EFOB 3T0GA 3IURA 3ZWNA 5F2OA 1BMDA 1QQ6A 2QMUA 4KTVE 5CH8A 1PZGA 1A1SA 3G1TA 3LXMA 4OXKA 4MPJA 4XDZA 3ZD9A 4YUAA 3GCZA 3AETB 4U7PB 3X2FA 2NYAA 1AS3A 3PHHA 4Q7LA 3BF7A 1SHLA 1JUDA 2QLLA 1QLHA 3WB9A 4KAAA 3DUFB 1MC8A 4Q6BA 3QI7A 1USUA 4WGGA 2VT2A 3Q3JB 4LPKA 1TAQA 4WXMA 5CPFA 2C5EA 4GOND 4DQ0A 4NF2A 4I55F 4BKRA 4W5OA 3EOAI 2GD0A 1C41A 2NV2B 3M4YA 1QX3A 3NTUA 2WV9A 5FWAA 3TLZA 3MCAA 4CEJB 3OTWA 4BE9A 1G7RA 4FOLA 4BQEA 5LXTF 1J8FA 3HCCA 3T5MA 1AHHA 3K0BA 1Y8CA 1FFXA 3R1IA 5CU7A 1K6MA 2JGNA 3DB2A 3P2MA 5BVGB 2O05A 2QRNA 4PSUA 1RJ9B 4TZTA 3AVOA 1QIEA 3CJQA 2F1IA 4XWWA 3IXQA 3FM9A 5BV0A 1KKUA 2GCIA 2H08A 1UJMA 3N8GA 2JFQA 5AM3A 4IFEA 1WUYA 4QBHA 4AN4A 2OD2A 4BU0A 4JJ8A 3RWOA 3UA3A 1NN3A 1XA0A 2V3VA 4OJKA 1G2PA 1E9RA 3U3RA 4ZALA 2FVXA 2DTEA 2VHTA 3BD7A 3CTPA 3IHWA 4UXJA 3PNPA 3R0ZA 4DR1B 4M60A 3GJ3A 3GFPA 1TYDE 3C1UA 1XA3A 3TEJA 1N36B 4GRIA 1PR4A 1D9XA 4Y2HA 3F8WA 4WN9B 2A5JA 2HDHA 5JT1A 2IEGA 4UEJA 5FOTA 5LZ5A 4MIKA 1W29A 4DVGA 1TO2E 5FA6A 1Q16A 4NOMA 1ACMA 3DZFA 3NP9A 4IO1A 5KHAA 3BK1A 3VZDA 1GVNB 3OSUA 3TPFA 5C34B 3U0BA 4ZVRA 4GP6A 4H1UA 1K8ZB 1WLSA 3AI3A 3JPWA 3PYLA 4P8RA 1E77A 1RAGA 4DT1A 4HC4A 1CEQA 4F1KA 3UF0A 1LVUA 3LC7O 3TG2A 1P6QA 3CUTA 4LY3A 4FYPA 4AW9A 1XTQA 1TCAA 3SZUA 4ARBA 4KFRA 1W8IA 3SXUA 3HSYA 4EAQA 1BN6A 5JWHA 3MWEA 1MJFA 1FE8A 1ODLA 1FY2A 2F3TA 3L5KA 3C5WP 1MVOA 2FXIA 3KLPX 1DU4A 4G56A 4RVUA 4Q3EA 1AMNA 4S05A 2QL5A 3TM5A 2O0MA 4DEVA 1I3NA 1E7YA 3HA3A 4KK4A 1CP2A 1U5AA 2FW8A 3PGJA 2B4KA 1C4OA 4XWTA 4BRUA 2AG0A 2NO4A 2E6KA 1QVZA 3KYBA 5FD8A 2AH5A 3DZKA 5KB3A 5FO1A 1KE2A 3K6SA 1D0VA 1GY8A 2QA5A 1Y8QB 1B7GO 2XE7A 2AZMA 3NKFA 3W06A 3EEBA 2WKQA 1ZKMA 5EJGA 4HB3A 4DPMA 2O2DA 2AMJA 3MWKA 4LMBA 1D5CA 1CTQA 1YT5A 1WSDA 2R1UA 4A23A 4MYDA 4EF4A 2YOGA 2GZ2A 1F6DA 5B3LA 5ITSA 2LCIA 2PWPA 1I6MA 5G4KA 5FL7D 4G1MB 4PN7A 5CFRA 7GPBA 2PSJA 4G26A 3EZ7A 1D8TA 3KVNA 2XCTB 2IEZA 3RADC 3WNQA 2VKQA 4R4JA 5BWLA 3S6JA 5CXXA 5I7VA 1J25A 4ZC1A 4DA9A 2FEPA 2PSDA 2FEMA 5EG5A 2P4HX 3ROPA 5BUZA 2BI4A 4AJLA 2JVKA 3QX7A 1SUSA 4WKCA 2V0GA 1I30A 1CU1A 5I8WA 5JAHA 3L84A 1XEWX 3QJGA 4G5YA 3ZD7A 4LJLA 4IDAA 3X1DA 4IP0A 3DFZA 1R27A 2V4MA 4EYQA 4FWIB 4ID9A 3VZSA 5AW1A 3U4QA 3AEZA 1EWYA 3AQIA 2R7KA 3E9CA 3V8VA 1IEQA 4C0HA 4E46A 2HRDA 5CCEA 3WGQA 2RK4A 3JWIA 4R8KA 4Z1MA 3SCZA 2BM1A 4FGWA 1WDWB 4LE2A 4UAGA 3EG9A 4RZQA 1X2BA 3RS4A 5SZJA 4BN4A 1EE1A 3DR3A 3CM0A 4KVAA 3P2IA 3I9LA 3AESB 1VJGA 1L4YA 1XYVA 4CQMA 4XVHA 4E88A 2J9GA 1F17A 1ZJ4A 1Z2NX 2RGDA 3F3KA 1OVGA 2BFEA 5DGCA 4FNAA 1QZUA