2CDXA

Structure of cobra cardiotoxin ctxi as derived from nuclear magnetic resonance spectroscopy and distance geometry calculations
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
b'LKCNKLIPIASKTCPAGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN CTX I
publication title Structure of cobra cardiotoxin CTX I as derived from nuclear magnetic resonance spectroscopy and distance geometry calculations.
pubmed doi rcsb
source organism Naja atra
molecule tags Cardiotoxin
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2cdxA00
1LSIA 1LXHA 2K3GA 1H0JA 2MJ4A 2QJ9C 1TFSA 1NORA 5DO6A 1KBAA 3HH7A 1TXAA 1IQ9A 2VLWA 1ONJA 1TXBA 3BT1U 1FSSB 2BTXA 5EBXA 1IKCA 2ABXA 3LAQU 4RUDA 1NYUA 2CTXA 1HOYA 1DRSA 2BHIA 2CRSA 1NYSA 1NXBA 4FAOC 1KL8A 1CRFA 1B41B 1JE9A 4DO8A 3FEVA 1FASA 1CCQA 1IK8A 1CB9A 2GOOB 1F8UB 1HAAA 3EVSC 1CHVS 1CXOA 2H7ZB 2MUPA 4UY2C 2J8BA 3NEQA 1FF4A 1MAHF 2HLRA 1V6PA 1ZADA 1REWC 3U73U 1CVOA 1CTXA 2CCXA 2NBTA 2JVEA 2H62C 4OM5A 2L5SA 3EBXA 1KFHA 1ERGA 2GOOC 3KFDE 5DU1A 1LX5B 2LA1A 2L03A 1CDSA 2I9BE 1JGKA 4ZQYA 3KFDI 2PJYB 1TGXA 1M9ZA 1YWHA 3BT2U 4HQPF 2ERAA 1BTEA 1IDIA 1CREA 4EY8B 1MR6A 1I02A 4BIKB 1CDQA 1LXGA 2H8UA 1ERAA 2JQPA 2QC1A 1ABTA 3NDSA 3NH7A 2MJYA 1COEA 2H64B 1IJCA 1JBDA 2QJBC 1IDHA 1IDGA 1KXIA 1QKEA 2MHYA 1KC4A 2X8BB 2HLQA 1KS6A 1S4YA 1HC9A 1F94A 1BXPA 1CXNA 1VB0A 1KBSA 4P7UA 2N99A 2CDXA 4XJJA 1QM7A 1W6BA 1G6MA 2MFAA 1FRAA 1FSCA 4LFTA 1LJZA 2H5FA 2UX2A 2QJAC 5IMYC 2PJYC 4QTIU 4FAOE 1QKDA 2FD6U 1FFJA 4IYEA 3ERAA 1NEAA 1KU6B 3QB4B 1L4WA 1KBTA 2LCRA 1XT3A 1CDTA 1UG4A 6EBXA 2H7ZA 1CDRA 5DZ5A 1NTNA 3VTSA 1PLOA 1HAJA 2MUOA 3U74U 1ES7B 1KTZB 1HC9B 1RGJA 3PLCA 1CODA 1NTXA 4OM4A 2H62D 1IDLA 2CRTA 4AEAA 5IMTD 2H64C 2OFSA 4BDTB 2UWRA 2MJ0A 1RL5A
chains in the Genus database with same CATH superfamily
1LSIA 1LXHA 2K3GA 1H0JA 2MJ4A 2QJ9C 1TFSA 1NORA 5DO6A 1KBAA 3HH7A 1TXAA 1IQ9A 2VLWA 1ONJA 1TXBA 3BT1U 1FSSB 2BTXA 5EBXA 1IKCA 2ABXA 3LAQU 4RUDA 1NYUA 2CTXA 1HOYA 1DRSA 2BHIA 2CRSA 1NYSA 1NXBA 4FAOC 1KL8A 1CRFA 1B41B 1JE9A 4DO8A 3FEVA 1FASA 1CCQA 1IK8A 1CB9A 2GOOB 1F8UB 1HAAA 3EVSC 1CHVS 1CXOA 2H7ZB 2MUPA 4UY2C 2J8BA 3NEQA 1FF4A 1MAHF 2HLRA 1V6PA 1ZADA 1REWC 3U73U 1CVOA 1CTXA 2CCXA 2NBTA 2JVEA 2H62C 4OM5A 2L5SA 3EBXA 1KFHA 1ERGA 2GOOC 3KFDE 5DU1A 1LX5B 2LA1A 2L03A 1CDSA 2I9BE 1JGKA 4ZQYA 3KFDI 2PJYB 1TGXA 1M9ZA 1YWHA 3BT2U 4HQPF 2ERAA 1BTEA 1IDIA 1CREA 4EY8B 1MR6A 1I02A 4BIKB 1CDQA 1LXGA 2H8UA 1ERAA 2JQPA 2QC1A 1ABTA 3NDSA 3NH7A 2MJYA 1COEA 2H64B 1IJCA 1JBDA 2QJBC 1IDHA 1IDGA 1KXIA 1QKEA 2MHYA 1KC4A 2X8BB 2HLQA 1KS6A 1S4YA 1HC9A 1F94A 1BXPA 1CXNA 1VB0A 1KBSA 4P7UA 2N99A 2CDXA 4XJJA 1QM7A 1W6BA 1G6MA 2MFAA 1FRAA 1FSCA 4LFTA 1LJZA 2H5FA 2UX2A 2QJAC 5IMYC 2PJYC 4QTIU 4FAOE 1QKDA 2FD6U 1FFJA 4IYEA 3ERAA 1NEAA 1KU6B 3QB4B 1L4WA 4KSNA 1KBTA 2LCRA 1XT3A 1CDTA 1UG4A 6EBXA 2H7ZA 1CDRA 5DZ5A 1NTNA 3VTSA 1PLOA 1HAJA 2MUOA 3U74U 1ES7B 1KTZB 1HC9B 1RGJA 3PLCA 1CODA 1NTXA 4OM4A 2H62D 1IDLA 2CRTA 4AEAA 5IMTD 2H64C 2OFSA 4BDTB 2UWRA 2MJ0A 1RL5A
chains in the Genus database with same CATH topology
1LSIA 1LXHA 2K3GA 1H0JA 2MJ4A 2QJ9C 1TFSA 1NORA 5DO6A 1KBAA 3HH7A 1TXAA 1IQ9A 2VLWA 1ONJA 1TXBA 3BT1U 1FSSB 2BTXA 5EBXA 1IKCA 2ABXA 3LAQU 4RUDA 1NYUA 2CTXA 1HOYA 1DRSA 2BHIA 2CRSA 1NYSA 1NXBA 4FAOC 1KL8A 1CRFA 1B41B 1JE9A 4DO8A 3FEVA 1FASA 1CCQA 1IK8A 1CB9A 2GOOB 1F8UB 1HAAA 3EVSC 1CHVS 1CXOA 2H7ZB 2MUPA 4UY2C 2J8BA 3NEQA 1FF4A 1MAHF 2HLRA 1V6PA 1ZADA 1REWC 3U73U 1CVOA 1CTXA 2CCXA 2NBTA 2JVEA 2H62C 4OM5A 2L5SA 3EBXA 1KFHA 1ERGA 2GOOC 3KFDE 5DU1A 1LX5B 2LA1A 2L03A 1CDSA 2I9BE 1JGKA 4ZQYA 3KFDI 2PJYB 1TGXA 1M9ZA 1YWHA 3BT2U 4HQPF 2ERAA 1BTEA 1IDIA 1CREA 4EY8B 1MR6A 1I02A 4BIKB 1CDQA 1LXGA 2H8UA 1ERAA 2JQPA 2QC1A 1ABTA 3NDSA 3NH7A 2MJYA 1COEA 2H64B 1IJCA 1JBDA 2QJBC 1IDHA 1IDGA 1KXIA 1QKEA 2MHYA 1KC4A 2X8BB 2HLQA 1KS6A 1S4YA 1HC9A 1F94A 1BXPA 1CXNA 1VB0A 1KBSA 4P7UA 2N99A 2CDXA 4XJJA 1QM7A 1W6BA 1G6MA 2MFAA 1FRAA 1FSCA 4LFTA 1LJZA 2H5FA 2UX2A 2QJAC 5IMYC 2PJYC 4QTIU 4FAOE 1QKDA 2FD6U 1FFJA 4IYEA 3ERAA 1NEAA 1KU6B 3QB4B 1L4WA 4KSNA 1KBTA 2LCRA 1XT3A 1CDTA 1UG4A 6EBXA 2H7ZA 1CDRA 5DZ5A 1NTNA 3VTSA 1PLOA 1HAJA 2MUOA 3U74U 1ES7B 1KTZB 1HC9B 1RGJA 3PLCA 1CODA 1NTXA 4OM4A 2H62D 1IDLA 2CRTA 4AEAA 5IMTD 2H64C 2OFSA 4BDTB 2UWRA 2MJ0A 1RL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSI A;  1LXH A;  2K3G A;  1H0J A;  2MJ4 A;  2QJ9 C;  1TFS A;  1NOR A;  5DO6 A;  1KBA A;  3HH7 A;  1TXA A;  1IQ9 A;  2VLW A;  1ONJ A;  1TXB A;  3BT1 U;  1FSS B;  2BTX A;  5EBX A;  1IKC A;  2ABX A;  3LAQ U;  4RUD A;  1NYU A;  2CTX A;  1HOY A;  1DRS A;  2BHI A;  2CRS A;  1NYS A;  1NXB A;  4FAO C;  1KL8 A;  1CRF A;  1B41 B;  1JE9 A;  4DO8 A;  3FEV A;  1FAS A;  1CCQ A;  1IK8 A;  1CB9 A;  2GOO B;  1F8U B;  1HAA A;  3EVS C;  1CHV S;  1CXO A;  2H7Z B;  2MUP A;  4UY2 C;  2J8B A;  3NEQ A;  1FF4 A;  1MAH F;  2HLR A;  1V6P A;  1ZAD A;  1REW C;  3U73 U;  1CVO A;  1CTX A;  2CCX A;  2NBT A;  2JVE A;  2H62 C;  4OM5 A;  2L5S A;  3EBX A;  1KFH A;  1ERG A;  2GOO C;  3KFD E;  5DU1 A;  1LX5 B;  2LA1 A;  2L03 A;  1CDS A;  2I9B E;  1JGK A;  4ZQY A;  3KFD I;  2PJY B;  1TGX A;  1M9Z A;  1YWH A;  3BT2 U;  4HQP F;  2ERA A;  1BTE A;  1IDI A;  1CRE A;  4EY8 B;  1MR6 A;  1I02 A;  4BIK B;  1CDQ A;  1LXG A;  2H8U A;  1ERA A;  2JQP A;  2QC1 A;  1ABT A;  3NDS A;  3NH7 A;  2MJY A;  1COE A;  2H64 B;  1IJC A;  1JBD A;  2QJB C;  1IDH A;  1IDG A;  1KXI A;  1QKE A;  2MHY A;  1KC4 A;  2X8B B;  2HLQ A;  1KS6 A;  1S4Y A;  1HC9 A;  1F94 A;  1BXP A;  1CXN A;  1VB0 A;  1KBS A;  4P7U A;  2N99 A;  2CDX A;  4XJJ A;  1QM7 A;  1W6B A;  1G6M A;  2MFA A;  1FRA A;  1FSC A;  4LFT A;  1LJZ A;  2H5F A;  2UX2 A;  2QJA C;  5IMY C;  2PJY C;  4QTI U;  4FAO E;  1QKD A;  2FD6 U;  1FFJ A;  4IYE A;  3ERA A;  1NEA A;  1KU6 B;  3QB4 B;  1L4W A;  1KBT A;  2LCR A;  1XT3 A;  1CDT A;  1UG4 A;  6EBX A;  2H7Z A;  1CDR A;  5DZ5 A;  1NTN A;  3VTS A;  1PLO A;  1HAJ A;  2MUO A;  3U74 U;  1ES7 B;  1KTZ B;  1HC9 B;  1RGJ A;  3PLC A;  1COD A;  1NTX A;  4OM4 A;  2H62 D;  1IDL A;  2CRT A;  4AEA A;  5IMT D;  2H64 C;  2OFS A;  4BDT B;  2UWR A;  2MJ0 A;  1RL5 A; 
#chains in the Genus database with same CATH topology
 1LSI A;  1LXH A;  2K3G A;  1H0J A;  2MJ4 A;  2QJ9 C;  1TFS A;  1NOR A;  5DO6 A;  1KBA A;  3HH7 A;  1TXA A;  1IQ9 A;  2VLW A;  1ONJ A;  1TXB A;  3BT1 U;  1FSS B;  2BTX A;  5EBX A;  1IKC A;  2ABX A;  3LAQ U;  4RUD A;  1NYU A;  2CTX A;  1HOY A;  1DRS A;  2BHI A;  2CRS A;  1NYS A;  1NXB A;  4FAO C;  1KL8 A;  1CRF A;  1B41 B;  1JE9 A;  4DO8 A;  3FEV A;  1FAS A;  1CCQ A;  1IK8 A;  1CB9 A;  2GOO B;  1F8U B;  1HAA A;  3EVS C;  1CHV S;  1CXO A;  2H7Z B;  2MUP A;  4UY2 C;  2J8B A;  3NEQ A;  1FF4 A;  1MAH F;  2HLR A;  1V6P A;  1ZAD A;  1REW C;  3U73 U;  1CVO A;  1CTX A;  2CCX A;  2NBT A;  2JVE A;  2H62 C;  4OM5 A;  2L5S A;  3EBX A;  1KFH A;  1ERG A;  2GOO C;  3KFD E;  5DU1 A;  1LX5 B;  2LA1 A;  2L03 A;  1CDS A;  2I9B E;  1JGK A;  4ZQY A;  3KFD I;  2PJY B;  1TGX A;  1M9Z A;  1YWH A;  3BT2 U;  4HQP F;  2ERA A;  1BTE A;  1IDI A;  1CRE A;  4EY8 B;  1MR6 A;  1I02 A;  4BIK B;  1CDQ A;  1LXG A;  2H8U A;  1ERA A;  2JQP A;  2QC1 A;  1ABT A;  3NDS A;  3NH7 A;  2MJY A;  1COE A;  2H64 B;  1IJC A;  1JBD A;  2QJB C;  1IDH A;  1IDG A;  1KXI A;  1QKE A;  2MHY A;  1KC4 A;  2X8B B;  2HLQ A;  1KS6 A;  1S4Y A;  1HC9 A;  1F94 A;  1BXP A;  1CXN A;  1VB0 A;  1KBS A;  4P7U A;  2N99 A;  2CDX A;  4XJJ A;  1QM7 A;  1W6B A;  1G6M A;  2MFA A;  1FRA A;  1FSC A;  4LFT A;  1LJZ A;  2H5F A;  2UX2 A;  2QJA C;  5IMY C;  2PJY C;  4QTI U;  4FAO E;  1QKD A;  2FD6 U;  1FFJ A;  4IYE A;  3ERA A;  1NEA A;  1KU6 B;  3QB4 B;  1L4W A;  4KSN A;  1KBT A;  2LCR A;  1XT3 A;  1CDT A;  1UG4 A;  6EBX A;  2H7Z A;  1CDR A;  5DZ5 A;  1NTN A;  3VTS A;  1PLO A;  1HAJ A;  2MUO A;  3U74 U;  1ES7 B;  1KTZ B;  1HC9 B;  1RGJ A;  3PLC A;  1COD A;  1NTX A;  4OM4 A;  2H62 D;  1IDL A;  2CRT A;  4AEA A;  5IMT D;  2H64 C;  2OFS A;  4BDT B;  2UWR A;  2MJ0 A;  1RL5 A; 
#chains in the Genus database with same CATH homology
 1LSI A;  1LXH A;  2K3G A;  1H0J A;  2MJ4 A;  2QJ9 C;  1TFS A;  1NOR A;  5DO6 A;  1KBA A;  3HH7 A;  1TXA A;  1IQ9 A;  2VLW A;  1ONJ A;  1TXB A;  3BT1 U;  1FSS B;  2BTX A;  5EBX A;  1IKC A;  2ABX A;  3LAQ U;  4RUD A;  1NYU A;  2CTX A;  1HOY A;  1DRS A;  2BHI A;  2CRS A;  1NYS A;  1NXB A;  4FAO C;  1KL8 A;  1CRF A;  1B41 B;  1JE9 A;  4DO8 A;  3FEV A;  1FAS A;  1CCQ A;  1IK8 A;  1CB9 A;  2GOO B;  1F8U B;  1HAA A;  3EVS C;  1CHV S;  1CXO A;  2H7Z B;  2MUP A;  4UY2 C;  2J8B A;  3NEQ A;  1FF4 A;  1MAH F;  2HLR A;  1V6P A;  1ZAD A;  1REW C;  3U73 U;  1CVO A;  1CTX A;  2CCX A;  2NBT A;  2JVE A;  2H62 C;  4OM5 A;  2L5S A;  3EBX A;  1KFH A;  1ERG A;  2GOO C;  3KFD E;  5DU1 A;  1LX5 B;  2LA1 A;  2L03 A;  1CDS A;  2I9B E;  1JGK A;  4ZQY A;  3KFD I;  2PJY B;  1TGX A;  1M9Z A;  1YWH A;  3BT2 U;  4HQP F;  2ERA A;  1BTE A;  1IDI A;  1CRE A;  4EY8 B;  1MR6 A;  1I02 A;  4BIK B;  1CDQ A;  1LXG A;  2H8U A;  1ERA A;  2JQP A;  2QC1 A;  1ABT A;  3NDS A;  3NH7 A;  2MJY A;  1COE A;  2H64 B;  1IJC A;  1JBD A;  2QJB C;  1IDH A;  1IDG A;  1KXI A;  1QKE A;  2MHY A;  1KC4 A;  2X8B B;  2HLQ A;  1KS6 A;  1S4Y A;  1HC9 A;  1F94 A;  1BXP A;  1CXN A;  1VB0 A;  1KBS A;  4P7U A;  2N99 A;  2CDX A;  4XJJ A;  1QM7 A;  1W6B A;  1G6M A;  2MFA A;  1FRA A;  1FSC A;  4LFT A;  1LJZ A;  2H5F A;  2UX2 A;  2QJA C;  5IMY C;  2PJY C;  4QTI U;  4FAO E;  1QKD A;  2FD6 U;  1FFJ A;  4IYE A;  3ERA A;  1NEA A;  1KU6 B;  3QB4 B;  1L4W A;  4KSN A;  1KBT A;  2LCR A;  1XT3 A;  1CDT A;  1UG4 A;  6EBX A;  2H7Z A;  1CDR A;  5DZ5 A;  1NTN A;  3VTS A;  1PLO A;  1HAJ A;  2MUO A;  3U74 U;  1ES7 B;  1KTZ B;  1HC9 B;  1RGJ A;  3PLC A;  1COD A;  1NTX A;  4OM4 A;  2H62 D;  1IDL A;  2CRT A;  4AEA A;  5IMT D;  2H64 C;  2OFS A;  4BDT B;  2UWR A;  2MJ0 A;  1RL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...