2CDRA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 53
structure length 147
sequence length 147
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cdrA00
1PYOA 4PRZA 1RWWA 4QUDA 2QLJA 5LUBA 3EDRA 3P4UA 1NW9B 4QUEA 5LU8A 4EHFA 1I3OA 3V55A 3H0EA 3DEKA 3S8EA 3D6HA 4QUIA 3V6LA 5IARA 1NMQA 1RHUA 3R5JA 2QL5A 4ZVTA 2QLFA 3R6GA 4EHKA 3SIPA 5IAEA 3R5KA 1IBCA 4JR0A 2CNOA 4PRYA 4HVAA 3KJFA 1RWOA 1RE1A 4NOMA 3S70A 4N6OA 1RHJA 3DEHA 3BIJA 4ZVSA 4ZVPA 4NBLA 5IC4A 3V3KA 3H11A 4M9RA 1RWVA 2HBZA 4EHNA 4ZVRA 2CNKA 1RWXA 3GJQA 3K7EA 1SC4A 3IBCA 2XYGA 5IABA 2H5JA 5IC6A 3V4OA 4QU8A 1NMEA 4JR2A 4QUJA 4QUGA 1CVRA 2C2MA 5LU9A 2CJXA 2K7ZA 2WDPA 4JJ8A 2C2OA 3DEJA 3R7SA 1F9EA 4FXOA 3UOAB 2AR9A 2CNNA 2H4WA 3ITNA 4N6GA 4QU5A 3PD0A 3H1PA 1I4EB 4I1PA 4DCJA 4NBKA 2HBRA 1GFWA 5I9BA 1K88A 2P2CA 1PAUA 1I4OA 1RWPA 3PCXA 4DCPA 4JJ7A 4QUBA 4ZVUA 4JR1A 1JXQA 4QTXA 2CDRA 4EHHA 2H54A 4EHDA 4N7MA 2J31A 3NKFA 3R7NA 3IBFA 3KJNA 1RWNA 2Y1LA 1K86A 3V6MA 5LUAA 1RHKA 5IBPA 4FGUA 4PS1A 1RWKA 4D3XA 1QTNA 5IBCA 4DCOA 3P45A 1RHRA 2FUNB 5IAJA 3H13A 4ZVQA 3GJTA 2Y0BA 4JB8A 2H65A 1SHLA 2XZDA 5IASA 1BMQA 2H5IA 3UO8B 3GJRA 1M72A 2J32A 5IBRA 4QUHA 4NOLA 1QX3A 1RWMA 4HQRA 3NS7A 4QU9A 4HQ0A 4D3YA 1QDUA 2C2ZA 4QU0A 4FDLA 4AW9A 2DKOA 2C2KA 5IANA 4EHAA 1SHJA 4NBNA 4JQZA 1GQFA 4QULA 2H4YA 4ZVOA 3E4CA 2QLBA 5IAKA 3GJSA 3EDQA 2HBYA 4JJEA 3DEIA 4N5DA 1F1JA 1RHMA 4EJFA 2H51A 2XYHA 3NR2A 3H11B 4IYRA 2QL7A 4NOJA 1CP3A 5IAGA 3SIRA 1RHQA 4IEFB 4FEAA 4QUAA 2J33A 1SC3A 2FQQA 3PD1A 3QNWA 2FP3A 3R6LA 4I1RA 5I9TA 3KJQA 4D3ZA 2QL9A 4AWBA 3RJMA 4NOKA 1NMSA 2XZTA 2C1EA 5JFTA 2CNLA 4AWAA 4PS0A 3R7BA 5H0IA 1SC1A 2NN3C 3D6MA 3V4LA 4EHLA 2CJYA 2XYPA 2J30A 1I51A 5K20A 4N6NA 2H48A 1KMCA 1ICEA 4JQYA 2HBQA 4N7JA 4QTYA 4LSZA 3OD5A 3D6FA
chains in the Genus database with same CATH superfamily
2BP7B 5ER6A 6REQB 2XTZA 5L7YA 2MYTA 3L01A 3Q7TA 1A77A 1BE0A 1Q0HA 4J3NA 4H31A 4JT8A 2MSKA 4J7UA 3OUZA 3GPBA 5D84A 4HWGA 2YC2C 4D5GA 1BS1A 4UASA 5CDHA 3PUIA 1U63A 3BJRA 4K6FA 2QT0A 1KI2A 1UM9A 4N0PA 1ABEA 3W9SA 3VDQA 1NR1A 1Y1LA 2L0XA 2PUJA 2WU3A 1IBCA 2FNAA 2XVYA 3CW9A 4IOLA 1DLIA 4LOLA 4TWAA 4YP0A 5AJHA 3D8BA 1Y6QA 1FDRA 3GFVA 4XQEA 5DNEA 3HDQA 3GRYA 5A9SA 4IUDS 1AC5A 6PFKA 2XQKA 4FCTA 2EBHX 4IIJB 4IIHA 4CCAA 5AKJA 3R8CA 2VWGA 3VTAA 3EFHA 5C4GB 2CXOA 1LVHA 1NBWB 3DKVA 5AXCA 4OGGA 4GOKA 1O5TA 3EEBA 2B8TA 5EMNA 3L0ZA 2NYVA 4HDSA 2QMHA 4C5BA 4FFVA 3NFYA 4CQNA 5LP6B 1XLTA 1WMEA 2P1ZA 3SP1A 1ZOIA 3IKLA 3VPFA 2X8WA 1JKJA 2PXCA 2RAUA 5BY2A 3THXB 2ZT8A 4KQEA 1WX1A 2F7SA 1U6JA 2X1VA 2DXIA 4XWOA 1E2JA 1CUVA 1AXEA 2ATEA 1TTPB 4CLOA 1AJEA 2BISA 3MD0A 4AJEA 2I2FA 1ESCA 1GEGA 5E9JA 1SBNE 2CF6A 4KKVA 2Q3BA 2CMFA 2Z9BA 3G9QA 3DMPA 3AU9A 1ZD5A 1GPWB 3ZHCA 5DNAA 1J8DA 2G9ZA 4G4JA 3C1TA 3CUSA 3HWSA 4IIBA 2ZUEA 3Q2KA 3X1DA 3GA0A 3EXFB 3HCCA 4NMLA 1QMGA 4HNQA 5JS2A 1P2UA 3SF8B 3UT5B 4BBJA 3DL7A 4RMJA 1U9ZA 5A04A 3C74A 3SJUA 3D3QA 2ZIUB 5JH7F 1EG2A 2UV8A 3KPYA 3OZUA 1FFCA 4NKRA 1L0BA 1IPFA 5JECA 4U7FA 3NASA 4TV9A 2O7SA 3WK6A 4R01A 4UNSA 4DVGA 2FEOA 4UMFA 1TLFA 2XUHA 3FYHA 2FWBA 3ON5A 4GR4A 1ACMA 2J45A 2D06A 2FWNA 1U3VA 4FMCB 4X60A 1LNQA 1Y5RA 4LC0A 1G21A 4D97A 4YI3A 3MGAA 2HHAA 4LDQA 2RAFA 1N5LA 1P44A 1Y3DE 2J9ZB 1XF1A 3LD9A 5KREA 4LGYA 4DQVA 4KNWA 4ZP1A 3KT3A 4GKJB 2BTQB 1HGXA 3HCNA 4PIMA 3VR5D 3JQBC 2OESA 1XJQA 4IJ5A 3JV7A 1BTOA 1TYCA 3HVUA 4FXPA 4OKIA 5DHAA 1ZJWA 1GYQA 2G1AA 3T5TA 1CBUA 4HADA 3HJRA 5AYVA 1YCDA 4ZEOA 2WPDD 1A69A 4BFCA 4E5DA 1ECCA 1BHJA 2Y1OA 4ACAA 1QZUA 4D9EA 1QE3A 2IL1A 3D7KA 4JC0A 5FUMA 4TLEA 3TBHA 2HA4A 3F3SA 3RVLA 2E49A 3MS7A 3VAAA 5AW7A 1ISRA 3VDRA 3ILYA 2JLZA 4NNJA 1TAQA 2P8JA 4OHZA 1OIVA 2VYVD 1EGVB 2PLFA 3BXHA 2UDPA 3BWDD 4PFKA 3TL3A 3K9WA 3EPPA 4WVLA 1YACA 5J40A 9GPBA 5L8VA 1GNTA 1YO6A 4WFQA 4Z3DA 4RTRA 4PG4A 4O4HF 4CF4A 1IQPA 3AHEA 4M0PA 5BV7A 3MPOA 3VR6A 5GADl 1LBQA 1KEKA 1A9PA 5LXTB 3AW8A 5EE0A 1W5BA 1XCPA 1WKBA 2ZYAA 3K9CA 1ZVMA 4RVCA 4B76A 3MLEA 2IOFK 3G8BA 4UEOA 2AV6A 3TAXA 3BZBA 4UM9D 3SGLA 2Z8ZA 3IOYA 1F17A 3N70A 3P0HA 3MCVA 1LUAA 1CQJA 2JK0A 3OTGA 4F38A 1Z16A 2HMYB 4E12A 3CG0A 4OGWA 4AJNA 1CUBA 1EFPA 1F0KA 1XLUA 4LS3A 4OHXA 4PV7A 1JILA 3ANSA 4A15A 3L02A 3WIUA 4DV2B 3BRWA 4A2PA 2JGDA 1IAVA 5JBNA 5HUHA 3AFOA 2I54A 3NC4A 4O02B 4AP9A 1EUDB 1XTRA 2I6SA 2OBLA 3C15C 3ESDA 3GJQA 3SF8A 5B4VA 1E2QA 4TS3A 2J3DA 3V7YA 5BUSA 1P4AA 2PANA 2OILA 4MI9A 1BCSA 3JR7A 2O8CA 1Y89A 2G83A 1F3LA 2WVAA 3LXUX 3R5HA 3EYAA 3C3WA 2X22A 3AOGA 1ST3A 4MRAA 3SYMA 5FA8A 3K5HA 5TS3A 1ZGGA 4KQ1A 1VA5A 4MVYA 3E4DA 3ZX4A 5IJ0A 3NC1C 2AMYA 1XDWA 1UOOA 1I24A 1A96A 5EUBA 2WG1A 3HKCB 2OYRA 1M1UA 2B7LA 3NKFA 4UU1A 1J97A 1U2TA 4QGBA 3RV3A 1Y4ZA 4U3JB 2P90A 1XZEA 4MICA 4B5LA 3H4TA 1C7JA 1E3QA 2C2XA 2E4XA 4A1OA 3MT0A 3NHFA 1LBSA 1K6IA 4NJMB 1P80A 2BV3A 5LJIA 1SOVA 1O9GA 3THSA 1YRHA 2I55A 2W6ZA 2X3YA 2BUAA 1A5ZA 2YOGA 3FOWA 2O5RA 3PHCA 3R24A 4DKJA 2GN2A 2P4UA 3T6KA 4O2AB 3ZU2A 1TYDE 1QV7A 1JHYA 2PZBA 1CY7A 3M49A 4B3MB 2BUBA 3B6MA 1QFJA 5A5EA 3GFGA 4LDPA 4TTRA 1N6KA 5A4FS 4O4JB 1I5EA 5THXA 3NPAA 4J0DA 3IELA 1DBRA 3AF6A 4PEVA 4CZ2A 4F4DA 4TUYB 3D8UA 1VGQA 1G64A 2IBSA 2Q6LA 2FZ5A 3TQRA 2NZ2A 1VLLA 3DWIA 2Z5LA 1MTOA 1EXDA 4IH1A 2H51A 4PSVA 5AVRA 1ODLA 3HDGA 1Y8ZA 2J08A 3VUFA 1OE0A 1RHQA 4NFLA 5SZHB 4B8WA 1JEOA 2FVYA 1JL3A 3C41J 3CPHA 1H2HA 3OPVA 1RIFA 4L7QA 1TZJA 2WNIA 2OHIA 2P6OA 3PQFA 4GOLD 4QWWA 3WLFA 1O94C 2IYZA 5G4LA 4TV8A 1CJTC 4UE6A 1L4UA 4MJ3A 3ZTTA 2AFIA 2AD1A 5KTNA 1VJ1A 3GLGB 4AVYA 4LFAB 3A7EA 1TZMA 1WB5A 1SA0B 2AIRA 2ECOA 2JEOA 4G0ZA 4X41A 3TRFA 5LDHA 2JIDA 4GP6A 1F2VA 3FZGA 1KYXA 3R6DA 3PUXA 4XRGA 2E6UX 4B6PA 1TC2A 2NUBA 3PXEA 5CIWA 3O9MA 2G88A 3N8IA 4UBIA 5CH3A 4EO7A 5AHWA 2O59A 3UUWA 4U9IS 2ZSUA 3SD7A 4MW0A 2OCBA 3FPEA 3PI7A 3HP1A 4E5PA 4RF2A 5HJ7A 5G1OA 1XO1A 4OGKA 2I8LA 1NJ2A 3DAYA 3AEXA 4GWKA 3T5GA 1E5DA 1ZISA 2O2GA 5EERA 5TQ0A 3RI3A 5IN4A 2WIAA 1EUDA 1THZA 3FYDA 4RVSA 4ARVA 4OHKA 1FS4A 1QH9A 3A04A 3N9IA 1DJQA 1CFJA 1OR8A 4LQLA 3IALA 2LIVA 1V6CA 3R3JA 4KL8S 1H66A 1ADYA 1AUXA 3KD2A 5H3CA 4YRNA 1JFTA 2VRBA 1TMOA 2H0RA 2X23A 2R6R1 2G7ZA 3LGXA 4U7WA 2BC9A 4M54A 3CV3A 3ITKA 2CUNA 4ZT2A 5CIQA 1ZOLA 1QHIA 1JGTA 4UHKA 3CPEA 1TRHA 1AB6A 2R8YA 2Q45A 4LZZA 4URFA 1C1XA 3RC2A 3RF6A 4Q7EA 3PR3A 4QU8A 1M83A 5EYPB 5IC6A 4ZCTA 1FTWA 1YUMA 2NLOA 3DEJA 4Q47A 5IMSA 1Y6GA 5A3JA 1MC1A 1EVLA 3K0FA 2CNNA 3L1HA 4U7GA 3IQIX 5AW2A 4QEKA 4L0CA 1KJJA 1PRYA 2JJQA 3AJ8A 3KJZA 1V16A 2FKNA 4JKOA 3VHXA 3OZFA 2HY7A 3IBGA 3FYTA 4HLDA 2GUWA 3LSYA 3WLNA 1N33B 2NNLD 4FWTA 1C3EA 1G17A 4ZGGA 1AE1A 4DA0A 4DQLA 3OX3A 4RDHA 3PLRA 1VE3A 2JCSA 4QQFA 2UZAA 4BGUA 4CLEA 1U8UA 3VI4B 3OWOA 3L3BA 2HIMA 4GZ5A 2C4WA 2XZLA 3FLBA 2Z30A 4K26A 4DLSA 1M8FA 1VOTA 1GU1A 2FGJA 2CLHB 5ALWA 3LHKA 5K0TA 3GLFE 4S12A 2M9MA 5K0ZA 3FR7A 4RXMA 5J59A 1KARA 5DYIA 3WKAA 5KQGA 2FV8A 2F90A 4S1WA 3T9EA 3TIVA 4HFRA 2OWEA 2PX3A 2O7QA 1GZDA 5ERGB 2R6JA 3IE0A 3AKEA 3EWAA 5EWJB 5F2EA 1ND5A 1RWMA 4O08A 4B46A 3MK31 4RJ2A 4MK4A 4DDWA 5JCJA 1O0BA 1R18A 2GAIA 4TV9F 4UPEA 1QM5A 3OJXA 2V5VA 5H4HA 3SS8A 4IOMA 1IDOA 4BTVA 5HOQA 2DKOA 5DSZA 2GOYA 1T0JB 2UZ4A 2IYPA 2ONZA 2R8BA 5MGNA 3A58B 3A4YA 4HFMA 3TLBA 1M2FA 1IFXA 4UNRA 4FMCF 4LAFA 2O3TA 1XXHB 3T7AA 2XXAA 1GPDG 4E5KA 3CVOA 2Q0HA 1U94A 1QLHA 2PIAA 1P62B 2RCYA 4P22A 2R751 2VZEA 3REQB 4LRUA 4CMGA 3G49A 1ZVJA 5E8RA 4LHVA 4ILEA 3BMNA 4DHWA 3FGZA 3KJQA 4U7HA 1QUFA 4ZOLF 2XDYA 1DOAA 2B2XA 4CYMA 2QRKA 1GFZA 3DOUA 3JAMA 4ZO9A 2YV2A 4F2HA 5KB3A 1MXHA 3NHZA 2VQEB 4H9GA 4P0TA 2NN3C 1ATIA 4P9NA 4R7TA 2EDCA 3DZGA 5ELLA 2O50A 4DMGA 1M1YB 1NJSA 4XFJA 1NXVA 4R1LA 4LZLA 5F3DA 3TB6A 2Y92A 2V7QA 4ZCIA 2I6TA 2QRVB 1SHZA 2QUIA 3WK4A 4JBHA 1RCTE 2ZATA 3IHTA 4YJ2F 5DBEX 5HDBB 1V7QA 3EWNA 1TM4E 3T9DA 4RD3A 4JBYA 1RXUA 1JJIA 1XTJA 3B5JA 5HZKA 1IWOA 2VCEA 1QQTA 5JNSA 4YP7A 3TAHA 3M3PA 3ZE6A 4QJ4A 2UZ1B 2GN0A 5BNFA 4E14A 3WQRA 1PJBA 3PD7A 1ACLA 2PJUA 4GI7A 1U8TA 4Z8XA 4RC9A 2ZM5A 1RBQA 1E8MA 1A8SA 3VPHA 2A9RA 3UYLA 2HMSA 3SE7A 3WYAA 3QEJA 4DCMA 4NBLA 4E4YA 3HO1A 1KWGA 4D4HA 4OAPA 3MAJA 1AKYA 4M1MA 5FBWB 1D8TA 3TL2A 3WYGA 3U4QB 1M73E 3HJFA 3EXIB 1Z07A 4BNYA 3K3PA 4BCCA 5C7IO 2W6MA 2ORIA 3CWZA 1KHHA 1CUCA 3WYBA 1H2RS 4NJEA 1HTWA 2FEXA 2Y67A 4ZREA 3VZPA 3WQHA 1JIQA 2RMKA 4ETNA 1ZZGA 2LVBA 3A0RB 4IX9A 4B6FA 5JQGF 4MW1A 2BGLA 3AY0A 3V8MA 3IR7A 2VWQA 4KK3A 4B6EA 4YHHB 2IF0A 2N3ZA 1OWLA 2W11A 2VDVE 3Q6MA 2IELA 5EN4A 4CMCA 1HE3A 3LE8A 1WEKA 3V8EA 3SICE 1WZNA 4YYZA 3K71B 1P8AA 1QHHB 2XDQA 2J5RA 5IT0A 2PUCA 4LQDA 4YBZA 2GHQA 4DLUA 2FN3A 3LT1A 1MNQA 1JFFB 4D4LA 1YI0A 2DR3A 2YYAA 1YZTA 2ZBEA 4IV0A 3F74A 3ZU4A 3PXGA 1TQ8A 1IQ0A 2F4NA 2I4LA 2OFOA 1V3TA 2L69A 1BOOA 3JZDA 4TXNA 5I7FA 5J58A 1JDSA 1XNQB 2ZT7A 1U7ZA 1L5HB 3KX2A 4LNAA 2JIOA 4BB9A 2PRSA 1LTQA 3AIIA 1TCUA 2HMVA 1PR4A 1RAAA 1EWYA 4D6PA 4FLEA 3KHSA 1NV9A 2QTNA 3PNVA 5I8WA 3OPYA 5DCWA 3KXLA 3OTIA 3H5AA 1QO9A 2ET6A 1D4ZA 2BFDB 2XVMA 4J8PA 5JAPA 4OQDA 3H84A 2CB9A 4I4IA 1BS2A 1C9MA 3OQJA 3U3JA 3B53X 5A4IS 3SI7A 3WMFA 2GYYA 1GG8A 2EJTA 3GZJA 5F52A 1Z75A 3DL2A 5TPWA 1PFKA 3WYCA 4D3YA 3IO5A 4F2GA 1QHFA 4I55F 5B7GA 5AVTA 4DWJA 2Z09A 3KVVA 1LGYA 4KLCA 4QECA 4EHAA 3IPRA 4RPIA 1RXCA 1YA8A 4PLHA 3AIKA 1BJRE 1IY2A 2ZSDA 4XQCA 3BPSA 4KE8A 1G20A 5DEIA 3M3HA 3U0VA 3CLVA 2R2AA 1B7GO 1OFGA 1Z73A 2OB1A 2ZRAA 3KPVA 3HR7A 4HGNA 5TT0A 4C0HA 1ZM4A 3DEYX 5AVVA 1AA6A 1NKTA 4JI4B 4RK4A 4DQDA 4DABA 3H6HA 4Q3AA 3PNSA 4N3NA 2EXXA 5K2OA 3U17A 2SKDA 3OE4A 1IUNA 1ZK4A 3ZXXA 4JASB 1C4KA 1SQSA 1D2HA 5IBQA 2VSQA 3V1MA 2G40A 3S27A 4L0QA 4EG5A 1OX6A 4JLUA 1YGYA 2X0IA 1TJPB 1R6VA 5AK3A 4EHLA 1XZGA 3IKJA 4D42A 1M34E 2EX4A 2PCLA 2FSPA 1U1FA 2H85A 5HK9A 1YJ8A 3TR5A 3CU5A 1W0JD 2J1LA 4Z3KA 3VZSA 4LSZA 1KQGA 3OPYB 1ISJA 2Y1XA 2WP0A 4LE0A 4EF4A 1U9JA 4Z9FA 3K0HA 5A3SA 4G1FA 2VWPA 3ZZNA 1DZIA 1WNFA 4R3UC 2PR2A 2HF8A 3TQQA 2GRAA 4UKDA 3U0BA 5CG1A 4D25A 1R6BX 3R3ZA 5KNBD 1IBRA 2BF4A 5I7HA 1QIFA 3DULA 3JWEA 3M6IA 2PEZA 1NJ1A 3L0OA 1EFVB 2P11A 1ISPA 1XE3A 2V3CC 4V3CA 4JY7A 2AE1A 4PAQA 4V0SA 1W76A 2AH5A 1W2HA 2QLTA 3K35A 3VSAA 1IOZA 1WSDA 2A33A 3WAGA 1TK3A 4JC8A 5CH8A 3L6EA 1LDYA 2JATA 4QUKA 4BE7B 1Y4AE 5EMJA 2ZWMA 1BHQ1 4JIMA 1ONPA 4HUTA 1F6BA 2RH8A 3WSTA 5CNJA 3LFTA 1NRJB 1WZIA 2AK3A 1P1FA 1FDIA 4IZHA 1NMEA 4F3RA 1W0KD 1PGNA 1FJGB 3UHAA 4B17A 3ZIUA 2WDPA 3DE3X 1Z88A 2FE4A 3R8FA 3OTOB 4M1OA 3TR6A 3WQSB 3WAJA 5JD5A 4RXUA 2PH5A 3E48A 3DPUA 3LDGA 3RAPR 4C5CA 1OFTA 3DDSA 1BDMA 3QSGA 5LP6F 1KFKB 5AM2A 1N5OX 4RH0A 1P33A 3VR3A 5AQEA 1EWQA 1DKRA 2AN4A 3V8RA 1H94A 4IDHA 5JNUA 1FFWA 1L3IA 2M1XA 2O2SA 3CH7A 3ZGNA 1U9IA 3TOZA 3OX4A 1UMKA 1RBMA 2B30A 3GW8A 1YRQA 3ZPXA 1NXSA 3AP3A 3FPCA 1A27A 1GWNA 3H97A 1JAXA 3B13B 3ELUA 4HNSA 3ZWNA 3T3IA 4K1XA 1C30A 5FI1B 1KYZA 1ISIA 2QKYA 2QD2A 5DNYB 3LW7A 3TZ6A 3RAGA 1U9YA 4HI0E 3QU4A 1YB7A 4IPTA 3AI3A 4OHPA 4E5SA 4RDXA 1A98A 2QQEA 2HRRA 3VNRA 1KSHA 2AG0A 4L5YA 4EH1A 5KOIA 5HM6A 1V7CA 1B74A 4QTTB 4AJPA 2FFRA 1MBZA 2LBPA 1VKNA 1TA9A 1YVUA 3A9UA 3CS3A 3FPLA 3NTRA 4D44A 3TG8A 3IRUA 1SUFA 3ZYZA 2PD3A 3AEUB 3ZWAA 2RHWA 5L6LB 3PNPA 5AUNB 1BDBA 1EAYA 1X94A 4M1YA 5ITSA 3PWTA 1H42A 1PBTA 1Y5MA 2CJWB 2FB9A 3CNQS 1LLQA 4L74A 1IVSA 3DW1X 2JCYA 3VNQA 3I9KA 3IPAA 3AF0A 4ZOAA 4BJ1A 1RE0A 2RGNA 2IQIA 4MQUA 4C4YA 4I1RA 4PYRA 2BGGA 4KSYA 2JI7A 2PSFA 1TXGA 2FPGA 4K9MA 2NNWB 5NULA 3CZMA 1C0PA 3HUTA 4QSHA 5BSRA 4V1CA 4OLFA 1A9ZA 4P4LA 4DRXB 3C7AA 1U4OA 3KBBA 1JWBB 4RZSA 1CRPA 3EDMA 5FT9A 2VQDA 3C1AA 2FW9A 1W0KA 1DDOA 1KBQA 4BP8A 5B58C 5IAOA 3ZDDA 4HH3C 5K3BA 3L41A 5B6JA 1N78A 3KRTA 2ZOSA 3LMKA 1JPNA 1DIAA 2WTMA 1YCFA 1KS9A 2H8GA 4IHJB 2JFZA 1XLVA 5SYAA 5JD3A 4UW9A 1T8RA 1RR6A 5T6BA 4XLTA 2WB2A 1QGDA 1IRXA 1QO0A 4JROA 1OLUA 2RK4A 3IT0A 3LLMA 3W77A 4RFLA 1DKNA 3R6GA 3ZE1B 9ABPA 2NPOA 1O0CA 2PGXA 4PO3X 1N0UA 4Z9BA 3GNQA 3OIYA 2GI4A 1BRTA 2DAPA 4FHGA 2A0FA 1KP9A 2QZ4A 4LSWA 2Q3CA 1XN4A 4EKIA 3HTXA 2IUYA 1JAIA 5TC4A 5B53A 3PUJA 3DT8A 3TRIA 1C41A 3WIOA 5B57C 1G2IA 2XMPA 4ZI7B 3PC6A 1GV1A 5J43A 3L7BA 1E79D 3ASUA 1FJHA 3MTIA 3R44A 1CQWA 1F0NA 2O23A 2Q3HA 3NBFA 3I58A 4DCNA 1W36D 4OF4A 3L6UA 3JQQA 2H5LA 3PIIA 2PT5A 5EQFA 1G3QA 4OSPA 3V2UA 4CTJA 4X1IA 1EWVA 3TTTA 4MVWA 4BQQA 3JQAD 3OKFA 1X7ZA 4Q00A 2DLNA 1IPHA 1QVWA 4K46A 2C7QA 2DBQA 2YWFA 1SK8A 3QVMA 1GPMA 4Q9LA 1FNCA 4KAXA 3JQ6A 4ZOLA 2CHUA 2ZJ8A 2V9CA 4PNHA 4XB6B 1DEKA 2ORVA 4NZZA 5DULA 4EHHA 3WRYC 3KWJA 1C7FA 4KBYA 4D0RA 4HB0A 4D46A 4DOMA 4LBVA 1IBKB 1SIBE 5LYJB 1F06A 5HRAA 1C8BA 3KJNA 4GBJA 2F3UA 5JFOA 2GJKA 3LK6A 3CPSA 4MB6A 5IDQA 3T9BA 3N6VA 4I50F 1BXRB 4MINA 4DJFC 2O8EA 2Z6VA 3QXSA 5ES4B 2FLKA 5K01A 4IFIA 3RVNA 1VDZA 1FK8A 4ZYTA 2W5UA 3C14C 3AL0C 4R6WA 4D0NA 3RVRA 2V6MA 5GP1A 3IODA 4XVQA 2R1TA 3RIXA 1JEYA 4Q3DA 5DX8A 4ZCPA 3ROFA 2A86A 4J0QA 3HBMA 3AESB 3QYPA 5KMGB 1DKOA 1N8KA 1T0IA 3T7CA 4U6QA 3H1AA 4PPYA 1O97C 1M34B 3PNOA 1T8WA 3ZLUA 4BTLA 1QCZA 2IIQA 2AOXA 4QDJA 3VC1A 4CM5A 1BRMA 4Z4CA 3S81A 4YROA 2I4IA 3KLBA 4P5PA 4H7DA 4OH7A 2IX9A 4I08A 3KKPA 5JVDB 4BJHB 1XCGB 3BK1A 4MEBA 5DE3A 1M67A 2X6TA 1NVXQ 1PFQA 3EGEA 3GRCA 3ISVA 3ULKA 5ITZA 4CV1A 4Q9HA 5JRZA 3WYEA 1B8OA 4PYJA 4G36A 4XUEA 4HF7A 3P8ZA 4HTAA 2CZGA 2XUPA 1OI3A 1RP7A 2ZZKA 4Q3NA 3DMYA 3SAJA 4DTIA 3O4FA 3PUZA 4JYPA 4F6CA 1L5VA 3QMPA 1YZLA 3CBQA 2XNHA 3LYHA 5JBQA 4N5IX 3N53A 5JASA 3LXRA 3MGGA 3KZCA 3O4VA 4FFBB 1RYDA 3TTWA 1BFKA 3DE6X 3N0WA 3UC9A 3AVOA 5H70A 5J5CA 2D1FA 1VJCA 3ANMA 4Y0VA 5SICE 1HT2E 5J63A 2BW0A 2XVZA 3H5WA 4KSBA 5HA5A 4M2LA 1CUHA 1G6KA 4MKHA 3UM9A 1MHTA 4HNAB 4MUHA 5BSVA 4RE5A 3NORA 4Q9DA 5LFAA 1RYEA 1TQ6A 2YV5A 3D6HA 5H68A 4EAQA 1ETUA 5CX1A 3IE2A 3LVBA 4R2MA 1S2LA 1GV0A 1LS6A 4YRBA 5P21A 1GKIA 1IBSA 1XTBA 3P4YA 4XM0A 1L8LA 1DTWA 2EL9A 1Y6ZA 2ZIXB 2X5KO 3VR4H 1Y8CA 5D85A 2GYUA 1E2IA 1TM2A 4EVIA 1KL7A 1J33A 1K7XB 1OLXA 1ZJJA 2JH9A 4NESA 3ZE0B 4QTUB 2IYTA 2QJFA 2ZVPX 2I2BA 2OGWA 3C3BA 3KOYA 3Q8WA 1SU8A 3QHQA 3ZU5A 4YAIA 4YJGB 3TLXA 4YRKA 3Q7SA 4UQOA 4MITA 4MQFA 1WPRA 3GOHA 4AQDA 1OF1A 2RH9B 2C2MA 4RHXA 3F7MA 3S6JA 4AJLA 1OX5A 3SFZA 3WRVA 1P7WA 2ZWPA 4L6CA 4B3SB 1HQCA 1VJDA 2GRUA 3VJLA 3MWDB 3V8QA 2OAGA 1UJ2A 3K9HA 3CSSA 1QG0A 2P9BA 1LK5A 1S3FA 2RGXA 5DYTA 2G04A 4DPMA 1RWPA 1H1DA 5FCDA 1SB8A 4JUBA 1E3WA 4MGYR 1MH9A 2HLHA 2OV1A 2YW9A 1PZFA 4BKOA 4BIIA 1XGKA 1SBQA 4GOMD 1T6ZA 5E2AA 3MQ4A 1ADJA 2GASA 3AXTA 1Q7GA 2HXSA 3USZA 3EFBA 4ITVA 1PV2A 3ESYA 3KJIA 1SIWA 3CR8A 3QLUC 4BN5A 2A30A 2V6BA 3QPUA 1MX5A 1BNCA 5T8KA 4BVAA 4AICA 5G1NA 2DBYA 1HOXA 2YINC 4WNCA 5LQDA 2JFYA 3EA5A 3UXYA 2Y1KA 1CQXA 3GP8A 1U3CA 4XWWA 4W1SA 5FPPA 1OWNA 1VECA 2H1WA 4ZQCB 1U2GA 3PUHA 5DXJA 1MR3F 3GLQA 3I9FA 5TF0A 3TD6A 1IXYA 1SVSA 2GSDA 1WLSA 4LSGA 1QTQA 2XB9A 3AILA 3CVJA 3DDZX 3QUQA 3S2GA 2VQFB 2BH9A 4QFMA 4XJTA 4DREA 3DT9A 1YBMA 4NAVA 5DYWA 3SBDA 2VDRB 2KI5A 4J94A 4TVSA 3IQHX 1TZCA 5EHXA 4CT0A 5B1IA 2IS4A 3WRWA 5L7TA 3M4XA 3EGOA 4MPRA 3KBOA 1K63A 1CVLA 4DA6A 1CJVC 2PUVA 1Q22A 4OCZA 4PONA 4P2GA 4CM8A 2GK6A 2YWHA 5C8YF 1RYMA 4TV9B 3I2JA 1MABB 4WERA 2FP4A 2JAWA 2YNMC 3IR6A 4QGHA 5ALRA 1KH3A 1NQ5A 3TEMA 5CA1A 2J5BA 4YRSA 1EP1B 4Y2QA 4TLDA 3H1FA 4PZEA 3U1TA 3S7TA 2PO5A 3UG6A 4JOCA 1NNI1 3QNWA 1XCJA 4L5JA 4BEJA 3BMOA 1UAYA 3QHPA 4F9FA 1HNXB 1J0AA 2X9LA 4IVNA 4YP9A 1L7BA 3FHOA 4O5AA 5BRAA 2C1EA 2VK1A 3MA0A 1Q84A 3D0OA 3BSYA 7MHTA 2PXXA 3JYNA 3VOTA 2XZOA 2B3TA 1SEVA 2QR3A 3ZDXB 5LMCA 1QH8B 3NHUA 1RMYA 4FZVA 4D3FA 1KFEB 1TEVA 4AG3A 5I7EA 4L9RA 2JPDA 2XRMA 2G1PA 5JSYA 3NG1A 3MTAA 2N1BA 5HZGA 5TQVA 4ARIA 1HC7A 4GWLA 2FZCA 3TGLA 1XU4A 3ABQB 3H2IA 5EQTA 5J2UA 2DETA 5BN3A 3HRKA 3OH8A 2ZZNA 4J0HA 4OBXA 5AVXA 3MUEA 3OM1A 2WKRA 3IXQA 1XTSA 4GI2A 4LC1A 3QELA 5FBHA 2RBGA 4AMYA 2V96A 1XMOB 1FVOA 2AW3A 2BGRA 3KOOA 3PHGA 2YY7A 1T29A 2JASA 3EIEA 3I2YX 3O0TA 3P2KA 3QE0A 4AMUA 4DJEC 4E2FA 3P9RA 1ONBA 1DAEA 4IICA 4CQMD 2LRHA 1GQ2A 4YRZA 3CA8A 3JVDA 5KX5B 4NCKA 2J6BA 2YHAA 3J7AC 1GA4A 3SBXA 4WK2B 1NJ5A 2J5XA 3GN1A 3IBCA 4IZIA 1FFGA 1ZA2A 1DZ3A 3HL0A 1WXIA 1D2EA 4BNTA 2Z2XA 2PKCA 3EVGA 1M8PA 1REQA 3GFOA 4YMVA 2F1IA 5THQA 3TK1A 4CM9D 5EJGA 3SX2A 4L22A 2EGGA 3RHFA 4J1TC 4K28A 1U8FO 1Z83A 3ITNA 2ODPA 2QENA 4US0R 2P2SA 1GITA 2PK3A 1LPOA 3GCGA 3OHMA 4HNAA 2VYCA 4HS4A 4BNGA 4W5QA 4AB1A 2VHJA 1YU6A 1FZQA 1SUBA 1QDEA 2IZOA 5B58T 3VR0A 1NN1A 1TLTA 2TECE 3FHCB 3ZS8A 1AQLA 2ZANA 4QHSA 3BGDA 1J6UA 4RACA 4DANA 2QN6A 1X8XA 2JCBA 3LDUA 3GJ0A 1F8UA 1XAIA 2RC6A 5GONF 3CUKA 3E22A 4DV7B 4J76A 5E7QA 3EXG2 3CHYA 3LCVB 2X8AA 5TPZD 1QC5B 1YDGA 1R27A 3PHBE 2YJGA 4FCWA 1GRVA 5IUNC 2VRNA 2JI4A 1DC4A 10MHA 4UTZA 3GLTA 3GLFB 3NEAA 1ZVKA 4IUCS 4WBXC 2QSUA 3FHLA 1W5EA 3ANTA 4X64B 4CN9A 5GTDA 3H5NA 5KNDA 4ABTA 5ALLA 5DNWA 2JD1A 5E2IA 1SRRA 1EUZA 3KZKA 3ZLTA 1KI9A 3ZGYA 5JNWA 3ERCA 3I83A 1ECJA 2YUIA 3R7WB 4TL8A 3VSEA 4DN6A 4KAAA 3MWDA 1SY7A 5CEFA 1EAMA 1US8B 3L6DA 1KPIA 1KYWA 3B1KA 4HZIA 4LEIA 4TKVB 1UPBA 1WD5A 4B82A 4GDFA 3I23A 4LXYA 4RYDA 1J7KA 4MP3A 2FN9A 1VYTA 4KN9S 4O59O 4B87A 3UB3A 2FF5A 5SY9A 3CUTA 2WHEA 1BX0A 4LV5B 4PNPA 4Y6SA 5AJTA 3U7QB 4B3FX 4NFHA 2XYHA 4PZ0A 3A4VA 2GCOA 1T9ZA 3KFVA 3JPWA 3A1UA 4U00A 1VGVA 3M5CA 4JVLA 1FDTA 2DUWA 3QY9A 4XIFA 3MRTA 2CBZA 2JAPA 3IX7A 4Q1BA 4ZRNA 1U2PA 1NLFA 3ZZUA 2ZE8A 5B36A 4OFXA 1DI0A 3QRWA 2G5CA 2IXEA 5IG2A 1L8OA 1W0JA 1XT6A 3IMKA 5JHGB 1KE1A 2JLCA 3FUTA 4GIBA 3FFBA 3QLVC 2GPSA 3UFXA 2BFFA 4YVFA 3HK2A 3K05A 4XXHA 3W04A 4G85A 2PH3A 2A7QA 1Z3IX 1ZQ9A 3I1YA 4JBXA 1A04A 1N1DA 1A8PA 1WP4A 4OMDA 4PSCA 3KTAA 3NBMA 3T4XA 5TMPA 3HA5A 1AQ6A 4AK9A 3W6PA 3QUAA 2Q1SA 4GG1A 4DIOA 3C3YA 2VP0A 4E2WA 2PXAA 3M7IA 4QFBA 3WL6A 4L02A 1EHYA 2CK3A 1JDVA 4JLSA 1V35A 4R1NA 4GOJA 4YPFA 3QH4A 4WBNB 2YS7A 3Q98A 3KR0A 4G1EB 4ZQIA 5E3JA 4TROA 5ISMA 4HOYA 1O03A 2I4TA 2IXFA 4ZTUB 1OJLA 3H9QA 4N3AA 4RK5A 5I9MA 5LMZA 2NSYA 2ZUCA 3L8DA 4GLLA 4LBZA 3RFUA 2AFHB 4MR9A 1W96A 2HWWA 1NKSA 1HE2A 2HQOA 5BVHB 1ZH6A 3IDZA 1ZOPA 3MC1A 3JQFA 4BKMA 1IH8A 2HJ9A 1YDFA 3A7DA 4N65A 1BWRA 1NVVQ 4Z6KA 4PWYA 2IZ5A 2WD7A 1VJRA 3QX3A 4C7OA 3QVTA 3L1VA 1RT9A 3IURA 3M4YA 4KOAA 2ZRKA 1E2FA 3GJ5A 5JXGA 4N40A 4N5NA 3GEEA 3ETHA 3KVOA 3BILA 1THMA 1ZD1A 4K86A 4QM6A 3GR6A 1JQAA 3GHYA 4G41A 4UJ5A 1U7DA 1PFWA 3M1AA 3KYIB 4AZTA 1DEHA 5GPBA 2ZYWX 1GLNA 4M8LA 3AHHA 2WAOA 3B2NA 4WTOA 3TTSA 1D5WA 2X0JA 2FZ4A 4DA8A 2ZR7A 4KGDA 4C2BA 3D7SA 3PYMA 4V0RA 5AVZA 2PUGA 3K1AB 3SDSA 1JSLA 2DH5A 1I14A 3NHJA 4KFRA 3WK7A 1P4HA 4F4JA 2QAJA 3TJRA 3NV9A 4AYXA 4OHRA 4EITA 4DCOA 3DBRB 4Z0NA 3FBTA 4IWYA 5F1KA 2FPPB 4UVDA 2HSWA 2PJRA 1TRKA 2BMVA 3X1YA 3BH0A 1PKXA 4ZAVA 1MV8A 3A2NA 3LUGA 2AWNA 3FTPA 3NHLA 1OXMA 2FW7A 2ZYGA 3WA6A 2B4YA 1Z7WA 1L4NA 1VMIA 2AOUB 3NETA 1KJYA 4HLUC 4RK1A 4A6XA 4ESHA 4OAOA 4ZHSA 1E3DA 3LF2A 1KF0A 2XAUA 1FPMA 1ZQ1A 5EXTA 3RASA 5TY0A 4E11A 1ODKA 3U2QA 3M89A 4YRJA 4OI2A 1P29A 3DBHA 5F7XA 2VH2A 1LBTA 1GUDA 2RHLA 4K9LA 4OGFA 3IXLA 3TI9A 1MB3A 2FSHA 3D4PA 3UCEA 2DX7A 4RKWA 1LBHA 1F4LA 2PAAA 2R00C 1JQEA 3VDNB 1OX4A 3F0TA 3P2YA 1R8SA 1XG5A 4JJEA 4F2PA 3LX6A 5C7LO 4WEOA 3H2KA 1JS1X 1PNVA 4TMKA 1UDAA 2LP4Y 1TUIA 3E8MA 2EG5A 4HAIA 4YGXB 1EE2A 3EW7A 4ZCRA 4IF4A 3ZHSA 1FUEA 3MJDA 3MTBA 4AWBA 2X9QA 3JVVA 4DQ0A 1BGWA 8GPBA 1K6XA 1LTHR 4OUDA 4CBVA 4G0WA 4O4IF 3VPDA 3D0QA 3FCUB 2VDUE 2YTZA 4FD3A 4FZRA 4OATA 4JZKA 3VZBA 4HNTA 4B6JA 1QU3A 5TR9A 1KVUA 1KSGA 3PCTA 4EPRA 1N5RA 1YL7A 3C6QA 2FEAA 5KTTA 3OQ1A 1QWOA 1CJUC 2DPGA 2O2ZA 2OE2A 1P5ZB 1HYBA 3IEPA 4YP5A 5LA6B 4DJJA 2UYCA 1R00A 2UYOA 4X6LA 5CR9A 5J4LA 1T5TA 2Y27A 3ET4A 2Z3WA 3LO8A 4JCOA 2IZZA 4DFDA 3AR5A 4EK9A 3BXEA 2QN3A 4QDZA 3HWRA 1YDHA 4LDAA 3J80A 4QRIA 3AM4A 5FPYA 1BH6A 4B35A 4ZV4A 4ETWA 1T3HA 2DTDA 3AWDA 2W0SA 3ECCA 4KQJA 5AW8A 1M0EA 1NZFA 1QU2A 2OP0A 3QKRB 4NCJA 2ZPUA 5AI5A 1KO4A 9LDBA 4EJSB 4TRJA 2KLHA 3GAZA 2XEXA 2CNWA 3M6LA 1JEAA 4UHEA 5D5HA 4EB0A 3W9BA 1TKCA 4MR8A 4LVUA 1XQ9A 5FL7D 1UODA 4ZQHA 1N1EA 3R6TA 3DE0X 4ZVLA 4TKLA 4B31A 2GVNA 2DB3A 2ZKIA 4Y2TA 4ZRMA 4FOLA 4D9IA 1CERA 1GKKA 4BFTA 4ENPA 2YWGA 1EFLA 1XYYA 3PF8A 4HX5A 5HJ5A 5JAOA 2VKTA 3D1VA 4XFKA 3DTYA 4ENVA 1PN3A 2H6EA 3VPSA 3WNBA 2QRJA 4KMOA 1SBZA 2Q2OA 3DYIA 5HE9A 2EQBA 2DCMA 2QEQA 1PSDA 4MKXA 3T99A 5BSEA 1L7XA 1OWOA 1PSZA 2XJ9A 2ZTUA 4JELA 4NCXA 1AKUA 1ZD3A 2QTFA 2CZQA 1YMQA 3IUMA 4LXQA 5IVKA 4QHTA 4JEMA 5IT4A 4Q9KA 5I01A 1ZN7A 3PDUA 3KTDA 2IZ1A 3QVLA 4JS0A 2ACKA 2P65A 4FKBA 3NTOA 4RSHA 1MPTA 1P7CA 1SD2A 5TGTA 4MQ6A 4ALLA 3A11A 4GKVA 4WJKB 4M46A 3TZQA 2Z4TA 3P45A 5CVDA 3M9XA 5JWHA 5KYKA 1V1MA 3HU2A 3UWSA 3GJTA 2W58A 3O8LA 4MWBA 1Q77A 4M8KA 1WXWA 1UUFA 2QDKA 3N58A 5EZYB 5IASA 1KI6B 4ZDIA 5JZBA 3KVRA 4EX6A 1ORVA 1ADBA 2IGTA 4INJA 3HKDB 1QGUA 3FLAA 1P5JA 2BEKA 4LZWA 1UXHA 1P2VA 4OJTA 4CDRA 3SR4A 5C46F 3VX4A 1G8FA 3FPBA 4JLBA 2GZ1A 1DLJA 3M4ZA 1C2TA 4LVOA 2OG2A 3B12A 3D59A 2R1TB 3IMGA 4QU0A 4R69A 2Q21A 1EGHA 2GKGA 1ISMA 3AOEC 4BRWA 2BZSA 3RYTC 2QRZA 3WIVA 1U1IA 2MOKA 4ND8B 4G0OA 1E94E 4PHFA 13PKA 3CEPB 3O4RA 3GYBA 3UAVA 4B2YA 4UDOA 3ZY2A 4IGFA 4PBRA 3WLHA 2Z2KA 3WB0A 5BVGA 3H9CA 1Z0KA 3WGOA 2HT1A 1FBTA 4ND1A 3S7ZA 2HYIC 3JWHA 4MQLA 4YYEA 1S2OA 2JCXA 5FPHA 4B9EA 1YR8A 2JRLA 5TMEA 4YMHA 1G55A 4ZQFA 1QHSA 3T4EA 1E4VA 3DC2A 4TQUS 2I2DA 4XIJA 4PSDA 3ID6C 2YXLA 3IA2A 3HJTA 4HAOA 4C05A 2QK4A 3TKYA 3V8NA 3VOAA 1Z13A 2Z83A 2V7EA 1NVAA 3CKYA 3O9ZA 3I09A 3SR0A 2Y1CA 3GAMA 4AJJA 1Y0BA 1OB5A 1B4DA 2CUKA 8AT1A 1CZHA 1YF3A 2GK4A 1GCAA 1VJGA 2B1RA 1TJYA 2GNPA 2OZPA 4OHFA 2C29D 2R48A 3BULA 1YQTA 1CG6A 4DRXA 4RA9A 2Q3FA 1F7VA 1CY4A 1ZD2P 1OXSC 1U0TA 4QHYA 4RELA 3GUCA 3FIUA 2AZ4A 2OCXA 1KA9H 1QKJA 2ZETA 1S9DA 2WT4A 4CUJA 3CNNA 2CJPA 4ZYUA 3WOHA 2GN8A 3KZMA 4Q1VA 1M8GA 1Q11A 3E5HA 3CNEA 1DDGA 4HEHA 4MYRA 1RC1A 4NVRA 4ZVSA 1ZP6A 1QZXA 1TEXA 1YZKA 3BJEA 3FNRA 4ZTBA 5BQPA 3WWEA 1C1YA 3B2QA 3MSXA 7REQA 4BV2A 3V7UA 1PJ4A 4DSOA 2C54A 5LKAA 5LQCA 3SBOA 4WGGA 1XF9A 1J8VA 2EBUA 5EL0A 3L5KA 4UM5A 4Z49A 2PWPA 2GFHA 1LC3A 2K7ZA 3W06A 2VS1A 4NF2A 1IHOA 4EYKA 221PA 5M3BA 2QVXX 1PCXA 1JDPA 3WNCA 3OSZA 5UKDA 4Z4QA 4TT8A 1CRLA 3BS4A 3AQIA 1LRLA 4F2DA 2VTEA 4LTMA 1V5IA 2QQ0A 3QOYA 3PFBA 4OL0A 4RD4A 4XX0A 5J2TF 2EJVA 2FWRA 1JXQA 4G9EA 2CXSA 2EWMA 4TYNA 4PBSA 1YTUA 2QTBA 3T06B 4XWAA 1P91A 3TQCA 1A1SA 2CJFA 4GZLA 1WUTA 4I5IA 4K9QA 4EHDA 2BOVA 2H9AA 1MQ8B 4P34A 4P98A 5K0CA 3KVYA 3E70C 1VSUA 3KTFA 1SB9A 3PQEA 4TSKA 3UV6A 1RADA 4OA5A 3TXXA 2HMTA 1E6CA 3RIYA 4EYSA 4R1MA 5B2EA 2XX3A 3AJRA 1QE0A 1Z7BA 3FCEA 3NNDA 4JKYA 4PPQA 2XRFA 4Q24A 2NUTA 3VH1A 1SXJC 2QX7A 4JA0A 3F5SA 3ZNOA 2WICA 3U4MA 3KQNA 2VDOB 1J8QA 1I9CA 2H9YA 3QP9A 4FFLA 1Z6QA 4AKTA 3PVSA 5F1PA 3GUVA 4BKRA 3UNXA 1LF5A 3Q0TA 4AKHA 4CKBA 4DNQA 4TVBA 4JLOA 3CVVA 3W6NA 2JJ2A 2MYNA 5AVKA 1PUJA 3E84A 4GGPA 4CT4B 4Q93A 4CKEB 3H2GA 1ZR4A 2R6AA 5EJ5A 3STVA 5JH7A 4D74A 1RFGE 2XD9A 1B8UA 1I5OA 2W6QA 3CW2A 1X3SA 2JLQA 1X1QA 2E4VA 2XYVA 3NRBA 5CX1B 5AKGA 5I5EA 1XBTA 1ZW1A 3PTZA 4G89A 4F4UA 2ID4A 3QYAA 2O5VA 3UJHA 5ALNA 4CL2A 3RS3A 1MAAA 4CRWB 2JIMA 1FNMA 2BKXA 3NGXA 3QPVA 2XTNA 2CHVA 4DL9A 4N76A 4AM8A 3KKOA 3RKUA 2QRGA 3AGQA 3E5MA 4KLZA 1ZX1A 2XTJA 1B26A 2AOWA 1I1HA 4NJMA 3WDKA 4GI1A 4GMXA 3LA8A 3QX8A 1UBMS 4ALKA 5IDXA 2E5WA 5DM0A 3C6ZA 2NO6A 1DAHA 4B47A 3RC3A 2HO5A 2JFNA 1DT3A 3HBNA 2VG8A 4XX0B 1QF7A 1UC4B 3DO8A 1ECBA 4YNBA 1E60A 2I2CA 1CIVA 2HFKA 1QQAA 1KNXA 3SMQA 3BXOA 2NU6B 3IQEA 4G5FA 4DIUA 2BMDA 5LDDC 2HGSA 2QN7A 4B73A 2OK8A 3BUSA 3U4IA 1XP5A 1XZMA 1XRMA 2EYQA 4TUYA 4HRYA 3NC0C 2AC7A 3DOJA 1TUEA 1MPXA 3A9TA 4FFNA 5DN9A 5BO5A 5C5EA 4ENRA 1RKUA 3KXDA 3LHSA 1LB1B 1D0VA 3GWZA 3EAGA 1RRCA 1QO0D 4EI8A 1EQUA 3PFKA 4HYEA 4KE9A 4QATA 5CXXA 1OBOA 1C8LA 2FRVA 2OV2A 4LRTB 3EC1A 3KLMX 5EMKA 3DHYA 2GWHA 2QG6A 4Y2YA 4YQZA 2RGGA 3B1JA 3GVCA 4HXEB 5EIBC 1W5FA 4US1R 3ROPA 4L8GA 2VAXA 4DV5B 2CN1A 2CJXA 3G7NA 1V8ZA 1E5LA 2F43B 5EJ2A 5GJBA 2PSSA 1AMOA 1I01A 3DMDA 5A2GA 5ALHA 5EWMA 4C7VA 2C31A 2K7FA 3ESXA 5E1DA 4NHOA 5GVRA 4P80A 3VHLB 3ZX5A 5LP1A 1D9XA 3BL6A 5T41A 1UOEA 4WOPA 4MARA 2QOEA 1W29A 3WL4A 2WMNB 3O1IC 4C2UA 3HY3A 4IP0A 1SU6A 1Q44A 3K0CC 3U81A 2VCHA 5DP2A 5DTJA 3KNZA 3UJNA 1V2GA 3PE6A 3H0KA 4HNVA 2CY0A 4FTWA 3DSRA 3GK3A 3SLRA 2H1VA 4YT5A 5ECGC 1RZUA 2ZRLA 3E9EA 3GD5A 5EXEA 4NJOA 4A8TA 4BLRA 1TW2A 3F9IA 1FP2A 1ECPA 421PA 4BQOA 2CFRA 1CEEA 1HT3A 1NW7A 3ENVA 1ZR2A 4L8YA 4KR3A 1Z3CA 1SA0A 4O33A 1VLMA 2O1SA 4J75A 3ZEAA 5B12A 1XZCA 1PL7A 1U28C 3OJFA 4FYVA 4LF5B 2A59A 3I64A 4HQKA 3RTGA 1JXAA 3BSFA 3WWYA 4DMFA 4ZODA 2BVNA 2PRYA 3NS7A 5AKYA 4L4XA 3ZN2A 3UA4A 4B33A 4X90A 3ZXYA 5EE5B 3IT3A 4C0KA 1L5OA 3HXLA 1JKMA 1KAOA 1K4MA 2BKUA 4RVOA 3TLGA 2QBYA 3VZCA 1OGYA 3IPCA 1WCIA 5EJ8A 1KWKA 1SQ6A 2ZSIA 1SC6A 4I3FA 3ZK7A 4OBEA 3FZEA 4MW2A 3FVTA 3LOUA 4RQUA 4I3HA 3AH8A 1N3YA 3BXZA 2R25B 4FYWA 4TTVA 4IEFB 3RQIA 1KVTA 3B5IA 2C4VA 2Q1XA 3D8TA 3IAM1 4KXXA 4RS3A 3KHUA 4HWOA 2O0KA 3KCQA 1CCWA 5A6SB 5JATA 4X6YA 5BYBA 1KJQA 3R7DA 1X7XA 2DTEA 1ORRA 3SKVA 5JNRA 3BCUA 3ZXUB 4B71A 1HK7A 3WRYA 3T3DA 3A6KA 1ORWA 6GPBA 2WB4A 4L85A 2QVBA 4EHIA 4KWCA 5FUWA 5BYJA 1CR4A 5K6AC 2MMGA 2D2IA 1I51A 1WJGA 4M6WA 3OZGA 5BQXA 4X97A 4QTYA 4J03A 3UQZA 4LXUA 2R8OA 2A1IA 4E33A 5AVOA 3CUEF 5DI3A 3KP1A 3HLKA 1YCGA 1Z4MA 4XDHA 2JB9A 3RC9A 2KMLA 3IOMA 4HZUA 4M49A 2C07A 3ZOKA 1NRWA 4Q12A 4TSFA 5D1NA 1M0TA 4XOIA 3CRZA 3HO8A 3IYLW 5FEUA 4ZYXA 1UK6A 3HRIA 2I6QA 2C97A 5IM4F 2WZQA 2XXAB 2QRLA 5FPQA 1VL5A 1QTIA 1IHUA 5DO9A 1LPSA 4BP1A 1GM5A 2XHZA 3HG7A 2OD2A 2NZ8A 3RNLA 4F12A 3WQBA 1ZD4A 3GMSA 1JW9B 4URYR 1XCBA 3VR6H 3HNRA 4YXWA 4UQLA 4WQMA 5FTMA 1I3KA 1OAOA 3L46A 2WYOA 2EP7A 3R3HA 2QNBA 2YJ5A 3C85A 3EXHA 3ES9A 1UBEA 4C0LA 1XZPA 2XNKA 1XUOA 3CKMA 4IDDA 3UG7A 2ON6A 3IVMA 2C2BA 2QTHA 1QVZA 4QDUA 2ZIVB 3EXEA 3TFQA 1EM6A 2D1YA 4F1WA 2FEMA 3E9DA 1ARZA 1GPJA 3H1PA 2DVMA 2ZG6A 1EX7A 5CW1A 3ZD7A 2AYYA 3B3GA 2OHJA 3NBKA 3SZRA 4BWYA 4GVLA 3W5VA 4D9NA 4MPTA 4X7PA 1W88B 3E7FA 2ADMA 2PT7A 2AHRA 1EG7A 2Q9AA 3BWEA 4DXHA 2RGUA 4JDUA 4B6OA 2V0GA 1L6RA 3NCTA 3BWBA 2IYYA 4MQEB 3HBJA 3FN4A 3F97A 2E0IA 4XAQA 1YJXA 3I6BA 3D5EA 1KTVA 2RIRA 5TIIA 3S2UA 2BFMA 1I9GA 1ZD8A 4YMWA 4M0MA 3HR8A 2FDRA 1E9BA 1Y3BE 4PIPA 3GLKA 3TMAA 4D9HA 2G17A 2G09A 5U4QA 3UJAA 1W94A 1E6MA 2O8DA 3MFYA 4FQ8A 4K6KA 3SE0A 4TXMA 5BURA 3OQBA 1J2EA 2Q6VA 1R0CA 1J9ZA 3ONNA 1ZH4A 4QOHA 3I92A 3GT3A 5IM4A 4HDOB 1E58A 4HQ0A 1AGYA 4LYDA 4R83A 2GAAA 2GVZC 1IRIA 1DJOA 1X0VA 4CNQA 1Z12A 5ALQA 2YZ2A 3TMKA 2X9NA 1T3LA 1EFHA 4XI9A 1P0PA 4MS3B 2Q5OA 3H8SA 4LYYA 2A92A 2HDOA 3RU7A 4BMSA 3THYA 2H4YA 3RGGA 2Q3MA 2WYUA 2FU5C 4P36A 1H2BA 3AONB 3OE7A 3CX8A 1TDJA 2VI5A 2YVAA 2ZGVA 3IQDB 5HTKA 4CODB 3CBGA 1ILWA 2O07A 5IAGA 4J16C 3ABSB 5CTAA 2Z1NA 2FWPA 5AHKA 4BJ3A 1EX9A 1JSZA 2G76A 2YRWA 4IXNA 4YY3B 4KAFA 3PLAE 2NYRA 3DOCA 1GXSB 2GEUA 3N75A 4KQ2A 1NBME 2VJMB 4FLFA 2OVBA 3SSAA 4M6WB 5CURA 3SKYA 3H05A 1N77A 1BIFA 4NYJQ 3GBVA 1YS6A 2QORA 2QZSA 3K4PA 1MXFA 3ANXA 3GLUA 3ZK9A 5EGNA 3MMZA 4B44A 4I4TB 5KWEA 3DAPA 3K70D 2BR5A 1PTJC 3WKDA 1SNYA 5BR4A 4I4TF 1EQ2A 5HOEA 4TZ6A 2QZJA 5HBRA 2ZBFA 3KSZO 1KERA 1K68A 2V65A 3OBIA 2HO4A 1OVGA 3HM9A 1RBYA 3N5KA 1KVRA 5E0KB 3P0JA 1I13A 3DUFA 1BWSA 4YB8A 1I30A 3BBPA 1YZQA 3LFHA 4YT8A 4F04A 5LQMA 4TMXA 5FA6A 1O5IA 2WWTA 3VBEA 2LDXA 2XMZA 5JFGA 4DCGA 2J0UA 4DJTA 1MAWA 2WIBA 3GMTA 3IDQA 3KTAB 5T4FA 4DLZA 4Z7JA 2CMDA 3MTDA 4Y6GB 4RULA 2ZT5A 3OESA 3I72A 3QWHA 3BE8A 4YEDA 1D6MA 2ZTSA 4J3JA 4EDHA 1XVVA 1DG3A 1X15A 3L4BC 3WY9A 1QGOA 1A82A 3KKQA 4ARAA 4YDQA 1CR1A 1T2UA 2QSZA 3NP9A 5FX2A 3FLEA 1C9YA 4A4DA 1Q3KA 1XJCA 2LUOA 3L0DA 3ASYA 3LVQE 4JUIA 4UNIA 1N1GA 4DSNA 2VNHA 5KHOC 3W5CA 4HO1X 4J9VA 2IHBA 4TRNA 3E3MA 2B83A 1T9CA 1Y37A 2NADA 5CFPA 3RRYA 3N0TA 1D7AA 1DV2A 5CTJA 3SSNA 4WZBB 3N2IA 1GFWA 1USVA 3AFIA 5KNDD 3KAKA 3IA7A 4OU4A 2HLDA 3C4VA 5DLPA 3W2HA 5L3SA 1KEEA 1PFVA 4CG1A 2IYSA 4AO6A 1T36A 5G0WA 1BD4A 3FRHA 4ZZ2A 1EH5A 3ANNA 3UGTA 1W2GA 4KV7A 2ZXUA 1ULTA 1SULA 5A4DA 4AN0A 3CR7A 3VO9A 2AVDA 5AJUA 3VKUA 4Z4GA 3V42A 2O2JA 2ZUSA 3RUAA 4CIWA 1PEAA 3RROA 3VKWA 4K9PA 3MS2A 3A3OA 4JGIA 1A7AA 4WOBA 5JUWA 2G6TA 4Q03A 1TUBB 5AVQA 4ARZA 4JYCA 1O5OA 3BWXA 1V5FA 1TE2A 5EFZA 3Q3JB 3T8YA 4CF6A 4M0EA 1OAKA 3C48A 3DFMA 3VMMA 3COJA 1DIOB 3AVYA 1JZTA 1Q74A 3CCBA 4YWHA 1RQGA 3B3JA 1P0IA 1CQPA 4L9WA 4D9JA 1C7EA 2AEEA 3VR6D 5IJXA 1DXHA 1X74A 3RCBA 3ZE8A 2ZYSA 3RH0A 1Y1PA 4S24A 1TM1E 3N0VA 3CZ5A 3QITA 5AJXA 4EWLA 4C0WA 4C4PA 1LY1A 2HQSA 2C0CA 3Q1LA 2AQIA 4K1LA 4EPVA 4WXRA 4BHTA 4C76A 1TOAA 5JG7A 1UP6A 3L8GA 2WHPA 1SCJA 3HSSA 3T7TA 4F4FA 1PL6A 2YYZA 3MJTA 4KJXA 4IKEA 2CE7A 1E79A 2HTEA 2DHEA 3OA0A 3PTLA 3GRZA 3PC7A 1N5JA 3QKRA 4G5GA 4HB2A 4B0OA 3VR4A 2DRIA 3LKVA 1JHPA 4LHSA 4CFYA 3T5AA 3LYLA 3R6LA 1TT5A 3F47A 4NDAA 1CJMA 2ZTMA 2HEGA 2CW5A 3AC0A 4JD5A 4QNNA 4U0JA 1J7JA 1XR3A 4JI3B 3TLAA 3ODPA 3NEJA 2A1UA 4CCSA 4CKXA 4ZI7F 1LW7A 1R64A 4RSGA 4KQIA 4E15A 2NU7A 2NUPB 1XZAA 4JUDX 4RESA 1HKUA 4L73A 3T3EA 5L95A 4WZBA 2Z8YM 4LFCB 2I76A 1OZGA 4CKWA 3H3JA 2SKCA 1PD1A 1U9CA 2CL6X 3VPAA 1AGPA 2GXAA 1P2DA 3OIUA 3MLAA 4XSVA 1K8YB 2PXHA 2QX6A 4PG5A 1EK6A 4BQSA 1L4EA 3RWMB 2PFKA 3MBOA 1HI9A 4NFYA 4R41A 1H2XA 5IARA 5IWAB 3I12A 4DGQA 4D4GA 1FP1D 2OCYC 3DTVB 2JGKA 4K81B 2BHTA 2ETVA 1JEJA 2XWPA 3BH7A 3C1UA 1AKRA 4P3OA 3NHMA 4IHQA 1GSOA 3HMQA 4ZU6X 5JZOA 4RKEA 3DEHA 4EUKA 1E1QA 5L3ZA 4F4CA 2OY0A 1NVFA 4N0DA 3V3KA 4MA4A 3EISA 2X1LA 3WOVA 5HQ3A 2XV1A 4DBVO 5J3JA 4W9NC 4X1IB 1IIRA 4WEQA 4GMFA 1TA0A 3E7DA 2A0KA 4JYBA 2GK3A 3OFJA 3OLVA 3R5TA 4X6UA 2G9QA 5I7UA 3AL2A 2BCEA 1WXHA 1UEXC 4FIZA 4L4ZA 4MPJA 4U2DA 2IY8A 1F9EA 1DADA 3U7EB 1QUEA 1R37A 2POCA 1K5HA 1T4DA 2O4CA 3M2PA 2R11A 1Q0TA 3IHLA 3W8FA 4JLKA 4J16A 1IG0A 2JH8A 1XALA 3K5PA 2BT4A 4G1BA 1HYQA 2RKWA 1QAQA 2AZDA 3DR3A 4DMUB 4L6AA 3HJCA 3FPJA 2CVFA 4EM6A 4FFDA 2P9HA 3ZHXA 5CDFA 2UVDA 4Q7MB 1J25A 1HDZA 1P3JA 1M7BA 1VHLA 2P91A 1LXCA 1M0SA 1WB4A 2P3OA 4ESVA 2G1UA 1VRVA 2NT4A 3L8ZA 1ZNYA 5E9AA 2CUTA 3USCS 2VJNA 1ZU4A 3E7WA 3WKEA 4TWJA 1SWWA 1BA3A 1UK9A 3NUZA 2BY4A 2ICAA 5LB2A 3WMRA 4CR6A 3M1YA 1PDOA 4QJIA 1ZFNA 3NJRA 4EAAA 2F1JA 4N49A 5K09A 4EIWA 1R0XA 2HNBA 1VIVA 4MUKA 3ZW9A 1BJKA 1MFPA 1VKOA 3GUZA 2NO7A 3UENA 2BM0A 2G1JA 1NZDA 1M1NA 4D7AA 4LOHA 1Y7TA 2R1VA 4IIYA 2OEPA 3RIGA 2J85A 3SQXA 2O5CA 1GNLA 4ITRC 4M83A 5BW5A 4W5NA 1DEXA 1FNSA 1CS0A 1NLUA 3D7NA 3EG9B 1BQEA 3P94A 3Q4GA 3RUIA 3ZNNA 3VO1A 3VV2A 1FBNA 4L4UA 3DHWC 2KLBA 2C2KA 4MS1B 1QFMA 2QX8A 2Q6KA 3GRVA 3IAHA 5E1BA 5FQOA 4YX9A 5B55A 5CVTA 1PUXA 4LDJA 1T2AA 4EJFA 4WK4B 1INLA 4W1QA 3AP2A 1O6GA 2FFAA 3CZQA 3DQQA 3Q0IA 4YRGA 3QXGA 2P4QA 1FSGA 2FLWA 2GDJA 3QOWA 4JHLA 3SIRA 3RT1A 4NK5A 1CUWA 1UFOA 2V4ZA 3RVOA 1V3VA 2ACWA 3EXFA 2X13A 3RW9A 1NW8A 3VR2A 4U0KA 4GW3A 4X1YA 4YJFB 2D00A 3CY6A 2FG6C 3OWHA 2TMKA 2NAPA 4W7IA 3MWYW 4TMTA 4C2AA 1XPJA 2IUSA 3K2EA 5CT4A 4J4TA 3VTFA 5EMHA 2FPIB 1POXA 5ADVA 4FFPA 1EP2B 1JTEA 2AUMA 1ONNA 4M89A 4UBJA 1YJQA 3TLZA 4MLPA 1JKJB 1P2GA 4D99A 3MUOA 3PSAA 4TLMB 1SK9A 3I9MA 3LO5A 3ZCTA 3QF4A 4E4TA 4RTQA 2JKZA 1P1RA 2XYRA 1RZ3A 3N8HA 2GK7A 1I3OA 2C3MA 4K05A 4K87A 1Z4PX 5LR6A 5C81A 5C53B 4AZ3A 3OUTA 2QTAA 3OIVA 5J5AA 1R5NA 4QL3A 1EIWA 3NYRA 4ADSG 4RTJA 3O8RA 1V1JA 1YDEA 3EGVA 3USES 4CTMA 1DE0A 1T15A 3H65A 1RWOA 1ULSA 4ZCMA 2GCNA 1QSGA 2CHQA 4YJGA 2HLDD 4R7ZA 2QRUA 1M6YA 2CXTA 2BGTA 2WZCA 4G8BA 4KXFB 4XYMA 2H7YA 5IK2D 2ECFA 4BO9A 3EZNA 1AF4A 1JDZA 1AHPA 1NQAO 4GNRA 3BG5A 5DI9A 2BIFA 1IC6A 2BI7A 3AERA 3OZ7A 4U2BA 4ZVRA 5J4VA 3QVJA 4AS2A 3ZWOA 5IABA 2R5WA 2FOXA 3B85A 1WMSA 2QIPA 3H18A 4LK2A 1NBHA 1WU8A 4Z99A 3GA5A 1OD6A 1PJLA 4C87A 1G9TA 1Z29A 3F6CA 4JJ8A 1JDTA 1OFIA 2Y9MB 4Q02A 2QZPA 4JI2B 5C1OA 3DLAA 3GVXA 1SXGA 5AVJA 3TQFA 3PA8A 3DVAA 4QG3A 1XKTA 2R60A 1F2UB 2JIRA 2GD6A 1UBRS 3PEVA 2B5OA 4ZT4A 5TE9A 2O8EB 3PT9A 4FILA 1DBVO 3T0FA 3KDPA 4DLRA 4UUPA 1QZ3A 4MV1A 4EW6A 5KPJA 2ZBVA 1IY1A 4IVRA 4MX8A 4XGQA 1THGA 1E59A 3SX0A 3TW0A 3WGVA 4WZ6A 2XLBA 4GMKA 1LI5A 2QF7A 4R8LA 3GEIA 4X3OA 5EKTA 4GL4A 3CN7A 1BXGA 4FIDA 3G9UA 3BD9A 4LY9A 4Y9UA 3RRBA 3T5MA 2OOKA 2Q2NA 3CB2A 2PNFA 5IBPA 1ODJA 3RSFA 1YZNA 3LIPA 5K4GA 1GQYA 1QTNA 3E3OA 3TNLA 3WP0A 1PDVA 4JQCA 2GWRA 2BJHA 5BOSB 3PPYA 1R15A 5ALSA 2UXDB 1X8LA 4I1IA 1G3MA 3PTAA 4PO1A 5A9TA 3C6YA 5DHSA 1FLAA 3RS0A 2WU0A 3HN2A 1KMHB 3NWEA 4JNCA 3B60A 3GUHA 3GMIA 4U2KA 1UWVA 1YJAA 2LTAA 4LE2A 4RV4A 4XYGA 1T43A 1XNGA 3H2BA 1KAQA 4PTZA 3A4LA 4JB2A 2IBTA 2BM8A 2CFIA 4PQFA 3GPDG 3LP8A 1B6RA 5JC8A 1GTZA 1KJZA 5DGDA 4OIMA 2DOKA 1QH1A 4D9BA 4CIBA 1RWBA 2LWIA 3HU3A 1OFVA 4ZYWA 3L43A 1U3FA 1CQJB 5BW4A 4QPCA 1CULC 2F67A 4C4ZA 1PR6A 3UAWA 3U7JA 7REQB 3UANA 3OIDA 1T26A 3DAFA 3B6ZA 2XUAA 3WO1A 4CMKA 1MN6A 3RSOA 3QSYA 3LSTA 2XGOA 4LTDA 3ORFA 3BRQA 4IDQA 5G02A 2REQB 4M0UA 3I61A 4LNHA 1GPBA 3QI2A 1JTVA 2JKYA 5CM9C 4BQIA 1E98A 2EZ8A 2ZRHA 1Y9EA 4E2XA 4FE4A 2DWPA 1XAHA 1HFKA 1L8AA 3HADA 4UREA 3HACA 1B8PA 3P32A 4UD2A 5JS6A 4GSKA 2P6PA 5K8TA 3JQDA 1XHEA 4Q4CA 4MVJM 2YR0A 5EWMB 3D31A 1U7TA 2F3SA 4H4CA 4Z2YA 1TGYA 3VZDA 4R8RA 4NBWA 2K5UA 2NO5A 3BTSA 4IJKA 4MW7A 4FJ2A 3EAFA 1D2RA 1Z18A 1TJ4A 2PX8A 1JI0A 1K8QA 2B69A 2QT1A 2ZJ4A 1OW3B 4P4TA 3VH4A 5LKRA 1IOWA 1CZRA 3GLHB 4LBWA 1LPPA 1HRKA 1LZKA 2C94A 3E61A 1BWQA 3AVQA 1B6SA 3IV7A 1PT5A 1SOWA 4MVXA 3RSZA 1OH6A 3G2KA 1N9ZA 3ONFA 2Y1DA 3P9KA 2CE2X 3L07A 3KE8A 4JBLA 1BU5A 1RAIA 1X7HA 2W2MA 3H75A 4YJ2B 3VU9B 1ND6A 2PKWA 2PMCA 1XQ1A 4DDUA 5LNK6 3KG2A 2H7CA 5CFRA 1J22A 1DS6A 3FMPB 2A84A 1B3BA 3R77A 4R51A 1MDBA 4YQEA 1UBLS 1FTGA 1U2RA 1L9KA 2D54A 2ADOA 2IPLA 4GBGA 3KD3A 5EG5A 4DUZB 4R2JA 1KY5A 1KYTA 3BB4A 4DNOA 4FUQA 1IN8A 1RKQA 4JC5A 5CPFA 3R7SA 4L76A 2WTBA 2YYYA 4N6GA 4YMLA 1K4KA 3TM5A 4MCJA 4B40A 2XYQA 1P5RA 4NPCA 4KRFA 1EB9A 1WW8A 3UJ9A 1T3SA 1D2AA 3H4IA 2J4CA 2K87A 5K45A 2WQ7A 4G5SA 4H1HA 2XUKA 4FYHA 1PW5A 3EZ7A 3BHMA 2UUBB 1ZNZA 4LA4A 3DB2A 2WG2A 1OT3A 1A50B 3IP9A 2VHYA 3ORHA 2YBEA 3KOXA 2A9PA 1DRWA 3FNBA 1BD3A 4EOGA 3EBOA 3I9JA 1CUZA 2G1KA 4Y98A 1ENZA 1K7FB 3NW9A 3R40A 4KYVA 4RJLA 3U7RA 3GLGE 4HLNA 3DWFA 2WJ4A 3SQLA 1Y8RA 4P93A 3WP1B 3NTQA 5JALA 2CHGA 4D9FA 1N4DA 3S2SA 1H69A 2JFQA 2ZBRA 1HY3A 1HPLA 2Y1WA 4MUNA 2W2PA 2G8NA 1KFBB 5AM1A 1NP3A 1RQXA 2J41A 2ZUDA 4EI2A 5JI2E 2UU9B 5JZ9A 2PLRA 3C8UA 3ZHBA 2JVIA 1Z0IA 3DFKA 1JR6A 3AR6A 4YRLA 1RPNA 2D74A 3GEGA 3NFRA 3CRNA 2V45A 3FUWA 5KINB 4EL5A 2ATXA 4S1OA 2BKLA 1DOHA 2XCQA 1JIKA 1PNTA 4IWNA 4M60A 5F33A 3RFCA 1ZU5A 3U7QA 4TRRA 4AZ0A 1YUBA 2BFEA 1IEXA 4ANFA 1C4XA 5FTKA 4F3TA 1EINA 5JMPA 4CF5A 1VJ0A 2VH5R 3Q7IA 4OA8A 2X9GA 4QDXA 3ZBPA 4EW1A 5LVAA 4BB0A 1CEYA 4B8ZA 1GRCA 1W9MA 1JRLA 4OKSA 3VGPA 1J8FA 3O8OB 3A25A 4YAKA 4Q0MA 4ZKEA 1NC3A 1OT5A 1MIOB 3OZCA 4H7IA 4YH1A 1QTRA 1EGMB 4AO8A 3I6IA 1RXEA 3UH0A 3GGJA 1GDHA 4HFJA 1Z4QA 3ND6A 2OZKA 4B3CA 1E32A 3MPUA 4RPCA 3ZVKA 5BOSA 4N5MA 4KUEA 2FPPA 3AIMA 9MHTA 5H1YA 4OGLA 1L1FA 3T7IA 4BBAA 5B1SA 3ELYA 3A3KA 3OQIB 2AK2A 2YWRA 4A23A 3GLIB 1YI1A 4R40A 2B78A 2J0QA 1E2GA 4MA0A 4GEKA 4HN9A 2JS7A 3N2KA 1KZ9A 3PKZA 3FZNA 1GTSA 1XCLA 4DLXA 1CUDA 3EGDA 4RGYA 3I2HA 1GPH1 1P4JA 4MB2A 4JFRA 2F8SA 1RZVA 1H6DA 3SC4A 2JAXA 3EGXA 3LBAA 2XSZD 2Z4SA 3MN1A 2B98A 2PBRA 1KVSA 2Z6UA 1C1DB 5CT5A 2P9GA 4ZVTA 4JBNA 1N2CA 1J5XA 2OGUA 1KZYC 1OC4A 1AVTA 2QV7A 3L0PA 4PHCA 1GILA 2IKSA 2OXEA 5K99A 2VPTA 2JZNA 4D98A 4BLPA 3C5WP 2IYEA 5BSFA 3Q0EA 3QUCA 1G9SA 2WT9A 3K15A 3Q3CA 5FUQA 2ZREA 1YZGA 5AI9A 1LRKA 3OTHA 5DBIA 4JITA 1P0QA 3RG8A 3V1NA 1USIA 3VPGA 3O84A 1DHRA 1M1YA 4JOBA 1Q0SA 5D7BA 3R7FA 2CGEA 4AC9A 4MV5A 2Q2WA 3HHPA 2P2ZA 4YRAA 2EAUA 1JHRA 5EUQB 1P1BA 3ZGZA 1WQ1R 5EE1A 5EP1A 5FTNA 5T6MA 2ZBQA 3D3KA 3IP7A 4G56A 4FNGA 1EZZA 1HH4A 1UBJS 4PCVA 2NVUB 3KJXA 3EDYA 1TX4B 1WB9A 4FEGA 1E5TA 2K2WA 3VVBA 2B99A 1ZM2A 1U2QA 3T34A 2H54A 3TIXB 4ZAFA 2W2NA 3SJZA 2FEWB 3D6VA 4NC9A 4QYTA 1BU8A 4FP9A 2ENUA 4K3UA 4EGSA 1JU3A 3NDPA 3ZCQA 3MHTA 1E20A 2ASEA 2NP6A 1VCMA 2H2IA 2OVFA 3MINA 5JMTA 3W5DA 2PSEA 7ADHA 4IHKA 1KQ3A 5DNUA 1XYGA 1RJGA 2IEDA 4OHMA 5B3KA 1XZDA 4BNWA 2FW0A 4PG7A 3R0JA 2BLLA 3OJCA 4AYTA 5HQTA 1HMYA 2XZDA 3E3NA 1ZEJA 2H0QA 4FGJA 2YHIA 3ADOA 1NF8A 1CYDA 2CBGA 2FW1A 2XUFA 1ZXBA 3T7EA 3UO8B 2QXYA 3L4BA 4DRYA 1JWAB 2XMGA 3MRSA 5CIYA 1HFWA 4GO1A 4QNMA 3PKJA 5HMMA 1SCDA 2XW6A 3F6RA 1SEPA 1QH1B 2ZXFA 4W5JA 2JD0A 5CW2A 4LWOA 5GV7A 4COOA 4KNVA 1NY6A 4Y67A 5ECDA 3V46A 4CHTA 5INTA 2XOXA 4ERXA 4RCZA 1CQZA 2D5IA 4YIKA 3F6BX 1WZCA 3RFTA 4CKYA 4YLGA 4KQHA 3UBMA 3MT7A 3OZVA 2HA7A 4W8OA 3QY0A 2KBEA 3ZDFA 4C08A 4KPYA 3SC6A 4XUCA 2FQWA 3RTCA 1RM0A 5JXHA 3WGZA 2CV0A 3F3KA 5CVVA 3AEKB 2IHYA 2RHTA 1DQRA 3LT5A 1QX4A 2EKDA 1UJ5A 2PZFA 3RR2A 3ZD9A 5KC9A 5DLEA 3R9XA 2NXCA 3GT4A 3PNKA 1PDWA 1UC8A 2AFRA 3HVHA 3K20A 3MZ0A 3ZHQA 1DMRA 3KAQA 4MH0R 3PFWO 1KR2A 1KDVA 1D9ZA 1MVOA 2R5NA 4UUAA 1VKZA 3R7BA 4AZWA 1EZ4A 1MA3A 3V7NA 3RYFB 1U0FA 5HIKA 1G2OA 3AI1A 5G41A 4RY9A 1X3LA 4FNMA 4A8JB 1EZ1A 2WYVA 2WBLC 1AZSC 3I42A 1OLSB 1T4CA 3SZGA 4RABA 1C7IA 1P3DA 1RNLA 1VC2A 2VAVA 3L79A 3JVUA 4QYSA 3PSHA 2W2KA 2P8SA 3PEFA 3TGPA 1LLUA 5FNVF 4FWIB 1HWYA 2AN1A 2CCJA 2FPWA 3EZ2A 2Q28A 4R3WA 5BMVF 4ND8A 1LDEA 1C5KA 1GZ4A 4C0QC 2W43A 3ZVNA 2BBSA 4HRAA 4KPEC 4DMMA 4J43A 3D6AA 1NI5A 2WPNA 3MERA 4XR9A 1KR5A 1B8VA 4ZALA 2FDXA 5KDOA 3EXIA 3GC6A 1KXZA 4JBGA 1W1UA 4Q1FA 2D1QA 4G4SO 5F76A 2XWBF 1WHSA 3AHFA 4L8VA 1JIVA 1PQWA 5CBPA 2OLKA 5CJ2A 5K8VA 3PDWA 4E1BA 1KNQA 3X1XA 4UAGA 3FPFA 2VRCA 5YASA 1Z8NA 4AS3A 1UKBA 1WIWA 3W90A 4OJNA 1ZNWA 5C5DA 4EKGA 2JFHA 2JFGA 4MCHA 3X2FA 2MTBA 2ODNA 4FK8A 3GYGA 4Q5IA 3OQOA 3HLYA 4K8RB 3GLGA 1J39A 1I0ZA 2YY5A 3NVKI 1DT5A 1XTUA 3DKPA 1ZWLA 1E4OA 3EF3A 3KXPA 3NOOA 3OJOA 4TS1A 1G7TA 1NI3A 3SF0A 3O7WA 3VKFA 2CSXA 1J00A 3AVWA 4XB1A 1A8HA 3F90A 1HSOA 5K3DA 4ARZB 2DE0X 5T4BA 3VRHA 2LKCA 5I47A 2XCUA 2GN6A 2RDMA 2IIPA 3R3XA 5K0LA 5BV1A 2IIBA 1D04A 3SOZA 2XKBA 2RHRA 1OXTA 4A7PA 3L7CA 3H7IA 1UEIA 3R3UA 3QV2A 4AX8A 4DBLE 1U5AA 1SHKA 1Q7RA 2GZSA 3DFUA 3MJCA 3QKIA 1Q6ZA 3JQGA 1PFGA 3OECA 2C3PA 1ML4A 1XTPA 2PLWA 1P7ZA 3KAJA 1MX9A 3G6KA 4N03A 4V0OA 4W82A 3TE7A 4G1VA 2K2QB 1X39A 1Z4JA 1FDSA 3OFND 2PKQO 4QT0A 1JDNA 3OT1A 2FXVA 1KEEB 4YHBA 1C7RA 2C92A 3WHLA 1QG2A 5L3SB 4KXWA 2JBAA 5P8WA 3FNFA 3H2HA 4HRXA 1YV9A 5GWXA 5K1ZA 3A1DA 1SHLA 3NX4A 4WBNF 2IOQA 2H5IA 1C29B 2Q9CA 1N2GA 1Z47A 1RC0A 5F3RA 3X0DA 3ICVA 3E9YA 1VKRA 1E7SA 1NTRA 4E70A 4EFNA 4UFPA 2GAFA 4JLPA 1F5NA 1PQUA 2W8BB 3JY6A 3I8SA 1E9AA 1U80A 2QMZA 1KQOA 3S2YA 2YJ3A 1MOPA 1G6Q1 1G3RA 3L6CA 3JVIA 1IXRC 3OM8A 5BSMA 4LGVA 3FG9A 1YC2A 4TTTS 2BDUA 3LGSA 5EUMA 1ORDA 5IAKA 5HUJA 1DAKA 1MC8A 2X8BA 3SDZA 2H1HA 2OB2A 4QFDA 3UGKA 1QIMA 5KNBA 4RWZA 3AUSA 3LHFA 1TPZA 3ZC3A 1SC3A 2VSOA 1VPTA 3WLSA 2FP3A 1Q57A 4X8MA 3H9UA 2OBNA 2P2LA 3RU9A 1KYYA 1R50A 3ZWKA 1UP7A 1BCRB 2B3DA 3FX2A 4UHDA 3TJMA 2NU8A 4QD3A 4MLZA 1XVTA 4IZ6A 1OFUX 1QFZA 3LLCA 5CLJA 1DKPA 1G3UA 3V4ZA 1M8KA 1R8YA 1JEEA 3AX6A 3ROXA 4QWMA 5AICA 4HDCA 3WK9A 3PPIA 4PNZA 2C4TA 3B5EA 4FS8A 5M34A 3OSUA 2ZUVA 1UFRA 3INTA 4LF7B 5CB8A 1RWWA 1EFUA 1QFYA 2BWJA 5F98A 1Y42X 3MGBA 3ND5A 3FHJA 4GGMX 1K2VN 1K8ZB 3K5IA 3RYHB 1R0ZA 4LOIA 2A67A 4HAYA 3HI6A 3R20A 4U7TB 4D9CA 4Z7QB 3UUGA 4KXNA 1GNRA 1GGFA 2O2XA 3AW9A 2EQ5A 1QKIA 5G0TA 1TQHA 4D3DA 1KDPA 2O1XA 3PRHA 1TZBA 3SZMA 1MENA 4EG7A 2CNOA 5EKUA 4CKWB 2YX1A 4H1VA 1ZIXA 5DMHA 1M1XB 5KDLA 4F3YA 3U09A 3I5YA 1LDBA 4NY1A 5KKCA 1Z2CA 5EGSA 4QDOA 2GTPA 2WU4A 5TMDA 5KBYA 2I91A 3BEDA 1E0SA 1ISGA 4GE0A 1Y9JA 3PGMA 3K1JA 1ZRNA 4F06A 5A0TA 3E23A 3F7OA 4NXNB 4LJLA 3V4OA 4K88A 4J0KA 1FSSA 1NW5A 2JFPA 4IIEA 1A9XB 2BBTA 1M75A 1N92A 1NLMA 2VHCA 2C8JA 3QTTA 4M1WA 4UBOA 3QXCA 4WPGA 3K2QA 5AW5A 2WHPB 2XB6A 3T3PB 5JCZA 3LDAA 4Y2VA 3P9PA 4M98A 2QN9A 2V7TA 4R7GA 4TYYA 1IHPA 2EKQA 5LIPA 4OQLA 4AJIA 2WVGA 5D6OA 4DA7A 3TZBA 1SZJG 1KHTA 4G01B 4ZVVA 5G40A 4MGEA 3RIMA 1R4NB 1UPTA 2FFBA 1CDEA 1K5PA 2R4TA 2AA3A 3HCWA 3IBFA 4HWRA 1N6RA 5JDCC 1JE1A 4B4WA 1IZ9A 1MJNA 5JYDA 2H4ZA 1W73A 2WMOB 1ZMXA 3AV0B 4YLYA 3P2EA 3AJDA 5E3HA 4DYVA 2W6OA 5E4JA 4B3DA 4CDGA 2P6UA 5DIZA 1ZO8A 1QNFA 4H3SA 5FBZA 1V7PC 2H57A 4JIGA 4L16A 4WDRA 3VU8A 4BEWA 5BV2P 1JH9A 3QEBZ 2MSWA 1ZIYA 1NG1A 2V7PA 2J32A 1SCAA 1JPUA 5D87A 3T9CA 2DWUA 2ECQA 3FTCA 2XOEA 1M2OB 1PR3A 2D8AA 3VSBA 2RHBA 5CDUA 4R8MA 5CXQA 2ATIA 4FCCA 4HNGA 4NMXB 5J4KA 1C8VB 3SFTA 4EW3A 1E7WA 4P92A 3JTMA 1KEUA 3GPIA 3LX4A 3VR4D 3ESRA 2YIMA 1KC3A 1OXXK 1Q7TA 1ZRMA 3QMMA 1QPGA 4CLRA 1G7RA 2OK7A 1MT3A 4O2AA 3D6NB 3OEYA 1RJEA 621PA 1U0RA 3GJ8A 3DDOA 4D57A 1TIKA 3HN6A 3LUJA 4G0PA 3UW1A 4R68A 3JAWB 3RLIA 1BMFA 3S5JA 1CYEA 1V25A 1A95A 2FMKA 3O4HA 4BQFA 2ZRQA 4PC1A 1U3WA 4MRNA 3A1WA 3O26A 2O6HA 4M53A 5DWQA 1K2WA 1BMTA 1G8PA 1L7MA 1LX7A 5I8ZA 3ZCPA 1MA0A 4XQGA 3GDOA 3DV0A 4OXQA 3PHJA 5ALOA 3ZG6A 4EY4A 4MJLA 4OB6A 5TEVA 4RTMA 1LLDA 2R86A 3Q7PA 4O2BB 2QR5A 3H5RA 1XTIA 2OC4A 5DMXA 2W2KB 4QYWA 3ZXIA 1T6BY 3GARA 2OHXA 2W4QA 2ZWAA 4O8ZA 4D8YA 4BUZA 1VMAA 2NSHA 1XSEA 4ARBA 5DK4A 4IKPA 2VDJA 5J23A 2VRCD 5E4FA 4DWVA 3N8KA 4I46A 1Y1QA 3QFHA 2DPLA 2ZFUA 3O3MB 1BGVA 5KSYA 3DTVD 3QMVA 2FMTA 1O08A 5TPZA 4EHFA 3KUXA 1YE8A 1