2CDRA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cdrA00
2P2CA 2C2OA 3D6FA 3EDRA 1QDUA 3H13A 4QUGA 1RHKA 1RWMA 2Y0BA 3OD5A 4QUJA 4ZVOA 4ZVTA 3NR2A 1RWWA 4NOMA 4N7MA 2K7ZA 3P45A 1I3OA 1RE1A 2HBRA 2XZTA 4ZVSA 5IC4A 4M9RA 2QL9A 2H51A 3NS7A 3R6LA 4FGUA 1JXQA 4FDLA 3S70A 4QUHA 4HVAA 4DCOA 3QNWA 3GJRA 1NMSA 1QTNA 1NMEA 4HQRA 1SC1A 1GQFA 3E4CA 4N7JA 2Y1LA 2CDRA 1BMQA 3H11B 4PS0A 1PYOA 4I1PA 1SHJA 4IYRA 4QU8A 3SIPA 4ZVRA 4NBNA 5IAEA 4NOLA 1M72A 2C1EA 5IASA 2CNOA 3KJQA 4JQZA 3IBFA 2HBYA 4PS1A 4NOKA 3R6GA 1I4OA 1NMQA 2HBQA 1RHUA 3R7NA 2FP3A 4QTYA 2CNLA 2XYHA 1SC3A 1GFWA 4D3ZA 4AWAA 2J31A 2QLFA 1RWNA 2J33A 4JQYA 3UO8B 2XZDA 3R5KA 3H11A 2QLBA 2DKOA 3GJTA 3GJSA 3R7BA 3DEHA 4EHLA 4QUDA 4FXOA 4N6NA 4NOJA 2FUNB 3IBCA 2CJXA 4HQ0A 4EHFA 4PRYA 2H4YA 5I9BA 4JR1A 1SC4A 1ICEA 3R5JA 3UOAB 4EHDA 4FEAA 3H0EA 2H48A 4ZVPA 4JJ7A 5IANA 2XYGA 4ZVUA 2H5JA 2QL7A 4JB8A 4IEFB 5IAJA 3NKFA 1PAUA 2C2ZA 2C2KA 1RHJA 4QUBA 4QUEA 5I9TA 3V3KA 4EHAA 4QUIA 1CVRA 1F9EA 1I51A 4QU5A 4QTXA 3V4LA 4EHNA 4NBKA 2AR9A 2QLJA 2QL5A 1IBCA 2CNKA 5IABA 2H4WA 5K20A 2J32A 2C2MA 4ZVQA 3SIRA 4EHHA 3K7EA 3EDQA 3GJQA 2CNNA 3KJNA 2CJYA 3V6LA 1SHLA 4JJEA 3KJFA 3BIJA 1RHMA 3D6MA 2XYPA 3PCXA 4QU9A 4EJFA 5IAGA 1K86A 4N6GA 4PRZA 3R7SA 3V4OA 4I1RA 5JFTA 3V6MA 3PD0A 5IBCA 4QUAA 2WDPA 2J30A 5IARA 3H1PA 4AW9A 4EHKA 5LUAA 2H54A 1QX3A 4QULA 5IAKA 4AWBA 1RHQA 3PD1A 3V55A 3DEKA 1K88A 4NBLA 4N6OA 5LUBA 4DCJA 1RWXA 5IC6A 1F1JA 4JR0A 4N5DA 4QU0A 3ITNA 5IBPA 3DEJA 4LSZA 5LU8A 1RWKA 1CP3A 2H5IA 4D3XA 1RWVA 4D3YA 2FQQA 2HBZA 1KMCA 3P4UA 5IBRA 5LU9A 1RWOA 1RHRA 3D6HA 1I4EB 4JJ8A 2H65A 5H0IA 4JR2A 1NW9B 2NN3C 3S8EA 4DCPA 1RWPA 3DEIA 3RJMA
chains in the Genus database with same CATH superfamily
4JI8B 2QQFA 3MBIA 4KUHA 4QTTB 4DLKA 3ZCTA 1ARZA 1E5LA 1PSWA 2C8VA 1KI2A 4Q1EA 3TO5A 4JI0B 3PFHA 5DRYA 4FK8A 1P9WA 2Q3MA 4U2BA 5C9ZA 5A4JA 5JALA 3H3FA 1DFGA 3VR2D 4DJJA 1EM8B 2G4LA 1RYFA 2XWQA 3BKXA 3JV7A 1T4CB 3GW8A 4K3UA 5FLKA 4EARA 5IK2D 1UQUA 4AZ3B 4WXRA 2P68A 2OCAA 4NCHA 1UEXC 1K6JA 3RVKA 1RKVA 2CZCA 1OX5A 2PX6A 3EQ7A 3K6JA 3WGMA 5ITZA 1KE2A 4M99A 1V1MA 1XI2A 3A9TA 2WA2A 4G8CA 5L3ZA 4DQVA 2IUFA 5JR3A 3TR0A 4UU0A 3O0DA 3COYA 4W6QA 4A27A 2BJVA 2E48A 3INYA 2N0SA 4CBVA 4F7DA 1RLOA 5CXQA 4JASB 5JMTA 1O5IA 3GCXA 3S8YA 4ER3A 4F4JA 2O7SA 5JASA 5FAXA 3JW8A 4C7OA 3QRWA 3I92A 1T3LA 1V5GA 1U80A 1M66A 2ACEA 3AG6A 1EDEA 3IQHX 4PF1A 5E3IA 3CJQA 4XARA 3VR4D 2R6HA 2IIQA 4RK7A 5H3CA 1H22A 5A6SB 1TD1A 1EGAA 3KXPA 3H11A 4WK0B 2O7VA 4Q47A 2J3LA 1SKYB 1RYDA 4YDSA 4GBGA 4W1RA 5LSAA 4ZTZB 3HCOA 4IFTA 5FUYA 2CXSA 3WYGA 3AW8A 2DRIA 3SHVA 5TR9A 1E1QA 3SNHA 3IE1A 2HLDD 2GD0A 1H5NA 3KUDA 3R3JA 4LBYA 2DR3A 2INGX 5F51A 1CTQA 4FEAA 4GMHA 4WLVA 4EHDA 3DL7A 2P6MA 4KIWA 2WBLC 1FVXA 3G0HA 1H0SA 2CHEA 1EFRA 4DUPA 3JQFC 1OIVA 1FS5A 2VHZA 1G19A 4KFTA 4LDQA 4DANA 2ZTMA 5EJ8A 4E51A 5G02A 2QD5A 3H5OA 1RBYA 4KW7A 3T15A 3WVNA 2GCOA 2HMAA 1RM3A 4M1TA 5IWCA 2BTQB 2R6R1 1NQXA 1U1EA 1VYHA 4PLVA 1W4CA 3LOPA 4KE9A 2P1ZA 3EMVA 1QNLA 4L76A 4K05A 1I7NA 1T25A 2JIMA 2OYSA 3TLMA 3OOWA 1U31A 4UUNA 1Q1GA 1KYWA 3ZU4A 2ZIVB 4EP1A 5KNBH 4Q16A 2CWWA 3Q41A 4MV3A 1PT6A 2D2VA 4X3OA 1Z2CA 4YCCA 2I6TA 4QHSA 1PZGA 5EJ4A 1FVHA 3W2TA 3MJHA 3M2TA 1HQKA 1QCCA 1XL0A 3BM5A 2C2XA 1L5LA 4OTZA 3WZ2A 2LUOA 4EKIA 3DHWC 1OJ7A 3CHYA 1WPGA 4YJFA 1X3SA 2RHJA 3NPAA 4DBVO 2A5JA 3CM0A 1OF1A 5HJ5A 4O4IA 2PL9A 3PEUA 2ZS8A 1T5HX 1IDOA 2EDAA 3HZRA 2HA2A 4M49A 3H3JA 4TROA 5JS7A 2A84A 3UMMA 2C9MA 1YS2X 3DW1X 2P9FA 1BCRA 4G24A 4LHXA 5F5NA 3TOZA 3FGNA 2GEJA 1MDFA 4DJAA 4F06A 4BNNA 3R3XA 2GN4A 3SLKA 4MVJP 3DXZA 3EH2A 1AKWA 4BYGA 1C3JA 4A2PA 3DEAA 1CR0A 1GPBA 1F2TB 2JFVA 4ZEXA 4TXHA 1QPGA 1TAUA 3LH5A 3FETA 2ZYGA 4FT2A 4ILEA 5E6UA 1TAHA 1ZISA 1BHSA 5BR8B 4P81A 3I04M 4J29A 3ZZ0A 3SHOA 3LCMA 3LIIA 4QGAA 4BNYA 1YA8A 2X3YA 4WD3A 2XZTA 5T5QA 2XUZA 4OFBA 3P9IA 3FCEA 3PLRA 4FE3A 3GFGA 1EVYA 2AT1A 2KM1A 3D8HA 3KU1A 4I4LA 3VKVA 4IV5A 4BRUA 3TUIC 2OYCA 3HJCA 2MYTA 5FOUA 4Q1AA 3IHTA 3W0LB 5HCUA 2ACVA 3WGYA 1EUYA 3BRQA 3ZYZA 5EVCA 4BIMA 2WHQA 1TYCA 3BMCB 2AOWA 5JO0A 3UGJA 1B23P 1SBIA 3I2JA 2ZATA 3IBFA 3I9V6 1GPAA 4TTAA 3GFOA 3GZJA 2PA3A 1SU7A 5ICMA 3IESA 3FOAA 3JQ8B 1JXAA 2GPYA 3T3DA 3W5DA 1T2FA 1KS2A 3NGMA 5FBWB 2QLFA 1UQRA 3R8CA 1E8NA 4AB1A 3ZW9A 2BMFA 3I30X 2B9VA 5CX1A 4ZPJA 3GEDA 3JWEA 1NI3A 2JF0A 2QYHA 3NHUA 1RMYA 4Y6SA 4RHXA 1A95A 3N2EA 4HEA1 1IL0A 2X42A 4PAOA 4HO1X 5KOIA 1QDLB 1U8AA 2J07A 4EB6B 1K0FA 4GSLA 2QR3A 4RWZA 2ISCA 3KLMX 4LJ8A 5DASA 3TZKA 4AP9A 4BFTA 1U0BB 2WT4A 5DXFA 2XNJA 5LOVB 1M8GA 1EVIA 4QARA 1KVSA 1ADYA 2YOGA 3NBQA 3PHLA 4ZYYA 1C0IA 5LZ9A 2HPVA 5BYBA 4MW6A 1MEJA 5M04A 3NDBB 2FMKA 3QE4A 5JZOA 3FUXA 2CXPA 1V8PA 3HGMA 4GE3A 4IGKA 3UMRA 5K9ZA 4FFVA 1N0UA 1KY2A 1NSYA 4Y2TA 2FSUA 5HUHA 2DOKA 2C3PA 2MIIA 2P9EA 2XMSA 4L74A 1NVBA 1IOLA 1PJBA 1CJCA 3HN2A 4O02B 4PR3A 3F98A 2BEUB 4YJ2F 1XNRB 3MYRA 1D0SA 1GAEO 1G2OA 2GT1A 2QP4A 2JKVA 3NM4A 4DFDA 5MHTA 1RQRA 2QRNA 2WOJA 2ZU6A 4M8SA 4RIGA 1Y7HA 1WMEA 1BW9A 1PR5A 4MVJD 4XIFA 1C7ZA 4IXMA 3RUPA 1Q3TA 3LFHA 4JOSA 1CJVC 2HD4A 2F00A 2ZR7A 3DV0B 4IQ0A 4URZR 1ODTC 1Y6RA 3M1YA 3I5XA 1V43A 2N46A 4QJBA 2CXXA 3U4DA 1ZI8A 3IMGA 1KI7A 3CO0S 4LSMA 4XWOA 1O95A 2MMCA 1Y8AA 1REQB 1KSJA 2F8MA 2Z09A 1NONA 3AKYA 1GDTA 2AX3A 3WWZA 1V9CA 5C34B 2AQ8A 4RH1A 1RAGA 2QYTA 5E6RB 3M3PA 1KVTA 5F77A 3UMVA 4NE7A 1AKYA 1FP6A 3K05A 1Q20A 1WF6A 3PI7A 1V2HE 3PXBA 3SDBA 3QUSA 1M2KA 2YXNA 3JD2A 3QK7A 2HGZA 4IAOA 3EZXA 2Z6AA 4MW5A 2ZRLA 3GUHA 5IYZA 2FN8A 4RA9A 2ZSKA 1NW3A 1RMQA 1Q5PA 1VYVA 4FFOA 2MCFA 1GYQA 4BC0A 4TOIA 1TJ5A 3S7ZA 1ZIDA 2I4OA 1DEXA 1QIIA 3SR3A 4P3NA 4C2AA 1A96A 3C74A 2FUCA 1B0PA 4KPUA 2FG6C 3KV3O 3SSNA 4EHIA 4EG4A 3EEFA 4ASUA 4DIMA 3PNQA 5JEDA 3KXLA 2FSGA 4OFZA 4OV6B 1KY4A 2GM9A 4NOMA 3A25A 5EIWA 3ASZA 3RHSA 1AGRA 2YC2C 3LMKA 3NC0C 2D0DA 2VZ9A 3O95A 1UJ6A 3I6BA 1U3UA 2ZIFA 1CHDA 1SZDA 4LWPA 1KYYA 4I5GA 4MVJG 1RKQA 4DYVA 2IUUA 5G3ZA 4CQMB 5KYTA 4PG8A 5J1TB 2Q5JA 4AC9A 4AZTA 1VKZA 1RLTA 1AURA 2QTRA 1JB1A 1K6XA 3HSSA 3IB3A 4JN6B 3E1KA 3DUWA 3UC9A 3UA3A 1LZLA 1WS6A 1Y33E 4R83A 5JATA 1NSTA 2FCAA 3B6EA 3E03A 1NJ2A 3EEYA 2XMGA 5REQB 1P44A 3TGPA 2HMTA 4TSKA 1QVRA 1ETUA 3AG5A 2XVZA 3B3AA 3GUYA 5DJ5A 3T4EA 5CNIA 1CIJA 3GVIA 5EYPA 3WKDA 6PFKA 4FMCF 1YZVA 1NY5A 3W6PA 3GLGA 1P7YA 2QORA 2NYAA 1LVHA 3QKWA 4NOJA 3HVJA 4PZYA 5AHOA 1RCUA 4BV2A 4CV3A 2FWRA 1UMBA 3U4GA 1KJJA 4BGIA 4ZC1A 3EPJA 4TKVA 3R3WA 1SPBS 3R3HA 3CSDA 4PY2A 4TV8A 3EDCA 1KIMA 3CH4B 4ZOLB 1YR7A 2JIOA 5TPWB 4UZSA 2AH5A 1QGZA 2OCGA 3OURA 2SICE 4ZT4A 4HI0E 1A2KC 2QUBA 2IEGA 4C14A 4ZJZA 1UBTS 3UJ6A 2V0GA 1M34E 4MUNA 4LI3X 4OH1A 4QLAA 5CGQB 1X1TA 1YS6A 4IIFA 4K9RA 2QPAA 3DE1X 1DAFA 1TU4A 1BH2A 5D3ZA 2XODA 3I39X 4NQZA 4D26A 2RARA 1SCBA 3EHEA 4EW3A 2R96A 1M83A 2Q5CA 4LY9A 3QBDA 5DN9A 1VOTA 3ZNPA 4JI6B 3WMFA 3PPXA 4MS4A 3BIJA 4FS8A 3PUZA 1YR2A 3LGSA 2XT6A 2HMVA 4YCBA 3R77A 5KC8A 4WFIA 4ZEOA 1M1ZA 3PQEA 1NJ5A 4OI0A 3GD7A 3KYIB 4IZIA 1H8ED 4MEAA 4PO1A 1YHZA 5F23A 3M82A 1XN4A 2I2WA 3SYMA 2WIJA 3I5UA 4NV1A 2CJFA 3HJBA 3JWJA 4RD6A 4FQ5A 2XUKA 5E2AA 4E0BA 3THYA 2DVMA 1KYIA 4D4MA 4JR0A 1O4VA 1A97A 2CF5A 4AD8A 5CLFA 4H3KB 4IMRA 2HCBA 2PX3A 1U8CB 2WOOA 4RK0A 5B1EA 3HO6A 2IH5A 2E82A 3GRPA 1C7RA 5KSPA 4JFAA 1PNVA 3TQCA 3GT3A 5HX7A 2DTDA 3SJZA 4QBHA 4QEKA 4TM7A 1EVZA 1L8QA 1DKQA 5KPJA 2IOHA 3ECSA 3F90A 4P08A 2GASA 2HXYA 2O5VA 3TLGA 4R6XA 3CX7A 4PZEA 1C9MA 4Y1GA 1GKYA 4M83A 5B37A 1J9EA 1NLZA 1NNEA 1G8KA 2HPHA 3IRUA 4G09A 4JP1A 4WECA 1UANA 4U7JA 1XTPA 4KAJA 2QX6A 2PL5A 4EUNA 2XBUA 2I6XA 2ISSD 3CB4A 2GERA 2GOYA 1R6UA 4IUCS 3IULA 4RF3A 2XECA 1AUOA 5E4JA 3ED1A 1KSHA 3PNPA 1PRYA 3FVVA 4OI1A 4YAUA 4XRGA 3PVZA 2Q6IA 1NAHA 2C5FA 2QL6A 2VRCA 2V4UA 3F3YA 5K4AA 1U5BB 2RBGA 3U3OA 4IGIA 1N6OA 4ZDKA 4G0ZA 2OB1A 2A0UA 5CK4A 5JFOA 3KKPA 2EZ8A 2RHHA 3GGPA 5AICA 3H0KA 3DMRA 1T9GS 2AE2A 1N2CB 4PC3A 5BN4B 1CIVA 1G5TA 4RZ2A 4LRQA 2OA0A 5BOSA 3FOBA 1VYUA 1Z3CA 3WNDA 4E5PA 3AHFA 4PG4A 4G37A 3HVIA 3VKHA 2NQTA 4S3MA 3E48A 2C9CA 3FYCA 3HYNA 1FRFS 1T4BA 1C8VB 3D5QA 3H18A 3PPIA 3N0VA 3KEMA 2XYVA 3GRRA 3EJ6A 5M3BA 3GD5A 4DSNA 4K3VA 1KH2A 5F2NA 2R44A 1JHMA 1VPDA 2CGEA 1TM3E 2ZE6A 1Z12A 5BW5A 1Z08A 3DOCA 2O7RA 1QU3A 3WKEA 5ALJA 5E0KB 1KL7A 5DGDA 1BVHA 4N8EA 4BB5A 3R5JA 2ZJ1A 1H2XA 3UOAB 1IQ0A 1OLSA 3VO1A 5K4HA 2IS1A 2D3WA 1AS2A 2DR0A 4MCAA 2QN6A 1H2ZA 3EB9A 1D9XA 2A1TS 1UODA 1EFUA 3VYUB 4GVPA 3I9FA 3PG5A 4JXZA 2JVJA 1VFNA 5BMOA 3SXJA 2SKCA 3L4SO 1FX0B 1RHJA 1UFOA 1RQLA 1ISHA 2ZJ5A 1OGIA 1EGHA 3BS4A 2QN9A 2GPBA 4W99A 1V2GA 2QNIA 3L8GA 4LBVA 2EFGA 3ANXA 3NLLA 2DULA 1P45A 4V1CA 2ZYDA 1MQ9A 1MX5A 2Q29A 1FXWA 1D5WA 1FMCA 3JU3A 1AS0A 3OY7A 4IP0A 1ZK2A 4XX0A 5EIAA 3TB4A 1SVMA 1GWNA 1KAOA 4QDOA 3RJ5A 3VTZA 3VSAA 4UNNA 2CK3D 1J23A 2APJA 4Y2QA 3MWGA 2O14A 3LF2A 1Z2NX 1E1RA 1A9QA 3I09A 4ZCSA 3D7RA 4HDNA 3EOBI 3ISVA 5F12A 3WWDA 4MW0A 3LY9A 4UHBA 2HJSA 3WWCA 3TIVA 3WDKA 1T1IA 5I7OA 3L7LA 2GD6A 3C98A 5AP9A 5K8VA 1Z0KA 4K87A 2HYIC 2H5EA 4HCJA 4WRRA 4D97A 3DAPA 1P2DA 2QMQA 2C83A 1JIQA 2WYVA 3WBBA 4MPDA 4REOA 5FLXA 1ZESA 2FKNA 4LOJA 2IDJA 3G9ZA 3IP7A 4REMA 4ODIA 3PFWO 2AR0A 1XKTA 1RWVA 2F9FA 3UJBA 3VPHA 1U9IA 3SJUA 5HPYB 5LU9A 1XHEA 2Q9BA 4RJKA 1ECJA 5J59A 1QHIA 1X2EA 1MB3A 5LMCA 5HKKD 3H9EO 1MJFA 1SUSA 3E8MA 3LXXA 2R0QC 3O9ZA 3OEHA 4L8WB 4NCBA 5L6LB 2XYQA 5JY6A 1NBAA 2MSEB 1X86B 3O9VA 1S8NA 3NR2A 4LF8B 1M75A 1XEAA 1XVAA 3SZMA 3NM5A 1Q3HA 3PSHA 1ACMA 5LA6F 2R1TB 1KYTA 4IUYA 3F6PA 4YREA 3PGMA 3UOWA 4FDLA 3C6YA 3ZLTA 1AV7A 4P0PB 3PZRA 4Y18A 1HWYA 1S1MA 2ZYTX 4LOHA 1I10A 2AK2A 1E0SA 2HHAA 5HG0A 1NMEA 2GLTA 2GCIA 3N07A 3TR5A 1OH8A 1QX4A 3GLHE 3B6KA 1AE1A 4KO8A 3EYWA 2GPTA 2PD3A 4I2VA 3IBYA 3IDAA 3ZDFA 3H2KA 3V8RA 1TT7A 5JZMA 1JNYA 2B30A 4YGYA 4ZFNA 1XMJA 3HN7A 1ENYA 1X7WB 4RCYA 5A9RA 3E0XA 1T15A 3WWYA 5E9AA 3STXA 4DJTA 3HGQA 1EUDB 2PMCA 2GR9A 1AKNA 7MHTA 5KTMA 1XG5A 4HWGA 4ZICA 4IOMA 1P1KA 3R5KA 3LS2A 5J5CA 3ZEAA 3HCBA 5IPFA 5FNZA 2CHVA 2II6A 2W2KB 1LW7A 3AHEA 2UZIR 2FPWA 4ER0A 1YA6A 3A6JA 4HQNA 4ZO4A 1KVQA 1I2ZA 2H1SA 3CTPA 3EJWA 3I9NA 4HF7A 1P73A 1SEVA 1F8UA 3VJRA 1QZUA 3R4VA 4IR7A 3L4BA 1GPKA 3VO2A 1Q2UA 2O2GA 4CLRA 1H85A 1Z2OX 1ZOPA 2AW5A 4AF8A 1N34B 1M0WA 1JLRA 1KEUA 1XFAA 1R0YA 2D4AA 3B9RA 3DNMA 1H9AA 4MA0A 5DU2A 2JIDA 4R0MA 5B7QA 1Y34E 2HA4A 3H17A 4P98A 4O2AA 1M67A 1YIOA 4U1RA 3SF0A 2MINA 2CLSA 2QWXA 5IDQA 1OX4A 4Q9JA 5BNZA 4UHFA 7YASA 3ZZMA 3RUAA 3EWSA 3Q7RA 1U8EA 3OMLA 2WF6A 3AHJA 2V5UA 3BX1A 1CFJA 1X7WA 4E31A 2XWSA 3ITEA 4NFLA 5DI3A 2Y05A 1SOAA 5ESDA 4URVR 1HEUA 1GSAA 2FPIA 3WAJA 2IH4A 1HX7A 3NHLA 4IDGA 2C7OA 4MJLA 4X94A 4YHBA 3ZGYA 3CNEA 2C2MA 3THSA 2QPOA 3FJOA 3UGTA 2FA9A 4LMPA 3C5VA 1ONOA 5GV8A 4B0PA 5CYGA 1JVNA 2P9GA 3EQZA 5AVJA 4H4CA 3AGPA 4XJXA 5FLYA 4PRZA 3PX7A 1E2IA 2AWNA 1AQNA 1RM0A 3MXOA 4RZSA 1CCWA 4WKPA 1AQ6A 2JLSA 2OOKA 3R9WA 2OGSA 2P4UA 4DUGA 5TC4A 2VQDA 1HETA 2JCBA 1IG0A 2O06A 1AZLA 1X8LA 4H60A 2HCJB 3HHPA 4PZPA 5E7MA 3VR6H 3WL8A 5J2TB 5A7GA 1Z4IA 2PGDA 3V97A 5J47A 2I67A 3WLRA 4E5MA 4UU7A 4JBHA 3CPJB 1ENOA 4RMNA 3BZBA 1MX1A 1CRLA 4NPHA 4AKSA 1D4ZA 2YINC 3U7QA 2IK8A 3Q8XB 4IH9A 2ZYVX 2PQMA 3MSXA 3B78A 2HCTA 5AXBA 5T4FA 2PUTA 2ZE8A 5HTKA 3VR4A 5JZVA 4CV2A 1LFDB 2C42A 3A10A 4IXDA 5T8KA 4V0ME 4FX2A 4Y0VA 3SC6A 2JHAA 1EWVA 5KQGA 1FZTA 2ZSUA 3K9NA 4URUR 4Y6LA 4AJ9A 1C3LA 3H0CA 1Q2XA 4UOQA 3THWA 1UKEA 2Y0PA 2WY2D 4BIIA 4BNGA 5HW0A 1EHIA 4C2TA 2XB2A 3CF6R 4N5LA 1WZ2A 4JJ4A 3DHVA 2IS4A 3L0YA 4C5BA 4DLXA 3ZZUA 2XDAA 1DPGA 1E1DA 4PRKA 1DXQA 5DNAA 1EFRD 5CFPA 1BWQA 1DBPA 4Q6WA 1NE7A 2G76A 1FDVA 5CFLA 2GFQA 3CX8A 3T1TA 1JGTA 3JALB 5BQOA 2Z3VA 1XRSB 2AXNA 2D1TA 1ATIA 3W9SA 4C7MA 3GLIE 1L7NA 4I3HA 1NRXA 4WXEA 2QIPA 5EJ7A 2DAPA 3I53A 4YA6A 3D3WA 1XYYA 4AS3A 1AGPA 1ZLYA 3HN6A 3UENA 3VKWA 3N58A 2ZYAA 4FFNA 4OQFA 2FP3A 1Y8RB 1IRXA 2BGIA 3FPLA 5A4DA 2AOUA 5FOQA 4IIJF 4EF4A 4ZT6A 2A59A 3RTBA 1MOZA 4ZODA 5DGCA 5FWDA 2G63A 1DVRA 2FUEA 4L27A 4LGCA 1UL1X 2X5XA 2CE2X 2G0NA 4Q02A 3F6BX 4AMUA 2M1XA 3TTVA 3THYB 1J20A 2G5TA 3G2PA 3PWKA 3O3OB 4W7IA 2OQRA 1CY2A 2AVDA 3OQMA 1YHNA 1KEWA 3CH5A 3EC7A 1GR0A 3BCSA 1LSOA 2BGKA 3II6X 4MYDA 3K72B 5H7XA 1Y1PA 4NJEA 4OM8A 1JR3A 3QHQA 1KS9A 3FG9A 1W35A 5I7VA 1U7UA 2AC4A 4M7RA 2CNWA 4OQEA 1YMQA 2PVPA 1DELA 4Q93A 2X8LA 4WFKA 3K0SA 2VOJA 3QFRA 1D6MA 3TPCA 4PSVA 1LJLA 4FYHA 1TA4A 4U9HS 1B0AA 2Q2NA 4TUYF 3LPMA 3ZR4B 1VFPA 4IX1A 4XQ0A 5D1HA 1NURA 5EP3A 5I7AA 3RSGA 3NBMA 5KYWB 1FW6A 3HJNA 2PSJA 1E3QA 3G59A 5CG2A 1V5WA 2DMRA 3SEQA 4AICA 1A7AA 1ZGJA 3VNRA 2K2WA 4RAQA 2J0EA 1MX9A 2ZRHA 1VMIA 1TTTA 4ARCA 3R7SA 5KSZA 1B15A 4OB6A 5JMWA 3T0GA 1HQCA 5A5EA 2I5PO 3PC7A 3EW7A 4R3UC 3VGPA 1KJQA 4ZGBA 1ETHA 1FLNA 3RBZA 2BGTA 4EG1A 4BP3A 2O05A 3L8YA 2ZAOA 3IQXA 4N5DA 5BN5B 1DKRA 1E4YA 1A9TA 1MN6A 1XZIA 1VKHA 1QQAA 4AFNA 4F3YA 2F8SA 4BX3A 1VLZA 1LQUA 3H1GA 3NV7A 3PXCX 4GX1A 1RYZA 3DOFA 1F2TA 3ONEA 2R62A 4PX3A 3B48A 2HI0A 5CHYA 4C0HA 2C0CA 4KPEC 2V9PA 1OZ0A 2NUAA 2PCJA 1JR4A 1NNI1 2WUFA 3LX6A 4GZ5A 2A78A 2EFHB 3KPWA 4ZV7A 2PYDA 1C4OA 1UK9A 2V6MA 4I5FA 4JI3B 5C4MA 2C54A 4JP5A 2BJWA 1GKLA 3A28A 2VNKA 5BRAA 2GXSA 4M86A 4RHCA 2Y1KA 5BUZA 1XPUA 3E9DA 1RWWA 1OPXA 3OQ6A 3IXMA 1Y4AE 5GP1A 3F3KA 1W36C 2PJRA 1Z16A 2XV1A 3WJAA 3H8VA 3JR3A 3S70A 2BSAA 2MSCB 2PZKA 1LB1B 5FO0A 1O08A 1QCZA 5EQDA 1Q84A 3AJRA 4EH1A 4Q7QA 2NU7A 1OGJA 2O2EA 4ID3A 2CHGA 3ILSA 4JVSB 3B1JA 1NMZA 3THWB 3T1NA 3F6YA 3OAAD 1J1IA 5EWLA 3I83A 1PR0A 1NC1A 1QIDA 2C03A 2LIPA 2VP4A 2PDAA 1NKSA 3AOEC 3IKJA 2J6IA 4Q66C 4QSMA 4ZKEA 1WPXA 4YRKA 2QX4A 1QFZA 3HXTA 1CDZA 4C0BA 1BRMA 4PFJA 3L93A 1GKUB 1OFVA 1VP9A 1JT9A 1GQQA 3FKSA 1RP7A 3NP9A 1P4JA 3DBRB 1HT2E 2XXBA 1W19A 4TWJA 5FAKA 4KVGA 4MVJA 4WA7A 2ZBEA 1UJ4A 2XX3A 3ZI7A 2NZUG 4CGYA 1U9IC 3DLAA 4KPFC 4KJZA 4M55A 1DKUA 2YZ2A 3OJCA 5CA0A 5JC1A 4X8OA 3L49A 2RBKA 2FMTA 4OQZA 3DLPX 1P80A 1RADA 1T36B 1ORHA 1SVOA 2QRMA 2V74B 2VA9A 3DVLA 4HSEA 5DW0A 1SOMA 3H2HA 3KBBA 1HL7A 1ZD8A 3AR7A 4LJ5A 5DBGA 4A6XA 4BMDA 1GPUA 4JBNA 4YRFA 4QDKA 8LDHA 2QJRA 3CRW1 3D3KA 3GQBB 1XMPA 9LDTA 4DR2B 5GJBA 2Y1XA 5CEEA 1YF3A 2E4YA 1F3LA 5CVCA 3PV0A 3GJ6A 1ZH4A 4MRSA 2H5JA 2ONJA 4Q3NA 5JYBA 2FR1A 3IQEA 3Q9NA 4WFJA 2XB4A 2ZPAA 4E70A 2AKEA 3CR3C 2BGUA 3NWPA 4JC8A 2YZNA 3JPYA 2OXTA 1XQXA 4MQFA 4M6WB 4NULA 5IJZA 4QOEA 1F9EA 5C18A 2V7PA 1P0PA 3FM9A 4B8YA 1THTA 2Q1UA 4QDTA 1LLCA 5HOEA 2DH5A 4MVJM 4DEVA 1M0SA 5K6AC 2C7PA 3GBVA 2QN2A 4LCJA 5AK6A 4ASUD 2E4XA 3LLUA 3GPIA 4YAKA 2B7CA 2C82A 2XCRB 2RK6A 1VB5A 2Q49A 1QGED 3D8TA 3EF3A 4H1UA 4F3NA 3VISA 3U5TA 1X7ZA 2IXDA 2IHJA 3B12A 3DZDA 3C6ZA 4BKRA 4KJXA 1SUPA 1HDOA 2XZOA 3R6TA 5K2OA 2Z6QA 4QU9A 3F1KA 4UNIA 3DXXA 4IIJA 2WNSA 1J7KA 4H7PA 4L9RA 1NQVA 3D5EA 4PEVA 2PRZA 4Y1EA 3RS5A 1JQJC 3OCJA 1ELOA 4GNRA 3VH2A 3LLSA 4KR9A 5I47A 4EBBA 4X1OA 4F4UA 1N1DA 3A1VA 5J4YA 5K01A 1XUOA 2B8EA 4AMBA 4TLMB 5FNVA 2X2PA 1EP9A 2IHTA 1B74A 2YJTD 1TO1E 1ZUWA 2C4HA 5CW2A 4CG1A 4PAWA 5E9WA 4IJ5A 4AZ0A 2PBZA 4B47A 2VJMB 1PDOA 4YP6A 3QOXA 4ENTA 2ZSIA 4ZO6A 1QMGA 4KYVA 1T24A 4GPZA 3AYZB 5IEBA 3UANA 5CVTA 5DLQC 1CJBA 3IGFA 5B36A 4UBIA 4MGHA 2WFAA 2NSLA 4RDCA 5KJFA 2QTLA 3LDHA 2YVLA 3RIGA 4CMIB 1E2BA 4RA9B 2O2YA 4DDHA 2QRQA 3OQIA 1MJHA 3M4JA 4FPXA 4K40A 4LWQA 4OQQA 2WM8A 3FW1A 3HE3A 1GU7A 4TLLB 3VZDA 1SCIA 4PG6A 1J39A 1VIMA 3REFA 1KZ4A 1YB6A 4GPD1 4ZVSA 1KDYA 4WBNB 1NVTA 4I55B 4OU4A 4QVKA 4O3MA 4GLJA 3IEPA 2BSXA 1E9EA 2HJGA 1EBUA 3BAFA 2FPGB 4C7VA 2DPMA 4XVHA 4DDWA 2VUIB 1ZK4A 1YE3A 3I8OA 4FMPA 4IKEA 1T2VA 3KPJA 4WMLA 3E9QA 1GTRA 4Y2YA 3TLGB 1KH1A 2RKWA 3MAAC 3ND6A 3P0FA 2J6CA 2JFNA 3RS2A 1MHPA 4D1YA 2GXAA 3DLCA 4QYSA 1NM5A 1AZWA 2FGJA 5CBPA 1W6RA 2ZUBA 3VC3A 3LQ4A 1JLHA 1JAXA 2X0NA 3RJ9A 1ZGHA 1MJGA 4RDXA 1I7QB 1UK8A 1T6BY 1CXZA 2DPYA 1KFEB 1KIAA 5JXIA 4MJ3A 3LWNA 1JMVA 2J0VA 4EX6A 5CCBA 4WBNF 5KYYB 3VGJA 4TYMA 1PJAA 3D8BA 1AQIA 3ACCA 4NBTA 4NXMB 3IJRA 1IJFA 2I62A 1XQVA 1CY0A 1TJYA 4NG4A 1JHYA 3C6QA 4C06A 3NHWA 2D2XA 1PFVA 4XWWA 1XTQA 4NEGA 4I55A 2AUMA 5EHNA 1KZ7B 2J3KA 1NVWQ 2YOFA 5COAA 5FF9A 2WWXA 1E63A 2HUPA 4MLCA 4DJ5X 4KDRA 3OWXA 2VCEA 2NO4A 3F1LA 2NO6A 3VTAA 3DZHA 2QL7A 3R0IA 2IU0A 4CLOB 3P9CA 4D7AA 3PQ6A 4IEFB 3D6UA 1OMOA 3AKEA 4GICA 4ZOQI 3EVDA 1A2OA 1P31A 1QZTA 3AR4A 2PG3A 1AMOA 2GLUA 3B51X 4WCFA 3OPYB 4IIEA 3QLTA 4MMZB 3OO1A 3PBKA 1E9SA 3CW2A 1EMDA 1UAYA 1UMDB 2D5CA 4GP6A 4B35A 3H8WA 1KP2A 2C2HA 3G5LA 3QXCA 2I2BA 1XVLA 3R23A 1G64A 2AFIA 2I7TA 1QBKC 2HU2A 3O0TA 4GC5A 3FJ1A 5CNJA 2FG5A 3MJSA 3UBMA 4HLUC 4D44A 4YQEA 4N12A 3VYRB 5CT9A 4GL4A 5B1DA 3STTA 4NABA 1XVIA 4ND2A 4M8NE 4YS6A 5JDCC 3VC1A 3MB5A 5JZBA 4FZ5A 2G17A 4WJLA 3ZLJA 1C0KA 3DMGA 2VC2B 1XWWA 2HIAA 1DJMA 1DADA 2P62A 3LP6A 2XTJA 3FNBA 4BDSA 3ND7A 2W7TA 1UBMS 4FHGA 5DTJA 5AD1A 3FJYA 2WILA 2Y92A 2YVAA 1ZUD1 1JIKA 1V0JA 1UDBA 2YCLA 3AV3A 3ETHA 2HJVA 4WASA 4X8MA 2I4RA 4EZIA 2YN2A 2FKAA 3V3TA 1S2GA 2OZVA 3AVUA 2FZKA 4GZMA 3G9QA 2H4HA 3A9SA 4TTQA 5DN6D 1R4AA 2Q1XA 3CSSA 4HWOA 4FGKA 2D0OB 2RGNA 4LRXA 2GPWA 4EOGA 2VAMA 2PLAA 3IBSA 3NO4A 4MUBA 1CE8B 1YZYA 1IBLB 3EZ6A 4FYMA 1Q21A 3K2EA 3WK8A 2BFPA 2QBYA 3T52A 3TEMA 2ACKA 4M46A 2W2PA 4WCVA 2D06A 2BJHA 2G1UA 3QVXA 4FFBB 4OVKA 3TWOA 2B4RO 5CIYA 3T3OA 5EUCA 1Y80A 4B32A 1TZ2A 3AW9A 3CEPB 4GXRA 2G67A 1Q0PA 2Z2ZA 3BERA 1LPMA 5TGTA 5K4GA 5LP6B 3WAGA 4YDHB 1LCIA 2H85A 4DV5B 4NZPA 2AG6A 4ZYVA 1K27A 2YH2A 3CZQA 1EHYA 4EO4A 1ZKDA 3I9V1 3L05A 4UU1A 2AUNA 3TFOA 2VZ0A 3WK6A 4OOFA 1UP7A 1FIUA 1OAKA 3G9TA 2JASA 4S0XA 3JSXA 2P2ZA 1A72A 1QTNA 3FCXA 5EIBD 1L8OA 1WTAA 2Z9CA 4OQDA 4R69A 1ZIOA 4ZP1A 2WINI 4QOFA 3HC7A 4IGFA 5CCDA 4Q4AB 5T41A 1PYOA 3TD2A 2PKEA 1TIPA 1USKA 4PW0A 4QU8A 4R2LA 4EMBA 3MPOA 4MK4A 4TRJA 4M53A 3HSKA 1NA5A 1XZMA 3EDMA 3KB2A 3EVNA 1SOWA 2JEOA 4M87A 3VVMA 4J0JA 3UG7A 1GRVA 2CXRA 3H7AA 1ZONA 5KJEA 4D0NA 2BBOA 3QPDA 3MWDB 3Q6IA 3BJRA 5FUMA 5ARDA 5ICFA 5CLGA 4LZLA 3IHKA 4JWKA 3GAFA 2X5OA 2VH2A 3TQOA 2CFCA 3V00A 4S1NA 3QU4A 3WIEA 1XO1A 5KQMA 3UWKA 4CCWA 4C01A 4LVUA 5JADA 1XX6A 1ESMA 3ORSA 1G3QA 5E0OA 2AZXA 4RPGA 5U9CA 4EA9A 1NAIA 2DPGA 4ZZ3A 4NYMR 1E8MA 1O95C 5FULA 5IMBA 1EZ4A 4GGPA 1UJBA 1JKFA 2POQX 2OVBA 3QITA 1BXZA 1JIUA 1H4TA 4YUXA 2M2IA 1Z5ZA 3FZYA 1KAEA 1GGEA 4MI9A 4B4VA 1NUAA 2BLLA 4H35A 1A1VA 3NHMA 1W4BA 2VXBA 4Z9YA 2YJNA 2FGKA 1GD1O 3GWZA 4PLCA 2QAIA 1JAIA 3OO0A 3TJZA 4ARSA 1UIRA 5MF6A 2JS7A 4UFNA 4DARA 8ADHA 3NXSA 5I4IA 5EZYA 4Q4HA 5BW6B 4UTPA 4G1MB 2Q07A 1KK1A 4WKOA 5K8CA 2WTUA 3OEHD 1DG9A 4FE7A 4KR6A 1XPRA 5JH7B 1E3SA 1L4NA 2KYRA 2FB9A 3KG2A 3GJ4A 3K7EA 1Z63A 2XLBA 4Z4FA 4P35A 2X0KA 3OCCA 1XMXA 1YMVA 1XNJA 3H83A 3K0AA 4J7CA 3OCXA 2NSYA 8ATCA 4MDFA 2JLWA 1B6RA 2I3ZA 5FL7A 2J9RA 3ZVLA 3R7FA 2ZUUA 5TY0A 3UFXB 3UH1A 4CMJA 2WU1A 5AVQA 4F96A 1C7JA 1KJZA 4ECAA 2Q28A 1QORA 3GJ7A 1WDKA 1XTSA 3UAZA 2A6PA 4Z7NB 4DR5B 2AN9A 3N8KA 5E7JA 4B6QA 3UEOA 4M89A 4RE6A 4AJ4A 1U4OA 1A76A 4MGZR 4R2JA 1UM8A 4X5OA 1IOWA 4D92A 1W75A 2EZTA 4RH0A 2ZWOA 1ZNQO 1ZD3A 2FFAA 4CMBA 4EYEA 4HMPA 3P5SA 5DNWA 4QJ4A 4KYIB 3DYIA 2JKYA 4B09A 3EZYA 1X80B 4DRYA 1XF1A 3QE3A 4Q1DA 1AF7A 3KYDA 2E89A 3B1FA 4G2NA 4EW6A 3Q3CA 3QA9A 4AN0A 2Z95A 1E2QA 3FSGD 3G9UA 4YP0A 1D0IA 1M2WA 1T4GA 1IHPA 4QYIB 3URMA 2WIFA 4NFSA 2WHRA 2I66A 4RQUA 1T2EA 4JBGA 1ID8A 1T4MA 3M34A 2HQSA 1YZUA 3PA6A 4KU4A 3WIOA 3QVOA 4C03A 1OH6A 1NE2A 1E77A 1K5DA 3H1FA 5KYKA 1EWYA 1K7YA 4DCOA 3KT8A 3NOXA 1QP7A 5L51A 2BHRA 3HFGA 2WHXA 4IRUB 2YASA 1E9BA 3NVAA 2HIGA 1VL1A 2ZR0A 1SHJA 2DCUA 1FTNA 2VJYA 2ZTVA 3LC2O 3LX8A 3PHCA 4YQYA 4Z54A 5IDXA 4M7PA 1ZIYA 3KJGA 2BHLA 2F62A 2IW1A 5JTUA 1VKRA 1XDZA 2DQYA 4G9GA 4RKFA 3UY4A 3G1TA 1I4OA 4BLQA 4CKCB 5JPIA 1V5IA 1IUPA 4TT8A 2OMKA 1A5TA 3WLAA 1O6CA 3LZ6A 2P4QA 2X15A 3L6EA 4AK9A 4DJFC 1PR6A 1XD8A 4XIJA 1PWHA 4PCVA 1EJ2A 3R7BA 521PA 3ZY4A 4D99A 1AHNA 2OV4A 5CXXA 1KAGA 3OJOA 3COPA 3T9EA 2J6HA 3D3JA 4ER5A 4PQRA 3WJ7A 5AI6A 1YUBA 3GELA 4AJPA 2A5LA 2TMYA 4XDGA 3T5TA 4UEJA 1ID1A 2HPZA 5GOTA 1GPH1 4XX1A 3WQBA 1CUBA 3QWIA 1Y1TA 4XX0B 1CR1A 2GTPA 1I3LA 3FYDA 2GPAA 5DLDA 3G5UA 3ENKA 4CN8A 1ZCAA 1Z34A 3D6TB 4BN0A 5JC8A 1BA2A 4A9AA 2PD6A 4O2AF 3AFNA 1DC7A 1YZLA 3FVTA 3MA0A 1Q77A 3IBGA 4KLRA 3HACA 4LMRA 4EHJA 2VDUE 2R1UA 1YCDA 4CM6A 1P5HA 2VPZA 4AROA 2DT8A 5JBQA 4MYRA 3A1EA 3VAZA 2WFZA 2CFOA 3I1FA 2MSWA 4Z7OB 4K7JA 1XYGA 4P34A 4RHUA 2H1LA 1RI5A 4NZMA 1YS4A 2XI4A 2YWEA 3F74A 5AKJA 1IM5A 2JVKA 3RF6A 3VYWA 1EG2A 4JIMA 5DNDA 1JVSA 2L19A 2QZ4A 2PMWB 3ETNA 2D62A 4LJ7A 1YD7A 4P9NA 1E94E 3AFIA 4JBXA 2I29A 3JR7A 1D03A 4AUNA 1PTKA 2Q2OA 3TECE 4I6EA 5BWCA 1C0EA 1N0HA 3UAVA 4ZYLA 3HYCA 1I3MA 3U09A 5K0CA 2Q46A 1FFCA 3QXXA 3V6MA 1J90A 2ZCUA 4PZAA 1Z7YA 3D1VA 5HBGA 3QLJA 2GKSA 5DM2A 3WK7A 1MC4A 2PLWA 4DG8A 1RTTA 1NQTA 1YJ5A 2C00A 3LT1A 3S4YA 5JXHA 2HEIA 2W83A 1L4HA 2DWOA 2VP6A 2J0UA 3KQHA 1G98A 2H9IA 2PVSA 1DC6A 3OFNA 1RRMA 5IJAA 3BOSA 4OXYA 1M2HA 5AI9A 2CL6X 4C4YA 5M2QA 4LJ9A 3AKZA 4XVCA 4RIHA 2O1EA 5BPHA 2FMHA 2WR8A 4FCTA 2FPUA 4HEJA 5TQ0B 1ONPA 3FHCB 3H04A 1I30A 3VX3A 3UMCA 2C5BA 2CMHA 3H9UA 1PL7A 1I32A 4MS3A 4P3KA 2W70A 1EVLA 3C3BA 4A0QA 1GUBA 4DSUA 3EGXA 1CPYA 3FX2A 4OXXA 5J9FA 4FFWA 4JGIA 2V59A 3IUBA 4R8MA 3NI2A 4G5OA 1DBQA 1EFCA 2QSUA 3FH0A 2YXEA 3S28A 2VJLA 2HV8A 2WHEA 2YDYA 2J3JA 2ZJFA 3LU1A 4OD0A 3W1EA 3NONA 4DN6A 1VJ0A 4JA2A 3WBFA 1I6MA 3IUEA 3ZGLA 1S2IA 2JGIA 3JATA 4MITA 2D5BA 1W7AA 1U81A 4J0IA 2OECA 3OQNA 1QC5A 4PGGA 3B6MA 4M1MA 1W0JD 3D7LA 4N3NA 1ILWA 3A6HA 3SZOA 2BE7A 3EXG2 3O1IC 3URKA 1VHQA 4D96A 1NJ6A 1ZMBA 3OEED 3LK7A 5HCIA 3T4PA 1V8OA 4OGLA 3V7FA 2GEUA 3CIOA 4FGLA 1CZKA 4J75A 1Q0QA 4AY5A 4AM8A 2VDWA 2HBYA 5TGDA 1Y8RA 2PBRA 2Q27A 3CCFA 3BF7A 1N3BA 3R7WB 3VQTA 2ZSAA 3KLBA 4FMDF 2BUBA 4AULA 3KSMA 5ALNA 2Q2VA 4ZGWA 4KSCA 5DNUA 2C5GA 4MQ6A 3AIIA 3SC3A 4JROA 5JD5A 4FOLA 4BAUA 1DAIA 2IL1A 4E33A 4WKCA 4E2WA 2L0XA 3GMDA 2NNWB 2QZSA 3R6DA 3FTDA 4KSBA 3PK0A 3S7TA 3TBHA 3TXAA 4ES6A 1DAOA 2R11A 3PDWA 1RBQA 4WUVA 4OFWA 1TM1E 5DM4A 1I6WA 5A06A 1UOEA 1UDWA 2QW8A 4KXVA 5H80A 4A91A 3RKRA 3GXOA 3KB1A 2GJ4A 2GB4A 2QE7A 3AESA 2LGJA 1UWKA 3Q15C 3TDNA 1T43A 2GNAA 3B5IA 4IVRA 5CTAA 2WKRA 4CMGA 1X92A 1ZM7A 2YBEA 1WTCA 1GUYA 2PX4A 3IQDB 1MIOB 3LY5A 1PJTA 5BOVA 2DHCA 3IJEB 5CGZA 5KEIA 3NM6B 4GGMX 5IP5A 3RV4A 3KO8A 1L1EA 4QOJA 1EFHA 3S2YA 3EX7C 1P19A 3MM4A 3RSZA 1P6QA 4KODA 1PSZA 3C3WA 4YUZA 3QVTA 2BISA 1XU7A 4EHNA 5KNDA 1CEQA 1J2UA 2YYAA 2SKEA 3KZKA 2MR5A 4K8RB 4Z1MA 1EQAA 3QKUA 4OMUA 3TNDA 1G1MA 3B60A 1U4NA 1Q44A 1XNHA 1Q3KA 3UQZA 3BMNA 4MQLA 4B6PA 3OLCX 4OHYA 4JI1B 1US8B 1CUYA 1TLFA 1Z82A 3VR2A 5B3KA 1K86A 1JFVA 2Q6OA 3EFEA 2G72A 4ZYTA 4WACA 3R8XA 1J2JA 4HNVA 4P5DA 1OWMA 1F3OA 2I65A 3EGOA 4IDNA 2JAOA 4KKXB 2D3TA 4QL3A 3QUTA 3SBOA 1EGQA 1G2IA 1SHUX 2VH1A 3ZZNA 2XA2A 1GNPA 1SKYE 1ZJWA 3IPAA 1GG9A 5MGNA 3CNLA 2WYUA 4CCAA 2EWWA 1SCDA 2D13A 2GRAA 2H3EA 1IVNA 1KDPA 1V39A 4C7BA 1SU4A 2P3OA 1NI4B 3UG6A 1CS0A 2QIOA 5IJ0A 1KP3A 5SY6A 1OAOC 2IW3A 3N53A 3WL6A 4XVUA 3V4SA 2QZJA 1ND5A 5K0SA 1MXHA 1INLA 3P0IA 5FOTA 3NVMB 1Z9BA 4G0NA 4Q82A 5G53C 4QOIA 4EVRA 2GM4A 1FOEB 4PFSA 2QNRA 3IIJA 4D9KA 4JC5A 2CHUA 1EXWA 3AF6A 2ZM6B 1VCNA 3FSRA 3R41A 2OFFA 4Z6KA 1NW5A 2DERA 2YUIA 1BDBA 1O6ZA 2ZITA 2Q3CA 2NVUB 4J4BA 4J1SA 2I3DA 2VDRB 2CFRA 5JWOA 3T6KA 5DGTA 1CUGA 4ZVLA 4RK4A 2ODTX 3ZX5A 821PA 1E0AA 1GAWA 1NQWA 4F12A 3A3NA 1QCDA 1KI3A 1SUWA 4R9SA 2UXBB 5G40A 3GRVA 3L77A 1U2GC 3C6BA 4KQEA 1W88B 4DLZA 1F38A 4QEZA 3RNLA 3P5BA 3HCWA 1BMDA 1NX9A 2V5AA 4WKNA 4XI9A 4ZAWA 2PXAA 2PYZA 5A3QA 1X77A 1Z47A 2P5TB 4QYWA 3PE4A 3PFCA 4DV0B 1MGOA 2AJBA 1TDJA 1RU3A 3BH7A 1OI4A 1JFFA 1SVUA 4AY6A 3C3KA 4NWIA 4WXHA 2PZJA 4UEKA 4EQZA 1EVJA 4V0OA 1QKJA 4MI1A 1RXYA 2ADOA 3OZTA 1LXCA 3REQA 1W85B 4BLVA 4NQRA 3RIXA 4JH0A 4FM9A 5BYKA 3FROA 5EEHA 1LBQA 2F1RA 2C95A 3BGOS 4QASA 2A86A 1W87A 4AU1A 1NTRA 4XCXA 3DDNA 3X1YA 4O6VA 1R1DA 1Z6AA 2OQIA 2R4QA 1X80A 1GNQA 4GQBA 5HKLA 5GM2A 4IEIA 4DOMA 1WW2A 2GHTA 1UPBA 1XXHA 4ZQCB 3SZLA 2VDWB 3K30A 4X20A 3WDLA 4CTJA 2FLVA 5CLQA 3U3ZA 5IJWA 3D02A 3DS8A 3QJYA 4IMJB 4M8KA 4LQDA 1G8FA 1FYFA 1K3FA 1LEHA 4DT1B 2QVLA 2VS1A 3FPFA 3GLKA 2IEDA 3K1AB 4JUAA 1Z2DA 4WEOA 2FEMA 3TNFA 2W2LA 4OGKA 4B73A 1OBCA 2WLSA 2XNDD 2QJOA 3L2OB 3REGA 4QC2A 2BDEA 2ZIGA 5FTMA 2AN4A 5CT4A 1EIWA 4HXGA 1KZ1A 1N1GA 3BIOA 4FZRA 4LSGA 1ODSA 3TD6A 5L40A 1HMPA 4BXOB 2FLKA 3GRZA 1VHLA 3VU0A 4BKPA 1Z0SA 2DZDA 1RHMA 2X4LA 3RYHB 2IP2A 1MOQA 2JZNA 3PB3A 5BWMA 5KNCH 3A1NA 3SFTA 4M7WA 3CO5A 5AJHA 3FYUA 4XLLA 3NMUF 5A7HA 2VDMB 2BHTA 2CL7X 1N2OA 1LZKA 4ZGGA 4R8KA 4B8WA 5B4VA 5KTKA 1G20A 4UAUA 2NU8A 2HNBA 5LMNB 1TMKA 3FHJA 3Q10A 2R7NA 1E6CA 1N6RA 2OO3A 2EG9A 4HR7A 3K70C 2ORWA 3ABIA 2G1JA 5CA0F 4JEMA 4P4NA 1W1UA 1N2XA 1IBMB 2YMQA 5DT2A 3PJDA 4MUXA 2HFKA 2BBTA 3UA4A 4JJ8A 2C20A 2L18A 2O8DA 1E18A 3CZAA 1LVUA 4MA5A 3AUXA 5BNFA 2J45A 5AW5A 4AL4A 5M34A 1HPLA 3M6LA 2WJPA 4KRYA 4ZQHA 3OETA 1GFIA 2FR8C 2Q62A 3GH3A 3PYMA 4FHEA 4QUJA 3ZJUA 3JWGA 3WIVA 5ALFA 5C8YF 3VHXA 5GIPE 4L8GA 2PUDA 3LCRA 2O1SA 3U5ZB 1ZMOA 1XJCA 3KKQA 3PFKA 4EB0A 2XE6A 1JE0A 1N5RA 5GM1A 1U4SA 3T7TA 1X13A 3W9YA 4A2CA 3W3ZB 3GP3A 1NSFA 2ZYSA 3QNWA 5FKJA 5IH3A 2UAGA 1Z4PX 2C7BA 1JTEA 2BKVA 3I28A 1VGQA 3N2IA 5C7LO 2QW1A 1V3TA 2DG2A 3S5UA 1QFSA 2GEVA 3V4VB 2WD7A 1WE2A 2WD8A 4Q4DA 3WK4A 1XCGB 5KNCD 1AA9A 2ZCJA 2KHZA 1YNSA 1N6PA 1CQIA 4NNJA 5F1KA 4CKBB 5KYUB 3O1JC 5IUJC 5FEMA 1RQPA 1K6IA 2CCGA 3MJEA 1C50A 3DPUA 4LUCA 3CZRA 4HPJB 1JN0A 1ICIA 1Z4MA 3HDGA 1QFYA 1NULA 1RCFA 1OJLA 4RPHA 1XEXA 2G7ZA 1VP3A 4CT0A 4HLCA 4UHJA 1K2VN 1KFKB 2V7TA 3LHFA 2Z1MA 4WOKA 3SYKA 3VKFA 3WXMA 4AF6A 5FTWA 5JJ5A 2YC4C 3O8QA 2QQ5A 3PUKA 4QQ8A 4FXOA 2L82A 1UFVA 3BAZA 2ZRMA 4HDNB 3DM5A 5DCYA 4YXWD 4BJ5A 4Q21A 3OPYI 2ZRGA 4PXAA 3ZE7A 1CNFA 2HAEA 4D9NA 4E4TA 1YAJA 1YRWA 5K0LA 4UUMA 3KBOA 3Q3IA 1H8HD 3GDWA 3RVPA 3JYHA 5EEGA 2NXWA 4FMBB 2ARKA 5FFMA 2C1XA 1QNFA 2BGGA 1IK4A 1IJKA 2PVCA 2HHHB 3SFZA 2XMRA 4RU1A 5ITVA 1D7OA 3IMEA 3L8HA 1GTVA 1RPZA 1HDZA 4BC1A 2DY0A 3PWSA 5AYVA 1K92A 2EBHX 3K6RA 4PPNA 3A2KA 4LZWA 1SAYA 1UAGA 3GBPA 1P1FA 2VNSA 3OHPA 3PDIA 3QHPA 1ECFA 4S1PA 1P2VA 3N1UA 3SQOA 3W7BA 5M5BA 4OLBA 3KSZO 4F11A 3FTFA 2F64A 3G5MA 4D9EA 1ESNA 4YY3B 3CG4A 1CUCA 3E5NA 2ZRCA 1BHQ1 4EAQA 5DSZA 1Q0ZA 3AR3A 1WSBA 4GW3A 4KVAA 4ZVQA 3RSSA 3X1MA 1RC8A 4M1KA 3MTIA 2V97A 2E1PA 1FFYA 2ZSJA 3PRKE 1K89A 4F84A 1TGYA 2CUTA 5A0FA 5HUQA 2ZR9A 3ACDA 2XKJE 4L73A 2OSVA 5KKCA 4WGGA 5KYXB 4OH7A 1KWGA 2VKQA 3R24A 3K2BA 4OHXA 5GTDA 3RVNA 1WUHS 1N2CE 3GFPA 5HIIA 1JH9A 3LQYA 2RHWA 5HCNA 2DP4E 1OTXA 3HR4A 3FPGA 2RE8A 2W48A 1B2LA 2GETA 5LUBA 1MJ5A 2VHQA 4RE5A 3E8XA 4L95C 2WE7A 5DM1A 4MS1B 1J1ZA 2CYCA 2I1QA 1NRWA 2E85A 2FVXA 3FWPA 1G21B 5SZJA 1VIAA 2VYND 4NEHB 3VJMA 5LOVF 3D6HA 1JA9A 5HZMA 4LCBA 1O58A 3FUUA 4UQOA 1HBJA 3EIOA 3WICA 4LJLA 1O87A 3O91A 2C04A 4J2OA 1KO8A 2AF3C 4KWTA 4NZ9A 5KHOC 3GYBA 4ZI7B 3AVVA 4XGNA 1E9DA 2JJQA 2PWZA 2ZETA 1MUUA 1VIYA 2B4KA 2OZPA 1MH1A 2X22A 2YVQA 2ZSBA 4JLSA 4XUDA 2Q6LA 2VK8A 1K8QA 2EWMA 2QTBA 4F5DA 5JD4A 2MR6A 3MTGA 5GIOE 3AF1A 1AXEA 1ZIPA 4FKMA 4PSDA 3CC8A 4WOJA 1VE7A 5LC1A 1FQWA 3GFBA 3UM9A 1M6EX 1X38A 2WDZA 4FS3A 2B0CA 2K6GA 2W2KA 1EUDA 1NMYA 1KVUA 4UW9A 3VDRA 1VCMA 2BDTA 1X7YA 1DBIA 2XY4A 4TMYA 4HQRA 3EA4A 2WJAA 4CL3A 3DO6A 3F7OA 2BTOA 2C3OA 2YQZA 3GJ8A 2IYAA 3PEYA 4UCQA 3TMYA 2ZBQA 3GVXA 4JBLA 4ZWNA 4ZXPA 4DR7B 1OXSC 3KLNA 1ULHA 2AZDA 4HNSA 4O4LF 1E6KA 4KIUA 2E21A 2IWRA 2ZBPA 3T99A 3UATA 4XWKA 1FX1A 1WZIA 2A30A 4UPEA 3WHKA 1SY7A 2ERXA 2CXUA 2QSZA 3CJRA 3E9CA 5EHXA 5BSVA 3LDUA 3L8CA 4G6ZA 4B8ZA 4MHOA 1IHXA 2ZWPA 3EY9A 2X1VA 4HJRA 3U3XA 3NUGA 3MWJA 1HTWA 2B83A 4GQAA 4WBSA 5LP6C 1FYXA 4HV4A 3D7MA 1H8EA 1DEHA 1EI9A 1QIMA 1A5AB 2AZ4A 2DSTA 3DE5X 4P32A 3RFUA 3D2CA 3ZS9A 5KNBD 1QPZA 4G1CA 1SC4A 2OWDA 4OQYA 2VN8A 1WCWA 3C1OA 4CN9A 2EX0A 4FT4A 3ZXIA 4K26A 4YRNA 3DKIA 2ZEJA 3KU4A 4ZI3A 5HHTA 1ZM3A 3GN2A 5ABPA 2PUEA 5AVZA 4GLOA 2VAPA 1E2GA 1T9BA 4DCNA 4LWZA 3EXG1 3VMFA 1JMKC 3QKSA 3LKZA 3I01A 3HB1A 4YPVA 4D42A 1XTTA 3ILVA 3ANLA 4XFDA 4XLZA 1ZJJA 2P0EA 4UNSA 1IZ8A 2NU6A 1OE0A 2X8BA 3COJA 1I94B 5F7JA 3HMQA 3MRTA 1PW7A 4RZQA 3ZPXA 2O2CA 5I7FA 2BCJQ 3AH8A 4Q1VA 1QGUA 1OYOA 3GDGA 5J58A 3PHGA 3UKJA 2ZK7A 1YRYE 2C4TA 1XMIA 1A88A 1QHEA 1HYHA 2B99A 1A7JA 2OBFA 2WT9A 4IIJB 3SQNA 1NIPA 4KWIA 5LPNA 4FQ8A 2XKKA 3CRMA 4LGYA 2ADFA 3HI6A 4RCZA 3UGQA 3V1NA 1KA9H 2Q5LA 3I1JA 4KR0A 4QPNA 3F2IA 1KY3A 2J4DA 4XPIB 3CUVA 4I9GA 1PYGA 2WTAA 5ED4A 1K08A 4RL6A 3X43A 4GR4A 4C4AA 2AG0A 1KTVA 2VRCD 2MWMA 3Q85A 3PC2A 1V47A 4F3CA 1JVBA 1WUTA 1Z17A 2OZKA 3FVQA 3OFVA 2WM9B 3E3LA 3QF4B 1PGPA 5FTKA 1KDZA 5IC6A 5CA1B 4M6WA 3HB0A 2C98A 4Q19A 2HMWA 2JH9A 3WB0A 3OE4A 5EHZA 1XTUA 1NOJA 4PG5A 1FCJA 2HF8A 4FYYA 4BAGA 3M0EA 4V3CA 5LLTA 1H3NA 3VNVA 5JCXA 1T6NA 3K5WA 2NZXA 2JIQA 2GFHA 3SXPA 3B6IA 4AJEA 4L3OA 4EFMA 1U0SY 1HOTA 1Z56C 2DQZA 2AI3A 3AJAA 3WP0A 4KREA 2P2CA 1I5EA 1XZBA 1YO6A 3B7GA 5A9TA 1E66A 2DFVA 3O8DA 1US8A 1GGVA 3GRYA 5TS3A 4FILA 1O8BA 3EE6A 3S44A 1A82A 4DNXA 4KPYA 5AJTA 4AG5A 3EVEA 1H2YA 1S89A 3ZHTA 2GEDA 2XF8A 1QV9A 4H77A 2NQ2C 3BJEA 3EIUA 1UBGA 4PANA 1U5CA 3TDMA 4MHTA 4NZNA 4MQEA 4RA6A 1Y3FE 5CDSA 2GAAA 2IV2X 3OTQA 4B40A 3HDTA 4B71A 3KKKA 4NYJR 4BASA 3WNQA 4HEA6 4MAMA 1G7RA 1LBSA 2WG0A 2RFLA 1JA1A 4KDFA 4TMWA 3T12A 2VJPA 1N2CA 3JQEA 3PDUA 4C20A 4G23A 4JBYA 1G8JA 1Z39A 3AHIA 1J5XA 2YR0A 2HRRA 2OV6A 3JQ8A 3V7YA 3JWHA 5K0TA 2WJ6A 1RHUA 1E9RA 1F9AA 2PL3A 4RADA 4OYYA 4FIDA 2EARA 2JAWA 3IYLW 1I2MA 2O0HA 1ZRHA 3EA5A 1VJDA 2NZ2A 3F49S 5EN4A 3SBEA 3EZFA 3H2BA 3OLYA 5FT9A 3T5PA 1HT0A 2QAGB 2NO1A 2WG1A 5CPFA 3FPEA 5ADVA 5FOVA 2XSZA 3C85A 2VPPA 3OKCA 5FUXA 4RIIA 4YJ3A 1JQDA 3KXDA 2WP0A 2XQIA 3WNCA 2CXNA 3SIXA 5LP6A 5CT6A 1M1YE 3R44A 2JFQA 4IJQA 3O3MB 2W6ZA 3NDIA 4I4NA 2IV7A 5H4GA 1J09A 3PD7A 4R7TA 1TO2E 1PBTA 1XT6A 1MVLA 4ZARA 2GO1A 2DQKA 5ALPA 4DJDC 5JO9A 4UFPA 4TTVA 2WSLA 3FNEA 4LGVA 5EWMB 1R3DA 5A2QA 3LUKA 2ZM5A 3O2SB 3INGA 3D81A 3I6IA 2WWHA 2CEKA 1L5GB 5I6DA 4LY0A 4BTVA 1G4HA 1QZZA 1UBKS 4ZU1X 2C7RA 2HOQA 1WUIS 3NUQA 3TW8A 4MLDA 3VMMA 3NBFA 1J8YF 5DCLA 2ZS9A 1ZVMA 3C5CA 3H9CA 4D81A 1TC2A 4PVDA 4YFVA 3D4PA 1G8MA 3T5MA 1WDWB 1F14A 1UOQA 2GM3A 4H1WA 3JD4A 3FMFA 3O8CA 4IL5A 4MJ7A 2I8AA 1ORWA 3MT8A 5FJJA 1AN9A 1TX4B 4E5SA 2V7VA 1LI5A 4R8LA 3G8BA 4M9XA 1SHLA 3VVCA 3J7AC 1Y5MA 1SNYA 4IYJA 1QRAA 1DC5A 1W2HA 1PJ3A 3DC2A 3RV3A 4M9UA 1QH1A 1XA4A 1FFHA 1MKYA 1GUDA 3MPUA 4IMIB 4NU8X 4ZAVA 5LZ4A 3U49A 2PIDA 4F92B 2OG1A 3RT9A 4UCWA 5JAPA 4KMMA 1CULC 1RI4A 3IDOA 2NPFA 7ADHA 2XHEA 2QMUA 4B3XA 3OEEA 1IC6A 4N4AA 1L4LA 2YHSA 4DBZA 4DM4A 3QKTA 5D5HA 1U2DC 3HKCA 1JYEA 3DV9A 4ONEA 1D4AA 2IYEA 3EVBA 3FZQA 3C24A 3HKDB 1KNQA 3L8FA 1O57A 3N7TA 4RVSA 2UZAA 4OAQA 4TRNA 3SYNA 3H9GA 2E1RA 3O4HA 1NXPA 2HT6A 3K0HA 4KQWA 4CMHA 5KWVA 4NJEB 1C30B 1SB8A 1PGOA 7REQB 3ZVNA 1VL2A 1E20A 1ZK0A 2NTEA 4G36A 2PX0A 1K06A 3LO5A 2WUEA 4HN9A 1XQ9A 2NIPA 1XLUA 2OKGA 2YJZA 3HVKA 3L3BA 1A4XA 4RVDA 1LV7A 2FZ4A 1P0CA 3R0QA 1E79D 4IJMA 1ZCFA 2OD7A 3AYXB 3IUSA 4BP1A 1ECBA 3HCEA 4I50F 4LDNA 1IZZA 1F0YA 1QFXA 3O93A 1ZH2A 4M1QA 3ZNNA 1YVPA 1HV8A 2BM0A 2CSXA 5K0ZA 2FSPA 3H2ZA 1IN6A 1L5SA 3EW9A 3Q8WA 1CR6A 2ASVA 3MQ4A 3ZE8A 4DLYA 1W2WB 2W6JD 4AO6A 4Y6QA 4N5IX 4BQEA 1GTJ1 3H11B 1EPUA 4YV1A 3LTNC 3K0EA 5HS4A 4I1SA 4G0WA 1UBCA 2WV7A 1S7CA 2DWPA 4Z1MD 2PR7A 3BXPA 2EVWX 3DE2X 4RL4A 3RUFA 1PUIA 3SCZA 2VPYA 4QVIA 3IR5A 1NP6A 1QWOA 4M98A 4PXYA 2FSHA 1L5FA 3AHCA 4FI3F 1NBIA 3ANYB 2ODPA 3C3JA 2O23A 3UJNA 1GGKA 1IBKB 3AX6A 1Y7TA 1W48A 4ZHQF 2OC4A 1FTSA 4GFDA 3VV3A 4CMEC 1LLDA 3UT5B 4OHPA 4DUGD 5AMXA 1BCSB 4OF4A 4EB3A 3PHBE 3DO5A 4LBWA 2XCIA 3IRVA 3SQDA 4RTPA 1LY1A 1E1NA 3JQBC 1JFSA 4G97A 1UPUA 2LCIA 1H4SA 1GZSA 2H00A 3TZCA 2IPLA 5ENVA 2CLMB 2YY6A 5DX1A 1JQBA 1E3WB 1LK7A 1ZM2A 5G1PA 4MQ5A 2X40A 3ET4A 4QUBA 4BBJA 1Y4UA 4GLBA 4NXNB 1T2DA 3R9XA 4DR4B 4AY3A 2RGUA 3K1ZA 4K1LA 2TMGA 1R12A 5DBFA 3UTCA 1PT7A 3UKDA 3TDKA 1QO7A 3WYBA 5HSGA 3LHIA 4P3PA 1PK9A 5AM0A 4HGYA 3Q5EA 4HYQA 1DEKA 4O59O 3IAXA 3F73A 1YDFA 4INPA 1FYEA 3RHZA 4KDCA 3MSCA 2YN0A 3BJIC 3IDQA 3K70B 1JHXA 4AKHA 3DYBA 3I5MA 2C61A 2HM7A 4HH3C 4WINA 3ADBA 3PGXA 1EE2A 3HLYA 4K0RA 1TA9A 4MQUA 1XELA 1DDOA 2AEMA 2C5HA 4FYVA 3ZY3A 4JZYA 2WP8J 1DTSA 3T34A 3BQ9A 3U4HA 1QH9A 4NBLA 4QXOA 1YVUA 3WIDA 4EUSA 2AOVA 1TD9A 4CU5A 3BWYA 4BUZA 4NBVA 3EWAA 1JBEA 2I9PA 4EMSA 1D1TA 2FUG1 1MT0A 5ECWA 5C8XA 1OR8A 2J0QA 1ZSYA 2FRDA 1NXSA 1SB9A 2XHZA 4RF2A 4CWAA 1H66A 1DEAA 2ROQA 2FPLA 4RGQA 1S7GA 1UKZA 1W2GA 2W2MA 2HLHA 2B5VA 2ZIWB 4HNGA 4HX5A 4RY9A 3RLIA 1YFZA 1BS1A 1BQ3A 1VPTA 4LECA 5AW3A 1PUXA 1UZUA 3LVRE 4RMHA 1MXFA 5FPPA 1MO5A 3H5WA 5EE5B 5FRDA 2QTHA 2Z9DA 3I73A 2IKQA 3UMGA 4LZNA 3VBCA 3ZOKA 4LE1A 1KYZA 1WV0A 1H2RS 1ZW1A 1VLHA 2G0TA 2Y1WA 2XKAA 3ONWA 1YBMA 2R2GA 1CK4A 1T5IA 2QA5A 4H3SA 4QUHA 3CH6A 9LDBA 5KMGB 4L28A 2IDKA 2CY0A 3KOZA 5JZSA 2PLFA 1ZRSA 3RADC 1MIOA 3HDHA 3WV5A 4AO8A 1FLDA 1JDBC 1DCMA 5LBIA 5J4KA 3RYTC 1N0WA 5IM4A 5FQNA 3UPUA 1J9ZA 2QMHA 2P75A 3I6ZA 4JLNA 4YH1A 4ZYXA 1HYQA 1VI2A 1QH1B 2QUJA 2W2LD 3MGAA 1GA4A 5LQRA 4JV5B 4L5IA 1KQPA 3H42B 3I5AA 3KVRA 4B7AA 3ZCXA 3LL4A 1D2CA 1GXSB 1R0CA 3AESB 2PU7A 2PL1A 3CKMA 5DCWA 2OFPA 4Z53A 1XP5A 2RKOA 1I5OA 4O5OA 1ZNWA 4ETWA 3QLUC 2ZSEA 5FUBA 3LKVA 1W29A 1WKBA 3RGWS 1GGNA 2PTHA 1L6RA 3BDIA 2HWWA 1A71A 2VHUA 2YMPA 5F7ZA 2G8NA 3EOZA 1TMYA 3VHRA 1XZEA 4KQ1A 2C59A 3JQPA 3M83A 1F12A 3RAEC 3VTFA 4XJTA 2IZ5A 4UTXA 4LJRA 5HKAA 2DFKB 3NTOA 3R75A 2NUBA 4WI1A 4F45A 3Q3GE 3D8RA 2WUWE 1CT9A 1FDIA 3D4OA 4JJ7A 4QGGA 4DPKA 2I71A 3OJEA 1MW9X 4O2RA 4DDMA 3PQ8A 2FPXA 1EVEA 4YIKA 3UNXA 3EZNA 3V42A 3MC1A 3U60B 4TMKA 3B6JA 3LSTA 4XASA 2CFIA 1Z3IX 3PUVA 2XQFA 4NSNA 4Z49A 3AXSA 2CV0A 1B3RA 3SPXA 2YFQA 1G6Q1 4QDJA 3LDGA 3GA5A 2ZIXA 3KXKA 1E9AA 1HXHA 3AJDA 3O8RA 3IAEA 1KKLA 2ZGVA 5IX8A 1NFQA 2V3VA 2ZAMA 3IMKA 1ZNZA 4FDVA 4FMCB 2BHSA 4MS3B 1V6CA 4QXRA 2WAYA 4WBXC 5CVEA 2KBFA 3BK1A 1X9GA 3ZY2A 1NR1A 3S2UA 2CDCA 3HDVA 1GA6A 3K0FA 1I24A 1KZ9A 1EFPB 4NZYA 4A0GA 3ICCA 3TQIA 2FH5B 1RPJA 5E9QA 2X86A 3FPKA 3QUAA 3ZE0B 1ZBDA 4JLAA 1N3IA 1F2UA 4MKHA 5HM8A 2VXCA 4GXNA 1KZGB 4D45A 1USUA 1MO6A 2EFEB 5CVDA 2NTNA 3T41A 1CUAA 3CURA 3UB4A 3ZWWA 1BGVA 3WGUA 4EYGA 1RWXA 5I9NA 3PFIA 3DQZA 1U1CA 1GRNA 5TT1A 2SNIE 1JFRA 5FCDA 3RS3A 3ITNA 2XD4A 3JRWA 4KLAA 4JDUA 4Q4JB 3SNKA 4HB0A 4Q34A 1JHPA 3LNCA 1LGYA 4EKDA 2B37A 1L4MA 3T7RA 1CUFA 2ANBA 2LV8A 3B5EA 4RDHA 3GRFA 2A1UA 1UC8A 2HLNA 3A4YA 4MYHA 4PPGA 1JX6A 4LQCA 5TB5A 3BGWA 3S5JA 5K05A 3ZVMA 2J46A 4TVBA 2QY6A 4Q3CA 3QNUA 3VR6A 2MSDB 4ARZA 4EO9A 1T4DA 1E2NA 3UJDA 3OPXA 3MTEA 4N8DA 3D6FA 4DL9A 1E7YA 1KYVA 1RWMA 3ABZA 2R5FA 3CF0A 3DD5A 3GFVA 3LJKA 3NHSA 3NW9A 4K9SA 4YFYA 3THXA 4YR7A 1GU1A 3EVFA 4DQDA 1Q74A 1WXWA 3FRHA 3KWLA 1H8HA 2X0EA 4EDFA 3IV9A 1Z0IA 4EA6A 4XA8A 3FPAA 5EXXA 4DCUA 5ALEA 1VE5A 3KS9A 2ZP1A 1K9SA 2WICA 1B3BA 2C5EA 1QGAA 4HTAA 5BXQC 4BQNA 4JLUA 2BFDA 2GK3A 4RTKA 3CLUD 3LBAA 1A50B 4C88A 4Z3DA 2VBGA 4DG9A 1YGYA 1E2MA 1RPAA 2LW7A 3KUXA 5K0JA 4W1PA 1KI1A 3Q3JB 2ATCA 3BCRA 2Z3WA 4L15A 3AETA 3GGCA 4IG4A 1KJ9A 1YRBA 4BEVA 5TGZA 1KRHA 3KZMA 1WXQA 3BB1A 1YQGA 5DIZA 3QE9Y 4R5MA 4KGDA 2K2QB 1L5ZA 4TS4A 2E2WA 3FB1A 2IUSA 1CB0A 3UTDA 3CJTA 3GO4A 3TW6A 1JDUA 4J4TA 1NVDA 1XSEA 4JY7A 5DHQA 1ILEA 1IDN1 4TLAA 2C0PA 2EJTA 1M6WA 3LM8A 3DB1A 1EDDA 3L46A 1ANKA 1B2RA 1M1NA 2GHIA 1SRQA 2BUAA 4UEQA 3QLVA 4J16A 4YLEA 3NNDA 2R6DA 2VCYA 4ITRC 4TXJA 3MHTA 2OYRA 3DH0A 4PSUA 2W22A 4IQ8A 2COKA 3RLFA 2GJAA 1CDDA 1EFAA 4BRZA 4BO5A 1W0KA 4XYBA 3HLTA 2AEJA 3QV1A 1KJNA 3AR2A 1JU4A 1VJCA 3NBXX 5BVHA 2ZUWA 1Q1AA 3EC1A 4XCQA 1SOUA 4I81A 3Q2OA 2WB4A 3JQAA 3K9WA 3Q0EA 4KH1A 5HIMA 1A77A 3USES 1PDVA 4RD3A 4F3RA 3JYNA 1E2HA 3HB7A 3I9KA 1ZNXA 4TV9F 2BC9A 2XW6A 2Y3IA 3ASUA 4EMUA 3UB2A 3SSAA 4CG2A 1RYEA 3NATA 3QMVA 2YWCA 3G1WA 4R2MA 5JLAA 3V1KA 2LE0A 4YHHB 3A6PC 4IHJF 2OV3A 3W6NA 5TEWA 4EGCB 2NXEA 3LPCA 4JJEA 3P96A 1C9YA 4MICA 3ZK7A 1ZJZA 1C8BA 3LGXA 4X9XA 3ZGZA 4IIGA 1GZUA 4HH1A 4AG3A 3WGLA 4ZEVA 1JEJA 2RGNC 4HS9A 5AIAA 4P80A 3E81A 3HUDA 4IQGA 5FXMA 2NUAB 1NQAO 3P26A 3UOGA 3JRNA 4QWMA 4KE6A 2WAAA 5TNXA 1Y1LA 3P2MA 4J0QA 4LXQA 2ZT8A 5AK3A 4CQLB 1YJ8A 4QTUB 1TUGA 4XVRA 2I2DA 1CRWG 1FJGB 2WLTA 5C35A 2G36A 4OATA 3E3MA 5HF8A 1NBMD 5AKGA 2EHDA 3FBTA 2X7JA 2RGCA 2RH4A 3C48A 3LVBA 4WPGA 4FTWA 4KRFA 2GH1A 1WOYA 4DLPA 4YV7A 3O9MA 5HP4A 1E5VA 1N7HA 5T67A 4YCJA 4EPXA 4KVZA 2RB5A 5I4BA 3DLTA 1QHHA 4ZI7A 2I34A 1E0JA 3A1FA 3H65A 1VKOA 4Y2VA 5C80A 3WRXC 4OHMA 4Z4CA 4JJFA 4DNQA 4LHYA 1ESEA 3L18A 1FEZA 2HU8A 2ZTSA 3TLXA 3VKGA 1AV6A 2UZ1B 5KNBA 4AYWA 5HS6A 2WKPA 3TSOA 4WGFA 3VZQA 5HUJA 1T3SA 1DJPA 2CD7A 2E5FA 2I4NA 2IUYA 2C2GA 2RCYA 2BL4A 3ZWMA 1RRKA 1TIKA 3Q0IA 3UJ7A 5FA6A 3HXLA 4LC9A 5IDWA 1WVIA 1M2GA 5L3SB 5CB8A 3I1YA 4Y3UA 1IHDA 4FEGA 5E1OA 2VT2A 4G5QA 1N6NA 2B3TA 4BMPB 3L4JA 1CBUA 1RJGA 2NAFA 2R4TA 3GAMA 5G4LA 4FW8A 3V2GA 5C81A 4LBZA 1X6VA 2JDIA 4R1PA 1X42A 1C2TA 2OILA 5G4KB 3D2AA 1AQUA 1KAHA 2JLRA 2G7MC 3PE6A 4FJ2A 4Q12A 1QJ4A 3MWFA 5BQ5A 5EMLA 4BFUA 3Q98A 2XYHA 3QWBA 1HKHA 4DDKA 3FFTA 3HWSA 5IM5A 4E21A 3AVYA 4QWWA 2C92A 1M2VA 2F9MA 1PGNA 1Z2AA 1U7OA 2G5CA 3B3QA 1W5EA 3FSJX 3FA2A 3TR6A 3WO1A 5DH9A 3CF2A 5KQRA 3RUIA 4HJXA 2I6UA 3AZPA 4LHZA 4KITB 5FOWA 2G77B 3BZUA 3GGGA 3QOYA 1RYHA 2Z1NA 4LYDA 3UJ3X 2GQ0A 2JBAA 3K9BA 3L7NA 1EZ1A 2A9FA 3DBRA 3GVCA 4NBWA 3EK2A 4Q3EA 3EUAA 4QJ5A 4X41A 1SKMA 1P3JA 2GBFA 2BFBA 5F5LA 3ROTA 3M5PA 2OP1A 2PK3A 3STUA 1QP4A 4N3CA 2BGMA 3ZU5A 1J25A 3FB4A 1SKAA 1VHJA 3AEXA 1ISJA 2EQ5A 2WAMA 3RO7A 1EJBA 3N5CA 1BCSA 4QRDA 4I1YA 2HRBA 3BWVA 5KDOA 3CGGA 2A7XA 3DVSX 1Z38A 2IYZA 3TTSA 3VSDA 2DE0X 1B6GA 4TWBA 1PK8A 5DBIA 5IAOA 2EJVA 1L7PA 2RB4A 1IB0A 3I2KA 4NBKA 4YJFB 3J81A 3KQVA 1EX1A 1IBCA 2X76A 3QE2A 1SKUA 1XK6A 2QJFA 1ZJ4A 3K8YA 3OQVA 4PSCA 2YNMC 4MV0A 4R3WA 3FTPA 3EDQA 3GJQA 1IHOA 4II2A 4DRXB 1PNTA 2VRWA 2GUGA 4Q9AA 4ESVA 5JDIA 5DEOA 2IGBA 5GMOA 2J6BA 4R71A 3UWDA 1Y6QA 3T61A 2CE7A 3R3VA 1LPBB 2CL5A 3HRIA 5IK2A 1E1YA 3I42A 1QFMA 1JG7A 3B1VA 5HRCA 2V65A 3AUFA 5A03A 5KOHA 2R7MA 1YS7A 1TKRA 4E22A 1XEFA 5JCOC 2AOTB 1PFQA 1CETA 3KZCA 2NV0A 5LMZA 4FFMA 4L6CA 1LI4A 4G25A 1TTPB 2HADA 4QXMA 4X92A 1ESDA 1VMEA 4EITA 2H5IA 1N9ZA 2PUFA 4D3YA 2B34A 1XFDA 4ZHSA 5HWSA 4OP3A 4ZYUA 1PL0A 4P82A 1JJBA 2IUTA 1QO9A 2PR2A 1NUPA 3N2KA 5ERXA 2XSZD 1YQ9A 3F4LA 1AGYA 3K8ZA 1M8FA 4HZUA 5LBUA 3C5WP 5GONA 3MJFA 2Z2IA 3H05A 4TRMA 2HA3A 5ERGB 2H16A 4I8DA 1BG6A 5DHFA 4ZAGA 4YPFA 3Q7EA 4BNDB 2FWNA 1ISRA 1YCFA 2JGDA 4KXLA 3WGHA 1F4PA 3TS1A 1FP7A 3SVZA 4YAWA 3EQ2A 4X54A 1AD2A 3ZLUA 4V2UA 4YRCA 1XVUA 3L8MA 3ZIDA 2G8LA 5EZYF 4CW7A 4D56A 3AEQA 2RSLA 3SBDA 1VM6A 1SXJD 3GIWA 1MBZA 1F2UB 2HSZA 2O6LA 3SU8A 3LXUX 1OU4A 1SC1A 3KQTA 4N0PA 5ULLA 2QVCA 4C7KA 3STVA 4MJXA 4FNAA 1E32A 3MLEA 3Q3EA 4KXFB 2OLEA 4DLNA 3LXMA 3BSWA 3UHOA 3M49A 2IX9A 3T3IA 1SVSA 1C1DB 1ZQ1A 3AIKA 1Z4OA 3K0FB 3ONVA 1PFWA 3W3AA 4L7VA 2BZ0A 4ZO8A 4ZCPA 1UUFA 2YKGA 2OBLA 2OORA 4KLZA 4V0LA 2O50A 3EA0A 1JQEA 1MDBA 3FNHA 3OZSA 4MXDA 4AN4A 1KO5A 1F48A 2REXB 1OB5A 1JAYA 1KFCB 3MQFA 4B84A 1CZHA 4MMXB 4NCAA 4DILA 4A6PA 2YS6A 3R2JA 5KYGA 4NAUA 4CVNA 1SQ5A 4RANA 5EKXA 5ELMA 3W5IA 1GZ3A 1GHTA 5E6SA 5EJIA 3K1AA 1D6SA 5E8JA 3BWCA 5B3JA 4RZUA 3AB7A 1WXDA 2ZTUA 3VPDA 4ED9A 1H6CA 1TFRA 3KKOA 1FQOA 3RWBA 4ETMA 2I4IA 4UCXA 3TUJC 3UCEA 4CM4B 5ICCA 2XE4A 2QUKA 3EY4A 5DNYB 1J07A 1PQUA 1T3ZA 1GOTA 4L07A 5H83A 1FVOA 3I2GA 4OQLA 1XLWA 3ADKA 4YI5A 3FFAA 1F4LA 3MD0A 3S40A 4MWDA 2QRJA 1YE8A 3I64A 3MCTA 1P39A 3NOVA 2HF7A 1V5EA 4J9UE 4YO7A 4N5MA 7MDHA 4IM7A 1Z0JA 5AI0A 2ZULA 1L7MA 4YAGA 5HFNA 4Z7JA 1UKCA 3KB8A 4HAVA 4WK4B 2GF2A 3MOSA 5ECGC 1AJEA 1HFWA 1ZOSA 2C96A 2PUWA 1XTRA 5HRUA 3B1XA 5TRTA 1T8SA 1X7HA 1ZCZA 2CDNA 2ONYA 4TMFA 4MKXA 1ZYUA 5HF9A 1JLLB 3BSYA 1YR6A 1IRIA 4TT3A 1FDSA 3DP7A 5IDYA 2YS7A 4NEQA 2BV3A 1Q19A 2O6HA 5T6BA 3AM5A 4X63A 4IDQA 1CUVA 5T8KC 3HDJA 1EA7A 3A70A 2AFHB 4LDPA 2AN1A 2WJIA 5IHXA 1N57A 3MMNA 1PZEA 4FFDA 3TM4A 4QG7A 2ZVPX 2TRSB 1HSZA 2WYIA 3CVOA 5ALSA 4BFYA 4S2EA 4C5CA 3WMEA 3A8TA 5EJMA 4AZ0B 3DFFA 4W7SA 4H1TA 1D07A 1G8GA 4KNYA 3LPNA 3OZGA 2NVUA 2V7WA 2DR2A 4DA8A 5A4MS 4V0KA 1SQ6A 2IYWA 1A1SA 1DQZA 4S0ZA 5IYZF 3RFVA 3H8JA 3NC4A 4DSOA 5C52B 3M7IA 2P40A 1VRCA 3A6FA 3E9RA 2M6RA 4UDNA 2IITA 3S6JA 4TM8A 3WX0A 4DCPA 3O26A 4O4HF 2YY7A 3G2MA 5ED0A 4C87A 4K88A 1Y5NA 5FUQA 3LWZA 4KFUA 5EIEA 1KGSA 2GN2A 2XCOA 4BUCA 4PLFA 2AOTA 5D1NA 5LIPA 1T5OA 2NZWA 3R7AA 4C4OA 4NNPA 1CNMA 1DIHA 2BI8A 4LRUA 5FFFA 6CHYA 2FW8A 1QYIA 3SXUB 5JS1A 2Q50A 4P38A 4GKAA 1OV4A 1KF0A 1W73A 1E7RA 2J9GA 4UKDA 1R5JA 2JH8A 1WMDA 2BFCB 2GA8A 2Y67A 3CB2A 3I76A 4KAXA 3T3MB 4QAJA 4CNQA 4A5OA 3DTYA 2CNDA 3SN6A 1VIVA 3AUUA 4GYWA 5ETJA 1RXIA 5JV5A 3PEEA 1AUVA 4URWR 2QVGA 3CZCA 4IYRA 1DRUA 5F3RA 5HBRA 4UXJA 1T8WA 2PWAA 2GD2A 4B17A 2G9RA 4ZO7A 4Z8YA 3EPLA 3B8HA 2ZJAA 4