2CE2X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ce2X00
1IN5A 1Q21A 2IEYA 3NBXX 1G8GA 4U5XA 2I4IA 4C0BA 1UF9A 2GBLC 2H16A 1A7JA 1P5ZB 1VHTA 1A5TA 5CK4A 2ZSAA 3EPJA 1Q0UA 3K09C 4NCNA 5KO2A 2W6JD 1XWIA 4A36A 4RD0A 2Q6TA 2YOHA 2ZYVX 2FGKA 1XB2A 3DZDA 2B8WA 3M1IA 4H1UA 2PLRA 2XAUA 2P5TB 1DARA 1KI4A 1D6JA 2NO6A 4Y0VA 2CCKA 5HCNA 3ZQ6A 5CB8A 2QG6A 3B7GA 3HR8A 2GESA 3FMIA 4IOKA 4MRPA 1SXJB 4PANA 3U7FB 2Z4RA 4PC7A 4GL2A 3GLHB 4IDNA 2WBLC 1I2DA 5E95A 2MMGA 2ZM5A 5J4YA 4G5RA 1UKVY 2RGEA 2CE7A 5DN6A 4DLRA 4CEHA 2ZRJA 3PUYA 4A0HA 5FR2A 1KY2A 2HLDD 3A4LA 1CU1A 2GXUA 3F5FA 1ZC3A 2IX3A 4OI0A 1YR7A 1N6KA 4IDPA 4PPNA 2F43A 3QVVA 3VU9A 2ORIA 2A9KA 3AF1A 3HU2A 4W5WA 3TGPA 1W0KD 3FDIA 4FD2A 3BFKA 1S2MA 5HCIA 3FHOA 1UEIA 2H92A 1VMAA 3ICQB 5FOXA 2QBYB 4F92B 1DO2A 3GQBA 1RJ9A 4LHZA 4M0LA 2CLDX 4JLKA 3W6PA 5EP4A 3FKQA 4DIDA 4DLZA 2EWVA 1AIPA 1UKEA 1KI7A 2PMKA 5LD2C 3LLUA 3PEWA 1ZM7A 3VNUA 1IN8A 1NMXA 4OHXA 5HTKA 1BS1A 2ZJOA 1IJFA 4OHWA 3BS4A 3THYB 1VKJA 3QXSA 4GP7A 3THWB 3PUVA 2OE2A 4U00A 3RABA 1IN4A 4QXAA 1GP2A 5C4GB 2IXEA 4QC2A 1NL3A 1CJKC 4M8NE 1JQLB 1K5DA 1EFRA 1OSNA 1R6BX 2FPMA 2R6DA 1HUQA 4CT5A 2Z4SA 2J59A 3LV8A 1E0SA 3TNFA 3ZDQA 1PZNA 5JBQA 3U6BA 3F8TA 3M0EA 4MGIR 2EW1A 2X1VA 1KK0A 5J4LA 3WRYC 4KYIB 2R6FA 3NDBB 4HUTA 1W48A 1KJYA 3QKRA 3HDTA 2YHSA 3CO5A 1XPOA 1OV4A 4IOJA 1TF7A 2ZS7A 4A6PA 3WHLA 3EWAA 3NIBA 1SXJA 3ZYCA 4KBFA 3WY9A 1XD8A 3GLHA 1KZGB 2D7CA 2CCGA 4DLWA 5CLQA 4EDHA 4F4CA 4DDTA 1XJ0A 4RD6A 1NJFA 4TZ0A 2J0VA 1RZ3A 3GJ0A 1W0JD 3L0IB 1SHZA 1TQ6A 2IYWA 2FNAA 5JWHA 3QPUA 1JXOA 3H84A 1D2EA 2HDNB 2B7BA 2FZLA 2ZYWX 4C30A 4E03A 4XD7A 3AVWA 3E1SA 2EYQA 2W2XA 4M9SA 1O3YA 1N0VC 1R8SA 4KODA 1LVGA 4PAMA 5LBIA 3KFVA 1W44A 4O3MA 1G64A 5DGXA 5KUTA 4NYMR 4X8HA 3OF5A 2W6IA 1S0UA 5EXTA 4RCZA 1X1SA 1ZW6A 2PMDA 4MKIA 4D2IA 1DS6A 2OUKA 1VG8A 3A1VA 3AKDA 1XMJA 1ZM9A 2GNOA 1NG9A 2IYXA 1E9EA 2BEJA 4NDZA 4D25A 4GNKA 3VHLB 4B74A 5H68A 4C0SA 1G7RA 5A5GA 3GP8A 3TE6A 3T1TA 4W9MC 4HDQB 3N2IA 1HEIA 4BEJA 1NF3A 1FP6A 2AD1A 4LJ8A 3THYA 4JKYA 3ZLJA 4BRWA 1OW3B 3THWA 1Z28A 3UPUA 2JLQA 2ODEA 2P3SA 4RCYA 3QEJA 4YXWD 5JSZA 3SYLA 1CJTC 1GOTA 3VTKA 1P2TA 3W3ZB 1YRAA 1E2FA 1SVSA 3VQTA 2XOKD 1US8B 3WNDA 3HR7A 1OFUX 5H1YA 1DAHA 2O0HA 2IXGA 4PHHA 2GXSA 1QHGA 3WBKA 4E5UA 1AJEA 2JLUA 1LF0A 1KSGA 4MQBA 2WKRA 3DMDA 3FE2A 1E2MA 3C14C 5HZHA 4RZ2A 4B33A 4MKHA 4CIDA 1KSJA 3W3AA 4ZCMA 3CR7A 4ZDKA 2P67A 2IWRA 5JHGB 3UWOA 2HXSA 5KNBA 3A1WA 2V54A 2ZR7A 3BJIC 5FOSA 4XIGS 3QXXA 1DAEA 3A1UA 3TSWA 4ZI3A 1BMFD 2OILA 1CBUA 5D3MB 2ZI3A 1ZU4A 4BRUA 4LOAA 3LBIA 1SVMA 2PLFA 2QMOA 2YV5A 5FBLB 1RFLA 3G5UA 3U44B 2P2LA 4JT4A 1LV7A 5CITA 1GL7A 4ZKEA 1C1YA 2I1VB 4URWR 4X8MA 3U3JA 4F38A 3TMKA 3QIAA 1G17A 3MJHA 4B3BA 4LHYA 1S96A 4EIWA 1DEKA 1XU4A 3OE7A 1G7CA 3DEFA 1R5NA 3V00A 1PLLA 1FMJA 3GCGA 5JEDA 1N5KA 2NTYC 4B48A 4OI1A 4B3CA 2HUPA 3NBYC 1P61B 4E07A 2IF0A 4OI4A 1QF9A 1FTNA 2JDID 1DG3A 2WMNB 1NLZA 4YMUA 5KPDA 1JECA 3WNBA 1SVOA 2ZSFA 1JBKA 4B6EA 4TLEA 1KO8A 4GMDA 5J4HA 4NCHA 2IBMA 3IPXA 3FHCB 3MG9A 2QGNA 3ZD6A 1E3MA 4ZIRB 2WHXA 5SZKB 3PCRB 3QXCA 2PJZA 1US8A 4BLQA 2R2AA 2QP3A 3C5HA 4B35A 5JECA 2QM7A 2GEDA 2NG1A 2JIZD 4LC1A 4N1AA 3RS5A 2YWEA 2YZ2A 3CZQA 1H8HA 4TTRA 3UATA 2VP4A 2VP2A 1XBTA 4WIAA 3MRSA 5J4VA 3ECCA 2GILA 1HQCA 3CM0A 1CR4A 5DHFA 1Z8FA 3X2SA 4LDJA 4GDFA 4HAWA 4HLUC 4TYQA 1KSFX 1OJLA 4DWJA 1YRBA 4QHYA 5DYIA 1UAAA 1XTQA 1TF2A 4Q21A 2ODNA 2G88A 4O2LA 4XWAA 4P31A 4PPFA 5D3MA 5KPJA 4ESHA 1J70A 4N0EA 2RGCA 2NO9A 1N0UA 3BOSA 1QHYA 1NN0A 4C7OB 2VPPA 1ZJ6A 1QBKC 3JZAA 4ASUD 5IDVA 2YC2C 1T9HA 4DCTA 4IHQA 2BWJA 4DLTA 3IEUA 1E2LA 5TMPA 2YOGA 5EQTA 1XNJA 2VP9A 4KITB 2UZIR 2LWIA 2IYQA 3UMFA 1KK2A 4PSVA 3A36A 1XXHE 1YE8A 4MRNA 2WV9A 4HAVA 3OAAA 3KXLA 1RRFA 4WZBE 1E4YA 5F9HA 5TXGA 5E7MA 4BLSA 3BGWA 1QHHB 4JS0A 2AXNA 4M1MA 1HV8A 5KSZA 2QORA 5G41A 2VSFA 1COWA 3U60B 1KK1A 4TT3D 2FFBA 3GJ4A 1IHUA 3C41J 2ZUBA 1NN3A 3A4NA 3CWQA 1R0WA 3NTUA 1NN1A 1DAGA 2A5YB 4V0KA 1AK2A 1TUIA 2QENA 3HPRA 3UMRA 1IAQA 3B1WA 5BXQC 1R4AA 5CM9C 5G53C 4ZIRA 2ZANA 4MKFA 2CMKA 4TMVA 4C0AC 4WVFA 4LCBA 2VRWA 2DFKB 1FOEB 1WP9A 4QBIA 4E09A 1HH4A 5BWMA 3ND8A 1CIPA 3AV0B 3GD7A 1TQ2A 1IN6A 2FJUA 2HF9A 1OH8A 4JYCA 3I8SA 1GRQA 4QRHA 3K8YA 4G01B 4M9QA 3NH9A 1P60A 5BYKA 1TX4B 3EW9A 4GBMA 1TQ4A 1LS1A 4MUAA 1AN0A 1YKSA 1CR1A 2ZU6A 1OT3A 1G291 4MRSA 4Q1AA 2WIBA 3CRW1 2D4HA 4C7OA 4EQ6B 3DM5A 4OYHA 2YC4C 2EFGA 2EFCB 1JAIA 2JJ1D 4LPSA 3EA0A 2A5JA 2UKDA 4TL8A 4DEYA 3EA5A 3CRMA 3HU1A 5DI3B 1M7BA 3L82B 1RRCA 3KTAB 4JLAA 2A30A 4LJYA 3H2YA 2HYDA 1UDWA 3KUDA 1G3RA 4UNPA 5KDOA 1QHHA 2GJKA 2O8CB 1P2UA 4DCNA 1E1RA 3HP1A 1IY2A 2ZRPA 5K8TA 2FV8A 1XX6A 1KMQA 2C9OA 3LBHA 4J0QA 1J99A 1G19A 4JJZA 4RVCA 4P4TA 1XEWX 2A5GA 3A1TA 3EASA 4IOLA 4URZR 3L0OA 5EP2A 2JLXA 2XNDD 1G8YA 4KHZA 1E2EA 2DFLA 5F3WB 4KFSA 1CR0A 2XJ9A 1Q3HA 1W2HA 1Z2CA 1XCPA 3NBFA 4PO8A 2E9SA 2GZAA 4L4UA 1FZQA 4LYAA 4W5HA 4DBLC 1KI6B 3IHLA 4G5SA 3PIRA 1GRRA 5FPKA 4ZV4A 3GLFE 2J7PA 1KHTA 2YYZA 2ZJAA 3VR6A 3TIFA 2V7QA 2WZQA 3B2EA 1T8UA 4QBHA 2D06A 5KSOA 3PJRA 5KDDA 2Q9CA 3H1TA 4Q02A 3CRQA 4ZKDA 3VKWA 4WZAE 1CULC 3KKPA 3MUFA 2ECKA 1U8AA 1RYHA 3REGA 4FWTA 4G5OA 1H8EA 1EFCA 1ZINA 4DKXA 4A82A 3OEEA 1IN7A 5GJWC 5DYGA 4G3XA 4I1SA 4IDOA 1ANKA 1E99A 4EQ6A 3PEYA 1OH7A 2WMOB 1AKEA 2V6JA 4F93B 1EGAA 1OH5A 2ZSDA 3T34A 1Z63A 1OKKA 1W5TA 3WXMA 4DT1B 1ZUIA 1P75A 1ZNYA 2W83A 4Q7KA 2WOJA 2V8OA 1JR3D 2CL6X 4NHOA 1XPRA 2FEOA 1NSTA 3KTAA 4PO9A 3P32A 5FTKA 2BIFA 4IXNA 3R9IA 3WMEA 1EG7A 2WJGA 5HKKA 1JR3E 1AZSC 2N46A 5DH9A 3I92A 1W36C 2O0KA 2AWNA 3X1WA 3O8CA 1IOZA 4PFSA 2GWHA 4FCWA 4MDEA 4PAOA 1PV4A 1TQDA 3SOPA 1Q20A 2VO1A 2FX3A 4HDCA 1CRQA 4LRWA 3SHFA 2R9VA 2REXB 1TL7C 2KE5A 5AR1A 1P9NA 5L3SB 4POAA 3TBKA 4TL9A 1J8MF 1KI6A 4HATA 5DLQC 3RYTC 1Q12A 4FWIB 3C5CA 2ZROA 1P6XA 2AWOA 3KKMA 4HEJA 2FFQA 1NBMA 3DVLA 2RGNC 5TVKA 4IVQA 4PHGA 2FOLA 3QJYA 1LF5A 2ANCA 3ZZTA 1ZCAA 5JRJA 1E2NA 3HYRA 3CRRA 2WAYA 4QJ3A 2VF7A 1BYIA 5LDDC 1DADA 3K70B 3ASYA 3P20A 3LFUA 4L8GA 2NO1A 2JEOA 1RVDA 1XDBA 2QAGC 2WOOA 3A37A 4Q9KA 1R8QA 3IDQA 3T5DA 2F55A 1Z0KA 2CXXA 2OT3B 4KLNA 4DJTA 3AF0A 2J9RA 3VR2A 4D4JA 3GLIB 2C04A 1E1QA 4I4LA 2OBMA 3DHWC 4DVGA 1AS2A 3EIHA 4DT1A 2AX4A 4DDUA 2GEUA 1P73A 4W7SA 5KSPA 4G5GA 5B30A 1PJRA 1ELOA 4I81A 4PX9A 1S1MA 3WP0A 4DLYA 1G8PA 4MITA 4F7WA 4O2RA 2NIPA 5DISB 2VBCA 3ZS8A 1EFRD 3QPWA 4MH0R 3QQ5A 1WDTA 2C9CA 4PZLA 2R8RA 4UQOA 4XTRA 2G1KA 4NE2A 3B8HA 1NNEA 1A2BA 4DXAA 2WJVA 1VYTA 3AVUA 5GJVC 2CVFA 3JVUA 4H9GA 2CBZA 1NKSA 3QBTA 1RKBA 1T0JB 1Z6AA 4EJSC 1QHXA 5L3SA 1SXJD 3B13B 2X2EA 1OH6A 2C9YA 1JNYA 1YZLA 2ZI5A 3E2IA 3IQWA 4AYWA 2P65A 2QQEA 3QENA 2G0NA 1E69A 4LJ5A 3CF2A 4Q1FA 1ZD8A 4AY2A 1E2KA 1NN5A 3VR1A 3B5JA 1SXJE 3LBNA 2Z43A 2ATXA 3JZMA 3GLHE 4M1SA 1OHHA 1ZC4A 2GAOA 2C96A 3I3SR 2F43B 4XD7D 2JLRA 2VHTA 2HJVA 4D81A 2L0XA 4PSKA 4OQMA 1VPLA 3CPJB 2WKQA 3U7GA 1LS6A 2JGNA 1E79A 3RSLA 3ZJYA 2FEMA 2OEPA 3B9QA 1Z6GA 3GEHA 2A2ZA 4TZ6A 1FMLA 4EUNA 2IUSA 3BB3A 1DOAA 2R62A 2BC9A 5FUWA 1VDZA 5G3YA 2FSIA 2BJWA 4Q1DA 4UXIA 1L4YA 1KDRA 1G7SA 1W46A 2GK6A 3WHKA 1G8FA 3ZH9B 4UNNA 2B6HA 2PEZA 1CF4A 2CL7X 2HCBA 4ZDWA 4DLSA 2BBOA 3ZD7A 1NY6A 2RCNA 3A6PC 1XMSA 4TWZA 2F1IA 1SKYB 1IXSB 1G20E 4G5QA 5AK0A 2YKGA 3KXKA 4LYFA 3U5ZB 3QXHA 1GL9B 1RE0A 2ZETA 3UXMA 1QG2A 2OXRA 1QRAA 5EE9A 2BMFA 2IYZA 3Q7QA 4XVUA 2BV3A 2Q21A 4NMMA 1Z0IA 3OFNA 2G3YA 4DSNA 3V4RA 4II7A 3U3MA 2HYIC 3QKTA 1SXJC 1DBSA 5L3QB 3WYGA 3QF4A 2QMUA 1JR6A 3KJEA 3I5YA 3K0CC 2ZAOA 3B60A 4HYYA 1NI3A 3PEUA 3FMOB 3QKRB 4DCUA 1ZD9A 3AP2A 4Q7JB 4AC9A 1GILA 3CONA 1VIYA 1U81A 4PC6A 2QPOA 1QHSA 2XSZA 3HYTA 4QJ5A 2PEYA 2AKYA 1PVOA 3IBGA 4GZMA 1K5GA 4PSAA 1Y63A 2ZR0A 1FW6A 2PZFA 4WA7A 4UNRA 2MMCA 4YQFA 5GJBA 2QMHA 2GAAA 2B7CA 5KSYA 2OM2A 2NO7A 2WVJA 5FI1B 3HPQA 1QVRA 1LFDB 1E6CA 2DHRA 1S1CA 3WYAA 1AZTA 5IK2A 5C2JB 4MYHA 1DELA 2F9LA 2X8AA 4LJ7A 4L15A 2IYUA 3DPUA 1VYUA 3H0KA 4CW7A 2XZOA 4PC2A 3TJZA 4HB0A 4US1R 3OE7D 4WZ6A 5FBRB 2NMVA 2R65A 1VCMA 4AK9A 1S8FA 2B92A 4TYNA 3ZVNA 221PA 1E2DA 3CR8A 3ICEA 1X8KA 3SHWA 4AWXA 4DC9A 3ZVRA 2XX3A 4LYHA 3SQXA 5FBWB 3PUZA 1U9IC 2GVZC 1GKIA 2IYVA 1NKTA 2QROA 4B3XA 1EWRA 2JJ2A 2YVUA 2GXAA 2Q0HA 3QXJA 1N3BA 2YJTD 2G9NA 2RKOA 4AG6A 1NRJB 4EPYA 1YZNA 4YMTA 5JSZB 2WM9B 3P4YA 3SFVA 3LDAA 4NONA 1WF3A 4BFVA 4IXMA 4ESVA 2KI5A 1IONA 3PFIA 3J81k 2ZRNA 2IHBA 4I1UA 4OJQA 4OQNA 4C4PA 3EG5A 5L3QA 1TU3A 1FUUA 4FXPA 3I73A 1TEVA 4BLTA 4M1TA 4LPKA 2QTVB 3BRWD 1ZD1A 2A7QA 2VP5A 2VSXA 4C0LA 2WWWA 1E94E 4TLAA 5EXXA 3ONWA 1UEJA 5BN3A 2CLSA 2EYUA 2HCJB 1P7CA 3DKPA 3RLFA 1TF5A 4URXR 2QMEA 2DWOA 2ZJZA 1EESA 1E32A 2ZI4A 1W4AA 5AJWA 5EUQB 4B75A 1KSHA 3K0FB 3LO5A 2O5VA 3AKYA 4Q1CA 5LD2B 4ZDIA 3EIQA 1YZKA 3KZ1E 3NKVA 1V5WA 2O8BB 1KMHB 5CJPA 1TMKA 5EZ6B 1Q1EA 2VLIA 2ORWA 1GIAA 3A4MA 4O0MA 5GADl 1AM4D 4NCJA 421PA 4PTLA 5C4MA 4Q4LA 2CEAA 1SULA 4DB4A 2VP0A 3MGCA 3EPLA 2GBLA 1NSFA 1Z0DA 4Z8YA 2IT1A 2ZRFA 3PG5A 4EFLA 2WPDA 3PVSA 4Q47A 5EP1A 1RYFA 2ZVPX 3K09A 2NOAA 4Q7MB 3OAAD 2C95A 1KNQA 5SZHB 1KGDA 2EWWA 1N25A 3LWNA 2FPLA 2QUZA 1FUKA 3KUCA 4IJMA 4NPHA 3SFZA 1GKYA 1COWD 1YZQA 2ONKA 2ZRCA 3C15C 4FMCB 5J47A 1EFHA 1N5LA 4MKGA 3GLGB 3HWSA 3LX5A 1GDDA 1XFAA 3QG5A 4JZKA 1G9XA 2NGRA 3SI7A 4CGZA 1NY5A 3W8NA 1F60A 1QZXA 2IYSA 2GJSA 1IY0A 1YR6A 1JAHA 4QGFA 5JJKA 1G18A 3OZXA 5JJIA 2E1RA 3DO6A 3MWLA 1E2PA 5F9FA 1EFUA 1F48A 1KAGA 2V55B 4M1YA 2JCSA 2CK3A 3AVVA 1E96A 3IO5A 1KK3A 5FPYA 1Z6TA 5B64A 3VAAA 3I5XA 2OESA 3PR1A 4BECA 4A2PA 1RW4A 3CNNA 4RSGA 4JBWA 4HZIA 1G8HA 3RS4A 1UDXA 1N2CE 2IXFA 4DDVA 3CNOA 1YZGA 1T5IA 4RY2A 1E98A 2H5EA 2ZI6A 4M1OA 3CUEF 5CDFA 4V02A 3V9PA 2XZLA 3WNCA 4WW0A 3TR5A 4BUJA 4ERNA 2ZE6A 3K9HA 3P26A 2BEKA 3I72A 3K0FA 2VH5R 1P72A 3GJ6A 4C2UA 4LJAA 1OB5A 2BJVA 3KQHA 2O8BA 1AQYA 1KMHA 4V03A 2FWRA 5FUVA 3SR0A 2WAXA 1II8A 1E2IA 2GJ9A 4BEBA 4QM7A 3NG1A 4RD1A 2X19A 1Z47A 4URYR 1Z83A 4ILEA 2RGBA 1DTSA 1MO5A 3OHMA 5B2ZA 3GJ7A 4BPBA 4U02A 3T1QA 2GCOB 1W5SA 1XRJA 5FTMA 4OQFA 5FOTA 2NPIA 3U61B 4Q9IA 3KQKA 4TMTA 5FL7A 4HAYA 5FI0B 1CLUA 3I8XA 3SYNA 5B58C 2ZPTX 1M7GA 2CE2X 4GPTA 4QM6A 5JFGA 2BM1A 4MUBA 1CRPA 1E1RD 4B73A 1XF9A 4NH0A 2HLDA 2IF2A 3TUZC 3FB4A 4TLBA 4R71A 1GITA 2QRZA 3PENA 3GLGA 1KAOA 5K8LA 4E22A 4QGGA 2DPXA 2Z83A 2OLKA 1N6RA 1U8ZA 3T1VA 1GVNB 1T6NA 3RVBA 1X8LA 5K8IA 2GVDC 3VKGA 4NKRA 1FQKA 4FCTA 3BH6A 4XSHA 4EPWA 3QEOA 4Q9HA 5JWRA 1Z07A 3A58B 1N6LA 1F5NA 1O87A 2BBSA 2WSSA 4CZ2A 4TLDA 4MRVA 2J7PD 1E9AA 1EFTA 4NBSA 2EFEB 1DVRA 1KO4A 1GG2A 2V7QD 3P1JA 1G5RA 2W0MA 3BWDD 3IBYA 3DL0A 2RGAA 4BGDA 3QOFA 1DAFA 1EX7A 3BFXA 1T3LA 1N5IA 3BH0A 2REBA 5DSZA 4US0R 5LB4A 5TARA 4QNRA 1GL6A 1HA3A 4A2QA 3RWMB 4JVNA 4A4DA 1NMZA 4TYPA 3SJZA 2WJYA 3SE0A 1H8ED 3G0HA 4K46A 3ZZ0A 4MYUA 3OEED 1WRBA 3X1XA 4KAXA 2WJJA 3AF4A 2FFHA 1XZPA 4EPRA 4GT1A 1AGPA 2OFOA 3KQNA 2GJ8A 1S9DA 3TUJC 4M4SA 3CPHA 1M7HA 1BKDR 1XD9A 1KZ7B 2QTHA 1FP7A 3D31A 4URUR 3NHBA 3VMFA 2WJIA 4EFMA 3LW8A 2IYLD 3M6AA 3KDSE 4NTZA 4TTPA 1OKKD 2VF8A 1QHIA 2GCOA 3GEIA 1II0A 2C03A 3D6TB 3C16C 4UKDA 4GMXA 2VSOA 3KB1A 4NYJQ 4PZZA 4WXRA 1BO6A 1GRNA 3MLEA 3TRFA 5C1BA 1CP2A 2PBRA 2MSCB 4LX0A 4JLVA 3T12A 3TW8B 4OL0A 5HKKD 2VYFA 4LV6A 4BZPA 1MO6A 3AVYA 3GEEA 4FCVA 4ZCLA 2QE7A 1NLFA 2IW3A 2JASA 4R9UC 3N70A 3U2QA 3LA6A 4KLZA 4JL5A 2Y8EA 2QTFA 4DZZA 1MOZA 1UADA 8OHMA 2B8TA 4KVAA 4US2R 1AS0A 4LJ9A 2CDNA 3FGNA 2ZRMA 3GJXC 2F3TA 2ZRHA 4A15A 3SJBA 2ZR9A 2KSQA 4JLJA 2IS4A 2C8VA 4AURA 2RB4A 3EC2A 2QSZA 2ERXA 2I1QA 5FOVA 5CJ2A 3KB2A 4RD2A 4OBEA 1JB1A 5A4JA 3IILA 1NBMD 3EZ9A 3GPLA 1XCMA 3CPEA 2HJGA 2Q9AA 4PAQA 2NQ2C 1WB9A 4XOIA 1CS4C 5FTJA 3ETLA 2XTNA 1Q22A 4Q01A 1MABB 2RAPA 1J8YF 4I1OA 1NBME 4GP6A 1VCOA 2WWYA 3ZGXA 4K81B 4D4KA 4OKSA 4JIMA 4TSFD 3TW4A 1U0LA 3AEZA 4RKFA 2F3RA 4A9AA 4UNQA 1FPMA 2XB4A 3S1AA 2XOKA 1ZUNB 1G4UR 4JL8A 2IWHA 5KHOC 3A1SA 3CF6R 4CYMA 1UBEA 2G1JA 2BBTA 3R8FA 1KOFA 1E2HA 1E1QD 4A8JC 1UPTA 5JCPA 2ZREA 2DR3A 4YLGA 3LLMA 5CYPA 2ZJYA 4IOMA 1GNRA 5SZIA 4ZI2A 2DWQA 1RC8A 2UZ3A 3KJHA 2QA5A 4BZQA 3GJ3A 5JMTA 5KYKA 1XD2A 2XNSA 2KB0A 1OIWA 3T15A 3B82A 4B43A 2V1UA 4AYXA 4JLPA 5JZVA 1DAKA 2AXPA 2ZS8A 2FA9A 2IUTA 4NCKA 2C77A 3DKVA 4FIDA 2P6RA 4HLUA 4V0ME 2OSBA 2JLVA 2ODWA 3DDCA 4QL3A 3MD0A 1XXHB 1IXRC 3IQXA 3FHTA 1OYWA 2G6BA 1ZCBA 4PQYA 3OIUA 2LCFA 4MDFA 2H8KA 2D74A 2CL0X 4Q5IA 1Z08A 1KYIA 3CX8A 3PITA 1L4UA 5JEEA 2J5XA 3KKOA 1XP8A 4TQ9A 1S3SA 3U3OA 3EC1A 1KI8A 2CNWA 4IFEA 4WOPA 4QKQA 3PEVA 2GEVA 3LD9A 1GTVA 2C99A 2WKPA 1XEFA 1HTWA 4C0QC 2F1JA 4TL7A 3IGFA 3CIOA 2IYYA 3U7HB 2C98A 4A6XA 2JDIA 3BIFA 1ZU5A 1G16A 4HLDA 3X1DA 4HAXA 3AGPA 4PXAA 2NPFA 4DLVA 1MABA 4I99A 1VHLA 1Z6YA 2J45A 4HB3A 1E79D 1YZUA 1D9ZA 2VIIA 4DLXA 1XTKA 4NCIA 2G0TA 4Q66C 3G82C 4BFTA 1KI9A 4DEXA 1ZAKA 2ZSBA 1LW7A 1ZP6A 3EZ2A 1KO5A 4IDQA 4MYCA 1EWQA 3O8DA 4RZUA 1LB1B 3RS2A 1FX0B 4URVR 3V4FA 5FOUA 3PV0A 3JVVA 1I2MA 1KTVA 2AD5A 3BORA 4LBZA 3RC8A 2ZI9A 5DO9A 1Q57A 2IC5A 2CVHA 1W4BA 1S9HA 2IEZA 1A1VA 3GLIE 3IPYA 3E70C 4Q9JA 1BH2A 4C3ZA 1OIXA 4Z1MA 4C9BA 3L0SA 5FTLA 5L8VA 2O8EB 4KFUA 5J4KA 1SVWA 2Q3MA 2QAJA 3KX2A 5G3ZA 2OCYC 3DZ8A 1LY1A 3W90A 3FKSA 5EP3A 1OFHA 2GZDA 3AF2A 1CEEA 4ASUA 4ABYA 1G1MA 4B44A 4AI6A 4TN1A 1XXHA 2BMJA 4DSTA 1ZNXA 1VECA 3RRZA 3LH5A 4LHXA 2VHCA 5FTNA 2HT6A 3CRVA 2AFIE 4B76A 1E4VA 1E9FA 2P6NA 2GF9A 1G3QA 2WJHA 2QEQA 3CX6A 2PX0A 1HURA 6Q21A 2GXQA 3RSOA 3IIJA 2XSZD 1IY1A 4V0LA 1PLJA 1M8PA 3ADDA 3TSZA 4D26A 3NH6A 2VHUA 2D2FA 2IA5A 2EQBA 3P27A 3B1ZA 4P4SB 1T3HA 4HUQB 4Z8XA 3RRNA 2F6RA 4QHSA 5DN6D 4B2IA 1V43A 3CZPA 4HLCA 4BZXA 4G1UC 5FFMA 4BE7B 4TMKA 3AVPA 3KL4A 4TT3A 2QI9C 5IK2D 2J7KA 3I4LA 3ND9A 4B6FA 4DHEA 2RGDA 1E9CA 1ESNA 2BBWA 2YWGA 2OHFA 4NL4H 1F2TB 4LK2A 2CJWB 2VP6A 3Q5DA 3U3RA 4HDOB 3LX8A 2NO0A 1W36B 1B0UA 1WBBA 1WXQA 5AJZA 1PUIA 2WICA 4XWOA 5ELXA 1KDOA 2JLWA 1OLOA 4B2LA 1XPUA 5JS8A 3B6EA 1FNNA 2OFWA 4S35A 1I4LD 1FX0A 4ZCIA 3SJAA 1Z22A 5JWOA 2D7DA 4Y0AA 2WSMA 2J87A 3EPHA 1SVLA 2JJ2D 5EE5B 2FSHA 2OBNA 2PL3A 4R2IA 2J0UB 5BYJA 3EPKA 1WE2A 2PZGA 2ZTSA 1VG1A 4WAUA 5E7IA 4BLPA 4EPVA 2RH5A 2ZJ2A 2O8EA 1XTSA 1SZPA 2FPKA 2HXYA 3OEHA 2EU8A 2FE4A 1SKYE 3K9GA 4Q4HB 5FBVB 1E0KA 1RIFA 3EARA 3FVQA 2VL7A 4D0LB 2FH5B 3QY0A 1KJZA 1Q1ZA 1QDEA 1BIFA 2N42A 3VR3A 5EXPA 2AKAB 2OXCA 1E2JA 3FTQA 3PUXA 3QF4B 3AKEA 1Z2AA 4GOJA 3Q8XB 1U94A 4ZO4A 3CH4B 5KDLA 3B85A 4KVGA 4L9WA 4AKGA 5M04A 3LRPA 3O47A 1T8TA 3WMFA 2PJRA 3UG7A 4AKHA 4FMBB 4EKDA 2ZRLA 1QG4A 2XXAB 3GFOA 4KSCA 4BFUA 1U0JA 2XEXA 4P4SA 4HUQA 4LHVA 4A0GA 1U2RA 3A8TA 3I32A 3K53A 3RRYA 621PA 4GFDA 2IS1A 2KBEA 4Q03A 3QVUA 3K1JA 2ZE7A 1F2TA 3SEAA 3ASZA 2CJWA 4IDHA 3QKSB 2IYRA 1R5BA 3Q5EA 2GDJA 2PZEA 2WPDD 1S4QA 2JAQA 2RHMA 3SNHA 4CVNA 1OXSC 5AUQA 2J1LA 3SC3A 1UJ2A 2W6ID 3BC1A 4DDWA 1OXUA 4JYBA 5HR5A 2V9PA 1W1WA 1CR2A 1M1YE 4EPTA 3T06B 4CEIB 1R0XA 4QBGB 4QNMA 4KSBA 1E9RA 5F98A 2V3CC 2WTUA 1T3SA 5J40A 5KNCA 4FI3C 2RGGA 4BFXA 5IT5A 2J0UA 4MRRA 4NU0A 4P4UA 4WXPA 1UM8A 2NZJA 4H1VA 2ZEJA 3C8UA 4Q4AB 5GJCA 3CLVA 3LQQA 3WYFA 4Q4HA 3SU8A 4A0RA 3SQWA 1JXMA 4PHFA 2RGNA 4YC7A 1NG1A 3R20A 1DPFA 5FUXA 1YJ5A 1G5PA 1HE1C 5IHPA 4QG7A 3K9LA 3MWKA 1N6IA 3NVAA 4NYJR 4KV9A 4A0FA 4CT4B 4GOXA 2PH1A 1ZNWA 1NMYA 2GA8A 2VTKA 1GM5A 1MRSA 1MT0A 1H65A 4HSEA 4LZZA 1YHNA 1N6HA 1VYVA 3RC3A 3BE4A 2A5DA 3AKCA 2XXAA 5ANRB 3TQFA 2VHQA 5CDFE 4UNSA 2FF7A 3BBPA 2ODBA 4QFMA 4Q19A 2MSDB 5C18A 4RD3A 4AYTA 5BN4A 2Z0MA 3EZFA 4IEIA 3OIWA 2YINC 2R6AA 2BKEA 2ZE8A 1YR9A 4DIEA 1YVDA 1NIJA 2IS6A 2ZYUX 3QKSA 4NYIQ 1ZVQA 4C0HA 4C0KA 4PQRA 1AGRA 1CJMA 5FL7D 3VR5A 2IK8A 2GCPA 1P9RA 2ZRAA 4PPGA 4TLCA 1A4RA 1E2QA 4CEIA 1F3OA 4LBWA 2DCUA 2Z5FA 2EFDB 4KI0A 2RHDA 3Q7PA 3SDZA 4L16A 1X86B 3L43A 3UANA 4EJSA 4JLNA 3D3QA 1XJQA 1C4OA 4KO8A 2OG2A 4FMDB 3WRXC 5LB2A 2P0EA 1XTIA 3LW7A 3RANA 2ZQ5A 3W6NA 1WBDA 1SGWA 2RGXA 1ESMA 2ZSEA 3QG1A 2FSGA 2OCBA 4Q4AA 1N6NA 4DSUA 4DUGA 3U4QB 5FPSA 3GLGE 4P0TA 4BQSA 4TMZA 5TB5A 4LC0A 2WSSD 2XTZA 2H1LA 1U8YA 1JPJA 5AJXA 3WMGA 1GUAA 3LNCA 1H8HD 4M22A 1ZBDA 4ITRC 2PT5A 3QE0A 3IUYA 1OXXK 2XB2A 2AK3A 3PQCA 3EX7C 1R0ZA 3AP3A 3GJ8A 4OK3A 1ODFA 4HI0E 1DO0A 1JJ7A 1ZM4A 3NEJA 5CIQA 1YZTA 4KJZA 4LGMA 5AUOB 1E9BA 5D3QA 3QSYA 2JATA 1R10A 4MGZR 4GOKA 3ZIAA 2YNMA 3T61A 4DCSA 2FDCA 1W7AA 4Q7LA 1MV5A 2VEDA 1FTSA 1NVVQ 3R9XA 2WWGA 3U3KA 1R5OA 1KO7A 1KNXA 1JPNA 4HAZA 1II8B 1MO3A 2V4ZA 2OO7A 2ZRGA 4KU4A 2VHJA 2C5LA 3AM1A 2TMKA 2KWIA 2Q9BA 3LQRA 4D4LA 2BOVA 1D2MA 2QT0A 4OQLA 4Q48A 4EPXA 3T5GA 1S3GA 1A2KC 4DCVA 3DMNA 2R6CA 1R7RA 5JS7A 4EAQA 3W9YA 4DRZA 2HF8A 2CHVA 2VQSA 2BHRA 1EX6A 1OFTA 1OXTA 2ZYTX 3K0CA 5FPHA 1HQYE 4AG5A 1HT1E 3T1OA 2QE7D 2FSFA 3R8CA 1OXVA 1G3MA 5F2EA 3QBVA 4TL6A 4Q1BA 4RFSB 1TUEA 2C2HA 4BFZA 1WCV1 1MO4A 3DOEA 3AVXA 2AL7A 4BFWA 3RAPR 3P4XA 4B34A 3U4QA 4B3GA 3X1YA 1TAGA 1UBCA 2QM8A 1D5CA 1SVIA 2LKCA 5A0FA 5CB6A 1T0HB 4LJ4A 3AP1A 3D7MA 5TY0A 2GRJA 2R6GA 4JVLA 3TUIC 1U90A 5AJYA 3W5JA 5E7JA 2QBYA 3RNLA 2IS2A 3H86A 3SYKA 3Q85A 1OB2A 2F1RA 721PA 1E9SA 3T35A 3TSOA 3MJRA 1E2GA 3OESA 3DM9B 3RS3A 3F0TA 2GF0A 1Q3TA 3THOA 1IJEA 3U6KA 3L0PA 2OZEA 4Q18A 1UFQA 5EE0A 3X1ZA 3K9NA 2BMDA 1E9DA 1G21E 3EWSA 4X8LA 2QQ0A 3Q3JB 3SN6A 5E3HA 1KI1A 2IHYA 3CF0A 3CWZA 4HB4A 1U9IA 2K5UA 4TQAA 5KU1A 4F4IA 1SQ5A 2H57A 1GFIA 3VX4A 1BOFA 2AFHE 3AQ4A 1ZRHA 2G77B 3BXZA 3R7WB 2W6JA 4LI0A 2SHKA 2HT1A 2D3WA 5KOYA 4HZUB 1MR3F 2YWHA 2GETA 2O52A 1GSIA 4JLBA 3BAFA 4ACAA 4ZPXA 1JEEA 3B1VA 4D80A 2E87A 1RRPA 1VG0B 3VR4A 1KKLA 5AWFC 2WWFA 3BH7A 1OF1A 2OAP1 1IQPA 2ZUCA 4KFTA 5TDHA 3SJCA 1XJCA 4XWKA 5CIWA 1CTQA 4GI7A 2BKUA 4PQFA 3Q72A 2ZRDA 5EJEA 3LVRE 2ZXUA 1JALA 2H17A 4TYWA 1Q44A 1VTKA 1P2SA 4RFSA 5DE3A 3ZVMA 1FFHA 1M74A 5E4FA 5TV2A 1XMVA 1T4GA 1XTRA 2KJQA 4IKEA 4KYUA 4D0GA 4JSYA 1W0KA 4B3DA 4GSYA 4M1WA 3THXB 3TVDA 2GHIA 4RZXA 4CRWB 5HZKA 1L2TA 4LV5B 3GFTA 2CNWD 4ZDJA 3VNVA 1D8TA 2F7SA 4C0JA 4UXJA 5EXSA 3NXSA 3LVQE 2J0SA 5EZ5A 3AB3A 1JI0A 3HU3A 1Z3IX 1UKYA 4M1KA 1ZMXA 1CJVC 4JT2A 2CCJA 1GAJA 1QVAA 3OIVA 4FN5A 3VHXA 5C46F 3IIMA 1U99A 4JKIA 3UK6A 1DAIA 4PC3A 1W2GA 4XH9B 4BLOA 4R7ZA 4JMPA 2FZ4A 4JL6A 4OK6A 4YMWA 3Q9LA 2PCJA 4OQXA 521PA 4OJKA 821PA 3NHAA 1HE8B 5JLJA 3S1AB 3VKHA 1NVXQ 3QPVA 1X3SA 2H7VA 3M4YA 3ADBA 4OHYA 3R7WA 1OE0A 1DE0A 1P9WA 2OFXA 2RMKA 2WWXA 3C7KA 3O8BA 1WQ1R 1N6OA 4FMDF 4KFRA 4LBYA 4P3YA 3WP1B 4BASA 5JRZA 1NP6A 2LKDA 2XITA 1Q1QA 1AQUA 3FFAA 4HZUA 2FMXA 2XTMA 4QGAA 2X2FA 2AHOA 4P33A 4TMXA 4Z1MD 5DIFA 4FINA 2WWHA 1I4DD 2QPTA 4DSOA 1PUJA 5H70A 1G4AE 1XD2B 4B32A 5HE8A 5KNDA 3BB4A 1OIVA 4ON9A 3U7EB 1MRNA 4YDSA 3FKSD 1F6BA 1G41A 1W49A 2OCPA 4D4MA 4YMVA 1TADA 1IM2A 1F2UB 4PO1A 2I3BA 4YDHB 2C78A 3UMSA 1LNZA 4G0NA 2CHGA 3I61A 3U44A 1P3JA 2HEIA 2KBFA 1N5JA 1W0JA 3K0AB 2FG5A 3RWOA 2F1HA 2W2TA 3B78A 3NDPA 3DOFA 3AUYA 4JLDA 2DBYA 1X8JA 4OK5A 4IW3B 4KBGA 1ETUA 2AK2A 1TEXA 2DFTA 2IUUA 1ZM2A 2PT7A 3FPAA 4UXHA 3THXA 1Y3AA 3UWKA 5FOWA 2O0JA 1JQJC 4I1VA 3AVTA 2XZPA 1KDTA 4XTCS 4OHZA 4ARZB 3ZS9A 5BW8A 1G7TA 1UBGA 2GTPA 5IF9A 1E0JA 1L8QA 1B23P 1CJUC 4Q4JB 1K8RA 4XJXA 3ZZUA 1AS3A 4JBXA 1G3UA 1ONBA 4CDGA 4LHWA 1ZIPA 3F3YA 2XGJA 3MCAA 4YXWA 4JVMA 1UBFA 1YR8A 2REOA 3H4MA 1Z6XA 1T5LA 5IRCD 4A1FA 3RS0A 3B9PA 1J90A 3MWYW 1MKYA 4LUCA 3LXRA 3IKJA 1M34E 4DB2A 3CB4A 2ATVA 4RZ3A 2NZ8A 4HLQB 2FN4A 4ACBA 3CNLA 4FMCF 4JJKA 3QF7A 3KQLA 1IXZA 4IVPA 1HY3A 3IIKA 3PUWA 4AD8A 4P32A 3SS8A 5FH9A 2P5SA 2YOFA 4B3FX 3OEHD 1NVUQ 1GZSA 2GKSA 4RKEA 4Z54A 2O8FB 1XCGB 5HPYB 4IVRA 1JJVA 3LY5A 4KCGA 3TLXA 2W58A 1BMFA 2ZJBA 3ZQJA 3ADCA 2QT1A 1F2UA 4PHTA 2IL1A 5FR1A 5UKDA 3EZ7A 2ZAMA 3K0AA 3AH8A 4LY6A 4NYIR 4TMWA 2J41A 4DLUA 4LJ6A 1WMSA 2CHQA 3IHWA 3AVOA 3I1FA 5GVRA 2D2EA 2DWPA 2Q3FA 1P62B 4F91B 1KO1A 1G6HA 2BCGY 5LPNA 4M2LA 3D8BA 1RPZA 4Z51A 2OBLA 3REFA 1GKUB 1KI3A 2BDTA 1EXMA 2MSEB 2ORVA 4JLMA 3SBDA 4A8JB 1N6PA 4IRUB 3NWJA 1DAMA 1GNPA 3I62A 2GZHA 2N1BA 4FW9A 3LAWA 4IEEA 3VFDA 1YU9A 1Z06A 4ARZA 4D82A 2ZU0C 2ZRKA 4MGKR 4X8OA 1JEDA 2J3EA 3WBJA 1OHHD 1QHNA 1X6VA 4Q4JA 1Z29A 5CYOA 4R98A 1XEWY 1KJWA 3B1YA 1MH1A 3EAQA 2JJ8A 4N3NA 4PPQA 2W2VA 3NC1C 2EVWX 5DNYB 2GCNA 2BCJQ 5P21A 1W36D 5HE9A 2OV2A 3K70D 5FL3A 3MAAC 5JHHB 2PX3A 1LTQA 1W4CA 1XMIA 5K8UA 2V1XA 2JIZA 3C4JA 3N2EA 4NYMQ 5H8WA 1I4TD 2J46A 3W8RA 2OAQ1 3FMPB 3BB1A 3KJGA 3BERA 3EZ6A 4PR0A 2OCAA 2ZJ8A 4KXFB 2WIAA 4UJ3A 1FL9A 1E0AA 1W47A 3K0SA 2UVQA 5JJLA 1P4SA 2QU8A 1C9KA 1X1RA 1NVVR 4QOSA 3TAUA 1RRGA 3RHFA 3TK1A 3IEVA 2O8FA 1GNQA 1IBRA 1U98A 3L8ZA 4JVSB 2O8DB 3L2OB 3OFND 3UKDA 2DB3A 1VG9B 2ZIAA 5J5CA 2AN9A 1W4RA 4LSGA 5DI9A 2ZS9A 2B21A 3NC0C 4K8OA 1KIMA 3NBZC 1R2QA 5FBQB 3LXXA 3W5IA 4F4JA 1VCNA 4BFYA 5DI3A 2QL6A 3MMPA 4XSGA 1SVKA 5B57C 3QI2A 3AGQA 4LBVA 4JBYA 3AUXA 1SHKA 2QSYA 3KXIA 4AKEA 4TYYA 4A8JA 3CW2A 1J7KA 4M9XA 1J2JA 1ZNZA 2JLSA 4Q00A 3BFVA 4CF7A 2ZE5A 2YWFA 1G3IA 4N0DA 2OLJA 3GMTA 4XVQA 2O8CA 1KKMA 4PZYA 4IFBA 3VX3A 2W00A 4D0NA 2VA8A 3K70C 2BMEA 4JSTA 4RD4A 3TAHA 3L8YA 1TU4A 1TTTA 1CXZA 5L3VA 4YMSA 3UIEA 1WA5A 1HT2E 2A78A 1XZQA 4V0NA 1EK0A 3QNUA 5CLLA 3PXGA 4CEJB 4Q9LA 2ZRBA 2DFNA 1OYYA 3GLFB 4RFVA 3RS7A 1SKQA 1A82A 1T91A 2ZUDA 5BQ5A 4NZYA 2HV8A 3FWYA 1TNDA 4AIIA 2W0SA 3MSXA 4D6PA 1Q1BA 1M2OB 5SZJA 2GJAA 3FFBA 4LYJA 3OIYA 2J0QA 4BWYA 4JLOA 4GRAA 5L3RA 5JI3E 4QHTA 1UKZA 3KKNA 2FGJA 5CM8B 4W5JA 2R44A 2ERYA 4DUGD 5G40A 2DY1A 2H18A 2ZI7A 3KFXA 1KDPA 4TSFA 1OPXA 1Z0JA 2BM0A 2FFAA 2ONJA 2O8DA 2F9MA 1II9A 2QP9X 2X77A 2GK7A 5AUNB 1KY3A 2BVNA 1D9XA 4S2EA 2JA1A 1M6NA 2CLCX 1XEXB 2QRNA 4OI2A 5BN5A 3W6OA 1N0WA 3BD9A 2JJ1A 4HAUA 2AR7A 3R9WA 1FNMA 4B2PA 4L9SA 4V0OA 3ADKA 3KKQA 2QAGB 4A2WA 3RDPA 3E5HA 1CKEA 3EIEA 1FQJA 3O8RA 1OFIA 1YQTA 4R2HA 3EXAA 4QGHA 3ZIAD 4EFNA 3MFYA 3GFPA 4V0MA 4BLRA 3RRMA 1Z5ZA 1PLKA 2JLZA 2WWIA 3GJ5A 3W34A 2DYKA 5JI2E 2FU5C 1BYUA 2QZ4A 1VIAA 4TQUS 4B71A 1G5TA 2XJ4A 3N5CA 1Z0AA 4O25A 3IO3A 1VCIA 1ZYUA 1NIPA 4GZLA 5JCZA 4QBFA 3CH5A 121PA 1K6MA 2QPAA 3FYHA 1R0YA 3SBEA 4B47A 4UJ5A 1P2VA 4L5BA 4CEJA 1AA9A 4RJLA 1TPZA 4M9ZA 2EFHB 4HB2A 4YONB 2XNDA 3BK7A 2PCLA 3NEYA 3TKLA 3GLFA 2IYTA 4BFSA 3MWJA 4LV8B 3TR0A 3FMFA 4A92A 5CK5A 4TTQA 1G6OA 1NLYA 5AUPB 1Z0FA 5EE1A 3UG6A 4LWZA 5FPTA 4CEHB 1GWNA 5EUMA 2G83A 1HYQA 5FUYA 3AF3A 1ZUHA 3TQCA 4MGYR 2P6UA 4EJSB 1ZM3A 1L7VC 4QJ4A 2Q3HA 3SZRA 1AKYA 2QP4A 3VU9B 3AVQA 1ZIOA 4XVRA 4M53A 2QY9A 3K0EA 2ANBA 4MYTA 5DHAA 2QN6A 2ZITA 3B1XA 1KI2A 4Q1EA 4U7DA 1NJGA 3QKUA 4MA4A 3KJIA 2A3RA 1DG1G 2CK3D 5EE3A 4AKIA 3TVTA 3CX7A 2D62A 1U0HC 4OHVA 2ZJ5A 1RJ9B 1XEXA 3CBQA 3GLIA 3FOZA 2ASEA 5GVSA 2V6IA 4PC1A 4C2TA 2ZRIA 1NVWQ 2JLYA 5AJVB 1D2NA 2A5FA 3HJNA 4NP6A 3CKLA 2Z6VA 4M21A 2ZVQX 2QAGA 3TH5A 5KTYA 4WBSA 1XTJA 2QNRA 3QUSA 3KQUA 2QGZA 1JR3A 3ZVLA
chains in the Genus database with same CATH superfamily
3VYWA 4DGQA 1GDHA 5C1OA 5KYNA 1A5AB 3OPNA 2P2ZA 2BT4A 2YMMA 2IXBA 1U7OA 2XADA 5BUCA 1P91A 1PV2A 2CF5A 1NJ2A 1NX6A 1Y4SA 2XEDA 2WU4A 3DTYA 4UHHA 3R7AA 1A7JA 2ZUFA 3MJEA 3N8GA 1IUOA 3KKLA 4KQFA 5EIEA 5CK4A 1U63A 3H6HA 5KO2A 3SAJA 1S2NA 1FNDA 5FXMA 1PT6A 2OWDA 3DZDA 4RESA 2B8WA 4L7VA 4M7OA 1Q15A 2EDAA 2PLRA 1IZ8A 2V58A 1JA9A 2XAUA 2E85A 1CC1S 3V7WA 3CS3A 1D6JA 2NO6A 2XODA 2CCKA 5HA5A 1TZKA 2P2DA 3ZQ6A 3HR8A 2C5FA 4R8VA 3FMIA 5D7BA 5AMXA 2OCIA 3MGBA 3N9IA 5TT0A 3FOEC 3U7FB 3L6EA 1CJBA 2C54A 2LXNA 3CW9A 2RJ3A 4HXFB 3GLHB 4IDNA 4ZYZA 2ZM5A 2JCGA 5J4YA 1YI8A 2RGEA 1PWXA 1NC1A 2DC1A 4HDRA 4MB2A 3TIIA 5AYVA 3H5WA 4A0HA 5A4MS 4FQ5A 3AWIA 1I6KA 3A4LA 1CU1A 4D6XA 2HF2A 1Z33A 4TTVA 2XE4A 2IHUA 4PPNA 1E3DA 2F43A 3QVVA 3H11A 4I50B 4C04A 3VSDA 1QDLB 2ORIA 2OZVA 3PFCA 4BWFB 1C2TA 5L40A 4K0RA 4N7JA 5ITSA 1O5IA 3ONNA 1YBHA 1W0KD 4Y9TA 1LVHA 3ZHOA 2WWTA 4NDAA 3M4JA 3C6YA 4OGLA 3ZHTA 1VMAA 5CM2Z 1PJBA 3RS3A 1RBZA 2XMRA 3SS7X 3GQBA 2PFSA 3BCUA 1RJ9A 4M0LA 3D64A 3DR3A 5EP4A 4URXR 2FJPA 1ZOLA 2HSGA 1F6WA 3UHAA 1U0FA 4EHBA 2EWVA 5LD2C 2ZDHA 3NANA 4JD5A 1JSZA 1ZM7A 3QVTA 3L1VA 3RVLA 1IN8A 4CPDA 4HQNA 1IG3A 1E7QA 4N18A 4F56A 4WKCA 2Q49A 4HH4A 3KUUA 1EK5A 2ECQA 3BZUA 3OY7A 3BS4A 4G5HA 3QXSA 4GP7A 4LQDA 3EF0A 3DSRA 3PUVA 2OE2A 3GDWA 1GN9A 2VHEA 2I4RA 3HM2A 1K7SN 3G2IA 4J1TA 3WHIA 2AZMA 3NUZA 4QXAA 2G67A 2G7ZA 1G6KA 3FDFA 3NETA 3OKAA 1ZMOA 4OXXA 5KJ6A 1ZKMA 3NZEA 4GWGA 4YYZA 1VHQA 3FMVA 1NNLA 1PUXA 1V1MB 1Y98A 2PWPA 3C6BA 4L5AA 2JBAB 5HF8A 5HKAA 5ALOA 1K4MA 4JGGA 1NPTO 1IHDA 5JC8A 3F8TA 5FBHA 4W9NA 3DDZX 4C43A 1HDXA 4Y6LA 3CFYA 5J4LA 3WRYC 4EG3A 3EGXB 5G2OA 3O38A 1EVKA 2R1ZA 1MC4A 2X8WA 6REQA 1N7GA 1RI1A 2XQKA 3HDTA 1T2EA 4TVOA 1ETHA 3A27A 4ZT6A 4ZEXA 4IOJA 5AVUA 3C0KA 4OXRA 1TF7A 5DFAA 3HH8A 1UBRS 2DT5A 2ZS7A 3W5BA 1X1CA 3PR3A 4IRXA 2QVYX 3NIBA 5IC4A 5IJ0A 3EA4A 5IXSA 2XAAA 5H82A 1KZGB 2CCGA 4DLWA 4EDHA 3ROFA 3FCUB 3KWFA 1XJ0A 1ISHA 3I9MA 5KVQA 4DV5B 1W34A 2JFBA 4HWSA 5AOVA 5IYZF 3MOGA 4TZ0A 1A95A 1CF2O 3MQFA 4JR1A 4AUEA 1MQSA 1ENZA 1W0JD 4MR7B 5FRDA 4KAFA 1B43A 2DXIA 2FNAA 1D2EA 2XWJI 4E5NA 2FZLA 3OZTA 3OEYA 3UXYA 5G0WA 5IHPA 1YASA 5CCEA 1NVMB 3AVWA 4W63A 4EHNA 1N0VC 2XCQA 4KODA 1RPZA 2QUAA 2YWDA 1S8OA 4O3MA 1SQSA 3FVRA 2HMWA 1DQYA 3DXXA 2PTHA 3NBUA 3OF5A 4P80A 1T36A 3PCXA 1NFRA 4RCZA 3IT1A 3TIGA 1X2EA 1DS6A 4WCFA 4JQCA 3AKDA 2XVMA 1RWOA 1XMJA 1ZM9A 2GNOA 5AOBA 5GMOA 3PTAA 2YFHA 4O4LF 4WNAA 3B7PA 4GNKA 4LG1A 5LQKA 5H68A 4C0SA 1TZ2A 1G7RA 2VRNA 3E23A 4JBIA 1ST2A 1PK9A 4WY2A 3A9WA 3TINA 4D8WA 3T1TA 3KHKA 4IXDA 3N2IA 1HEIA 1NFFA 3VHXB 2BFPA 1Q0HA 4MRAA 5JROA 1FP6A 2AD1A 4JKYA 1TO6A 1XZKA 3AFGA 4BRWA 5GGYA 1R9MA 3D6NB 3LKDA 4QWMA 3K9WA 4A3SA 3T3OA 4E08A 4XDHA 5FADA 1H2EA 2PZ8A 5LXTA 3OEWA 5BNFA 3SVLA 1M6WA 1U8FO 3VQTA 9GPBA 4N76A 3HR7A 1OFUX 5E6RB 3HGTA 2O0HA 4TUYB 5KJEA 2I2WA 4BVAA 2G25A 1QHGA 2XF2A 4LJRA 3KHTA 1LF0A 5BQPA 1SY7A 4F4UA 3GH3A 2EHJA 4HH3C 4R9SA 1YL6A 3FE2A 4MUHA 3PYXA 2PXXA 2FPUA 1ZO8A 2WQZA 1DQRA 4UZSA 3T99A 4C6RA 2PQ2A 3NPMA 1LRKA 4RZ2A 2E5FA 3EMKA 2EJWA 5K51A 4B33A 4CIDA 5HOEA 1X87A 3W3AA 4ZCMA 3CR7A 4I55A 4LRSB 1FFAA 1CUJA 3KOUA 1F5SA 3PDIB 2ZJ3A 2HL6A 3F46A 1LU9A 3HDVA 2ZUEA 2HXSA 3GWGA 3RIXA 5KNBA 2X76A 4DUZB 2ZR7A 1HOXA 3C5WP 1KZHA 1DBRA 1WXXA 1JG3A 3MCTA 1BN7A 3TSWA 3ZGYA 1CBUA 3GVCA 3EIXA 1ZU4A 4ZI3A 3V8BA 1NXVA 5AHWA 1UPBA 3U4IA 5AVVA 4HBZA 3JU3A 4IIHA 5E8RA 2PLFA 1OMOA 3G5UA 3NHPA 5GONF 2VOEA 3ZEIA 1GG8A 1JZQA 2C8LA 3B6IA 1Q14A 3CCBA 3OPYA 1YWGO 5DP2A 5DXJA 3U7IA 3DGFC 5F2NA 1S89A 4URWR 4X8MA 4EO9A 1SUCA 3LQYA 3GBSA 2FPRA 2YXDA 1SK9A 3MJHA 2BGNA 3LUBA 10MHA 1S7GA 5J2UB 2F67A 2VAVA 2CWWA 4N7BA 4F5EA 2J85A 3LP5A 3OTQA 5J2TF 1C4KA 3I39X 4JGIA 3V00A 5CW2A 1X92A 3ND6A 4MV1A 4Q7QA 1R0KA 3GCGA 4M0EA 4D43A 5JEDA 3HFGA 4FDVA 1GU0A 1TI7A 3QWHA 1X74A 4B3CA 1TMGE 2HUPA 4JJGA 3ZVLA 4CKWA 1I7QB 3WAGA 2YV2A 1HLPA 1WBJB 1SHTX 3HXLA 5JMPA 1QF9A 1FVXA 1T1EA 3AEKB 4L4YA 3T9AA 2HH9A 5KPDA 1JECA 5KAMA 1SVOA 1JYFA 4M9UA 1SCDA 5E7QA 4TLEA 3KELA 5LMCA 2R48A 2IBMA 3H5LA 1G0NA 3FHCB 4PE5B 2YYAA 1IM8A 5JPCA 1C0LA 3R3HA 2VWHA 4F9GA 1BSVA 1FVOA 1LGYA 4ZU1X 3QXCA 4ZAZA 1FJGB 5JECA 3O4HA 2GEDA 3FI9A 3C8HA 3LWBA 3JD2A 3DONA 3RUAA 2YWEA 1OR8A 3CZQA 3NHZA 4R9NA 1MC5A 2BGWA 3MS4A 3KAJA 2FOIA 4FFBA 4IWXA 3O4RA 5EMJA 4GLFA 4DJDC 4IDBA 2ZK7A 3ECCA 4AJLA 1USWA 4HAOA 3CM0A 3BRWA 3D6JA 1MFPA 5DHFA 3ZWVA 3CLSC 4OG2A 5JO0A 1MOPA 1JDZA 5EMLA 4X91A 4PIPA 4HLUC 4TYQA 5BW6B 3UK7A 2ZYSA 1KZ1A 2X5JO 4MROA 5IF3A 2ZDGA 4JOQA 5EA2A 5FYQA 3GOHA 3KQWA 4C1BA 2FW6A 1L3IA 4H0CA 2O1SA 3IJEB 3PKIA 4YGYA 2G88A 4XWAA 3OF3A 3KV3O 1XQ6A 3OCXA 4MLZA 4PPFA 5KPJA 1ST3A 1JTEA 4N0EA 2NO9A 3BOSA 3PT5A 1TT5B 4L5CA 1KY4A 2HNAA 1EAMA 2O7QA 1V95A 2YC2C 3FH0A 3GEBA 3CNHA 4DCTA 3CU5A 4DLPA 4YP7A 4G9EA 5F5XA 1Q7CA 1SZJG 4P2BA 3TLYA 3OA0A 3L1UA 1XNJA 4BO2A 4G26A 2UZIR 2EFJA 2HJHA 5K2OA 4I9GA 1E3LA 1EXWA 3IAS6 4YECA 3ZY3A 1IOWA 3UJ7A 4UOQA 3UKJA 5IUNC 2BRUC 1Q0SA 3P2KA 4HAVA 4QQKA 1VE6A 1SU4A 2D5BA 3OOJA 4N47A 5EXDA 4B6OA 4ZK2A 2WILA 2P1ZA 3VC3A 3IE2A 1YJAA 4GWKA 5TRTA 1CS0B 3EXHA 2VJBA 3RE1A 5G41A 1COWA 3I2YX 5AI4A 4GPZA 5EZSA 1KK1A 4POOA 1JLLB 2NW6A 5IAJA 3QOYA 4ZK6A 1EB8A 5AVKA 2J67A 1R0WA 1YOVA 1NW5A 2UZ0A 5AW6A 1NQVA 4V0KA 3AXTA 1KAMA 2Q50A 1IAQA 4BMNA 1NHGA 2V59A 1T0PA 2VNKA 2FQ1A 2R1VA 2DECA 4MKFA 4ZIRA 4C0AC 5B36A 3TECE 3I58A 1N8NA 3IJ5A 4QBTA 4EG1A 4LCBA 3EEYA 1FS5A 1FOEB 4E09A 1G55A 2VCEA 1CIPA 2FZWA 3AV0B 1P39A 1TQ2A 2XMDA 4IGFA 1DHTA 1OH8A 1C7FA 4JYCA 3ZW9A 1DKOA 3DL2A 4KUGA 4ZVSA 2WF7A 2BSQA 3BL5A 4FZVA 4QRHA 3FYUC 1Q0TA 3G0GA 1XELA 4RXTA 1QZZA 4ALNA 1NXSA 1ZGHA 3ORQA 3AIIA 4G1VA 4LTMA 5IKOA 1QF6A 4FC6A 2EV9A 1CR6A 1ECGA 1Q91A 3PRYA 3Q1LA 1AN0A 1HSZA 4ZOLB 3UAGA 1OT3A 4MJXA 2ASVA 3PFFA 1F14A 4CETA 3QHQA 1RP7A 1D4ZA 1T9DA 3JYOA 1QRDA 1Y5IA 3MBKA 4N3CA 1X7WB 1Z7GA 4YP5A 4MVYA 4NOJA 3DM5A 4KR2A 4DDKA 1RM4A 5BWNA 3II6X 4DARA 4DCMA 3N2LA 2BFAA 1T9GR 3QTBA 2ZBGA 4LPSA 5KYWB 1MB4A 4B4UA 2UKDA 4DMCA 4W7HA 4TL8A 1JKIA 4GBJA 3JZFA 3OP1A 5EJ6A 1UOPA 4B3HA 3UJCA 2QL9A 1VRCA 4EGAA 4KQMA 3R24A 1RRCA 4ZVNA 1SR8A 2C4KA 3P9XA 2VYVA 4HN4B 4C4XA 5HIIA 3GNQA 2XW6A 5DOVA 4EHLA 4CV1A 1VL5A 1QH9A 1SUWA 1Z8HA 3TLJA 3KUDA 5F73A 1G3RA 4UNPA 2XUGA 1YE3A 4ALJA 1BHQ1 1WF6A 3IUNA 4H1HA 4YA6A 1P2UA 4DCNA 5J9FA 3SC6A 3MWEA 2AGVA 1IY2A 1YV9A 1GZ5A 3COSA 3CPSA 4FR0A 3HV2A 3TRHA 1XX6A 4F1WA 5MDHA 5AKLA 2VAPA 2QRUA 3DQQA 2P2SA 3LBHA 1EXVA 2EATA 4J0QA 4DR7B 3G9XA 4JJZA 1JA1A 4G4IA 3U0VA 4ZP1A 1XA4A 4DMRA 3EASA 4IOLA 2JLXA 2J3MA 3K2EA 3OCWA 1G8YA 4OREX 4EUFA 1L5YA 4KHZA 1E2EA 1JWBB 2DHCA 2VT2A 2XJ9A 4FS8A 1W2HA 4BHTA 1R6AA 2O2IA 5EHZA 1SIOA 4ARVA 5E2IA 1FZQA 2Y76A 4R3UC 3TTYA 1KI6B 4DBLC 5FPKA 3PIRA 4OAQA 2F8LA 2N1MA 2W6QA 2VHZA 3LUHA 2J7PA 1KHTA 2ZJAA 4GI5A 3R9KA 4ZZ0A 4KE8A 2VJCA 4WI1A 1VL1A 4XYBA 1HFJA 3QA3E 2JI7A 2O1EA 2Q9CA 1M8FA 4YTEA 3KKPA 2ECKA 3CR3C 3L46A 1RYHA 4IJUA 4LRXA 4QYSA 5AVZA 3T1YB 3G02A 1EFCA 1H8EA 4DKXA 5GJWC 1UPUA 2XTJA 5JH7B 3EHEA 1AHNA 1N32B 4G0VA 3S8YA 4IDOA 2J09A 3I2KA 2HHJA 3TI9A 1E99A 4NQRA 1O0SA 3MT0A 2PLWA 2C29D 2WMOB 4N5NA 4WEOA 3WGIA 4GRDA 3ZG6A 3ENKA 1AK1A 5C5IA 2IJGX 1IXKA 4KIWA 1V35A 2YFYA 3WWPA 3C85A 1P75A 1ZNYA 2KLBA 2W83A 4Q7KA 5HDQA 2M6RA 1RC0A 2WOJA 1DIAA 1JR3D 3G8BA 1BTOA 3GLTA 4X85A 3PNMA 4YFYA 1NSTA 3WWOA 3LXUX 2AYYA 5C34B 3W5VA 3PT9A 1M54A 1N8SA 1AB5A 1D6NA 5DHPA 2QX6A 1ZR2A 3R9IA 2ACWA 4ZYXA 3IIIA 1JR3E 2N46A 3GAAA 3S99A 3I92A 5ERXA 4CF4A 1F8XA 4Q82A 3CSDA 3I3OA 3A26A 3M1AA 4C7KA 1HM5A 4UC0A 1T1RA 2DPHA 4HQOA 4JHXA 4GKAA 1V39A 5EIXA 3OUTA 3GFVA 5DCWA 2IV2X 3C3YA 1GPUA 3FWNA 3QMMA 2V98A 3IFSA 2ZT6A 3RUCA 3WK7A 4BBJA 3QZUA 1CRQA 4LRWA 1BA3A 4RXMA 5J43A 4AZ3A 2XH8A 2QR3A 2IU3A 3G8DA 4BEVA 4Y67A 3MUOA 3W5SA 1V5EA 1QFMA 1J8MF 1M75A 2OL4A 3G8CA 3RYTC 5LMUB 4TV8B 4DJAA 3T38A 3C5CA 2GN1A 2ZROA 1QKJA 3NS7A 3RTAA 1P6XA 4XLLA 2VDVE 3E15A 1WPQA 3TZBA 4HEJA 1EYZA 1T5SA 2FFQA 3A1NA 3L7KA 3DVLA 1L7DA 2RGNC 4Q24A 1SCNE 1WXEA 4PHGA 2H29A 1NW3A 1LF5A 1OC4A 2EF0A 2II6A 3LKVA 5D5HA 5DGCA 1YS6A 2CBGA 2NSJA 3Q40A 1LKZA 4N8DA 3S3TA 1GADO 3ODPA 1KEKA 4O0LA 5K5EA 3KJXA 4GPAA 4QX6A 2WKSA 4KR9A 3I04A 2Q1XA 1IHPA 4L8GA 4HVAA 4WGFA 5SICE 1L5GB 4G0MA 2BD0A 2JEOA 3LGAA 1GCIA 2LUOA 4RZSA 3ZWYA 5GIPE 4AWAA 1OV6A 1RT9A 1VE5A 3QUBA 1FA9A 4UFOA 1DINA 5ALTA 5EI5A 3T5DA 3I64A 4YV1A 4KLNA 4DJTA 3MTEA 1YFKA 4K6OA 4YPFA 2J9RA 1BE6A 2PK3A 3HO8A 4S1NA 3ROGA 2HA4A 5LMNB 4G25A 5IC6A 5D1HA 5KVAA 3CMMA 2ET6A 4DVGA 3EIHA 3F6EX 3F67A 3DDWA 4KPUB 4O2AB 4W7SA 5KSPA 3G2MA 1ZL0A 1KERA 1JZSA 3ROEA 3ZHQA 2FPIB 2FSVA 1ELOA 4PX9A 1W52X 1K63A 4DLYA 3Q88A 1U0RA 3CA8A 3CLKA 4X61A 4DN6A 1L6IA 3DYVA 4R1SA 4WX2B 1W35A 1C7EA 2Q1TA 1P29A 3QQ5A 3TD9A 1WDTA 1PO7A 1XLVA 2FN7A 4G0YA 1XA0A 1Z4MA 4DIFA 3MHPA 1IEXA 1FXWA 4ZJPA 4Z4FA 1KMCA 1QANA 2WWVD 2O6HA 3GMDA 1BXKA 2RBGA 5HMMA 5FA5A 5AW9A 5BNTA 1AB6A 1GFWA 4EARA 3F7NA 3KLOA 4EKEA 4J0HA 1NNEA 2PO5A 1A2BA 5DHRA 2CZGA 1VYTA 2NSHA 2WJVA 2YS7A 3MGGA 4B9AA 1FU4A 1NZDA 2E4UA 5GJVC 3UWPA 1T0JB 3PE3A 3SGLA 1NVEA 5C31A 3W2IA 2C9YA 1ODCA 1XKXA 1RMYA 1YZLA 2ZI5A 3IQWA 5AHOA 2P65A 2QQEA 4KQIA 4E3ZA 1U8EA 4LJ5A 1V0JA 2QUJA 5FWAA 3CF2A 3KQPA 4DFDA 1EA5A 4Q1FA 3OBIA 3I42A 3HADA 3A2KA 1NN5A 1M2FA 2DF8A 3B5JA 13PKA 3JWEA 3W8DA 1J8FA 2WYVA 3IXLA 2PMEA 4M1SA 1OWOA 5KQMA 4X3PA 1WD5A 3CNBA 2I99A 3RKRA 3TRKA 3TZLA 4NG5A 1UP4A 1N3LA 4MEBA 4WXEA 2V65A 2VHTA 2HJVA 1XTZA 5TGZA 5LN1A 1VPLA 3BRCA 5GV7A 1IHYA 5IT4A 2VPIA 2WKQA 4I4IA 3U7GA 3HCEA 3IODA 4C89A 3DLAA 3RSLA 3ZJYA 1JQKA 2X42A 2I22A 3NJ4A 3JR7A 3V55A 5D8DA 3C43A 2AT1A 3LOQA 3INTA 2IUSA 3MEQA 2Z56A 4KNVA 5HG0A 2VZEA 5AW5A 2GOYA 5HW0A 1VDZA 1CQWA 2AX3A 4A0QA 4DR1B 4WY8A 3VO8A 5GY7A 3W6UA 1G8FA 3ZH9B 5F51A 1QGOA 2DULA 1N2IA 2HCBA 2PEZA 3KE8A 3CEHA 2BBOA 5EHQA 3SOZA 3USES 2ZYAA 5BN1A 3OCZA 4CODB 2GN8A 5FHQA 2R85A 4BYGA 4OKIA 2Y0EA 4G1BA 2DBZA 3AJ9A 1GL9B 1NKVA 1MT3A 1A50B 4MQFB 1FFGA 3UB2A 1NMQA 3UXMA 1C30B 5EE9A 2BMFA 2IYZA 4XVUA 1L0BA 2Q21A 4B8ZA 2WHQA 3REQA 3OFNA 2G3YA 1HE3A 4QPCA 4Z7NB 2FZVA 3U3MA 2CNNA 2H5LA 1VBFA 3MVEA 2RC6A 2YS6A 1ZCJA 1DBSA 2XVAA 2QMUA 1RKUA 3QF4A 3ABIA 3QY9A 4QFDA 5TE9A 3SJUA 3TXXA 1BEEA 2HRZA 5EWMB 5T4BA 3EFEA 4Q16A 3FMOB 2IV3A 1RPNA 1Z16A 3FLEA 4PBSA 4DCUA 4ZI7F 4YJ3B 1I6WA 1R6DA 3FBWA 5D6NA 1KYYA 1VIYA 1U81A 3GLIB 2J9XB 2XSZA 4IO1A 1NWCA 4OSOA 2AKYA 4DQLA 3EQZA 3ZHRA 1PVOA 5D00A 1GEEA 3PZBA 4Z7JA 2HFKA 2PZFA 3ER6A 5FV7A 4UNRA 3C3KA 3ZVKA 5CT5A 4YQFA 3HJFA 4Y2QA 2ZBUA 4BOYA 1RI2A 1ZMBA 2WVJA 2VJDA 1QVRA 4LY9A 5FI1B 4C88A 4EEXA 4ZT3A 3BRSA 1AZTA 2EDCA 4PG5A 3U48A 3STWA 1MJHA 3ND5A 4IO0A 3PHGA 2NV0A 3FETA 2FCRA 2B3TA 1Z73A 4EG5A 2POCA 1QYXA 5MFZA 1P81A 1VYUA 1WXGA 3NTXA 4PC2A 4HB0A 1J0XO 4WZ6A 4L57A 1VCMA 3N7UA 3KZXA 2QRQA 4IBOA 4TYNA 4GMKA 2XMQA 4RJTA 2WAMA 1MG0A 221PA 3QVJA 4QT4A 4WBNA 1CUDA 4KQ6A 3EVDA 1ABEA 3S28A 4DWWA 3HO6A 4MUEA 5C8YB 4JQSA 2YWRA 3K31A 5FBWB 1IVNA 4CMEC 4L5YA 1U9IC 1GKIA 1T9AA 2QROA 4B3XA 5IHXA 2OVBA 3RARA 4IS3A 3WGTA 4ZCTA 1PR6A 1V4VA 3UVEA 1L7AA 3K15A 4UOEA 2J6CA 2YJZA 3GK3A 2C8JA 3I12A 1E3SA 1VGQA 3QIVA 4XFDA 2EC5A 4GGPA 4YMTA 2ICAA 4KYTA 2C2BA 2NTNA 4NBTA 1Y81A 1GNTA 2Y0CA 4PSCA 2QX4A 1X1BA 2Y1LA 4YQYA 1QO0D 3O4GA 1WF3A 2OLEA 1JR2A 3CKYA 4OLAA 1GG9A 5AKGA 5CVTA 2ID4A 4HPWA 4OJQA 5D87A 3J81k 4C4PA 2VQFB 5L3QA 1AT1A 2N75A 2F2TA 4ISCA 1CUCA 2GFQA 2R6HA 3AHCA 4M1QA 3I73A 3HGQA 4JODA 3A32A 1R6XA 4KI7A 4EH1A 3TLBA 3I1JA 3HCBA 4JBHA 1JHZA 5CJJA 4CLDA 1UEJA 5DHQA 4L3OA 4Y7DA 5BN3A 2CLSA 2FMKA 2EYUA 2IYFA 3NTLA 4DV7B 1FP2A 2V0GA 5DMHA 1P7CA 3PX7A 2DWOA 3N3AC 1W4AA 5EUQB 1KPIA 4PS0A 3GZNB 1OX4A 2D5LA 3AKYA 3OTHA 4MCIA 4WOCA 3EIQA 1RADA 5EWJB 4ZDIA 1PZEA 3UJPA 4HN2A 2R4UA 2IZOA 2O8BB 2GD1O 1TMKA 4B6QA 5CLFA 4OTZA 1Q1EA 2VLIA 2GERA 3GCDA 1BDBA 1POWA 1ZQ1A 5GADl 4V38A 5DU2A 3U62A 2XCTB 5C4MA 1C5KA 3IT0A 5KKNB 1K9VF 3RF6A 4JLUA 2VP0A 4R2WA 3ECSA 4OJYA 5CR9A 1NSFA 1CUVA 2GBLA 1UC5B 3DLIA 3DVAA 3PNOA 1C7JA 2PVCA 1XCBA 3O2NA 3PP8A 4Z8YA 3FPGA 4EFLA 3UMVA 1PL0A 2WPDA 3PVSA 3TLZA 5EP1A 1BMDA 1RYFA 4ZD6A 2B9EA 3LT2A 3WDSA 2HA6A 5BUZA 1KGDA 2AN3A 1ZJZA 2JFVA 3I0NA 1N25A 3IAS1 5TMBA 4D9BA 3JQ7A 2Z08A 4PNPA 3H2JA 1EHCA 4NPHA 3SFZA 3VPXA 3VDRA 1X1AA 4OIMA 4RY9A 3GLRA 3GGJA 2BEWB 1I1OA 1CUBA 1NOIA 4Z99A 5JT1A 1D0VA 1YVEI 4EB6A 2XLCA 3QPBA 1AMNA 4KMOA 4ENWA 5B7PA 2J5QA 1XFAA 3M5DA 1SO8A 4JZKA 2NGRA 4QUEA 4UEKA 3RLIA 5F9MA 4AQ7A 4PY2A 3DAHA 3JSAA 4EA9A 5JJKA 1H0SA 1CQXA 3W1EA 3M6WA 1HDZA 4O4IA 2ZUTA 5JV5A 3D7NA 2HBZA 3IVXA 1KAGA 2V55B 3N0TA 4AP5A 2CK3A 2PT6A 3IO5A 3O84A 1KK3A 4QU5A 4KMMA 5FPYA 3V1YA 3T7IA 4RY8A 3VAAA 5B64A 2OESA 3I5XA 1GTMA 1TD1A 3JRWA 5G1PA 3CNNA 4RM3A 3OFJA 5IMSA 4GAEA 4IPTA 5KNBH 4RSRA 3RS4A 2I34A 1N2CE 3DTNA 1NAIA 3CNOA 4RIFA 1YZGA 4G1EB 3T0IA 1MMFB 2J6BA 3IERA 4WH0A 2GVNA 4WESB 4QECA 5M5BA 3I6ZA 2DTXA 4TLLB 2ZI6A 1RYZA 3SJ7A 4M1OA 4OU4A 4V02A 4BZZA 1Y48E 2V7WA 4PQEA 5TGDA 1UINA 2FWNA 4C7BA 5BW4A 1ZUD1 5JCXA 2X15A 4WW0A 5CXQA 1C3VA 2P6OA 4HYTA 4U2EA 2RARA 4G86A 4C2UA 4LJAA 2FRDC 3I0ZA 1N2SA 3KQHA 1KMHA 1BRTA 2AS0A 1II8A 1MUUA 2G40A 4OXQA 1EI9A 3CJTA 3GNSA 4DS3A 1Z47A 4DMHA 3EZXA 5BSWA 5SYAA 2C2YA 1JYEA 4KK3A 5DHTA 1TRHA 3VZDA 4ZJZA 5JNSA 3DPIA 4KR3A 3N3BC 1W5SA 4KXWA 4O1MA 5FTMA 2JFHA 3AJAA 2QRVA 2ETVA 2XD4A 2OOSA 3LK7A 4ZVKA 4YRJA 5IVHA 2BP7B 3R5KA 4X20A 4Y1GA 1T5BA 2GUWA 1CLUA 4QZVA 2ZPTX 1OWPA 3BA1A 2CE2X 2BM1A 3NBQA 2WD7A 4MUBA 3IVAA 3HJCA 5HWSA 4B73A 1XF9A 2HQRA 1N1MA 4NH0A 4UAJA 1R0LA 4IUCS 4ZC1A 3SEFA 3W5AA 3PENA 1YJBA 3FTFA 2JEYA 2AUNA 4EMSA 5K8LA 2DU8A 4AJOA 2DPXA 2Z83A 2OLKA 2IH4A 1U8ZA 3AU9A 3T1VA 5INTA 2HHLA 1T6NA 1EVLA 1X8LA 3KAKA 3SEQA 2QIPA 5ALUA 2HGSA 1FQKA 3GJZA 3RIGA 1NT2A 1T35A 3G8AA 3QLJA 1BAPA 3EE6A 3L18A 4J75A 3V8VA 3PDHA 4GI2A 4Q9HA 1Z07A 3A58B 4B5LA 4B40A 2BBSA 1F5NA 1VIMA 1KS9A 2JH9A 4TLMB 4X41A 4MKZA 4CZ2A 2CV2A 4MRVA 1GL3A 1E9AA 4DLAA 3TM4A 2EFEB 3VR6D 1JKJA 5LP1A 1VJDA 2DP4E 2IX9A 3DL0A 1O9GA 2OG1A 4JC4A 2CNKA 1DAFA 1PFGA 3QOFA 1Y8RB 2BFFB 2REBA 4I50F 4LSZA 5TARA 5HX7A 3B6ZA 5K6RA 1NI4A 4G1FA 3EH1A 4PBRA 4YJFA 1RYDA 2VLBA 3HBJA 3SE0A 1VJ5A 4C29A 3G0HA 3ZZ0A 4FLFA 4RH3A 5WRFA 3IDZA 4A8HA 1ILEA 3X1XA 3PFNA 4KAXA 2WJJA 3N8KA 2AFHB 1XZPA 3DVRX 3ORRA 2F48A 2H4WA 2OFOA 3LUGA 4NHEA 5ETJA 2Y1OA 2Q4EA 1NX9A 4PYQA 2GJ8A 3WJ7A 3QWIA 2C0QA 1YI1A 4ER7A 4M4SA 4EG7A 3CPHA 2VDLB 3JQFA 2B3DA 3HEBA 5KTKA 4W9MC 2CKMA 3TNLA 1JGTA 3HFRA 4II2A 1FJXA 3VMFA 4EFMA 2AEMA 5K6AC 4LMAA 3NGXA 4TTPA 3DL4A 2D5CA 1OKKD 3CLTD 4D6YA 2RSLA 2OYCA 2Z9DA 3DXFA 1I7NA 1LPMA 1S4MA 3T4PA 4ID3A 1II0A 3FZQA 4IHJA 3C16C 3ZJUA 1CHDA 1ECLA 4GMXA 4UKDA 4X66B 5K3BA 2GO1A 2BTQB 3EGCA 3G0BA 4PZZA 4X97A 5TS2A 3OTGA 2RAUA 2JIRA 3TRFA 5C1BA 3HY4A 2PBRA 2MSCB 5B58T 2HJWA 4JLVA 1YFZA 1AXGA 3TVYA 3UJNA 3UM9A 1WNTA 3GEEA 4QXOA 1HG1A 1PEAA 3SYRA 4WGGA 2AMJA 2Z6AA 1SVNA 1FRQA 3PQDA 4O3FA 4R9UC 3U2QA 3LA6A 4I1RA 1KMMA 2PD6A 5E0KB 4JL5A 4GGMX 4DZZA 4MAFA 5DGDA 1P4GA 1G9SA 1UADA 2XE7A 4L0MA 4OA8A 5E2AA 4US2R 1AS0A 3L7CA 4LJ9A 2QVXX 1UZMA 4I8DA 2RHCA 2P91A 3FGNA 3GJXC 5T8KA 2HI0A 1DX6A 3QLTA 4EY7A 4KREA 4HDKB 2ZRHA 4A15A 1MQ9A 3SJBA 3NOVA 1QP0A 1A7UA 1K2WA 4LZOA 5FNVA 1BQ4A 3KK0A 2IS4A 3A6GA 1I4WA 3EC2A 2FWMX 1DQNA 4FZJA 3B9RA 2BN4A 2I1QA 4KTTE 4R9RA 3RS9A 3UGKA 3HN7A 3PA8A 2RBEA 4RD2A 4NFLA 4BWVA 1IBMB 1KXZA 2DLNA 1REQB 1UK7A 3IILA 5DZSA 1ZAYA 2Q9UA 4HRAA 1QB8A 2JIQA 2WRZA 3D3JA 4PGAA 1V7CA 2GHRA 3K2QA 3UFBA 2WU8A 3VDQA 5G0TA 4ZGGA 3V6LA 1WB9A 1ZN2A 1CZOA 1Y6RA 1K7XB 2I2FA 1Z25A 5FV4A 1Q17A 3RROA 4I1OA 2PR2A 1VCOA 4R1LA 2VOJA 3RTBA 3C98A 4K81B 4NJOA 1S02A 4RZQA 1OWLA 1XN4A 1QK3A 2QUHA 4DQ0A 4RKFA 2GARA 2PKEA 1MAUA 4OH7A 3DZIA 4A9AA 3GRFA 3NVKI 1GZ7A 1L7BA 2C9MA 1G4UR 1SKUA 1TJPB 2XOKA 4DQVA 2C5BA 3A1SA 4AMGA 4CYMA 1IU9A 1UBEA 1D5WA 2IIPA 4Q3BA 1KYWA 3L05A 1N5MA 1XMOB 5DX8A 2PMBA 1E1QD 2PTGA 4YALA 3TOVA 2C5HA 5F7ZA 3UAXA 4B3SB 3KYJB 4YLGA 1Y8AA 3AUSA 3GLQA 3U1TA 4DAOA 3BQMB 3VHRA 4JGBA 1RC8A 2WU3A 1FSPA 3KJHA 2V7PA 1M1UA 2QA5A 4GLOA 4BZQA 3O83A 3GJ3A 4N0QA 5IJ9A 1SUSA 1XD2A 4BMCA 2HCFA 3QLUC 5SY4A 4B3IA 5LLSA 4IQ4A 4BY9E 2KB0A 4BNDB 5DULA 3PD1A 3VC1A 2QK4A 3NIWA 4QUBA 2PBFA 5BSKA 1Q2UA 1ADGA 1KC3A 1T9ZA 2WABA 4TUYF 1T6BY 3TOZA 1LDEA 4MS4A 4NCKA 2R8OA 2NVOA 5DBOA 3QM1A 2FR8A 4UU8A 1I2ZA 4R2JA 2HCRA 3E3OA 2P6RA 3U4MA 4XI9A 2CUTA 5EEHA 4DM7A 2O2EA 3KV1A 1C9JA 5LZ5A 4KV7A 2ODWA 2YXBA 4QL3A 5LQCA 2FZGA 4ZCRA 5IDWA 3NGMA 1OYWA 1NULA 2G6BA 1P2GA 4W8GA 3S8MA 4PQYA 3OIUA 2VRCA 3M7IA 2A0XA 3PGVA 3CY6A 4MDFA 2H8KA 3R5FA 3ZGLA 2V0CA 3LT1A 1T4MA 4RDXA 1J9EA 5HRUA 4QICA 3TBHA 1QAQA 3ZE1B 1O58A 1KYIA 1PJLA 1Z88A 1E5LA 5I7VA 3E7DA 4F6LA 3BDVA 3EAFA 4AO7A 3EC1A 4DTCA 3DBIA 1U2DA 2X6QA 5HKOA 1U0NA 3VSEA 2YRWA 3RTCA 1XEFA 3UJ6A 5FDFA 5IULC 4C0QC 2F1JA 4QIHA 3TKYA 4G0PA 1X8XA 1WB6A 5JRDS 2HHAA 3CIOA 1ZH4A 2OBYA 4YUAA 2NTEA 2ALJA 3OY2A 1G16A 4HLDA 1FLNA 3E27A 4DLVA 4PXAA 2H0QA 2VWGA 2NPFA 2WW8A 5C7IO 4R1OA 2BKAA 3AUJB 4GKKB 1VHLA 4ZYWA 4F2WA 4QLOA 4ZOQI 1E60A 1M34B 3SF0A 4CV2A 1HLDA 2JNWA 3C6XA 4BP8A 5ADVA 5KOHA 1KI9A 4UBIA 3OD5A 1O95D 2I7DA 4GH5A 3FWKA 2EQAA 4F86A 4FK8A 4K2AA 3OZIA 4U3JB 1EWQA 2ON6A 1EUDA 1PX2A 1FX0B 1KYXA 4N8EA 4WCDA 3L04A 4IRMA 4ZYTA 1YTUA 1B1CA 1OXBB 2ZT7A 4PGFA 4QXQA 1AHIA 1I2MA 3KYDA 4TWJA 4W1PA 1L4BA 2VYNA 3DWIA 3I28A 4IEFB 3Q12A 2ZI9A 5HP4A 5JU6A 1UQRA 1MW8X 2WQ6A 2EP5A 1V2HE 1W4BA 3NUGA 2O4UX 1A1VA 3IPYA 4F7DA 1BH2A 4OSPA 1OIXA 2BFDB 3L07A 4Z1MA 3ZHXA 1TEZA 4E6EA 4F11A 3D8NA 4MQUA 2OCYC 2PKWA 3DZ8A 2WFMA 4UM8B 1GARA 2I55A 2FQYA 3EVAA 3GZJA 1BW9B 1PBTA 1A5BB 4C4ZA 4FFDA 2LIVA 4KXUA 3MRTA 1XLTC 4JJAA 1G1MA 3P9YA 4PZ9A 3AF5A 4B44A 4ER3A 1YQWA 3ANXA 2B1GA 2DJIA 4AI6A 1XXHA 4EYKA 2B8EA 3BTSA 1ZNXA 2A9OA 4HWOA 2I2CA 1SVUA 1ENPA 3LH5A 3M4XA 2W8ZA 2AFIE 3LDUA 1PK8A 2WJHA 2QEQA 2HSWA 2PX0A 1K1EA 2HSJA 4XSVA 3R5HA 4XA8A 4AMYA 1AXEA 1OZHA 1V1JA 3MRVA 1IY1A 1IE3A 1PLJA 3D02A 3NXKA 5FEMA 3ADDA 4D26A 3NH6A 2VHUA 1NBWB 2WIJA 2B4AA 2W2KA 4WK2B 1MAAA 5F33A 5TNXA 4HUQB 1MDFA 2BMAA 2ZWVA 2P9QA