2CE2X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ce2X00
1MT0A 1CS4C 3CH5A 2XOKA 3HR8A 5JWRA 1JPJA 2V6JA 1KMHB 1ZBDA 4EQ6B 3QG1A 3GLIE 4HAUA 2XXAB 1NY5A 1H8EA 3KXIA 2VHJA 4NL4H 1E2PA 1GNRA 1Q22A 1U9IC 2CVFA 4II7A 3IEVA 2OCYC 1QRAA 5F9HA 4IOMA 1P2SA 3O8BA 1OKKD 2DFNA 5FOWA 2O8BA 1G6OA 1TEVA 1G8YA 3NG1A 2GJSA 4NYJQ 4C0JA 5DI3B 4XVUA 4TLEA 3OAAD 4GOXA 2C95A 1VG1A 1OHHD 1GWNA 2WWGA 1E79A 2RKOA 4D80A 4B3XA 1XRJA 2ZRJA 4LV8B 1E1QD 2C99A 2R44A 1K5DA 2WSMA 4FMDB 4B34A 2A5YB 1X86B 4FI3C 2AXNA 4I99A 1LV7A 1RE0A 1IN6A 1QZXA 3QF4A 5SZHB 3TNFA 3TJZA 1ZAKA 4Q18A 3REGA 3UWOA 5C2JB 4JL8A 4IEIA 3EW9A 1KZGB 4UNQA 5FPTA 3WXMA 3SBDA 4ZCIA 4ARZB 5C46F 4FMDF 4B33A 3MJHA 4MRNA 4IJMA 1II9A 4IVRA 2QP4A 2QSZA 5HTKA 4D81A 3GPLA 3RRNA 1YZQA 4LYJA 1M34E 3A6PC 1D5CA 5CK4A 1PLLA 2A5JA 1E2JA 1E2NA 2Y8EA 3A8TA 3NTUA 2XSZA 4C0LA 4CDGA 2GKSA 5EE1A 1WCV1 2HXSA 4OHVA 4ESHA 2H18A 1T3SA 3J81k 4PO8A 1EFRA 4EJSC 4IVPA 2H17A 3THWA 1QVAA 4TQUS 3GLFA 1A2BA 2ZS9A 3ZZ0A 2OFOA 1E99A 1KK3A 3CZQA 3CPEA 3QJYA 1E0AA 4FW9A 2BMJA 3K0FB 3KKQA 5HCNA 1NN1A 2QAGA 4F38A 3WBJA 1XEXB 5JMTA 3FKQA 2GBLA 2HJVA 1Q3TA 3CPHA 4Q5IA 2BHRA 2MSDB 1FP7A 1XMIA 3HDTA 1E2QA 821PA 4PQRA 2FDCA 2KI5A 3LNCA 4BFUA 3GLFE 2ATVA 2FPMA 2XZPA 3MUFA 1OJLA 2ERYA 3T5GA 1UKYA 3LX5A 3UXMA 5DYGA 1Z0AA 3QENA 5EUMA 4B74A 2C03A 1JR6A 1QHGA 1JQLB 4S2EA 2NPFA 4R71A 2YYZA 2OHFA 2FH5B 3VU9A 4QKQA 4N0EA 1R0WA 4LYAA 3FGNA 4Z8YA 5K8LA 3FHCB 1F48A 2J59A 2JAQA 2J0SA 4EPWA 3ASYA 3PG5A 3QY0A 5DHAA 2FFBA 5FTLA 2P0EA 3LVQE 2IYYA 3THYB 4TMKA 4G5QA 3EPKA 1D2MA 4Q03A 1I4DD 3CRVA 4MKFA 5H68A 3CONA 1Z06A 3FHTA 3SYLA 4I1VA 5KSPA 4CGZA 1W2GA 3U3OA 1A4RA 1TTTA 3I72A 3PUWA 3RANA 1EX6A 3L0OA 3VTKA 1JJ7A 4URZR 4Q7MB 3QXCA 3K0AB 1G3RA 2RGEA 4M1YA 1FQKA 4U00A 4O2RA 1IQPA 5AJVB 2HDNB 3X1DA 2OAP1 4AKGA 1II8A 2P5SA 2JLYA 1BMFA 5IK2A 4JLBA 2N1BA 3THOA 3TRFA 2ODEA 3B13B 4FCVA 2DYKA 1G5TA 3BORA 2IUTA 4UXIA 2QTVB 4QGHA 3IHLA 3HU2A 1E9CA 4C0QC 2QROA 2GXQA 5TDHA 1Q20A 4A6XA 5TV2A 2ZJ8A 3AEZA 1ONBA 4UXHA 5IHPA 3TQFA 1AS2A 2Q3FA 4NDZA 1N5IA 3C14C 2O8CA 2PMDA 1TX4B 1XP8A 5J5CA 2VPPA 4Q1FA 1XFAA 4LV5B 2G77B 2ZI6A 5FI1B 5AJXA 4MRSA 1MR3F 3B9QA 4ZIRA 1L8QA 5ELXA 1GNQA 2WVJA 1E2EA 5JSZA 3H2YA 3K9NA 1EFUA 2REBA 4WZBE 1W1WA 1CKEA 4TQ9A 1UAAA 4EDHA 4LPSA 2VLIA 5FTNA 5TB5A 3C15C 2AKAB 1Z0DA 5JBQA 4GFDA 1U8AA 3H86A 3KB1A 3IQWA 4NP6A 5FUVA 4C30A 1Z6GA 4D6PA 3U3MA 4ZDKA 2ZYWX 1R2QA 3T1VA 1G7SA 2H57A 5FBRB 4G5SA 3KQKA 4JYBA 2GCPA 2P6UA 3MCAA 4ACAA 5BYJA 4DIEA 3VKWA 1WBDA 2Z43A 3R7WB 1ZM2A 2VP4A 3TKLA 2W6JD 4QNRA 4PQFA 1QDEA 1SKYB 4P4SB 4PHHA 3SQXA 4PPGA 4CEIA 3AVPA 2G0TA 2KWIA 2L0XA 4O2LA 3CLVA 4JKYA 1JBKA 5KNCA 4A8JB 3B60A 1M8PA 1XNJA 2KBFA 3AM1A 2QRNA 1X6VA 2BEJA 3GJXC 1YJ5A 4GZMA 3FVQA 4QXAA 5D3MA 3ZVLA 4F7WA 1RRGA 2C2HA 4LCBA 4LJAA 2TMKA 3K0CA 5TMPA 1WP9A 4MYTA 4U02A 4KAXA 1TMKA 2PBRA 1VYVA 2V4ZA 5EXSA 2GJKA 2XZOA 4A15A 3C7KA 3U44B 4HLCA 1VYUA 2FWRA 4FN5A 1GAJA 2NO1A 2RGAA 2BCGY 4FCTA 4G1UC 3TK1A 5JI2E 3KX2A 1IN7A 1M7HA 4PQYA 2ORWA 2ZRLA 1FL9A 4M1MA 3TVDA 1NVUQ 4L9WA 1XPUA 2XOKD 3KQLA 1RRFA 2QQ0A 1CEEA 4BQSA 3WHLA 2GCOA 1FW6A 3WNBA 2J41A 2FEOA 1KSGA 2GEUA 2VP5A 2J0VA 1SXJA 2ZIAA 3QKSB 1YZUA 4GI7A 4KV9A 4WXRA 3IGFA 1KDOA 1KAOA 5FTJA 2KBEA 4B2IA 1FUUA 1IY0A 4OHZA 3V4RA 1Q1ZA 4V0LA 4JSTA 2GTPA 4K46A 1WB9A 4DJTA 1TL7C 2XB2A 1BYUA 4LJ7A 3OE7D 1LS6A 1Q1EA 1XMVA 3Q72A 4Q48A 4M2LA 3UIEA 2W0MA 2ZS7A 1AKEA 3PUZA 2V6IA 3PEWA 1CR1A 2J7PD 3RWMB 4JL5A 2WOJA 3BH6A 1D8TA 1ELOA 1SXJE 1P2VA 1ZIPA 2IF2A 2QBYA 1ZJ6A 2V55B 3VR5A 3C16C 1T9HA 1XEWX 5FTKA 3ZVRA 4DCSA 2B7BA 1U9IA 1BO6A 1M74A 2CCKA 2QN6A 1YZKA 3CKLA 1G8GA 4AIIA 3T1OA 4PPFA 4V0MA 2CNWD 1U2RA 3GEIA 1Z8FA 2VP2A 2JCSA 2CCJA 4Q4JA 1G4UR 2E1RA 4IFEA 4NYIQ 1ZUNB 2UKDA 1FX0B 3S1AB 5FL7A 2G6BA 4RVCA 1HT2E 1ZD1A 1X8KA 3FMPB 1QG4A 2PL3A 2C96A 2XNDD 2O8EA 4EPTA 1UFQA 5CB8A 3IHWA 1Q3HA 1ZNWA 1N5LA 1UEIA 3CF2A 4X8OA 2ZR9A 2HLDD 2QRZA 5B30A 4V0ME 2WJGA 4US2R 1GVNB 2ODNA 3B9PA 3I3SR 3B8HA 1NN3A 1M7BA 1NI3A 1OIWA 2ZJ2A 1F2TA 3PCRB 4M1OA 3SE0A 1OH6A 3LAWA 2XTMA 3ND8A 2X2EA 5AJWA 5FPSA 3KXKA 3HWSA 4M9XA 2QT0A 3QQ5A 4GZLA 4KCGA 2C98A 1US8A 4QNMA 4TYWA 1I4TD 3HR7A 2QMUA 3KZ1E 4DLTA 2CCGA 3RAPR 4DDVA 4DB2A 1ZCBA 4PTLA 1KJZA 2F43B 2GAAA 3QXSA 5H70A 3GLHA 3NBFA 4F4CA 2ZSFA 4NCHA 1GM5A 4JKIA 4IHQA 2C77A 3AVYA 2FFQA 1X8JA 4IVQA 1CR0A 1E4YA 4YXWA 1OFTA 4PSAA 3QXXA 5E3HA 2I4IA 1K6MA 3U60B 1JPNA 4CYMA 4QGAA 3TW8B 3TH5A 4L5BA 2CL6X 1VCIA 2RGBA 1ZC3A 3QPWA 3RS0A 4A0GA 2QAJA 3TSWA 4B76A 3K70D 1JALA 4PXAA 2ZU0C 3KJIA 1J7KA 4XSHA 4JS0A 3GLHE 1S1MA 221PA 1NVVR 2QPOA 2D7CA 3Q7PA 4G3XA 1FUKA 5EXTA 1QVRA 3V4FA 3EX7C 2AWNA 4EPRA 1E32A 3BFKA 1YE8A 2ZRFA 3AKYA 3ZH9B 4LRWA 4BFVA 2IXFA 2Z83A 4TMZA 1OKKA 2EWWA 4EPVA 3KFVA 5L3QA 4GL2A 2ZRBA 5DN6D 5CIQA 1S8FA 1II0A 4AKHA 2YJTD 3CRMA 4TYQA 4H9GA 2G88A 1C4OA 1FZQA 3O47A 5J4VA 3OAAA 4D0GA 1W0JD 1VCNA 1ZP6A 5CIWA 3V9PA 1OHHA 1E2LA 3TMKA 4BLQA 3U3KA 1TQ4A 4M1TA 4PPQA 2PEZA 2AHOA 2CVHA 1BH2A 1E1QA 3ADKA 1QF9A 1GUAA 1FP6A 1Z0JA 3BERA 4JSYA 4P32A 4BPBA 4Q9LA 1L7VC 1G21E 4RD0A 1W49A 1MO5A 1KK1A 4OQNA 1EFHA 3FOZA 1SVSA 3U2QA 4UXJA 1JJVA 1CF4A 3OIYA 4DVGA 3HJNA 1W4BA 1KI1A 5E4FA 3W8RA 1UPTA 4C0AC 1U0JA 4DLRA 1EGAA 3RS2A 2B21A 2OLJA 2YV5A 2A5DA 3AKDA 2VSFA 5KNDA 3EA5A 4EJSB 1JEEA 1NP6A 2ZRDA 3K8YA 5EE9A 3G0HA 3ZLJA 3U3JA 1O87A 3B82A 1Z07A 1G5RA 2REOA 2R8RA 4MITA 1B23P 3K9GA 1DAEA 4JLAA 2QAGC 1KI4A 5FBLB 1UJ2A 4DEXA 3U4QB 2GZHA 2PT5A 4Y0VA 2DFLA 5E7IA 1VDZA 3AKCA 4EUNA 2ZYVX 3BXZA 4XWKA 2PX3A 4W5JA 5UKDA 3B7GA 5J47A 3LDAA 1NLYA 5JJIA 3FWYA 4GMXA 1N6RA 2BVNA 5DNYB 1L2TA 4U7DA 521PA 5CJPA 1V5WA 3IPXA 3SJBA 5DH9A 3K70C 1DAFA 4GDFA 3KTAA 3Q5EA 4IDOA 2A5GA 4NTZA 2ZRIA 4DSOA 5FBWB 2VP6A 2DWQA 1XTQA 2FFHA 4LSGA 4P31A 1SVLA 3TIFA 3ADDA 2JLUA 2JLSA 3P27A 4H1VA 3QEOA 4QJ5A 3OIVA 4TLAA 4IDPA 5EP4A 2ASEA 1RRPA 3PVSA 1OT3A 1YHNA 2BM0A 4EFNA 2JJ1D 2PJRA 1B0UA 4QBFA 4TMWA 3UMFA 3WMGA 2D7DA 1OXSC 4PC1A 4FCWA 3SFZA 2SHKA 1MABA 4HAVA 4URVR 1G9XA 1E94E 1W5SA 4W5WA 1IN4A 4KODA 1QBKC 3EXAA 5BN3A 3B78A 4XJXA 1KSJA 5JJKA 3ND9A 4WVFA 4HSEA 4Y0AA 2IUSA 1PLJA 1NLFA 2J7KA 3P4YA 4NU0A 1G7RA 4TLCA 2FE4A 5L3SA 3K9LA 4JLJA 4RKFA 1TAGA 1ZNXA 3HPQA 2GAOA 4Q4HB 1G16A 4DEYA 1OXXK 1S2MA 2QY9A 5JZVA 1A82A 2CLDX 4A9AA 2CJWB 3EASA 2ZI7A 3EIHA 4BWYA 4GT1A 2Z4RA 2WOOA 4QFMA 1KO7A 2HXYA 3GJ0A 2QT1A 4LHVA 3JVUA 2IT1A 3QNUA 4DUGA 4B3DA 1XF9A 2CEAA 4MGIR 5BN4A 1QG2A 2A5FA 2BJVA 2FV8A 2OEPA 4OYHA 2P6RA 4Q1CA 4TZ6A 4HUQA 4LBYA 4MKIA 4URYR 3VHXA 2ANCA 3ZVMA 1P62B 2UZIR 3RVBA 3CO5A 4OI4A 5EXXA 1XPRA 2QMHA 2ZETA 2NZ8A 2QG6A 4D4MA 1JECA 3W6OA 2IYSA 5JEEA 4QBIA 1DS6A 3PV0A 1E2KA 4NYMR 2YC4C 4NH0A 3PEUA 3P32A 3TLXA 3LRPA 2BBSA 2QEQA 1N5KA 4DSUA 4PC6A 1N6LA 2RGDA 4XOIA 3EZ9A 4Z54A 1KI8A 2HUPA 2WKPA 4LJ6A 1HV8A 4EIWA 5JLJA 2FZ4A 3P4XA 3VMFA 5JEDA 2D06A 1KI6B 4TMVA 5E7JA 1FMLA 2ODBA 2VHTA 3KKPA 2CMKA 4FINA 1S0UA 421PA 3QKRB 2G9NA 1DAHA 1BIFA 4XTCS 4JLDA 3O8RA 4YLGA 1P4SA 3I8SA 1PUIA 2DWOA 2PJZA 1GP2A 5KOYA 4DLYA 1R5NA 5AR1A 4NCIA 3ONWA 3QEJA 1UM8A 3FKSD 3F5FA 4XIGS 4R98A 1DO2A 1VIYA 1XTSA 1OYYA 4TMXA 4AC9A 4HATA 4KYUA 2GILA 1P9NA 4JLNA 3W3ZB 2W6JA 4B73A 2HT1A 4C4PA 4PPNA 4LJ5A 5KU1A 2ZI3A 3H4MA 1IN8A 1VHLA 3OIUA 1OYWA 4DLSA 3GJ4A 5KSYA 3BB4A 4NHOA 4TQAA 1ESNA 5GJWC 1YZGA 4IDQA 1JNYA 2GXSA 5CLLA 2IXGA 3LLMA 1D2EA 2IF0A 1H8HD 5F98A 2DR3A 4HLUA 2AD1A 4WIAA 5SZIA 2K5UA 2GXAA 5FBVB 3EA0A 1G4AE 3BC1A 2WJYA 4IXNA 2W00A 4V03A 3T15A 1N6IA 4TZ0A 1E98A 2WMNB 2IYXA 4DLXA 2BC9A 3FB4A 4TMTA 1FFHA 3EIEA 4B43A 3ZS8A 2GJ8A 4M9ZA 5JJLA 2OILA 4WW0A 4C0HA 2EFGA 1CR2A 2WZQA 3I8XA 3SYKA 4YMVA 2ZITA 3P26A 3VHLB 1GL9B 1XD2A 2X77A 4TTRA 5JHGB 1X8LA 4JVLA 3VR2A 1ZD8A 2ZM5A 2RHMA 1NG9A 3FTQA 1QHXA 4HI0E 2O8DA 1VIAA 2FPKA 2NGRA 4Z1MD 2AX4A 3OEHD 3R8FA 2DB3A 4Q7JB 3SS8A 2WWWA 4RFSB 2F55A 1G6HA 2XNSA 2ZJYA 3OE7A 3U6BA 2OCAA 2Q9BA 3BD9A 1R0ZA 3L0PA 2J7PA 1NKSA 2BOVA 2REXB 2C04A 1XCMA 2ZJZA 3DKVA 2QM8A 3QXHA 2FMXA 4M8NE 3RWOA 4MYHA 3AP2A 2RHDA 3GLIB 3T12A 3EZ6A 1LB1B 4TL9A 3DZ8A 1XCPA 2QSYA 4M1KA 4ACBA 1XPOA 3I5XA 4XTRA 1M2OB 4RD2A 3X1WA 2QTFA 5IDVA 5AWFC 1XJCA 3NVAA 2IK8A 4DT1A 1BOFA 2H1LA 1UDXA 1AZSC 1AJEA 4QGFA 3W6NA 2YOFA 2XTZA 2CNWA 1SVKA 3DMNA 5KNBA 3MRSA 4F93B 2HYDA 2IBMA 4Q02A 2OZEA 2WIBA 3VAAA 4A92A 2EFCB 1R8QA 5DIFA 4A0HA 2Q21A 1KDPA 2IS1A 2XJ9A 4TYNA 1CU1A 4DKXA 1F6BA 3WP0A 1JB1A 2O8BB 1U8ZA 1OV4A 2XNDA 4B3GA 1E0JA 3THXA 2DCUA 2VHQA 4AKEA 2J0UA 3DHWC 1KI2A 1YRBA 2HLDA 2WIAA 1XD8A 4XVQA 4DCUA 2YZ2A 3PUYA 4PHFA 1S4QA 3WY9A 2NO7A 2VEDA 3QI2A 4OQLA 2IS2A 2QMOA 3RSLA 1UBEA 1EG7A 1OW3B 4LPKA 5GJVC 1MV5A 4C7OA 2GF9A 4PHTA 2ZPTX 3QPUA 3QF4B 3TE6A 3CRRA 3GJ3A 4OKSA 1Q21A 4Q47A 4L15A 3C5HA 4PZYA 3TAHA 2WMOB 2ZE8A 1AZTA 1FQJA 1KNXA 3X1XA 3AVQA 2B6HA 4KBGA 4RD6A 3L43A 3AF3A 3C8UA 3UANA 1HUQA 3W5JA 4B32A 2ZYTX 3E2IA 4DDTA 1SVMA 3BH0A 3CBQA 3TW4A 1OIXA 2AN9A 5C18A 4AY2A 1WE2A 3SZRA 4HZUA 1ZM9A 4V02A 4E03A 4FD2A 2WJVA 3OEED 1XU4A 3CNOA 3CR7A 3WMEA 3PEYA 1TADA 3THXB 1N0UA 1S96A 3OHMA 1VMAA 2KB0A 3B85A 5HCIA 5FPYA 3SI7A 2EQBA 1XXHE 1M1YE 3M6AA 1E9EA 3THWB 4I81A 3GLFB 2ZJOA 1T3LA 5DN6A 5DSZA 4ON9A 3MFYA 5DE3A 2VSOA 3D31A 1KSHA 2CL0X 3AKEA 4DUGD 3GFTA 1XEFA 3LBIA 1VTKA 2JJ2A 1W0JA 1ZU4A 1S3GA 2BJWA 2KE5A 4B6FA 3UPUA 4MGYR 2AR7A 4GOKA 3NXSA 4ASUD 4AKIA 2QAGB 5KUTA 3R9XA 2WWHA 4KI0A 2G83A 3EWAA 4JLOA 1Z2AA 5K8UA 4M22A 1VG8A 3MWKA 1YQTA 2HT6A 4ZPXA 3RRYA 1KO4A 1S1CA 1U0HC 2D2EA 2OFWA 2NO9A 3DPUA 4PO1A 2GVDC 2ZU6A 1FPMA 2OE2A 2ZUDA 2MSCB 4C3ZA 3MMPA 5FPKA 3VNUA 4WXPA 4NCJA 3RDPA 3VU9B 4F4JA 3ZIAD 4B2LA 3CR8A 1DELA 2IW3A 1AIPA 1NRJB 3GJ7A 4B3FX 5BXQC 2O52A 5KTYA 3DM5A 3DL0A 4TL7A 3WYFA 1NJGA 1XTKA 1E2GA 1P6XA 4QBHA 2VRWA 2QA5A 2B7CA 3G82C 5CYOA 3QIAA 2PZGA 1GRNA 2RGXA 2WKRA 4B3BA 1OLOA 3A1SA 3RABA 2IYVA 2DY1A 1JR3A 4Q21A 1AQUA 1G7CA 2JATA 5CJ2A 3OFNA 3KQNA 1N6PA 2ECKA 5LB4A 1ZUHA 3A37A 1OSNA 2ZI4A 4X8MA 1P61B 1FOEB 1JAHA 3ZDQA 1WDTA 2QM7A 4OBEA 2ZI9A 1RPZA 3AUYA 2O8FA 3NH6A 4FIDA 5EZ6B 1OH5A 1HQYE 1Z6AA 1J70A 5EQTA 5FOUA 3FFBA 4RZUA 4DLVA 3PITA 4D4LA 1II8B 2ANBA 4LJ4A 1Z0FA 2G0NA 2RCNA 3GLGA 5C1BA 1VYTA 4PR0A 3SJCA 4ESVA 2OT3B 4JLKA 3AQ4A 4YDHB 3IKJA 3CUEF 4FMCB 1JR3E 1W4RA 4CRWB 1DO0A 1OFIA 2OAQ1 3K0EA 4AWXA 1TQ6A 1QHNA 1OFUX 2JJ1A 5EXPA 1T3HA 2BCJQ 2HEIA 3ZS9A 4FWIB 2N46A 2O8CB 2IX3A 4D4KA 4TYPA 4AG5A 1MRSA 1ZU5A 4OQMA 4RSGA 4BEBA 1CLUA 4CVNA 4LJ9A 1YRAA 3K09A 2F7SA 1XCGB 1F2UA 2P6NA 3MD0A 4R2HA 5JCZA 2GZAA 4FMCF 4BZPA 3GLGE 4MRPA 5KO2A 4ZIRB 2CK3D 4BEJA 2WSSD 4M0LA 5JSZB 5H8WA 1TUIA 1KO5A 4HUTA 1XTRA 5J4LA 1D9ZA 2W83A 1TPZA 3I32A 4QOSA 4B71A 2JASA 1Y63A 3A1WA 1R7RA 1A5TA 1WQ1R 3RRZA 4LY6A 2VP0A 3LVRE 4JVSB 2OXCA 3ETLA 3GJ6A 3L8YA 3UK6A 3WBKA 5CB6A 4LHYA 2VHCA 2NMVA 2FF7A 2I3BA 2IC5A 2ZTSA 2CHVA 4L8GA 3VR1A 2IS4A 4JVNA 3O8DA 2OBMA 2YC2C 4B75A 3V00A 4UJ5A 4CEIB 5JHHB 2GVZC 1TF2A 4X8HA 1W46A 1GOTA 2HF9A 4PO9A 4BUJA 1W36B 4CEHA 1GKUB 3MWLA 1CULC 4A0FA 2WICA 4V0KA 5D3MB 4KHZA 1YR7A 1Q12A 4AG6A 3OF5A 2VF7A 1O3YA 1ZM7A 4OJQA 3NBXX 2A9KA 3TSOA 5LD2C 4Q9HA 4MKHA 4ZDJA 1G3QA 3MG9A 1E9RA 1DAMA 1E2DA 2EFHB 1DG1G 3DKPA 3CH4B 2BIFA 5TXGA 2WWFA 2DPXA 4D4JA 2FOLA 2XX3A 1OXUA 5HR5A 1R0XA 1ZD9A 4ZCMA 3VKGA 4KSCA 3ZJYA 3RRMA 3GCGA 2GCOB 3FMIA 4C0KA 4J0QA 1P2TA 2YOGA 1K8RA 2ZRKA 1XMJA 1HURA 3T5DA 1SXJB 1N3BA 4G5RA 1WMSA 3KKMA 2ZAOA 3ICQB 1HYQA 2DFTA 1ZM3A 1W7AA 4L4UA 2G1KA 3DM9B 3PQCA 3ZZTA 1J8MF 4HLUC 3SR0A 4BFTA 4OI0A 4PANA 2YHSA 3LBHA 5CYPA 1ZINA 2QE7A 4NCNA 4CEJA 1Z47A 5FUXA 2IA5A 2F1JA 3FKSA 3LD9A 5P21A 3SJZA 3ZQJA 2ZROA 2VA8A 1G19A 3EPLA 5FFMA 2UZ3A 2IYZA 4PX9A 4O25A 1G1MA 1ZW6A 2EFEB 1NVWQ 1G5PA 5SZJA 2QBYB 1LY1A 1N0VC 3F3YA 3WNCA 1AQYA 3UWKA 1DE0A 2YNMA 4CW7A 1E1RD 3KJHA 2ZJ5A 4RCYA 4X8LA 1QHHA 4AK9A 3KXLA 4F4IA 4W7SA 3CB4A 1V43A 1ZMXA 1GTVA 3ZZUA 3L2OB 1KSFX 2CLCX 1H8HA 2PLRA 2R6CA 2ZSBA 4NMMA 5AJYA 3T1QA 4U5XA 4Q4JB 4KLZA 2VO1A 3C4JA 3D8BA 3B5JA 3LFUA 3NDBB 2PZEA 2ZE7A 4NYIR 3EZ7A 2ZREA 3C41J 3I1FA 1N0WA 2X1VA 4JMPA 1RFLA 2FEMA 2QU8A 4M1WA 2O8EB 2AKYA 4RD4A 4HLQB 3X1ZA 4RY2A 2NPIA 1E9FA 2WWYA 4KITB 1XMSA 2OBLA 2P5TB 3LY5A 4LYHA 4OQXA 1T6NA 3IPYA 4BLTA 4BFZA 4TSFA 2CE2X 1Z0IA 2OM2A 2OLKA 4Z1MA 1F2TB 1SKQA 3ZGXA 3OEHA 4DXAA 1YKSA 5FTMA 3RNLA 2BM1A 3KUDA 3VR6A 5KYKA 4V0OA 1US8B 2JJ2D 1CXZA 2RAPA 2RGGA 4URXR 2ZANA 1ZNYA 3A4NA 1P9RA 3M1IA 1T8UA 1OFHA 3EWSA 4G0NA 2ZVQX 3PR1A 4I1OA 2RH5A 3GLHB 4HLDA 8OHMA 3W34A 4HAXA 3L8ZA 2UVQA 1GNPA 1CR4A 4HB2A 1IJEA 3A4MA 1RZ3A 3A4LA 3E70C 2FZLA 4DSNA 4G5GA 3T1TA 2FA9A 1UBFA 2H16A 1IN5A 3CRQA 4TLDA 2I1QA 4ZDWA 1E9DA 2BMDA 2WWIA 2BV3A 2OBNA 1XX6A 5M04A 4D25A 4MYCA 2D3WA 5JS8A 5FOXA 2R6DA 1YR6A 2JA1A 5JI3E 4A2PA 1RW4A 3QF7A 4JVMA 2QPTA 2W58A 3IDQA 4UNSA 4MRRA 4M9SA 1N6HA 3PUVA 1W0KD 1HH4A 1ZCAA 2HCBA 2O0HA 1HEIA 4QM6A 5BQ5A 4HAWA 1F3OA 1KI3A 1KO8A 4EKDA 3K0SA 1Q44A 1JR3D 1GKYA 4YC7A 1ODFA 5L3QB 1ZUIA 4PAMA 3OFND 5DHFA 1IHUA 4RZXA 5JCPA 1MRNA 1EK0A 2H7VA 2PH1A 3BAFA 2GA8A 2A78A 3EARA 4MUAA 2F3TA 1LW7A 1DVRA 4D0LB 3B2EA 5AUQA 4MKGA 4URWR 1JAIA 1N6OA 4B6EA 3AF4A 1JI0A 2IHBA 2WAYA 5HE9A 2GETA 4UQOA 4KO8A 1KNQA 4LC1A 1Z5ZA 3CWZA 2XZLA 3IIMA 1N2CE 4IRUB 4WZ6A 5FR2A 3QSYA 1VG9B 1U98A 4BLPA 2E9SA 4P33A 3MWYW 1SGWA 1M7GA 1NMYA 2O0JA 3FHOA 3NDPA 2B8WA 1Y3AA 2ZRAA 2C78A 4P0TA 4PSKA 5EE0A 3P20A 5B58C 5JS7A 2AXPA 2BBOA 1UEJA 4LX0A 1HY3A 5KHOC 2ZUCA 4ZKDA 5JRJA 1ZNZA 5DGXA 5AUPB 3AVUA 4C0SA 5L3RA 3WNDA 1R5OA 1Z08A 2XEXA 4UNNA 5B57C 1KKMA 4QRHA 2ZI5A 4ZCLA 3R8CA 1S3SA 2ZRMA 1IOZA 3OEEA 2H5EA 2W2VA 4ILEA 3CF0A 3Q7QA 1SVOA 2F1IA 3LV8A 1NL3A 4RCZA 3U7EB 1G20E 1EXMA 1UF9A 2WKQA 3KJEA 4IKEA 1J8YF 2FSGA 4LOAA 4HAZA 1R4AA 2A2ZA 4E5UA 3KTAB 2FGJA 1HTWA 2JJ8A 2V7QD 3BH7A 5HE8A 4LDJA 4OHYA 2G1JA 4YMTA 3AGQA 3MWJA 4UKDA 1MO3A 3MSXA 4A8JC 4ASUA 3U3RA 1G8HA 1GIAA 4HB3A 1RYFA 3NC1C 2NZJA 5F9FA 1NMXA 4XD7D 3ZD7A 4Q19A 4EFMA 3ICEA 2VIIA 1CJMA 2EWVA 2W0SA 2ZRCA 5KDLA 1MABB 1G64A 3F0TA 1X1RA 1Z6TA 4MYUA 2B8TA 5EZ5A 2WPDD 3EPHA 2DFKB 3ZIAA 4IDHA 4IOKA 2GXUA 1UBGA 1CRPA 4L16A 1E0SA 3WRYC 3AGPA 3PIRA 4CT4B 1T91A 4GMDA 1DAKA 1RJ9A 2VF8A 5FL3A 1FTNA 3O8CA 5JRZA 2ZE5A 3LQQA 2ZEJA 4QGGA 3SOPA 1VCOA 5L3SB 2BBTA 5SZKB 5JECA 5BN5A 4TYYA 4KFUA 1QHYA 4H1UA 2WJHA 1J99A 3IQXA 2QGZA 5B2ZA 5LBIA 3JVVA 2MMGA 1A7JA 1LTQA 1X3SA 2V1UA 1N5JA 3K09C 2QE7D 2Q9AA 1E2IA 2OG2A 4MQBA 3AUXA 5JFGA 3NHAA 4Q4AA 5D3QA 4Q7LA 4HUQB 1X1SA 4QG7A 4KXFB 1VPLA 5KSZA 3AP1A 3LW7A 4Q1AA 1GL7A 3HP1A 3BFVA 4TT3D 3VX4A 4A2QA 5J40A 2ONKA 1T8TA 2CHQA 1KMHA 3LW8A 3L0IB 3VR3A 2OFXA 4EQ6A 2BKUA 4R2IA 4Q9KA 2XXAA 5FPHA 2FSHA 3NC0C 2LWIA 3MJRA 4IOJA 4YDSA 4DBLC 3CZPA 2HV8A 2ZVPX 1AK2A 2EYQA 5JWHA 1GILA 4TTQA 1SHZA 4TL8A 4D26A 1G3UA 2OV2A 3A1TA 2NQ2C 1Z28A 2XJ4A 1HA3A 5DI3A 1TU3A 1CJVC 4LK2A 4POAA 3NBZC 1BS1A 2WAXA 3AV0B 4UJ3A 2F1RA 4FXPA 4BFWA 4QJ4A 4V0NA 2CK3A 1KOFA 2WSSA 4DDWA 1W2HA 3QOFA 3I61A 2IEYA 3X2SA 1RC8A 1YU9A 4HEJA 3VFDA 5LDDC 2ZR7A 1Z3IX 3T34A 1Z63A 1IY1A 4LI0A 3RC8A 1KI7A 1SQ5A 3LO5A 1HQCA 2BMEA 2PCLA 3AP3A 2V8OA 5LD2B 2BDTA 2Q3HA 3RSOA 2JLXA 4TSFD 3DMDA 1IAQA 3TR5A 1WBBA 1XBTA 1Z83A 4PC3A 3GP8A 4M9QA 4ARZA 1P73A 3SFVA 1NY6A 4BLSA 1XTIA 2ZE6A 3KQHA 1TUEA 3QKTA 4KSBA 1KGDA 2VYFA 3KUCA 3TUIC 4PAQA 4MDEA 4KYIB 1XTJA 3CW2A 2J0QA 2ZSEA 3D7MA 5AJZA 4QHSA 4AYXA 5KDOA 1KHTA 3U61B 1WRBA 4QM7A 3U6KA 1ESMA 1C9KA 1DARA 4A4DA 1E3MA 1RKBA 4I1UA 2IXEA 5AUNB 2DBYA 3L0SA 3U7HB 3W8NA 1VHTA 1YZNA 2EW1A 3PEVA 1COWD 1P3JA 1T5LA 2R62A 2R9VA 4HDCA 5K8TA 4LBZA 4XVRA 4BGDA 3ZYCA 4TWZA 3RC3A 2NG1A 1ETUA 3WYGA 2C9CA 4BZXA 1EESA 4W9MC 1HE1C 2GEVA 1W4AA 3M4YA 1UKVY 4JBWA 2IWHA 3LBNA 4GBMA 3K1JA 3EAQA 1A1VA 1XD2B 4IW3B 3K0FA 3RS7A 1GDDA 4DCVA 3TAUA 5BW8A 1IJFA 2DHRA 4BECA 2OXRA 1XEXA 3E5HA 1EX7A 2ZSAA 3WP1B 2O8DB 3I5YA 1OB2A 4JZKA 1Z6XA 3IO3A 3QG5A 4OI1A 4JJKA 2IYLD 1U81A 3K53A 5DYIA 4I4LA 4IEEA 1DADA 5CITA 3LXXA 1OPXA 3BK7A 4NYJR 2AWOA 4DCNA 4LC0A 4NKRA 4PSVA 1Z22A 3GFPA 3EIQA 1TU4A 3R20A 4JLMA 1DOAA 2QUZA 1NSTA 3AB3A 2PEYA 4LHXA 4RD3A 3N2EA 1G17A 4OK5A 4PZLA 2CE7A 3QVUA 1SVWA 1WF3A 2Q3MA 4KVGA 2ZRHA 2YWEA 3WMFA 2Q9CA 1IM2A 1IBRA 1PLKA 3LXRA 2NTYC 1E1RA 2GK7A 5HKKD 2H92A 4G01B 5DO9A 2XGJA 3OIWA 3THYA 1NLZA 4IFBA 4DT1B 1KK2A 3B1VA 1OXTA 4AD8A 2QGNA 3P1JA 1A2KC 4HDQB 5BWMA 4NONA 1XXHA 4DDUA 3B1YA 4ERNA 1N25A 1XB2A 3PENA 3GD7A 2LCFA 4Q1EA 2IS6A 3R9IA 3Q3JB 3K0AA 1FNMA 4DLZA 5FOSA 2W2TA 4JBXA 4DHEA 2NOAA 4Z51A 4ZI2A 2LKDA 3BRWD 1MO4A 2A3RA 3OZXA 4LJYA 2WJIA 5A5GA 3ADCA 3W3AA 5DI9A 3CX6A 1SVIA 2J0UB 1RYHA 3RS3A 121PA 3A58B 2J3EA 5CDFA 5A0FA 4NZYA 4CIDA 2R65A 2F9MA 1F5NA 2FSFA 3ZD6A 3GQBA 4N1AA 5EUQB 2CLSA 2JIZD 4ABYA 2EFDB 2ZYUX 3K9HA 4DIDA 1OH8A 1T5IA 2FG5A 4P4TA 4GP6A 4C7OB 2X19A 1XJQA 3HU1A 2QENA 4KU4A 1VG0B 3ECCA 4MUBA 5G53C 5C4MA 4Q66C 1ZIOA 3CPJB 1ZVQA 2GHIA 2I1VB 4BASA 1GRRA 4TL6A 1OE0A 3MAAC 1E9AA 5EE3A 3UMRA 3TBKA 5CDFE 1RRCA 1DAGA 2E87A 4HDOB 1XXHB 4NPHA 4OI2A 2BKEA 2R2AA 1J90A 3E1SA 2GJ9A 2W2XA 3AVVA 4LHWA 1I4LD 2HJGA 2NO0A 1JQJC 2FNAA 2MSEB 5HPYB 1D9XA 5FR1A 4TLBA 3T35A 1G41A 3B6EA 3IBYA 5LB2A 5JWOA 1GKIA 3K70B 4JLPA 2D62A 2QL6A 4LWZA 1LF5A 4HZUB 721PA 3R7WA 2QP3A 1MO6A 2V54A 2W6IA 3RHFA 5KPJA 2PCJA 3SN6A 3DOFA 1P9WA 4P4SA 1WA5A 2P65A 2VH5R 2JDID 1W0KA 4MGKR 1TQDA 1PUJA 2AFHE 3JZAA 2GK6A 2O5VA 1GITA 5GJCA 4BFYA 4A8JA 1W47A 5FOTA 3BWDD 3KFXA 4AYWA 2P67A 2R6GA 2GRJA 4BRUA 1I2MA 4CT5A 1U94A 1EFCA 1PJRA 2WJJA 4WBSA 3BIFA 2G3YA 2VL7A 3BOSA 1RVDA 4DCTA 4M53A 3U44A 1W5TA 2VHUA 3NIBA 2ATXA 4Q00A 1NBMD 1SKYE 2Z4SA 4JIMA 4FMBB 1YR8A 4BFXA 1E2FA 1U99A 4BFSA 1PZNA 4M1SA 3UG6A 1T0JB 3N5CA 4QBGB 3WRXC 3PJRA 1H65A 2JLQA 5DLQC 1AS0A 2IYTA 2CXXA 4LJ8A 3TQCA 5G3YA 1IXZA 3MGCA 3NKVA 4N3NA 1GRQA 1NJFA 3QKSA 1VCMA 4OK3A 1G18A 1Z6YA 1AM4D 2YINC 1R0YA 4WOPA 3REFA 1T0HB 1LFDB 1CJKC 2WHXA 4ZV4A 2ZRNA 1KY2A 4D82A 3TUJC 4YMSA 3KKNA 5GJBA 2WM9B 1UDWA 2R6AA 2DWPA 1NIJA 2ZRGA 2OCBA 2YVUA 3CIOA 4O3MA 3IBGA 2HF8A 1NKTA 2WV9A 1RIFA 3H84A 4ZO4A 1GL6A 2RGNC 3KQUA 3DO6A 3IIKA 1JEDA 2IL1A 3G5UA 3CM0A 4OJKA 1TEXA 2IYQA 2F3RA 2IYUA 4MDFA 3NWJA 4RZ3A 1N6KA 1D2NA 2PLFA 1Q57A 4C2UA 2FSIA 2J9RA 5GADl 4YMUA 2PMKA 4IXMA 3NH9A 2O8FB 3N2IA 4KFRA 1R8SA 2QMEA 3LLUA 3TSZA 2J5XA 4B35A 1C1YA 2QNRA 3A1UA 1UKZA 3VX3A 1P7CA 2B92A 2V7QA 4JT4A 3GLGB 4WAUA 2EYUA 4FWTA 3W5IA 3VNVA 5TVKA 1E0KA 3AVTA 3PUXA 2Q6TA 3H1TA 1FX0A 1OF1A 1H8ED 4A2WA 3S1AA 5KPDA 4Q9JA 5AK0A 5TARA 4EAQA 4A0RA 3QBTA 3CX8A 5F2EA 4XD7A 1IONA 5FUYA 4QJ3A 1Q1QA 4GOJA 3CNNA 4HB4A 1ZC4A 5EP3A 1SHKA 5IF9A 3TUZC 1AA9A 4B44A 4E07A 2VTKA 4GNKA 2JLWA 4MGZR 2PZFA 2FFAA 4B3CA 1MOZA 2J1LA 3ZQ6A 2EVWX 4KLNA 1MH1A 3HYRA 4ITRC 4OK6A 1FMJA 2BWJA 2H8KA 1F2UB 4W5HA 4AYTA 1E79D 1LNZA 2D4HA 2WPDA 1BYIA 3TGPA 1AN0A 3KDSE 4IDNA 1LVGA 2ORVA 4OHXA 4RFVA 2FX3A 5FOVA 3EZ2A 2IYWA 2F43A 4JYCA 3LH5A 1KTVA 2VSXA 3QXJA 2D2FA 4UNPA 4F92B 4NE2A 1NNEA 2Z0MA 2WTUA 3IIJA 4JBYA 3IEUA 4NBSA 2GZDA 3LX8A 4KVAA 1E6CA 3UKDA 1GSIA 1XDBA 4KJZA 4MRVA 4F91B 1YR9A 5CM8B 1ZM4A 1E2HA 3VQTA 1AGRA 5AUOB 4RKEA 1NG1A 4JJZA 4CEHB 4PZZA 2OESA 4E09A 1L4YA 1CBUA 3KKOA 1NVVQ 5EP1A 2IYRA 5HZHA 3B1WA 4B47A 4TT3A 1KJYA 1WXQA 2XSZD 4LGMA 1LF0A 1XD9A 4GPTA 1IY2A 4NCKA 3CNLA 2JGNA 3JZMA 2XITA 2OUKA 4GP7A 2V3CC 3W6PA 1EFRD 4US0R 3SDZA 2GF0A 2FPLA 3AF1A 3FDIA 1Q0UA 1E9BA 2IWRA 2ORIA 4A1FA 1DPFA 3UATA 3NEJA 2WWXA 1QHSA 2N42A 5GVRA 2C9OA 4LUCA 4ZDIA 4RZ2A 1KK0A 4GRAA 4C2TA 3B1ZA 4IOLA 3QKUA 4JT2A 1JXMA 3DEFA 2GESA 4OL0A 4K8OA 4LV6A 2VBCA 3BJIC 1ANKA 5CM9C 3ASZA 4G5OA 1E96A 2AK3A 3X1YA 2AK2A 4Q9IA 2XAUA 1SULA 4XH9B 2HCJB 4DWJA 1TF7A 4CEJB 3KJGA 1PVOA 3KL4A 5BYKA 1NN0A 4HAYA 4R7ZA 3HYTA 2YKGA 1CJTC 3WYAA 2X8AA 3C5CA 4DZZA 1KAGA 4PC2A 3NEYA 4XWOA 3AVXA 2NO6A 4EJSA 3GJ8A 2VP9A 4ZKEA 2QI9C 2ZJAA 4S35A 4I1SA 4EFLA 4DSTA 4O0MA 4P3YA 1E2MA 1EFTA 3LQRA 1TF5A 2ZRPA 3QVVA 3U4QA 3SEAA 5KSOA 4A36A 1QHHB 1FTSA 1AKYA 4GSYA 4A6PA 2A7QA 4QHYA 3UG7A 1CTQA 3HU3A 4XWAA 1SZPA 1GZSA 3SC3A 3AH8A 3TVTA 1COWA 2AL7A 1JXOA 4LBVA 1I2DA 4URUR 3SJAA 2RGCA 1U0LA 4LBWA 4TN1A 3QBVA 1XZPA 2IEZA 5J4HA 1G8FA 3LWNA 2ERXA 1NN5A 1DTSA 2AD5A 4DB4A 2X2FA 3A36A 2GJAA 1J2JA 2W6ID 2C8VA 1BMFD 5IK2D 1GFIA 3DDCA 2KJQA 3RLFA 1W4CA 2ZQ5A 4Q1DA 4C0BA 1NMZA 3RYTC 2VQSA 3QE0A 4B2PA 3FPAA 2ZS8A 1G291 1KYIA 4N0DA 4YQFA 1G3IA 2C9YA 2ZUBA 4CF7A 1IXRC 1DEKA 2P3SA 3BS4A 4Q1BA 5G40A 1OH7A 1OXVA 4UNRA 5EE5B 3B1XA 5FI0B 1VECA 1CJUC 1Q1BA 3A1VA 1S9DA 5FBQB 1EWRA 1T4GA 2BBWA 3NBYC 2PX0A 2FGKA 2BMFA 4P4UA 4MA4A 3IILA 3VKHA 1UADA 1Z0KA 2CL7X 3IUYA 1G7TA 4RJLA 4EPXA 3CX7A 3SQWA 4KBFA 2P2LA 2GBLC 2ZR0A 4HB0A 1W48A 1CP2A 5F3WB 2CDNA 5TY0A 1TNDA 2JEOA 5GVSA 3F8TA 2ZXUA 4Q4LA 1KKLA 4ZI3A 2C5LA 3QUSA 2ZSDA 1E69A 2RB4A 5DISB 1KJWA 1NIPA 5HKKA 1NVXQ 2QORA 2YWFA 4Q4HA 4CZ2A 1GG2A 1P72A 4HZIA 1EWQA 1UBCA 3EC1A 3FYHA 3GEEA 2CJWA 3FFAA 5B64A 3U7FB 2JLRA 2NIPA 1F60A 1W44A 3H0KA 1OB5A 3D6TB 3GEHA 4MH0R 4PHGA 3T61A 1L4UA 3U7GA 4US1R 1KY3A 4JL6A 4YMWA 1W36D 3FMOB 4C9BA 4E22A 6Q21A 3EG5A 5K8IA 3CF6R 4YONB 3EZFA 4B48A 2OCPA 5FH9A 2OSBA 4DRZA 1R10A 4QC2A 1KIMA 4NYMQ 1CRQA 3IO5A 4PFSA 2F9LA 2FU5C 2PT7A 3W9YA 1TQ2A 3GFOA 1S9HA 3FE2A 5H1YA 1FNNA 3I4LA 1E9SA 3AF0A 1IXSB 2F6RA 4LHZA 4Q01A 4QL3A 2GNOA 2JIZA 2QTHA 1U8YA 3BBPA 2IUUA 4BZQA 1ZYUA 2R6FA 1XJ0A 1DG3A 5A4JA 5IRCD 3Q5DA 2J87A 1XZQA 4BE7B 3BB3A 1KI6A 2D74A 5C4GB 1KZ7B 1Z2CA 1LS1A 4HYYA 3CRW1 3QKRA 3I92A 1YZLA 3BB1A 3UMSA 1UKEA 2BEKA 1SXJD 1VKJA 2CBZA 3T06B 3OESA 1HT1E 2J46A 1DAIA 2QPAA 2QZ4A 3PXGA 1YZTA 3DZDA 2RGNA 4M4SA 1QHIA 5L3VA 2V1XA 3EC2A 3D3QA 2MMCA 3M0EA 4XSGA 1R6BX 2EU8A 3QPVA 4L9SA 2CHGA 3GMTA 2QQEA 4OQFA 2ZAMA 2GEDA 2J45A 5G3ZA 3SHFA 1KMQA 3NHBA 4A82A 5J4YA 3N70A 5KDDA 2V9PA 5EP2A 3DOEA 1U90A 3Q85A 3EPJA 2GWHA 2RMKA 3KB2A 1KI9A 4DLWA 1P2UA 3U5ZB 1E4VA 2XTNA 4WA7A 5L8VA 2JDIA 3I73A 5CK5A 3PFIA 4PC7A 1CIPA 5HZKA 3SBEA 1NSFA 1BKDR 3TR0A 5G41A 1P60A 3SNHA 5J4KA 3HPRA 1AGPA 3BFXA 3I62A 4LYFA 1KDRA 5LPNA 2OO7A 2YOHA 2O0KA 4EPYA 1ZRHA 5E95A 2KSQA 2FJUA 2GDJA 2LKCA 4BRWA 1W36C 3AVWA 1NBMA 2ONJA 5FL7D 2ZJBA 5CLQA 2HYIC 5EJEA 3AF2A 1P5ZB 3K0CC 4D0NA 1AS3A 4AI6A 1Z29A 1M6NA 3MLEA 3ADBA 4OHWA 1P75A 4TTPA 3RS4A 3FMFA 2YWHA 2Z6VA 5IT5A 4Z8XA 3SHWA 1NF3A 3CWQA 2A30A 2AFIE 2F1HA 1D6JA 4KFTA 4WZAE 2Q0HA 5FUWA 1NBME 2JLZA 3R9WA 4DLUA 1R5BA 4RFSA 3DVLA 2GCNA 1RJ9B 2ODWA 2YWGA 1G3MA 4AURA 1SXJC 1N6NA 4JLVA 1HE8B 5ANRB 3BE4A 4KFSA 4RD1A 1K5GA 1OIVA 3Q8XB 4LZZA 4M21A 1XEWY 2IHYA 2JLVA 1YVDA 3GLIA 1KO1A 3GJ5A 4BLRA 1PV4A 3L82B 1G8PA 2WBLC 3SYNA 1MKYA 4YXWD 2QP9X 3Q9LA 1XWIA 3VR4A 4DC9A 621PA 1DBSA 4QHTA 4Q7KA 4PAOA 5E7MA 3RS5A 3LA6A 4Q4AB 3WHKA 3W90A 2Z5FA 3SU8A 3AVOA 4R9UC 4BLOA 1KDTA 4D2IA 3ZVNA 2FN4A 2XB4A 3BGWA 4K81B
chains in the Genus database with same CATH superfamily
1MT0A 1CS4C 2D00A 1D1PA 2FUEA 4K9NA 1TC2A 4H7FA 5DJ5A 1O9GA 5F5NA 2WT9A 2FY8A 5FYQA 4GWLA 4B9AA 1L4NA 3UAOA 1J1ZA 4HAUA 1MFZA 4EP1A 4P98A 1EXVA 2AJDA 4RIIA 2XXAB 1P7PA 3EGIA 4B31A 1HMYA 1Z2NX 1QRAA 3HGMA 5F9HA 3OE4A 4M8IA 5DCYA 3O8BA 2DFNA 3I28A 3QW2A 3WK8A 3QU4A 4UAUA 3SDSA 3RROA 1O6CA 1U7TA 4WH0A 4DJFC 2C0CA 3DZJA 3TLKA 1XZMA 4F3YA 2Q5HA 5L53A 3R6WA 3WIUA 5EIBD 4EVRA 2C95A 1VG1A 5B6IA 4K1LA 4RK7A 5DN9A 4LV8B 1M1XB 4K6KA 4A3SA 2NYRA 2WJ3A 1K5DA 4FMDB 5AIBA 1X86B 4FI3C 4OB7A 1TZMA 4WGFA 3HKDB 3ZHOA 1LV7A 1M34A 4QE3A 1RTKA 3COZA 5SZHB 1UWLA 2HA5A 4U3JA 4PCVA 1FTWA 1ZS9A 4O4IF 1I3CA 4FYMA 1U8FO 4OJTA 4JODA 4G8BA 3TLEA 3FOCA 1GFZA 4UNQA 4C4XA 1E7RA 4U2DA 1ECPA 1KKUA 2VXOA 2YWRA 1JKXA 1R9NA 4ARZB 2FMIA 1NP3A 1TJPB 4MLCA 4EAAA 2NUAB 4B33A 4ZI7F 7AT1A 1II9A 1A7AA 5MN6A 4RULA 1RXWA 1UOPA 1Z7GA 2PPVA 1SURA 3G59A 2OFPA 3AW8A 4G1EB 4Q7EA 5FXMA 1TVKA 3UHJA 1ZONA 3A6PC 2K6GA 3WDMA 1D5CA 1M67A 4QXPA 1XGKA 5AOCA 4R69A 3IAFA 1ES9A 4ZVQA 2XSZA 5C51B 4RHTA 4NWIA 1KVSA 1OYOA 2FW0A 4GU5A 4QPZA 5HX7A 1TKRA 5H81A 5GIPE 2V96A 3ROZA 1J2RA 5AVWA 1IVYA 1CNEA 1G5HA 1WU8A 4EF4A 1A2OA 3AOEA 1EFRA 1KFBB 4R1UA 3KZOA 4AXBA 4CI0B 5I4BA 2CHEA 2Y1XA 3H97A 2B1IA 1FLAA 1QVAA 4X54A 1LTKA 3GLFA 2BMAA 2VA9A 3GD5A 3QY9A 1HLGA 4OH7A 3D1JA 1L5YA 4NF2A 3WYCA 3QJYA 4R3UC 4CLRB 4KN6A 2MDTA 2GA9A 1VSVA 1IG0A 1Z6ZA 1DWQA 2H1SA 3ESDA 4GE0A 3S6JA 3NHKA 2HW8A 3D7KA 5JTUA 2ZXFA 1ECLA 1WVMA 2QAGA 3PGVA 4ZT3A 1XEXB 2BH2A 3DW3X 4JP3A 2FKAA 1ACLA 1I36A 2OPBA 1GZ6A 1Q3TA 4Q5IA 1UC5B 2KMLA 2MSDB 3KEFA 4RX1A 4FEAA 4UE3S 2ZSKA 4UVIA 5EQJB 4EB8A 2QX9A 3C6ZA 4MPTA 5A7FA 1OVGA 3MB8A 2HSDA 3KSZO 3TL6A 2RJ3A 3ZK9A 3N59A 2JI7A 2HU5A 9MHTA 3LX5A 1Z0AA 2C00A 5D00A 5EUMA 2WG2A 4B74A 3TCNA 2I4MA 5JPCA 1QHGA 1WB4A 3NATA 1YJAA 3M3PA 2BI8A 3KKEA 1PWEA 4WESB 3PTZA 1R0WA 2WF5A 3DVAA 5K8LA 3AG5A 3FHCB 1F48A 4G0YA 3NU1A 2JAQA 3G2MA 3AJRA 1C7FA 3M1AA 1C7ZA 3OPNA 4QGBA 3A27A 4BU1A 2P0EA 2IYYA 3TLYA 2AVNA 1O6ZA 5WRFA 2XE4A 4G5QA 5CD9A 3IALA 5H68A 5BNTA 2Z2IA 1P1FA 3TQSA 2OFFA 2AFHA 3USZA 3GROA 4YI5A 1W2GA 2OGZA 1VSUA 3U3OA 2K7ZA 3E7PA 4FSDA 3EVEA 2G36A 4EHIA 1CWUA 1LBIA 1C0PA 1HGXA 1U8UA 2ONZA 1EX6A 3PGXA 1I2BA 2IOHA 2NM0A 4OHMA 3VTKA 4EW6A 3CE6A 4G4JA 5D1NA 2IJGX 4M1YA 2BTQA 3QPBA 3EEOA 1N2OA 4CV2A 1M2WA 5ECGC 4PNHA 1XZKA 4Y2UA 5JBIA 3HSSA 2ACEA 2IDKA 1II8A 5HJEA 3FF1A 5DP1A 5IK2A 5DSXA 1ZITA 3DWIA 3GXBA 3JWPA 3OX1A 4LGVA 2R86A 4IWYA 2P9CA 3COVA 4UUOA 3U49A 4M0PA 5AW2A 2GPSA 4UXIA 5KOJA 3COWA 4OJYA 1D03A 1E9CA 1OGIA 4WZBA 4C0QC 5FI3A 3KSRA 1Q20A 3T0GA 4IFIA 2GPTA 4YUYA 5CVCA 1C9MA 2QL9A 3DB2A 1N5RA 4HEHA 1X2EA 4NDZA 4L50A 4CNQA 2OMEA 1TX4B 2UVDA 3DG9A 4CKEB 1BGWA 1P8JA 2H9AA 2VPPA 3GT4A 3WHPA 4KXLA 1IBLB 2VOEA 1YA8A 2G77B 4B2YA 3CMMA 4E30A 1I7DA 1SG9A 4YRLA 3FBGA 3RC7A 2BR5A 4ALJA 1JAZA 1ZVMA 1MR3F 1X7DA 2C5BA 1ZN7A 2XBLA 3B9QA 1L8QA 8ABPA 5ELXA 1A9PA 1E2EA 5JSZA 5AHXA 2HF2A 3NIWA 4F2DA 5JASA 1EFUA 3H04A 1TEZA 2PGIA 4TQ9A 3BJRA 2I2FA 1CHDA 4JR1A 4Y1EA 4NBLA 4HDSB 2WHYA 2Q9UA 4LK3A 4LPSA 5FTNA 1MIOB 2AKAB 5TB5A 5JBQA 3R0XA 1Y8RB 3R23A 1Q15A 3H86A 3IQWA 1A8UA 3KB1A 3L7YA 4FFDA 1XLTC 2IH5A 2UXDB 1V41E 4QTTB 1JEOA 1TKCA 4KWEA 2C94A 3JQRA 1SEVA 1XVAA 4KE7A 4KI7A 2ZATA 1UMBB 3AW9A 3L7NA 4P54A 5FBRB 3ZDZB 4A2CA 4AS3A 4F6RA 1JXAA 4AJ4A 5KWJA 4DR3B 4ZGGA 3R7WB 2H2IA 1GNTA 1MEJA 1ZM2A 1KZ4A 2VP4A 1R6VA 2XWQA 5J2TF 3TKLA 4I2VA 2VN8A 3KIPA 4WEQA 2H52A 3JYHA 4XDGA 4CEIA 5ALLA 5C8ZA 4HH1A 1F8UA 3AFNA 3IKMB 2LTAA 4Z2YA 2GO1A 4JKYA 1TZJA 3WZLA 1ONOA 1LCIA 3OQ6A 1I6MA 1LNQA 4OIMA 3UOAB 4D46A 2CKDA 1Z7EA 1VPTA 1NMSA 1X6VA 5D3MA 3GJXC 1REQB 4GZMA 4RMHA 4QXAA 2XIQA 1L7RA 3SYRA 1QNLA 1RRGA 2O05A 3KQVA 2P5UA 2TMKA 1GQSA 4EX6A 1WP9A 3VPXA 2PFSA 2V4ZA 3TYXA 5DNUA 4NRDA 4XDZA 2D5CA 3LWBA 2OQRA 2H7CA 5LQJA 4FN5A 2NO1A 4FCTA 5CUQA 2BCGY 3F6PA 1G8AA 1NGSA 4ZU3A 4MRAA 1J5EB 4PQYA 4YWHA 2ZRLA 4JLWA 4H16A 1IQ0A 5D86A 2XDAA 1L5RA 5KNCH 3INYA 1FW6A 2FEOA 3UTCA 3B6MA 3K6KA 4C1NA 3IAEA 4IUYA 3G2IA 5DLDA 1DUSA 2JFQA 4HWOA 4J1TC 4QJBA 4WXRA 3VZBA 4MROA 3Q10A 4RELA 4PG7A 5U4QA 1Z8NA 1FUUA 4EG8A 1MJNA 5ARBA 4FE3A 1X70A 1ENPA 4JSTA 2GTPA 1WB9A 4M0MA 4DJTA 4PX2A 1IQRA 1TL7C 1EYZA 1X7GA 3DHYA 3O4VA 2MTBA 3GT7A 1TKAA 4YROA 3HYNA 3KT6A 3UIEA 4HMQA 4CQMB 1WHSA 4POOA 1X7YB 4JL5A 1TT5B 2GD2A 2HC9A 3B3JA 3Q7EA 4URHA 1GGHA 5HQTA 3C6YA 5ALSA 3HABA 4D45A 2A0FA 5BW5A 2QBYA 2YMQA 4B40A 1ZJ6A 2FW9A 2O3JA 2RONA 1E66A 3AV3A 4TXJA 1PO7A 1NXPA 4R6XA 3C16C 3K30A 4K9OA 1XEWX 3VV3A 2QG4A 3V97A 3ZVRA 5I7OA 2AEMA 1Z17A 1BO6A 1M74A 1RBQA 4UFOA 4Y98A 5AI0A 4WKCA 5DX1A 1GGFA 2YRXA 1GZ7A 1ZH0A 4AIIA 5AVVA 3LQ1A 3ZJ4A 1T8YA 3NUZA 3K1ZA 4IZOA 1U2RA 4ZYTA 1QZZA 3C24A 4HEA1 4F5EA 2CCJA 1U2GC 1G4UR 1HZZC 2AUMA 2SICE 3II6X 3JD3A 4IIEA 4KQ2A 4MR9A 4Z4IA 2FPXA 2UKDA 1BHJA 2AFVA 4DLPA 4Z49A 2AA3A 3S1AB 1XE3A 2G6BA 5JU6A 4RVCA 1BD3A 2LP4Y 1HT2E 1ZD1A 2ZBQA 4RVNA 4X1YA 3UJ9A 5IDWA 2O1XA 3HWWA 3JQFA 1XZ8A 2AMYA 2PL3A 3IAAA 1XC7A 5CB8A 3LKDA 4NR0A 1N5LA 1UEIA 4AJEA 1JG3A 5C8YB 2IDJA 1CY4A 1LK7A 4Q4DA 3AY6A 4DMUB 1PEKE 4MUHA 5B30A 1QWOA 4D3SA 4GXTA 2WJGA 1K1EA 4US2R 5JQGB 1GVNB 3USES 4DVJA 4M0CA 2XKKA 3B9PA 4CE6A 5ALGA 2GD6A 1T2CA 5BQ3A 4HNTA 1ORHA 1F2TA 2IHJA 3GMIA 3A9VA 4J0DA 2XTAA 4M9XA 2HDHA 2XMZA 2Z6AA 1DRWA 4GRIA 4MRMA 4KCGA 2C98A 4TYWA 2XQGA 3HR7A 2G09A 3KPWA 3RAPR 1MZVA 5HW0A 1MX9A 3IP8A 3LSTA 4I9GA 4DB2A 1OD6A 4FGLA 3QXSA 5IYZB 1N7IA 3GLHA 4HWGA 2J32A 4F4CA 3HO1A 5C4IA 1R6UA 2DFPA 1QCYA 2P2YA 3CH6A 2F8MA 1G6KA 2YZKA 3P9PA 2FFQA 1GUZA 5CYGA 4EJMA 1X8JA 2DRIA 3PDJA 4MTCA 3L7BA 4AN1A 2IVFA 4LFCB 5E3HA 2ZIWB 1DQRA 1P4JA 1CZLA 3CMCO 4IS2A 1O6BA 3O21A 1JU4A 4XI9A 4B09A 4ES6A 1MHPA 3VDRA 1IEXA 4TKUA 4O2AB 1YRWA 3U60B 2RH4A 2RGBA 4KLCA 1WCWA 4TXMA 2MCFA 4B76A 3K70D 1HKHA 1EEHA 4IV8A 1D3AA 5CDGA 1PX2A 2A58A 3CLRD 4HPXB 2X58A 3TX2A 3L0ZA 2C0QA 2Y1WA 4XZ3A 1S1MA 221PA 3I9KA 1KXZA 1NVVR 2D7CA 3MT0A 1QYVA 4G3XA 1UAYA 4NJMA 4OIFA 4XB6B 2AWNA 3KTDA 2XUKA 3DE2X 3W2GA 4YJ2A 3BFKA 1YE8A 1CNFA 3E0XA 1V8BA 4W4TA 3WGTA 2B94A 4YCMA 3FOFC 4LRWA 2IXFA 1B8VA 5IJZA 1SCUA 3F3SA 2ZJ6A 4JWKA 4MQ4A 3LP5A 4I5FA 2QD1A 2EWWA 3KFVA 4AT1A 2F3UA 4GVPA 5JSUA 1T9CA 4I3GA 3DV9A 5FBZA 1P91A 1AU9A 4UU0A 3U26A 4AS1A 1NV9A 1ABBA 1FZQA 2AMVA 2JBWA 3OFSA 3BF7A 5J4VA 2V6FA 2CB9A 1W0JD 1XAHA 1EFVB 4BLQA 3N87A 1W30A 4K0KB 3RC2A 3ADKA 1DIOB 4RVGA 1KDZA 1NNI1 3SCZA 4TVBA 1L7BA 1M2GA 1R0BA 2EJTA 3FR8A 3A6EA 3QRWA 1UK9A 4EG3A 4BPBA 1QF6A 1YCHA 2BFWA 3D7RA 1W49A 1NTRA 2EBHX 3CUWA 4GMKA 2XUQA 4Z0TA 4BNDA 1WKCA 3OIYA 1OI2A 1FFSA 3HJNA 4E21A 1W4BA 5FLKA 3W8RA 2P9FA 4C0AC 4E46A 1EGAA 4F11A 5TEWA 4D8VA 3AKDA 2VSFA 5KQPA 3EA5A 3IERA 5C7IO 2QRHA 3KYJB 3W5DA 2CMHA 4EJSB 3J81A 2IHZA 5C31A 3K8YA 4PLCA 3EDOA 3G0HA 3EMBA 3TKAA 4ZV7A 3ZLJA 2I2AA 4G37A 2VG8A 1YS7A 1OLXA 3KV1A 3ANMA 2R8RA 2R6ZA 1OX4B 1DAEA 1GKKA 4IO1A 1KVUA 4PRZA 3CRZA 5C37A 4BP3A 1CUWA 2QRVB 4A5SA 3QVMA 2UZ1A 2JAPA 1VDZA 2DMRA 4BJ5A 2JFHA 4EUNA 1B8OA 2PS9A 1UMKA 3BXZA 2VHZA 4W5JA 5UKDA 3B7GA 5J47A 1USWA 4UFNA 1BRMA 3N7AA 6ADHA 1N6RA 5DNYB 2ZSIA 1SA0B 1X74A 4W1RA 5GP1A 1CZRA 4Z0NA 3O8NA 5CJPA 1V5WA 5IUNC 3RS8A 4RW0A 1FDOA 2PQMA 4WRRA 3NFRA 4DOMA 4HN9A 3W7VA 1G59A 4EFDA 5KYXA 3Q5EA 3U1TA 1M2EA 4AJOA 2J07A 2IZ6A 4V0SA 3DLHA 3R3JA 2KLBA 4Y2XA 3UJ3X 3IBFA 3AC0A 5FBWB 4FGJA 2FFHA 1K98A 1K7CA 2P7HA 4Z7QB 3IJRA 4LZOA 3TIFA 3ADDA 4RORA 3P27A 1BWPA 2VNSA 2Y93A 4M9RA 1SKAA 5KAMA 5D6NA 1XKXA 5A3SA 1PJTA 2BGUA 2J4CA 1GCAA 3O9MA 3BD7A 1OT3A 3LBFA 5TQJA 4X94A 1MTOA 2JJ1D 5HUQA 7MDHA 4JI0B 2PJRA 4G9BA 1DC4A 4OG2A 4BC1A 1Y7IA 2ONCA 5IEJA 4H7DA 3UH0A 3UMFA 2DGDA 5EEHA 4O33A 4FCWA 3JS5A 2DUNA 4CM8A 1JHVA 1UJ6A 2NADA 2O2CA 2YXBA 4HAVA 1HYHA 3KQMA 4URVR 1E94E 1QYXA 4GECA 4KN5A 4CLOB 3PDHA 4KODA 3KS9A 1QBKC 2Y77A 3EXAA 5DPMA 3VTAA 4L4SA 2P2DA 4H7KA 1Q7BA 3ND9A 3VA7A 2H4WA 1A9TA 2BFCA 1JYSA 3LIIA 4BX3A 4G86A 3FWHA 1PLJA 4G0PA 2XKBA 5TEVA 3P4YA 3IODA 1RZRD 1G7RA 4OLFA 4HQOA 1SQGA 5DMHA 2IHTA 1TAGA 1JLLB 3HPQA 1P1HA 3WGZA 4A26A 1IHYA 4HZGA 1OXXK 1S2MA 1NXQA 2A33A 2X15A 2C7OA 3GZNA 4BWYA 4W7IA 1NDQA 4ZT2A 4WWHA 2HXYA 3GJ0A 4LHVA 2EXXA 4Y8VA 5BVHB 4L4ZA 4IJ5A 4LNUA 4DUGA 2O2EA 3GCWA 4JEHA 4CMKA 5HF9A 4F9GA 2VZ9A 2A5FA 2BJVA 1GPWB 1VM6A 2FV8A 2OEPA 4RA6B 2JL1A 3RAEC 6CHYA 3GX1A 4Q1CA 4BGEA 5G02A 3KU1A 1DKOA 2BLLA 4ND3A 1K0UA 4OFXA 4XIIA 3R7BA 1GPAA 3L04A 4P36A 3VR0A 1DXQA 1QU2A 2GQ0A 3NOQA 2AN5A 4XQGA 4GZ5A 2Y1EA 2QG6A 5B1HA 1RXUA 1XCOA 4QBIA 3UC5A 3VDXA 4DG5A 5JXJA 3Q6IA 2BTOA 1BA2A 5M3BA 1E2KA 2PRZA 4KSYA 1OWMA 2B69A 3PEUA 3P32A 3TLXA 4X1OA 4DSUA 2CZCA 1L9KA 2HHAA 3K2BA 1N92A 1KI8A 4E5KA 2QWXA 4EIWA 5DBIA 2J8ZA 2CV2A 2FHPA 2FZ4A 5JEDA 1KI6B 3V7NA 1FMLA 2ODBA 4JSRA 4LF6B 3KKPA 1QYDA 4BAUA 1Z5NA 2GEJA 2GZ2A 2JGKA 4FINA 1ESCA 3PUKA 4HD8A 3RIXA 5JISA 3Q1KA 3DO8A 2G9NA 4DIUA 1J0DA 1DAHA 3V1LA 3PYLA 5ED4A 1ZGHA 2J5QA 4LJKA 2HPHA 5HOEA 4YLGA 2Q29A 5AKKA 5F4ZA 5L6LB 2DWOA 2PJZA 1I9CA 1MH9A 2FEAA 3O4GA 4TTSA 6REQB 4HX9A 2ZT5A 4J4HA 5CFOA 4NCIA 1ISGA 5HOQA 3L92A 4XOUA 5GOTA 1NFQA 3F5FA 2ZGVA 3DMFA 4FILA 3L40A 5BSGA 5LWQA 4WNAB 2JIDA 3ABIA 3VO2A 1OYYA 4KO4S 4RMJA 4ZGWA 3DVSX 3ESBA 2WJZB 5EJIA 5IKEA 4KYUA 1P9NA 1IB6A 1QG6A 4KXYA 2UZ4A 3LYHA 4F21A 3KLMX 1UIMA 4IGFA 2YFYA 3TTTA 5KYYB 4XDYA 1FDIA 1L5LA 4EY5A 5KU1A 1HDYA 2IOFA 1BROA 1IN8A 1B26A 2PK3A 1OYWA 2HLPA 3JYLA 4PE5B 1G4HA 3OX2A 2Z6UA 3BB4A 3LLVA 4NHOA 2XXBA 1VKZA 1DHTA 1ESNA 3CKMA 3ELBA 3PJGA 5E6UB 1YZGA 3UWDA 3V1YA 2J09A 4EG5A 2ZBFA 5CLLA 4DV2B 1NVEA 4E5MA 3HA3A 4J0KA 3FW1A 1KS2A 2DR3A 1NT2A 2AD1A 3VYVA 4WIAA 4H6VA 2JFWA 3ANTA 1B6TA 2GXAA 2YXEA 1VGRA 2Q28A 4FOLA 4F3CA 3BC1A 3QE2A 2W00A 3DR5A 3HJUA 3UK0A 4U9HS 4MHSA 1OGJA 3ZDYB 1DCMA 3NFYA 4RAQA 1KQGA 3FB4A 2VDUE 1QO7A 4B43A 3F2IA 1W59A 4H4DA 3ZS8A 4XB1A 5D5HA 1SC3A 4E12A 4KQ1A 3ZCUA 3T5TA 3H1PA 2JH3A 4M8KA 3I8XA 4C0HA 1YMVA 2QN1A 5E2BA 1GL9B 4LW8A 5AKYA 2OXEA 2RH9B 5JHGB 1CUUA 2PSHA 5BMVF 4BQIA 4QRDA 4CUKA 3OZVA 4HDKA 1BMTA 1ZD8A 3NEAA 3OOEA 3HYCA 5G4KB 1N1DA 4HI0E 4RKYA 1JPVA 4Z1MD 2H29A 3OEHD 1H0KA 1JDNA 2RGWA 3NBKA 4Q7JB 3WWEA 3BSYA 2QX6A 2Q5IA 3ZXSA 2F55A 3DEKA 2LDXA 4PVDA 1Y33E 3O82A 3ZHUA 3IVAA 3M6MD 3WGLA 5CG2A 2M32A 3IXLA 1KJQA 3U40A 2B4AA 5E2AA 1PG2A 1XCMA 4GL4A 2FMXA 2NVOA 3I0MA 3AP2A 4EJ6A 4LZWA 3EZ6A 5AK6A 4OMUA 3DZ8A 4F1JA 3IDAA 4LAFA 1HETA 2Q4EA 3PXCX 4EGAA 2BE7A 3I5XA 1X1TA 4FHGA 2C58A 3SAJA 5JXWA 1B0PA 4OP3A 4DNPA 1GGNA 5DU2A 1EVZA 1UWVA 5KQGA 1RI2A 5REQA 4DT1A 3ITKA 1BOFA 5ITZA 1UDXA 3THSA 3KBOA 2O8NA 3SKYA 4FYXA 1AJEA 5ALXA 1GUFA 4IHAA 2I87A 3Q7TA 1PVVA 1WSWA 2IE0A 2WMYA 4PTYA 2YNMC 3TX6A 1KZYC 4GR4A 1R37A 4FYYA 3KUXA 4F93B 4FR5A 3F6CA 1LBEA 4Y1GA 3QE9Y 1JHUA 1MB9A 4AF7A 2VYVD 1XG5A 1A8QA 1VKNA 2WTMA 4U6QA 5EPEA 1Y5RA 1SIWA 4A0HA 4R0MA 4L3VA 1NF2A 3K9FC 3FB1A 1C8BA 1CU1A 5EMLA 4DKXA 2PYZA 3GCDA 4ZTZB 3C3YA 2O8BB 3QXGA 1U8ZA 2FCAA 5E4YA 5B7NA 1E0JA 4G6ZA 2ZBGA 2IRWA 1VHWA 2VHQA 2E5WA 4AZTA 4BQEA 4YJ3B 3AYZB 3DHWC 1YRBA 2PJDA 3EBPA 2YUTA 3AXSA 4LDRA 1DBPA 2NVBA 4YRSA 4F5ZA 1YTLA 4XVQA 1YWGO 1ZKDA 2YZ2A 4DCUA 3JQPA 1XJ5A 2C5SA 1YQ9A 4CQMA 1POXA 2B0CA 2VEDA 4AFNA 4D4GA 3QI2A 3QVTA 4MV5A 4OQLA 5LDGA 2IS2A 3RSLA 1A9ZA 1EG7A 1QZTA 3HACA 4Y1RB 1YACA 2FXIA 2R7KA 5GJVC 5IAKA 4JYPA 5CA1B 2GF9A 4AO7A 4PHTA 5KQLA 4GDMA 1JR4A 5T6MA 4FXOA 1X3LA 1T1IA 3BJEA 3QF4B 3OQOA 3CRRA 1KYTA 4ER3A 4QT4A 3GJ3A 4D81A 2CDBA 3Q8WA 3DOCA 3FYUC 4L15A 4PZYA 5TRTA 1R00A 1XQ1A 2ZE8A 3PP8A 4J76A 1KNXA 5J2UB 1Q95A 3AVQA 3TZLA 5JMOA 3RVKA 2PKYX 3L43A 3NUGA 4PYOA 5JPIA 1Z5OA 1YQWA 3UANA 4D9MA 4RACA 3V4SA 3AWIA 1IDOA 1XZGA 4OL9A 4CUZA 1S6YA 3W5JA 3CN9A 1RYZA 2XYHA 1WXIA 4ENRA 3SBXA 3ZWWA 4I3FA 5IC6A 1SVMA 2X3FA 3TW4A 4FEYA 1OIXA 1W4ZA 5DEOA 3JPWA 5TX7A 5C18A 1HDEA 1WE2A 3N8DA 2PUAA 4HAOA 4BNKA 1OLUB 1BFKA 3A9UA 2C2WA 5PGMA 3OEYA 1XVTA 3NHFA 1MG5A 1JFLA 1TADA 3LSYA 3OHMA 2KB0A 3PK0A 3ORQA 2HADA 3N86A 1C1HA 5FWYB 1EZ4A 1VJ5A 4C29A 1IUNA 1M1YE 4BO0A 3M6AA 1XL1A 2XCLA 4D79A 1QPBA 1YL6A 3Q0IA 4I81A 3K5PA 2R6JA 3T7IA 4PBRA 2XRZA 4UULA 2Q4OA 4ON9A 3PEFA 1XNHA 4B82A 2IGBA 1EMDA 1NAIA 5EMHA 3AL2A 3BN3A 1QGED 4DV0B 2Z09A 4UDXX 3GFTA 4QYIA 3I6BA 1YBAA 3LBIA 4X92A 4XLZA 1W0JA 3WGUA 1IJBA 3ZV6A 4JIGA 3FNEA 5C1PA 1Y4UA 1Y9JA 3NXSA 1YVEI 3FGOA 5TMEA 4ASUD 3R9XA 1MP0A 3ZX4A 2DHCA 2JEZA 3FPBA 1USVA 1VIDA 1X7ZB 1RWVA 3IUJA 5CB4B 3SX2A 2O6HA 2O7RA 1Y8CA 4R2LA 3MT9A 1RLUA 4KXQA 3RIEA 1KO4A 3RRYA 1S1CA 3BRQA 2D2EA 2HTEA 1J20A 3WIEA 3ZW7A 3DPUA 4PO1A 2RBGA 3UJHA 4KWTA 2ZU6A 1GTG1 1IU9A 1J49A 3F7MA 1FPMA 2ZUDA 3VGPA 4N0PA 1PJQA 1YQEA 2B61A 3EE6A 3H9EO 4IHJA 4MIEA 4CKCB 2JGRA 2GPBA 4D3ZA 4G4IA 5EJAA 4NCJA 3ZIAD 1Y42X 2FZ5A 3ZNOA 2Q8PA 4B3FX 1NRJB 2KLHA 3GJ7A 3WG9A 2O52A 3JSAA 2AVDA 3EF1A 3AFIA 3WYFA 3NYIA 2GLUA 4QLBA 5LXTA 1A69A 1PWZA 1TA9A 3ESQA 2VRWA 2QA5A 4FQ7A 4PY2A 4BQNA 5KSWB 3EC7A 3PZRA 1L5WA 1OROA 2M6KA 2PZGA 4C03A 2ZW9A 4RF2A 5C35A 3RABA 2R4UA 3LL7A 4KQIA 2NSLA 3NBUA 1G7CA 1F0KA 4N03A 4N3GA 1MMFB 1WMEA 3KQNA 2HLHA 5IBQA 1GPH1 1FOEB 5HEKA 3ZDQA 1QC5B 1H1DA 2FI1A 4DE5A 3AUYA 3GUZA 3AUAA 3P2KA 3MGAA 1RABA 1V7CA 2O8FA 1R64A 2ZYIA 4DA7A 4DA8A 1IY8A 2NU7B 3LG2A 1DLJA 1MOPA 4FKZA 4JI1B 4ISBA 5EQTA 3T3MB 1W5BA 4DLVA 3PITA 5DK4A 2ANBA 3H0CA 2G0NA 3F4LA 2RCNA 3OKFA 4NNPA 3GLGA 1ZJ5A 2F3SA 3OECA 1DUVG 3GVHA 3SJCA 3VU3A 2Q49A 4BO3A 2OT3B 4E3ZA 7GPBA 1I32A 1OZGA 2L18A 3D3WA 2EZ4A 3MQ4A 4LECA 4QQNA 1K7EB 4FMCB 1JR3E 1L5OA 3AOGA 1DB3A 3I6IA 4XM0A 5AM4A 5LQCA 4GC9A 5LP6A 2YWXA 3PKJA 1GZUA 1FSGA 2Q4DA 3K0EA 2MHCA 3AEKA 1Y3CE 3OT4A 1BEZA 2W8BB 2NNWB 1GY8A 1JV2B 1TQ6A 4AG3A 5KMGA 2JJ1A 1T3HA 1YRQA 2X9GA 2N46A 2NXCA 5BUCA 2Q3CA 5F73A 4TYPA 4AG5A 2JGIA 3CLTD 4H6PA 2W98A 1QDUA 3VNSA 1JFTA 1YRAA 1RLJA 2OKCA 4MS1B 2FB9A 1SXHA 5EZQA 4EARA 1XCGB 4R2HA 2D5IA 4BZPA 2HPAA 3CURA 2GBGA 2XUOA 4MRPA 3P9NA 4WLEA 1EE9A 3NDJA 3NTVA 4I50F 3RSCA 5IM4A 5KO2A 1N8KA 2RI1A 2WSSD 4MUJA 4DJAA 9ATCA 3CJQA 1XTRA 1D9ZA 4F4HA 1PWXA 1UXHA 1TPZA 3I32A 4QOSA 6NULA 4DADA 3ZE6A 3L5OA 1Y63A 3ISTA 4MW6A 3L8MA 4ZMBA 1RZRA 1R7RA 4G09A 2UUAB 1CEQA 2Q3DA 5J43A 4NPAA 1A77A 4P0PB 2G1UA 3TZKA 3T7EA 3O2NA 2Z08A 1Z73A 3JASA 3NONA 3R9WA 4M76B 3G9UA 3WBKA 1XYVA 4X5OA 4NDAA 2NMVA 3JD4A 4DV3B 2FF7A 4EO9A 2A9PA 2ZTSA 2QXUA 1X1BA 3HLTA 3CT6A 3HL0A 4L85A 4YRRA 3V4ZA 4Z9YA 3I42A 5EXEA 2H8GA 2IS4A 1K08A 4XPZA 4C4YA 2AEJA 2OBMA 2TS1A 3V00A 1E4OA 3D3WB 4B75A 1PNTA 2GVZC 1RR6A 1TF2A 5AMXA 1DZIA 2BMWA 3TFWA 3G79A 3ND5A 3GXOA 4DPMA 5CM2Z 4G5HA 2B5WA 3DW1X 4WDQA 1LPSA 1GVHA 1T13A 1LC3A 1YR7A 2P11A 2WP8J 4PRKA 3OF5A 4AG6A 4BV3A 2VF7A 3CZ5A 4FDVA 3DKRA 1TCBA 4PVCA 3PJFA 2HBRA 4MKHA 5MDHA 1B14A 1QZ3A 1XRRA 2ACVA 5TNXA 4XW2A 1E9RA 1DAMA 3IP7A 5C1IA 3DKPA 1J21A 2B30A 2BIFA 1IIRA 2IPOA 4JI5B 3B7WA 4EY4A 1MC5A 4F4FA 5KYUA 4TXNA 3L01A 1KQPA 1DBWA 1EP3B 3UJNA 3KAPA 1HK7A 2O2SA 1ZD9A 3RT1A 3A3PA 2FPIB 3IRVA 3I0NA 3KAQA 2I3ZA 4AB1A 4MVJF 2GCOB 4DPLA 3FMIA 3OFVA 4C0KA 3OWOA 4J0QA 1P2TA 2PG3A 1EVEA 1KEEB 1DC7A 1K8RA 2VUTA 3QVXA 1TJ3A 1P5JA 2RK6A 3GNTA 4MA5A 4DUZB 2O50A 1OX5A 1D6NA 1QCDA 1JAYA 2AE2A 1HWYA 2DHEA 3B5EA 3MYYA 3N07A 3N6XA 3QM1A 3AX6A 3PQCA 4OUKX 5ITVA 1NQOA 4JYZA 5D3ZA 3HI4A 5FHRA 4ZTBA 5FADA 5FFFA 3EG9B 3B51X 3R5KA 5EL0A 1S2LA 4TRNA 4INZA 5I51A 5FUXA 2YR0A 1XWFA 5P21A 1OV6A 4DMLA 2QTWB 2VA8A 3G8BA 2ATCA 3AEYA 4M0UA 4PX9A 4O25A 3RADC 1UBHS 3KSDO 1JHOA 1M6VB 1Z0ZA 3O0TA 4KIFA 3BMNB 1LY1A 3DAPA 3K05A 4DQDA 2Y1KA 1KQNA 1EGHA 3BSWA 1E1RD 3OT1B 4PZ9A 1FU7A 3MIIA 4K6HA 1GPYA 2IFTA 4AQ7A 5AXAA 1TXGA 4AK9A 4IYJA 1RRKA 3KXLA 4W7SA 4TWRA 5EWLA 4KR9A 1SBIA 1JIXA 3GPBA 3JAKA 1XTTA 2G63A 3VI4B 4QQRA 1Q0SA 5H16A 5DM70 1NR1A 3L2OB 2CLCX 5F7OA 3BTOA 2RAUA 1M6EX 1VBKA 3T8YA 1RQRA 1PZFA 3JVDA 1O95C 4PZPA 4S24A 2NAFA 4RUKA 3PF8A 4U5XA 1Z26A 5LQNA 5BOSA 3MTEA 4DUYB 2ZKIA 2RIPA 2JCYA 3DZIA 2F2TA 3MBOA 4XUCA 4L8FA 3SGLA 4H3HB 2HFKA 4G5YA 4OXYA 4GI1A 2ZUSA 2R66A 3JWJA 5C1OA 1X15A 1YUBA 1EZ1A 2GLXA 3IQHX 5H82A 3N53A 4B3IA 2C42A 1KVTA 1RFLA 5DASA 3SIXA 1O96B 2FEMA 2QU8A 4UDOA 1SXIA 1KC3A 1H22A 1QAQA 4EBFA 3W3AD 2W2KA 1YRHA 2NPOA 3FTPA 4A73A 3EBOA 1AURA 4LYHA 1GCOA 3MLBA 2OGSA 2ZCJA 1T6NA 2A0XA 4TSFA 2NXWA 2YWCA 3GVPA 3DXZA 3P5SA 1GDHA 4Z1MA 3D8UA 4AN4A 4JENA 2QN8A 3FSJX 3OEHA 4YFYA 4ZYYA 5FTMA 4ZZ0A 1P77A 4RK1A 1BFUA 2YRFA 3U4GA 1M2JA 3B3QA 4V0OA 1US8B 5DYTA 4REOA 4ZCQA 3V1MA 4E5DA 4F9FA 4PN3A 3LE8A 1PL7A 2MYNA 2QZSA 4FI3F 4LY0A 3C1OA 4YPOA 2Q4TA 1RYDA 1XF1A 3HKEB 2IV3A 2J3LA 4I1OA 4IWXA 1A97A 1FMTA 3QX9A 3T5MA 3W34A 2ABWA 4HAXA 1I3LA 1KHHA 3CE9A 2BFFA 4V24A 5ALKA 4HB2A 1CR4A 1LZLA 1IJEA 3PDIA 3QUTA 5EWJB 3A4LA 3HXQA 4ZTUB 4DSNA 5MGNA 4JU8A 1S2DA 2HO4A 3HCAA 4JMLA 4AJIA 2V4UA 5CAEA 3D6JA 1EPUA 1UBFA 2I1QA 1EXDA 5TPWA 2BMDA 2OBNA 4D25A 1GJRA 3MJ4A 2AKEA 2X6RA 1L5KA 1NYQA 2D3WA 3TLGB 1J7JA 1TU0A 2VXCA 1TYBE 4JP1A 3LQYA 1YR6A 2D2VA 1E3SA 3LQKA 2NP7A 1PFWA 4RPJA 2JA1A 2XKAA 5M7EA 3QF7A 5FEMA 4JVMA 3IDQA 2JH8A 4HMOA 1G9SA 2OZLB 2A57A 3HDHA 2VPXA 4LS3A 1NBEA 4M9SA 4JHXA 5JJBA 2RGRA 2HNBA 3P0EA 1T5OA 3PNPA 4JNKA 4YLEA 1ZCAA 2VYVA 1CQWA 1HEIA 3HBAA 2BGTA 5BQ5A 1JWBB 1ODTC 3PQDA 4EKDA 1P0PA 4YC7A 5L3QB 5IP5A 1L7AA 4JI7B 4INJA 1ZUIA 3DSRA 2YQ5A 4EA8A 1CQJA 3OUZA 4DCGA 4OEHA 1RWQA 3LXMA 4B8YA 2FEKA 2IYPA 4IG4A 2J67A 1ZICA 2G70A 3PHJA 4JITA 3PA6A 4AZSA 1R74A 2OV3A 1LW7A 2G5CA 5DHSA 4RV9A 2QR3A 4D0LB 1Q1GA 5AUQA 1ORDA 1JAIA 1XEAA 2YJZA 1BXRA 1GG5A 1CRLA 5HE9A 5H0IA 3AZPA 4F8YA 4BE9A 4LZJA 3GRZA 1MX1A 2QAIA 2QTCA 3QVWA 1YDGA 4IRUB 2O57A 4RS3A 3RYHB 4TKMA 2R85A 3QSYA 2X4DA 3CY6A 4P33A 1HZJA 3MWYW 2C31A 2O0JA 3REQB 4PIMA 3Q7IA 2ZP1A 4IMJB 2CNKA 5E6RB 1HMPA 4YMIA 1G20A 5TGDA 1TCVA 5T5QA 1N2ZA 2DJIA 5EWMA 5HJ7A 3HJBA 1K68A 1WDKA 5CRIA 4JWTA 4P8RA 2BBOA 1D7OA 4J0EA 2YHBA 1YVRA 1IEWA 4LZLA 1HY3A 5KHOC 3PA8A 2ZUCA 2Z9CA 3QX8A 1PZEA 1OZAA 4BZWA 5DGXA 2AEFA 4ZKDA 4MB0A 4X3PA 4MW7A 2OHJA 4DAOA 1JLMA 2BR4A 4GM1A 4UNNA 3NRBA 3O38A 4ZCLA 3R8CA 5HKLA 1U11A 3RK1A 2YV3A 4ZOCA 2SNIE 4B7UA 1YAHA 2D5BA 3IHKA 2W2VA 1UXIA 3A70A 3CF0A 4KR0A 2F1IA 3LV8A 3Q9UA 3QOWA 5IN5A 1N4DA 2Q8NA 5FT9A