2CE2X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ce2X00
1FUKA 3IHLA 4DC9A 3BAFA 1Y3AA 1DO2A 2WKRA 4DEXA 2GDJA 1UKZA 3L0OA 3VHXA 2ECKA 4KBFA 3QSYA 1DG1G 5FL7D 1CKEA 5AR1A 4A92A 1R6BX 2WJGA 3I72A 4G1UC 4ON9A 4M1YA 3RYTC 4R71A 1N6PA 5B64A 2CJWA 2OCYC 4PR0A 3LBHA 1KI6A 4E09A 2YOGA 3CRVA 1Y63A 2ZI3A 3TSZA 3W5IA 3KQLA 2O8EA 4CRWB 1X1SA 2ZU6A 5E7MA 3WRYC 1II0A 1AGPA 1U94A 1VYVA 3FHOA 3K0AB 3KQNA 5EZ5A 1OH5A 4D4MA 4B3XA 1LS6A 4A8JA 3TK1A 5CB6A 2GXQA 3DO6A 1X8LA 4TZ6A 2RGBA 1KDRA 4HDQB 1MV5A 1SXJA 1CR0A 1CRPA 4UXHA 4UJ3A 4RD2A 2ZE5A 3OZXA 3KQKA 1E9BA 2IL1A 2QBYA 2IS1A 4IVQA 4LV8B 2IF0A 2V6JA 2DB3A 4GZLA 2A5GA 5CJPA 2LKCA 1CJVC 2X2EA 2YWFA 1T8UA 2V9PA 1KTVA 2QENA 3CF2A 4JLVA 2XTMA 4URZR 3PUXA 3EPKA 1RJ9B 3QKTA 1ETUA 4X8HA 2CCKA 1CTQA 2IXEA 3PQCA 2XTZA 2IBMA 4OI0A 1RC8A 2OAP1 1A4RA 4KBGA 4G3XA 2ZSAA 2JA1A 1MKYA 4JL8A 4G0NA 1WDTA 2GCOA 2PEYA 2O0KA 5E7IA 4P4UA 3B1ZA 3EARA 4TL7A 2ZJAA 5BYKA 5FR1A 3B7GA 3E1SA 3O8RA 3AQ4A 3JZMA 4M9QA 1FPMA 3A1SA 1RRCA 1G41A 4TL6A 5B30A 1FX0A 1V43A 4CW7A 1M7HA 1ZD9A 2KJQA 4W9MC 1RRPA 3NDBB 1SULA 1ZUIA 2ZSBA 1G9XA 4WVFA 1IQPA 3N70A 3RHFA 5KUTA 1C4OA 2AD1A 1D9ZA 4P4SA 4DLRA 1A1VA 1AZTA 1E0SA 1UKYA 3A1WA 4PXAA 1UBFA 3N2IA 2QP4A 1P3JA 4IW3B 1QHHA 1F2TA 1U8YA 2NG1A 2VL7A 1E3MA 5EZ6B 1N5KA 3LV8A 1NKSA 4EFNA 4PC7A 2QAGB 3KKNA 3WNBA 1IN8A 2GAAA 4JYCA 3HYTA 4MQBA 3U6BA 1GAJA 1ZW6A 2G83A 2YWGA 4AG5A 3WYGA 1ELOA 1T8TA 3NBYC 4JKIA 2QT0A 4FMBB 3L0PA 1FMJA 1RYHA 3A4MA 4O25A 2VSFA 3Q8XB 1XDBA 3L82B 4NYIQ 2GJ9A 1G5PA 3AB3A 1OH6A 4M21A 4D4KA 2HUPA 4LRWA 1XMSA 4JL5A 3K9GA 4Q21A 2CJWB 1W36D 1N5IA 1P75A 3QPWA 5FUWA 1TUIA 5LPNA 2CK3D 3BFKA 1JPJA 3GEIA 4CF7A 2YOFA 3WNDA 3MWLA 1A2BA 3FFBA 1ZIPA 4HAZA 4BLRA 3CRMA 1XD9A 1EXMA 2HLDA 2BJWA 3C14C 3FPAA 3TAUA 1G291 3OEED 2W58A 1J2JA 4HB3A 1Z6YA 4D6PA 1SXJB 2B21A 3IEUA 5HCNA 4OYHA 5C18A 4OBEA 2ZRHA 1ZC4A 1CS4C 1VG8A 4WAUA 4UXIA 4M1KA 1KNXA 1ZNWA 5JBQA 4GPTA 2WM9B 3VR6A 3BGWA 3ZIAD 2QRNA 1E2FA 1U8AA 3BH6A 3CR7A 4KVGA 2SHKA 2ZJYA 4P0TA 5FTJA 3BE4A 1Z08A 3LVRE 3MFYA 4DCSA 2OSBA 4Q7KA 2VPPA 2XSZD 1U9IC 4B2LA 2QMEA 2ZRFA 1IXZA 2VYFA 1OH8A 3MMPA 4JLBA 3A36A 4ZCMA 1Z29A 2WWWA 1Q21A 3VR3A 1T3LA 2BKEA 4G5OA 3T1VA 5AJZA 2HCBA 1ZM7A 4IDOA 5AJXA 3GP8A 1QVAA 1G20E 2IF2A 4C0HA 1XD2B 2D7DA 3KXIA 1E9AA 2A3RA 3K9HA 4AKGA 4NU0A 3VTKA 1YR6A 4G5QA 4TQAA 3Q7PA 3GFTA 4TYYA 3FDIA 2C77A 3B1YA 4LBVA 1P9NA 5KOYA 4IHQA 4DLUA 4ASUD 2GILA 2IT1A 3DKVA 2AKYA 3M4YA 2LCFA 5L8VA 1SVKA 4JBWA 3KFVA 4M9ZA 1HQYE 1EFTA 3GLHE 1W36C 1Z0IA 3QUSA 2O8FA 2F1RA 1AZSC 2O0JA 5FUVA 1M74A 3AVWA 4BE7B 1R8QA 1IM2A 4IOKA 4EPVA 4YMUA 3K70D 1F60A 3GJ6A 4YXWA 1JI0A 3U3OA 3I92A 1W2HA 4C0QC 1E0JA 3GLGA 3NWJA 1DPFA 4V0LA 3QPUA 3ETLA 4LDJA 3L8YA 1G3IA 4P33A 5JECA 3HP1A 2AN9A 5IHPA 3R9XA 1R5OA 4A6XA 5CLLA 1E9RA 3NHAA 3SR0A 1OPXA 3KL4A 3LD9A 5JWOA 2ANBA 2GBLC 4BEJA 3KKQA 1S3GA 4ERNA 2EFEB 3RANA 5B58C 2ZROA 2GXAA 1LB1B 3CM0A 4I1OA 3V9PA 2FV8A 3KJEA 2HXYA 4AURA 4F7WA 4PC3A 1NRJB 2PJZA 2ORWA 1WF3A 2H57A 3BORA 3CB4A 4QGHA 1KKLA 3DVLA 4LWZA 2QPOA 5DE3A 2O0HA 3FYHA 1OKKD 1E1QA 2AX4A 2HJGA 3TIFA 3QXXA 2J87A 2J1LA 3IPXA 1HV8A 4BQSA 3E5HA 3QQ5A 1HT1E 2WSSA 2QQ0A 3EG5A 5IT5A 1IXRC 4JS0A 2IYRA 5JRZA 3I61A 3H4MA 4FMCF 1E2KA 3D8BA 2VP5A 4GZMA 4RCYA 3VX4A 2VSOA 2FDCA 3TW8B 4QBFA 2VH5R 3CONA 4HB4A 4TT3A 4TTQA 2ZUCA 1T91A 2ZRIA 4W5HA 4A2WA 4ZDWA 3NC0C 1EFUA 4HEJA 5H68A 1Q1BA 2IYUA 2BMEA 3KJGA 4I1VA 4M8NE 3SFVA 2PX0A 5SZKB 5GJWC 1R5BA 4LBWA 3WP0A 2C9OA 4W5WA 1CJUC 5G40A 3TMKA 3OESA 3K70C 4FMCB 3DM5A 1JJVA 1X86B 3LWNA 3EX7C 2IHYA 3KUDA 3W3ZB 4CYMA 4O2LA 1Z6TA 1BKDR 4NCJA 2WJHA 4ABYA 2OV2A 1SVLA 1JAIA 1P61B 1SXJE 4LSGA 1L8QA 1F2UA 3NH9A 5G53C 4ARZB 2O8DA 1VCOA 2WWXA 2IYVA 1N3BA 3KKOA 5DHAA 4URXR 4F93B 2FX3A 2YC2C 1ZD8A 1S4QA 2BM0A 3KDSE 4OI1A 1OW3B 2XZPA 5L3QB 1SZPA 3K1JA 1FNNA 1EG7A 3ONWA 3MSXA 2Z4SA 3LA6A 1ZJ6A 4Q4JA 3QG5A 3GJ8A 3IDQA 3RRYA 2UZIR 1YRAA 3I5YA 1HE1C 2ZAMA 2IWHA 2OESA 3CBQA 4X8OA 1DAFA 4HLUC 4YXWD 2ZI6A 3Q3JB 2XXAB 4TZ0A 1Z83A 5FBVB 5AUOB 3QENA 2DBYA 2KBEA 4EJSA 1PLKA 1VCMA 1Q22A 2HDNB 5FPSA 3SN6A 1XTIA 3RC8A 1E9EA 3T12A 1S1MA 5J47A 4PPQA 1RZ3A 2ZI5A 2IXGA 2V8OA 1FTSA 1N6KA 3K0FA 1R0YA 3R7WA 1XEXB 4WZ6A 2W6JD 5FUXA 1WCV1 4Y0AA 2C98A 2FZ4A 2EFDB 4NBSA 3T5DA 1E79A 2ZI9A 3KTAB 3QNUA 2X19A 1M2OB 2IEZA 3RLFA 1YR9A 1LW7A 1NG1A 4JLAA 2W2XA 1E2MA 3I73A 1COWA 4WIAA 5BWMA 4LOAA 4BPBA 1Q20A 3K09A 3GJXC 3TGPA 2Y8EA 3S1AB 3WNCA 4GP7A 2ZRPA 3NBZC 1PUJA 2YV5A 2ZI7A 2WJYA 1WMSA 2IXFA 2WJIA 1OE0A 3DZDA 1NMYA 1E9CA 2ZU0C 2FGKA 3DOFA 2J7KA 1J7KA 2G6BA 2W00A 3QE0A 4TTRA 4KYUA 2ZSFA 1E69A 1N6IA 5K8IA 1NIPA 2I4IA 3ZJYA 3PEYA 2ATXA 4MRRA 4YMSA 4JVNA 2C9YA 4A4DA 1EFRA 2ZRKA 4ZI2A 4A0RA 2ASEA 2FE4A 2ATVA 2P5TB 1B0UA 2QL6A 4UKDA 1B23P 5FPTA 4M1TA 2QTHA 5AUQA 2GXSA 4Q4AA 1XTKA 5HCIA 4CEJA 1YZQA 3SYKA 4R7ZA 2F43A 4XJXA 2R6AA 2C96A 1F2UB 3MD0A 4FCWA 1OH7A 4CEHB 2C95A 1D2EA 2FZLA 5P21A 4DCNA 4OJQA 3AVYA 4HI0E 3KB1A 1P2TA 2ZRCA 2NMVA 1TMKA 5JS7A 1XXHB 4KAXA 4DUGA 2ZANA 3QVUA 1U81A 2J0VA 3GCGA 1E1RA 3QF4B 2HV8A 4DT1B 2Q3HA 4NYJR 3TLXA 2JLWA 3THYB 3AF3A 1MH1A 1KHTA 3EZFA 2IUSA 4GMDA 2CE2X 5TMPA 4NH0A 1NN5A 2PMDA 5JHGB 3Q7QA 4MKHA 2G0NA 2OILA 2BBWA 4W7SA 2WWYA 4DBLC 1DTSA 4RCZA 4XVRA 1RW4A 2WAXA 1XWIA 3TQCA 5BN3A 1U0JA 4UQOA 5EP1A 4XD7D 3AVUA 2Q21A 3CH5A 3DOEA 1E79D 3U6KA 3RRZA 2IWRA 4HAUA 4TLAA 5KDLA 4P32A 5FUYA 5L3SB 2QMOA 2A5FA 2ZRDA 4NMMA 2XZOA 1SVIA 1COWD 1LF5A 4N1AA 4B3BA 5JSZA 2CHGA 3A1VA 3IPYA 1KO4A 5FPYA 1H8HD 1SHZA 4KU4A 3GEHA 4PZLA 1BMFA 5JRJA 3GLIB 1EGAA 1O3YA 2RAPA 3CR8A 4DLYA 2MSEB 2X1VA 1SGWA 4EPYA 4E07A 1KY2A 3CWQA 4UXJA 2RGGA 1P60A 3B6EA 1ZD1A 1PUIA 2RGCA 1GFIA 1Q1QA 4B47A 2HJVA 4Q1BA 5C46F 1U0HC 4AC9A 4TYWA 1G7SA 4KCGA 4YC7A 1G19A 4B33A 1NSFA 3IIJA 2A7QA 4NKRA 1OIVA 4V0ME 4WW0A 3SU8A 3VR2A 1ZP6A 4MITA 4ESHA 4ZCIA 3MGCA 2O8CA 2ZXUA 3OFND 4I1SA 2GJSA 3AVOA 4ZIRA 1J90A 3BRWD 4MH0R 4N3NA 4UNQA 5GVRA 4B76A 2DPXA 4MRVA 4L8GA 1JR3A 1VCIA 1IN4A 1ZM3A 3BERA 2J7PA 1P9RA 4HB0A 1E98A 3C5CA 4JSTA 4MA4A 4CEJB 4AD8A 3H84A 2YKGA 2WIBA 3QKSB 3C5HA 4P3YA 2OCAA 2QA5A 4WXPA 4BLQA 3SZRA 2ZQ5A 1EFHA 2VEDA 1G21E 3B8HA 3NEJA 4PX9A 4AKHA 4JVMA 3VU9B 1E2IA 2ZS8A 5CM8B 2QU8A 3LBIA 2AFIE 4EPWA 4JT2A 3UATA 2GJKA 3AKEA 3CRQA 3B82A 1T0JB 2OFXA 4HLCA 1E2LA 2JLSA 2ZJ5A 5CIQA 1VKJA 5TB5A 1UEJA 4E22A 2OCBA 1N6RA 2C2HA 5FL7A 2ZYVX 1E1RD 2WJVA 1GNRA 4DB4A 2D74A 4HZIA 2ZJ8A 2WWGA 4C7OB 2Z5FA 3ZS9A 1N0WA 1Z07A 5AJWA 1LTQA 2CLCX 2IYZA 5GADl 4RD1A 1AS3A 4CGZA 1NJFA 1YE8A 1XPOA 2RB4A 1BS1A 1US8A 1NBME 2BEKA 2IYQA 2Q9BA 3M1IA 1DBSA 3SS8A 2DCUA 5IRCD 1FMLA 2AK3A 2VHTA 1LNZA 3QI2A 2ERYA 1RVDA 3CRRA 3QF7A 2KE5A 1N0VC 2WPDA 1GDDA 5TDHA 3I5XA 2JGNA 4MKIA 2BIFA 4LJ8A 4NYJQ 1O87A 1UBGA 2KBFA 4HZUA 2P6RA 5M04A 1XNJA 4KITB 1S96A 5FH9A 1PVOA 3O8CA 4PANA 4I4LA 1PV4A 1UBCA 3P20A 3FTQA 2VTKA 2D2FA 3ND8A 4NL4H 4KO8A 4B44A 5FTNA 2GCNA 3E70C 2JJ1D 1P2UA 3W8RA 1W0KD 1ZRHA 4DDTA 4ZCLA 1R0XA 4KVAA 3MWJA 3LW7A 2BMFA 4JLNA 1KK2A 3VAAA 4U7DA 1DVRA 1Q3HA 3REFA 3V00A 1WE2A 5IF9A 4XSGA 4Q1EA 1JNYA 1EX7A 4Q7JB 1J99A 1GZSA 3GFPA 4EPTA 3K0CC 2JIZA 1OHHA 4QKQA 4TSFD 1T3HA 4LJ4A 1IAQA 1BOFA 1MO6A 1OXUA 2H1LA 2VF7A 1WA5A 1GSIA 4US0R 4CIDA 1RPZA 5TV2A 1RIFA 1JR3D 1FUUA 1ZMXA 4DCUA 2VLIA 4QXAA 1G8GA 2KSQA 3GLIE 2R6GA 1Z0KA 2V55B 3EC2A 3A58B 4JSYA 2FF7A 1HY3A 2CVHA 3HPRA 3BJIC 1E2DA 5FI0B 4C3ZA 3SYNA 4QRHA 1U9IA 1NN0A 2QRZA 4OK5A 4EIWA 5EE3A 1GL6A 3FKQA 3TR0A 5JCZA 2J46A 4NPHA 2IYXA 2JLQA 2HF9A 3VX3A 2QP3A 4KSBA 3QEJA 5CLQA 1XJQA 4AY2A 1X8KA 4GI7A 2I1QA 3VQTA 5AK0A 2RGEA 2NIPA 1W47A 1GL7A 2FPMA 3GJ5A 1FNMA 3E2IA 4IVPA 4LYHA 1HT2E 2GK7A 3TRFA 2VA8A 3MWYW 3U3JA 4OK6A 1U2RA 3AUYA 3ZD6A 3TUZC 3UPUA 1KZGB 2LKDA 2F7SA 4IDQA 4KV9A 2QEQA 3EZ9A 4DLTA 5FBQB 1U99A 2G0TA 2CK3A 3PVSA 1AM4D 1S2MA 3G5UA 1IN7A 2VP6A 4BFYA 2QQEA 3OIUA 4JKYA 4MRSA 1PZNA 1JEDA 2CLDX 4QHSA 5FBRB 1TF7A 2NZJA 1Q1ZA 4L9WA 2REOA 5SZIA 2WTUA 5EE0A 3OEEA 3REGA 3EPLA 5FTKA 2WPDD 3SFZA 3W9YA 4NYMQ 4DXAA 2BC9A 4DVGA 4LJ6A 1QHIA 2XNDD 4GMXA 5B57C 2C8VA 2ZE8A 5C4GB 2ZAOA 4BEBA 4M9XA 4UNNA 1GWNA 1YR7A 2GBLA 2P6UA 2FPLA 5E4FA 5HE9A 3UG7A 4S35A 3ZIAA 4B32A 2W0SA 3W6OA 1MO3A 1IOZA 3RRNA 3GLHB 5DI3B 1VG1A 5C4MA 2XSZA 3PEWA 2O5VA 3LLMA 2ZR0A 4D26A 4Q1DA 4LJ5A 1ESNA 4KYIB 5E7JA 2AD5A 1VECA 2DFLA 5BW8A 5LDDC 4A0GA 4EKDA 1XTSA 2GF0A 3RS0A 2YNMA 1R8SA 2ZRJA 2CEAA 2JIZD 2Q0HA 5KSZA 1OHHD 4WOPA 3A8TA 1KIMA 4ASUA 1BYUA 5F9FA 1MABA 2ZM5A 2OHFA 2O8BA 2EQBA 3QY0A 5A4JA 4KJZA 1TQDA 4MGZR 4QGFA 1C1YA 5DIFA 2WBLC 3UMRA 3RAPR 4DSUA 4F38A 5KHOC 2HYDA 3U44A 4RZXA 2PZGA 3GQBA 2QE7D 5EE9A 1JEEA 1HYQA 4JMPA 1D8TA 3QXSA 3ZQ6A 1NN1A 3H2YA 1T0HB 1ZM2A 1Z63A 1G7TA 1P72A 3C7KA 5HZHA 4Q9HA 1GP2A 1SHKA 1Z5ZA 3QBVA 2D06A 1DAGA 1ZVQA 2CL7X 2ZREA 5EE1A 5J4LA 4OHYA 2RGDA 4Q19A 1E9SA 3CZPA 1E2JA 2XAUA 2F1JA 1UKEA 1G8HA 4GOJA 4BECA 4WXRA 1CR2A 1Z0FA 1MR3F 2GCPA 5K8TA 2REXB 4CDGA 1JR3E 3TUJC 4L5BA 1N5LA 1LV7A 2F3TA 1KI6B 5KSOA 3W6NA 1W36B 1IXSB 2V4ZA 4CEIA 4IRUB 2O8EB 4F4IA 1P7CA 3UG6A 1D9XA 4Z8XA 1VG0B 3ZZTA 1OKKA 1UADA 3MRSA 1MRSA 3AGQA 2PL3A 1DAIA 4A8JB 3EWSA 1QBKC 4HLUA 3DL0A 4LBYA 4DSTA 2BKUA 2JLRA 3PV0A 5DN6D 5KU1A 2OLJA 3SJCA 2E1RA 2MMGA 4Q66C 5C1BA 3AF2A 4KFTA 4Q4HA 4ZDIA 2QBYB 2WOJA 4B6FA 3J81k 1U90A 1RFLA 1R7RA 1WB9A 1FOEB 3BB1A 2F3RA 4Q01A 4F4CA 1EK0A 3D7MA 4QFMA 1IBRA 4Z54A 5HPYB 2P67A 4BFTA 1G7RA 1KI3A 4OHXA 1KI2A 3WY9A 5CYPA 3LXRA 4E03A 5BXQC 2V7QD 3ASZA 1IONA 3TR5A 1XD8A 3LXXA 4GSYA 3THWA 3IQXA 2ZS9A 3CF0A 2BDTA 3QIAA 2GCOB 3F3YA 4GOXA 1SVOA 2YVUA 4POAA 4TMWA 1ZINA 1KMHA 2ORVA 4XWAA 1KAGA 4BFXA 2GXUA 1T5LA 1TQ2A 1CJTC 2JLVA 1UM8A 2VSXA 1FX0B 4ACAA 5KNDA 1UKVY 2GVZC 5CITA 2QAGC 1E94E 2OXCA 3K9LA 2PLRA 4P4SB 2ZEJA 3CPJB 1P73A 1TF2A 4Q7LA 4B73A 4Y0VA 2ONKA 3DEFA 3IKJA 2JDID 1DE0A 4PHFA 1QHHB 1F2TB 4XH9B 2XB2A 1FW6A 2Z0MA 1OXVA 1Z47A 2VHJA 2AK2A 2GAOA 1QHNA 3FHTA 1NIJA 2WSMA 3B78A 1OF1A 1E9FA 2FSIA 4U5XA 1QG4A 2ERXA 4QJ3A 5C2JB 1TF5A 2ODBA 3NIBA 5DISB 2XJ9A 1E0KA 1YZTA 1PJRA 1P9WA 1KAOA 3AUXA 1NLZA 1NLFA 3RS5A 1U0LA 1X6VA 2GEDA 4MUAA 4NCHA 4OI2A 2VP9A 3AGPA 4IFBA 3UIEA 2W6JA 1G3RA 2P2LA 1F3OA 4HUQA 2UKDA 1MO5A 2DFNA 2WZQA 2XEXA 3CWZA 4URUR 3RS4A 3ZS8A 4CT5A 1KZ7B 1W0JD 2B6HA 3FHCB 2VP0A 4FD2A 3SJAA 4DWJA 2K5UA 1GRNA 3UWKA 3A6PC 3ADBA 3EPJA 2WWFA 6Q21A 3FMPB 2L0XA 3THXA 3OEHA 4WZAE 2W83A 4LYJA 1KO1A 1EFCA 2XITA 1HE8B 3CX8A 3MCAA 621PA 2LWIA 2V1XA 3LH5A 3I3SR 721PA 4MGYR 1CLUA 4OQFA 3WHLA 2FSHA 3EASA 1KKMA 3SDZA 5LD2B 3SQXA 2P0EA 2WICA 4M1WA 4XWKA 1S1CA 3B60A 421PA 2ZR9A 3SOPA 1ZNZA 4V0NA 1T9HA 3R8CA 1LVGA 3QEOA 1W5SA 5EXTA 4QNMA 1P2SA 4Q9JA 4Q9LA 1XJCA 4PSVA 4DB2A 1N5JA 4CZ2A 1ODFA 3VR4A 2GESA 3P32A 4NP6A 5AUPB 4B6EA 2IUUA 3NC1C 2ZIAA 5IK2A 5FFMA 4RD4A 1ANKA 1VIYA 4C30A 4HAVA 4EPRA 2AXNA 3W34A 3SBDA 4IDPA 5DGXA 4PC6A 1ZC3A 2ZJOA 4FN5A 3MJHA 3P4YA 3CX6A 4US2R 1AS2A 4O3MA 3FOZA 2ZVPX 1XF9A 4R2HA 3NDPA 1JB1A 1W4CA 1JECA 1X3SA 1BO6A 3EIEA 4LYAA 5FL3A 1XMVA 1A5TA 1NY5A 1VIAA 2DY1A 1KO5A 3QVVA 4KFSA 2FH5B 4PHGA 2D7CA 5JLJA 4RY2A 4Q03A 4R2IA 3EPHA 4DZZA 2FEMA 3ZVNA 1UFQA 2GHIA 1W2GA 2VP4A 4OHWA 2ZTSA 2ORIA 2YYZA 4YMWA 3Q72A 4EQ6A 1MOZA 5UKDA 3BBPA 2HT1A 2ZR7A 1HEIA 1IN5A 3U3RA 4NCKA 2O8FB 2Z43A 3PIRA 5EE5B 3EA0A 1R5NA 4HLDA 1R10A 4RSGA 1S0UA 3HJNA 2F1IA 2ZPTX 3W3AA 3H1TA 2ZRLA 3BFVA 3X1XA 3PUVA 4ACBA 4BLPA 2J5XA 1QVRA 1UEIA 4YDSA 4AG6A 1E32A 1ZBDA 3GLGB 3RNLA 3AVXA 4PQRA 2YHSA 3RS7A 1NLYA 4H1VA 2D2EA 4RJLA 2OEPA 1OB5A 2JLXA 2OFWA 5FOUA 3BXZA 2DYKA 2NTYC 3TNFA 4OQMA 2ZJZA 3GJ4A 2BCJQ 2IA5A 5KPDA 4LBZA 2CXXA 1NJGA 1KGDA 1YZGA 3L8ZA 4UJ5A 1D6JA 1GKYA 4XD7A 4XIGS 4B3GA 3FE2A 4U00A 4C0SA 2IS4A 2CL0X 4BLTA 3PR1A 3OF5A 2GRJA 1XU4A 4IJMA 4QM6A 1N25A 3LAWA 3OEHD 4RVCA 3ADCA 5EUMA 3THOA 4PO8A 2DFKB 3W8NA 3R9IA 3R9WA 1TNDA 2NO9A 2I1VB 1H8HA 4AWXA 1WBDA 1DAEA 1D2MA 3VFDA 2KWIA 2H16A 1QDEA 2OE2A 3GJ7A 1QHSA 3AVTA 4B34A 2V1UA 2NPIA 4PHTA 1T6NA 2IK8A 2QPAA 3QOFA 1NVXQ 3WYAA 1AKYA 3KUCA 1ZAKA 1BIFA 4GBMA 4MUBA 4MDFA 3IIKA 5FI1B 4ZDJA 1M7GA 1F6BA 1KO7A 1G6OA 4N0DA 2OT3B 4MDEA 2C5LA 5HR5A 1DADA 3T06B 3U3MA 5AJVB 4PPNA 3FMIA 3L0IB 3B85A 3T34A 4YONB 3OFNA 5IK2D 3W90A 4DEYA 4K8OA 2GF9A 4HAWA 2FEOA 4HDCA 4BGDA 1T5IA 4IOJA 3G0HA 5CB8A 2RGNC 1MT0A 3MLEA 4IEIA 3RSLA 1GUAA 2BBSA 4YLGA 2R9VA 1ZIOA 3U7GA 5DYIA 3PXGA 4YMTA 3X1WA 1SVMA 5CK5A 1X1RA 4L4UA 2H17A 4ZO4A 1W4BA 2O8DB 4GP6A 4G5GA 1G8YA 4A36A 5F98A 5D3MA 1N6LA 4LHWA 4IFEA 4C0JA 2J0UA 1F5NA 2EYUA 4ZKDA 3B1VA 4Q5IA 1M6NA 3L0SA 1G3MA 3K0CA 4JYBA 4Q4JB 1EWRA 3T1OA 4ZKEA 4LV5B 2BBOA 2RHDA 3JVVA 1QG2A 4KODA 4M1OA 3QJYA 3RWMB 3UK6A 3K0SA 3BIFA 1XFAA 3ICEA 4MYTA 4A1FA 3OE7D 4EJSB 2YWHA 2JLYA 3B1WA 2IYWA 3GLFA 4O2RA 1E2EA 4AIIA 4DRZA 1J8YF 1OYWA 1JBKA 2BJVA 3PCRB 4EDHA 5J4KA 1JXOA 2JLUA 4PTLA 3K0FB 3R7WB 1UDXA 3IBYA 4Q1FA 4TL8A 3TBKA 1GRQA 2E9SA 3DMDA 4QNRA 4TMKA 3NHBA 3HU3A 4LZZA 3EZ6A 2PX3A 3UXMA 1G1MA 1E2HA 4D2IA 4DLZA 2YOHA 1JALA 3LVQE 4NCIA 4XTCS 3PFIA 3PITA 3CKLA 5ANRB 3SJBA 4PZYA 1N6OA 3IEVA 2B92A 4BZXA 3MG9A 8OHMA 1Q3TA 1AJEA 3GLGE 1NNEA 2JJ1A 3P4XA 4C2TA 3ASYA 3I4LA 1Z6XA 2ZRNA 1TEVA 1W0KA 4D0NA 3C15C 2GZAA 4DSOA 2ZJ2A 2RCNA 4OQLA 4A2QA 1UPTA 1XZPA 1ZU4A 2F55A 4C4PA 2JLZA 2OO7A 1M8PA 1XCPA 2AFHE 1GG2A 1S3SA 4GFDA 4K46A 3TJZA 2QTFA 1KJZA 3SNHA 3JVUA 2EWVA 2IHBA 1XMIA 2WHXA 3F8TA 4TSFA 4DLXA 2OZEA 3EZ7A 4OHVA 4BZQA 4UNPA 5FR2A 3BK7A 4C9BA 4EPXA 3BS4A 2QAJA 1DAMA 1HURA 1ZM4A 2F9LA 2R6FA 2NPFA 4D4LA 2XGJA 2ZRBA 2JCSA 4HLQB 2XNSA 4E5UA 3LFUA 4Q4AB 2ZSEA 2NO7A 5FBLB 5KNCA 2F43B 4TLDA 3TSOA 1NMZA 2F1HA 2FFBA 1XPRA 3A1TA 4FIDA 3U7EB 1DAKA 2AKAB 1S9DA 2D3WA 4D0GA 3WRXC 5JZVA 1CP2A 3KJIA 3MUFA 4URVR 2HEIA 2OM2A 1CULC 2GEVA 2V3CC 2BVNA 4NDZA 4OQNA 3B5JA 4U02A 4V0KA 2NO6A 1TUEA 4QJ5A 2OLKA 2QP9X 2PZEA 1ZU5A 2WKPA 3ZZUA 3TUIC 3AVQA 3U60B 4TMTA 4LJ9A 1R4AA 4NYMR 4RD3A 1SVSA 4M1SA 1K5GA 3CUEF 1BYIA 2GWHA 1KK1A 2ZE7A 1L7VC 4DLWA 1KJYA 1KMQA 2CBZA 2FGJA 5H1YA 3ZQJA 2H8KA 1XB2A 3GLFB 5DNYB 4TYPA 4BFZA 2GJAA 1GVNB 1AS0A 1XEWY 2RGAA 5G3YA 1N2CE 4II7A 1OIWA 2CNWD 1ZNXA 3AKYA 3WHKA 3N5CA 2XNDA 2FFAA 1MO4A 3AP2A 3ZDQA 4C2UA 2CVFA 1VMAA 4L9SA 3WMEA 4D80A 1HUQA 3NG1A 3O47A 4Q1CA 3KKMA 3AV0B 1GL9B 1DAHA 1H8EA 4KHZA 2D62A 1G8PA 2IEYA 1J70A 2R6CA 3K0AA 3ZZ0A 2BWJA 3PEUA 2VP2A 1KO8A 4Q4LA 1RRFA 5JSZB 1CRQA 2W0MA 4I81A 1L4UA 5G3ZA 4AKEA 2BV3A 1GTVA 3SE0A 2WOOA 1T3SA 1G6HA 2E87A 3PG5A 2QI9C 1FZQA 4IKEA 4Z1MA 1XX6A 4NONA 1LF0A 3AH8A 3CZQA 1CU1A 1E9DA 4UNSA 121PA 2FN4A 1W49A 2ZSDA 1N6HA 4IDHA 1NN3A 4PQFA 1RJ9A 1NY6A 5DO9A 4B74A 2WVJA 3HDTA 4LV6A 3ZLJA 5JJIA 1UDWA 4QG7A 1RYFA 4XTRA 4A2PA 3K8YA 3D31A 4MYUA 3X1DA 4H1UA 4B75A 2O8CB 2CCJA 3AP1A 5FTMA 2OCPA 4ZIRB 3NH6A 2W2VA 3PUZA 1G8FA 5JI2E 1F48A 3BWDD 3DPUA 3U3KA 1EWQA 5J40A 3TKLA 1HH4A 2EYQA 2J45A 3LX8A 2FFQA 3PEVA 3AF4A 4AI6A 1YRBA 1CIPA 2EWWA 1E6CA 2QE7A 3B9QA 2XOKD 2YC4C 1ZNYA 1TX4B 1E2QA 1FP6A 4DDWA 2QZ4A 1DG3A 1NVUQ 2RGXA 3O8DA 4OL0A 4XOIA 3A37A 3BB3A 2ZVQX 2ZITA 1DS6A 2QM7A 1KI8A 1RE0A 3FKSA 3CNNA 2NGRA 4UNRA 5LB4A 2J0QA 1AK2A 4JVSB 3Q5EA 5CK4A 1SVWA 2ZUDA 2QAGA 4D4JA 4WBSA 1KK3A 3A1UA 2H92A 3DKPA 3V4FA 4D0LB 2IX3A 3FWYA 1N6NA 5DHFA 4BWYA 4PPFA 5AWFC 3I1FA 2NZ8A 1US8B 1Z3IX 3HU1A 3B2EA 4KXFB 4PAMA 5JEDA 4I99A 4QBHA 3IIMA 1OLOA 1QHXA 1EX6A 4PO1A 4W5JA 5DN6A 3Q85A 4X8MA 4IOMA 2CE7A 2X2FA 2GK6A 3EC1A 4HZUB 1KYIA 4ZV4A 2BMJA 1NMXA 2FJUA 2QNRA 1H8ED 3H86A 3QPVA 4EFMA 1RRGA 1QF9A 3B9PA 1G3UA 1XZQA 2P65A 2ANCA 5KDOA 1XP8A 1RKBA 2YZ2A 1GNQA 1OT3A 2AL7A 1G17A 2B7CA 2V7QA 2RHMA 1E99A 3TH5A 1W7AA 3GLFE 2VO1A 4Z1MD 2MSDB 3NVAA 2N46A 2FWRA 2G3YA 4XWOA 5EP4A 1CXZA 1D2NA 4QOSA 3ADKA 1SKQA 4LHZA 4A0FA 2QG6A 2ZYUX 4M9SA 3BFXA 4LUCA 3NEYA 4C0LA 2WV9A 4BRWA 2Z4RA 4LPKA 2H7VA 3C4JA 1YZNA 2A5JA 4JLOA 2WJJA 2FFHA 1G18A 2CMKA 3CPHA 3X1ZA 4BFSA 4ZPXA 3EIQA 1KK0A 3IBGA 4NCNA 2HF8A 1XD2A 3AKDA 2JJ2A 4XVUA 5KSYA 2R44A 3UMSA 3OIWA 2JDIA 1P6XA 5BN5A 3IHWA 3C8UA 2AXPA 1KI9A 5TARA 4RD0A 4M0LA 1JQLB 1NI3A 3VMFA 4GRAA 2FG5A 2FU5C 4JIMA 3FFAA 5BQ5A 3WBKA 4HAYA 1E2GA 4Q7MB 1YVDA 3FKSD 1WBBA 2ZRGA 1G64A 3D3QA 4OQXA 5JEEA 2ZS7A 2TMKA 4KSCA 1GM5A 2BBTA 2QM8A 2BHRA 4MGKR 3PUYA 4L16A 3VKWA 1WXQA 4IEEA 1W0JA 3C16C 2ODNA 4LGMA 2ONJA 1KI4A 2JEOA 3NKVA 3CH4B 3EW9A 4PO9A 2FSFA 1G3QA 3P26A 4DCTA 2VF8A 4TL9A 4IXMA 4AYWA 1VYTA 2H5EA 1JPNA 3X2SA 4B2IA 4AYTA 4HUTA 4S2EA 5TY0A 4BRUA 1CR1A 4KFUA 1KSHA 3F0TA 3FMOB 3KFXA 5GVSA 4NE2A 2GJ8A 3EZ2A 3QBTA 4LHXA 3FB4A 1XMJA 2EFHB 2ZYTX 4FCVA 3HWSA 4QHTA 3PJRA 2R2AA 2X77A 1VHLA 3GFOA 2XTNA 4NTZA 3VR5A 3U61B 1R0WA 5CJ2A 2A5YB 4BFWA 2ZRAA 2Q6TA 4Z8YA 521PA 2OXRA 3TQFA 3KQUA 4Q00A 1U98A 2GTPA 3AM1A 3CNOA 4US1R 3RWOA 5JFGA 1E0AA 1SXJD 2P6NA 4Q1AA 1I4TD 4PAQA 3RSOA 4PQYA 4QC2A 4RFSA 4RZ2A 5DLQC 2OBNA 821PA 1VPLA 2A2ZA 5FOTA 3SEAA 4DKXA 3ZD7A 2AWOA 2BM1A 1TQ4A 2RKOA 5BN4A 3FVQA 1XTJA 1OIXA 1NVVR 1W48A 3SI7A 1YR8A 5JHHB 5JMTA 3ZVRA 4R98A 4V03A 4Z51A 5KSPA 3GJ3A 1I4DD 5JCPA 3V4RA 1E4YA 2AWNA 2PLFA 4BASA 3OIYA 3TW4A 1MABB 2V6IA 1WRBA 3ICQB 2O8BB 3ZVLA 4QL3A 2WIAA 3UANA 2PBRA 3IO5A 2PT7A 2IYYA 5LB2A 1OV4A 5JS8A 2JJ2D 4H9GA 1VCNA 2Q3MA 4Q47A 3QXJA 4NZYA 4ARZA 4RZUA 3U44B 3VNVA 2HXSA 2J0SA 1XCMA 3DMNA 2NQ2C 3WP1B 3H0KA 3K70B 1Z6GA 3HU2A 3SYLA 3CRW1 5L3QA 2RGNA 1NVWQ 2WMOB 3QXHA 4JBXA 2ODEA 3P1JA 4M22A 3WBJA 2B7BA 1J8MF 5DYGA 4LK2A 3JZAA 1Q57A 2RH5A 2XB4A 3Q9LA 3CO5A 3SHWA 5FOVA 1M7BA 1VTKA 1XTRA 5DH9A 5D3QA 1E4VA 5H8WA 1YHNA 2G1KA 4LX0A 2C9CA 3UKDA 2NO1A 4A8JC 4PPGA 1T4GA 4MYHA 1W4AA 2XXAA 4O0MA 2X8AA 3VHLB 1Q1EA 5BYJA 1UBEA 4FW9A 4EUNA 5EUQB 1SXJC 5FPHA 4HDOB 4QHYA 1JJ7A 1OXTA 3KXLA 2GA8A 4CEIB 1GITA 3TVDA 3WMFA 2QSZA 1FL9A 4QBGB 1D5CA 4TN1A 1VHTA 4FINA 2QY9A 1TU3A 1BH2A 1XEXA 1Z0JA 1AQUA 3T15A 1Q0UA 1II9A 3I8SA 2DWQA 3KXKA 1L2TA 4N0EA 1Z22A 5EQTA 2GZHA 5B2ZA 3M6AA 5F9HA 1OYYA 1V5WA 3SQWA 3BB4A 3KTAA 5FOSA 2REBA 2GKSA 4Q4HB 1OJLA 3CLVA 4HSEA 4V0MA 5HE8A 5EJEA 4BLSA 4BLOA 3KQHA 2EVWX 2IUTA 4M4SA 1TEXA 2CHVA 1GKIA 3GMTA 2JASA 3MJRA 1TQ6A 2HLDD 3RC3A 3S1AA 5TXGA 4RFVA 1KSJA 4PAOA 3ECCA 3N2EA 3B13B 4TLEA 2A78A 3QXCA 2H18A 2PCLA 1W5TA 5J4HA 1OFUX 1P62B 4QJ4A 1A7JA 1W1WA 3AP3A 5E95A 5E3HA 3THWB 3I62A 5DSZA 4RFSB 2WMNB 4KI0A 3LLUA 2N42A 1GOTA 1TL7C 2V54A 4PHHA 1Z0DA 4NHOA 2C99A 3I8XA 4GDFA 1KMHB 2UVQA 2QGZA 3AF0A 4GT1A 2BMDA 1QHGA 3EA5A 2GNOA 1K8RA 4MKGA 4RKFA 4M53A 1OXXK 4JJZA 4V0OA 2CCGA 1I4LD 3NTUA 2B8TA 3AVPA 3K9NA 4RD6A 3AKCA 4HYYA 3W5JA 3RDPA 2AHOA 1OB2A 1EESA 1NVVQ 4LC0A 1QZXA 5HTKA 5CDFA 1IJFA 4GL2A 4I1UA 1C9KA 1CJMA 2OFOA 3T1QA 1NBMA 3VR1A 4ZI3A 2OAQ1 5HZKA 4M2LA 1NKTA 4DSNA 4CEHA 4D82A 2IYSA 3OE7A 4MRNA 4D81A 1KY3A 3HR7A 1ZM9A 4M1MA 3DZ8A 4DHEA 1AGRA 1XXHA 1IY2A 4LC1A 3CF6R 3GJ0A 3M0EA 3Q5DA 5IDVA 5JJKA 4AK9A 4Q02A 1KI7A 3GEEA 4B43A 1CEEA 3QF4A 2FMXA 4HUQB 3PENA 4DT1A 1NL3A 3AVVA 3ADDA 4BZPA 3THYA 4OK3A 5ELXA 1FP7A 2PZFA 1ZYUA 5LD2C 3SC3A 1XCGB 2BCGY 3ZGXA 1K6MA 1JQJC 3THXB 4LYFA 1NP6A 2YWEA 4FWTA 1IJEA 2W2TA 221PA 1KDPA 2AR7A 1SKYB 4Q9KA 1YZLA 1ZCAA 4TMXA 4B3CA 4EAQA 2QSYA 3U7HB 2QPTA 2DWOA 2DHRA 4KLZA 5L3SA 2JATA 1JAHA 2OUKA 1R2QA 1TPZA 1W44A 4DLVA 4EFLA 4OI4A 5KDDA 2C03A 2PCJA 5KO2A 1E1QD 1A82A 5KTYA 2CDNA 2NOAA 3OHMA 3U2QA 4ESVA 1MRNA 3GPLA 5KPJA 2WAYA 4RZ3A 4CT4B 4JT4A 2EFGA 1E96A 2WSSD 4JLJA 4FI3C 2C78A 3GLIA 3DHWC 1VYUA 1ZUNB 4C0BA 3ZVMA 2HT6A 5AUNB 1YZUA 4ZDKA 4KFRA 2IS6A 3T1TA 2G88A 1LFDB 2HYIC 2VHUA 2O52A 1KDTA 4OJKA 4JBYA 4TT3D 1FTNA 4GNKA 4L15A 5JWHA 2XX3A 3OAAA 3R20A 4JJKA 3RS2A 1ESMA 2R62A 5F2EA 1GKUB 1Z2AA 3KKPA 4LPSA 5EP2A 1JXMA 1CBUA 3TSWA 2J3EA 3BH7A 3BH0A 4C0AC 4LJAA 3LQQA 1WP9A 2KI5A 4Q48A 4JL6A 5J5CA 1OFIA 1TU4A 2FSGA 1Z6AA 3RRMA 3ZYCA 3DDCA 4B2PA 2IYLD 1HQCA 2VBCA 2ZYWX 4PZZA 4EQ6B 5KNBA 2F6RA 2R6DA 2C04A 3L43A 3U4QA 3EIHA 4XSHA 4DDVA 1XEFA 1DOAA 2CHQA 3IGFA 1NBMD 3QKSA 5H70A 4A0HA 1YZKA 5EXPA 4AYXA 3X1YA 5EXSA 3L2OB 1Z28A 4A15A 1E2NA 3VU9A 2J41A 1S8FA 2GETA 1FQKA 2MMCA 1N0UA 1Z2CA 2W6IA 2YJTD 5CIWA 3K0EA 4B3FX 4G5SA 5G41A 2ZE6A 4BUJA 1UAAA 1G4AE 3EWAA 3K53A 1FFHA 3WMGA 5FTLA 3VNUA 3NBFA 1OFHA 1FQJA 2FNAA 2CNWA 4FMDF 2EW1A 4C7OA 2CLSA 3CNLA 4IXNA 1KSFX 2Z83A 3A4LA 4XVQA 1DO0A 5GJBA 2XZLA 3BC1A 1YQTA 1M34E 2A30A 2VQSA 1XRJA 2QROA 3LX5A 4R9UC 5GJCA 1GIAA 2OG2A 4GOKA 5LBIA 4Q18A 3T5GA 2XJ4A 4F4JA 1SQ5A 2JJ8A 3KB2A 4G5RA 3NBXX 2WWIA 3LW8A 4WZBE 4DCVA 4JLMA 1P2VA 5K8LA 4FMDB 5SZJA 4G01B 4DIEA 1I2DA 1G5RA 2VHCA 1QHYA 1L4YA 3LDAA 4TTPA 3QG1A 4IOLA 4URYR 3I32A 1S9HA 1YJ5A 2OBLA 4YDHB 1H65A 2R65A 4LJ7A 3UMFA 1K5DA 3FMFA 3UWOA 1IY0A 1LS1A 3EXAA 3TAHA 4DLSA 2QN6A 4ILEA 2OBMA 1HTWA 5JJLA 3IUYA 2PMKA 3KJHA 4A9AA 5GJVC 4TLCA 3LRPA 2DWPA 2QT1A 5A0FA 3G82C 2MSCB 2IW3A 4LI0A 4TYNA 5J4YA 4JVLA 4MGIR 4MKFA 1II8A 4CVNA 2VIIA 1OXSC 3OIVA 4D25A 5DI9A 3EAQA 4QM7A 3MAAC 1SKYE 5K8UA 1AN0A 3AEZA 1HA3A 1G16A 3CX7A 3OAAD 3SHFA 2ZJBA 4HAXA 3WXMA 4B71A 3CPEA 2XOKA 2N1BA 4HB2A 3T35A 1EFRD 5HKKA 1UF9A 2PJRA 3VKHA 4PC1A 3KZ1E 2A9KA 3VKGA 4YMVA 3TVTA 3R8FA 1UJ2A 3B1XA 3DM9B 5L3VA 3LO5A 4QGGA 1KJWA 5D3MB 5FBWB 4FWIB 3QKRA 4BFUA 4DJTA 4F92B 5J4VA 4EJSC 2IS2A 2ZUBA 3SJZA 2Q3FA 4HATA 2J0UB 2I3BA 5SZHB 5TVKA 4X8LA 3U4QB 4WA7A 4B48A 2P5SA 3BD9A 4PSKA 4OHZA 3C41J 4B35A 2B8WA 1G4UR 1KDOA 4TMVA 2EU8A 1CR4A 2PT5A 1XJ0A 1Z8FA 2Z6VA 4KLNA 1IY1A 4RKEA 5EP3A 2GEUA 2GZDA 1G5TA 4JZKA 3MWKA 3RVBA 2J59A 1TADA 2D4HA 1AKEA 2W6ID 1QRAA 3LY5A 4LHVA 2QORA 3TE6A 1X8JA 2R8RA 1KNQA 4J0QA 1JR6A 1VDZA 4DUGD 4IDNA 1AIPA 1NSTA 5FOWA 3CIOA 4TQUS 5CYOA 2JAQA 1A2KC 4C0KA 1NF3A 1P5ZB 3K09C 5L3RA 2QGNA 2UZ3A 4Q9IA 2RMKA 2FOLA 2Q9CA 3KX2A 3RABA 3HR8A 4K81B 4P31A 5CDFE 2BEJA 1E2PA 4LCBA 2KB0A 4QGAA 4A82A 4DDUA 2YINC 3CW2A 1XEWX 1P4SA 5FPKA 3PUWA 5FOXA 3O8BA 4YQFA 1XTQA 2F9MA 2CL6X 1KSGA 5F3WB 2QUZA 4TQ9A 1XBTA 3IILA 2IYTA 1OSNA 2Q9AA 2DR3A 1XXHE 4P4TA 2DFTA 1AQYA 1ZUHA 4BFVA 4MYCA 1Z0AA 2QTVB 3U5ZB 1WQ1R 1R0ZA 2QMHA 3P27A 4LJYA 4TYQA 4F91B 1NG9A 4LHYA 1U8ZA 2IC5A 2WWHA 3GLHA 3WYFA 5A5GA 4V02A 5CM9C 1DELA 1LY1A 4A6PA 1W46A 3F5FA 5DI3A 3BOSA 5JWRA 2FA9A 1Q12A 2ODWA 1BMFD 1I2MA 1IHUA 4JLPA 3IQWA 1ZCBA 1TTTA 2ZI4A 3SBEA 1II8B 4TMZA 1TAGA 3HPQA 1AA9A 1CJKC 1OFTA 3AF1A 4OKSA 3W6PA 1YKSA 2PEZA 2EFCB 2FPKA 4TWZA 2HCJB 4MRPA 3NXSA 1KI1A 4AKIA 5KYKA 2NO0A 4DIDA 1GRRA 4JLDA 1CF4A 4IVRA 2G77B 3RS3A 2J9RA 3U7FB 4FCTA 5HKKD 4PSAA 4B3DA 1XPUA 5AJYA 3T61A 1YU9A 1G7CA 1VG9B 2P3SA 1DARA 3LQRA 2VHQA 1Q44A 4TLBA 2QMUA 1PLJA 3QKUA 4PFSA 1ONBA 1PLLA 4URWR 2WKQA 5EXXA 3LNCA 1M1YE 2ZRMA 2J7PD 3QKRB 2GVDC 1DEKA 2G9NA 2A5DA 3A4NA 2VRWA 4PC2A 1W4RA 2ZETA 4FXPA 3ND9A 1Z06A 2PH1A 3LBNA 3GD7A 4JLKA 4QBIA 3ZH9B 1GILA 4NYIR 2G1JA 3HYRA 2BOVA 1KOFA 1IN6A 4LY6A 4ITRC 1GNPA 3FGNA 3IO3A 5JI3E 3D6TB
chains in the Genus database with same CATH superfamily
3QLVA 3IXLA 1YQUA 4ZOBA 1PJ8A 1VP9A 1Y3AA 2WKRA 4CIXA 1LPNA 2O07A 1B6TA 1H4TA 2ECKA 4NPCA 1KEEB 1DG1G 4JEMA 4LFCB 5FL7D 4DCOA 3MS4A 4XX1A 3AI1A 1M10A 1R6BX 5AR1A 2ZAGA 4M1YA 3HI4A 5FT9A 2IBSA 1N6PA 4MWOA 2RJNA 3GDGA 2CJWA 1FB5A 2OCYC 2VQ3A 5CAEB 3LBHA 1KI6A 1J49A 2BGLA 4HFMA 3TSZA 3JWHA 3W5IA 2PU5A 3BULA 1HOXA 4XGKA 4YAKA 1KKUA 2ZWOA 1NAIA 4BNHA 3WRYC 4ZAVA 5AW5A 2JPDA 3KQNA 5K6AC 2JFNA 4XB6B 4Z5XA 2OV6A 3COSA 4BYMA 3PFKA 4D4MA 2CFIA 4A8JA 5AKZA 4D99A 2DFDA 2G71A 3FWNA 2CZQA 4RGYA 2Y4OA 3DO6A 1PFVA 3V1LA 4PICA 3VVBA 4AMBA 4TZ6A 1XMXA 1H5UA 4HDQB 1MV5A 3M3PA 5I3CA 4RZSA 3K15A 4RD2A 2ZE5A 2B5VA 3I6QA 3KQKA 1E9BA 2IJGX 2NYVA 2O2XA 2Z57A 4IVQA 4LV8B 3FJ1A 4N3BA 2DB3A 2IS1A 3AOGA 3FG9A 2EL9A 1H2YA 2LKCA 1CJVC 1L4GA 1SOUA 1EVLA 2V9PA 1KTVA 2YWFA 2GWRA 3DDUA 2XTMA 2HU2A 3PUXA 4KLAA 3EPKA 1Q7GA 3RT9A 5HWSA 1FYFA 3QKTA 5JLAA 1I2AA 5F5NA 4HNVA 4RTSA 4QELA 3F6YA 4AZ0A 3M81A 3CMMA 1PEKE 2PWYA 3N0VA 4P80A 1WTAA 2WNIA 2NYAA 3DKKA 3HY3A 4PNPA 1R88A 3C0KA 2VJQA 4QPDA 3PLAE 1ISRA 1WY7A 1RC8A 1L5MA 4HXGA 5IM4A 1IK6A 3BN3A 1FXUA 4EL5A 4YCNA 1MKYA 2PTGA 1WDTA 3DC2A 3IFSA 4LDAA 4RAOA 5LA6A 3RIXA 4DIBA 5KYYA 1R8XA 2C2YA 2JD2A 4X3CA 4YCJA 2DM6A 3QBEA 3EARA 3SPXA 2OBFA 1T5DX 5FR1A 5BYKA 2QX6A 1YS4A 3O8RA 2QTAA 1QWSA 1IRIA 2ET6A 3WL7A 4RQBA 1FPMA 3EXHB 1J0AA 3PQ6A 2J5QA 5LNK1 1JDBC 4I19A 4WK6A 1YS7A 3WXBA 1X38A 1DC7A 2PXHA 3QSGA 1YRLA 4YECA 2V4MA 2KJQA 3OZRA 4OOEA 1WDMA 4GI1A 1G9XA 4WVFA 3QPDA 1BDHA 1CY8A 3N70A 2CMDA 3K8ZA 3P9SA 3DQPA 3RHFA 3TX2A 3FPSA 2OGWA 4JNKA 3LHSA 2PUBA 2DUNA 1E0SA 3WGHA 1R66A 1C3XA 3HVHA 1E18A 5DHUA 3RU2A 3KVOA 4PXAA 4LVOA 1QFXA 1ZVKA 1YIOA 1OFUA 3DBOB 3C7AA 2VL7A 3I4FA 3IRVA 1TCUA 2O1EA 4QWWA 5JSUA 1UEXC 5IN4A 2ES4A 5FA8A 3WNBA 3M34A 1E3SA 2VLBA 1PJQA 3GRPA 3HYTA 2B20A 1GAJA 4OXRA 2A1IA 1KFCB 5G1NA 4CN8A 4EYKA 3HVIA 3ZI0A 3WYGA 1ELOA 1HYGA 1ZUWA 3ISJA 4JKIA 2QT0A 4AJ2A 2I9KA 1HYBA 3KCQA 4WV3A 1LDGA 2IP2A 1QPGA 1XUOA 3Q8XB 1XDBA 2CXPA 1JVSA 2GN4A 4NYIQ 2N0SA 5KKAA 3K5WA 3KSUA 5ALTA 3VO8A 3FZEA 5CNJA 3RBZA 3GN2A 2CJWB 3QPWA 1ODKA 1U0GA 5DYWA 2UZ1A 3AESA 1ZJWA 1K4MA 2D5LA 3GEIA 2FP3A 3IPLA 2RH8A 4O63O 1OILA 4Z4IA 3FFBA 4RY9A 1ODJA 3HXOA 1ECPA 4RS3A 3FPAA 3TAUA 4DSZA 4UTPA 2UYYA 1AMUA 1J2JA 1YR1A 3O74A 1Z6YA 4D6PA 4LF9B 1WUTA 4CTKA 2PSHA 4GGMX 4OYHA 5C18A 3FAZA 4UUMA 1Z0ZA 1JEQA 2RBGA 2WUFA 2ZRHA 3TZEA 1CS4C 1AHIA 4N5IX 4ZCPA 2IE0A 3ZLTA 1DJLA 3I3OA 1AGYA 1DHTA 3FRIA 2GD2A 2CMGA 4HEA1 4WDQA 2QN9A 4M1KA 2FTKE 2V7EA 5ALNA 3TE7A 5H3LA 1FYDA 1DJNA 2Q2NA 3BGWA 3W7BA 2PRSA 2UZAA 3P2EA 3HO8A 1G4HA 2Y71A 3CR7A 4KVGA 3V1TC 2SHKA 3P0JA 1IEXA 4P0TA 2HRQA 3BE4A 5CG1A 1NI5A 2YJ6A 1CUWA 2X0JA 3VGJA 3VH1A 4GXRA 3BIOA 4JOSA 3DE0X 1RHJA 1WUHS 1CP3A 4Q7KA 1EHIA 4GPBA 1HQKA 1WUYA 1OH8A 3MMPA 4ZCMA 4J0JA 2VCYA 5LA6B 5J58A 4QUKA 1Q21A 1H5QA 1VSVA 3DVAA 3MQFA 2BKEA 3OA0A 4FEGA 4IKOA 4E30A 2HCBA 3C3XA 5K0SA 1QVAA 2FB9A 3AZQA 4EATA 4BJ1A 4CG3A 3K73O 3FFXA 4J90A 4AKGA 5DKFA 3L7DA 4G5QA 3MS7A 1WXWA 5IAEA 3B2NA 5BN5B 3QU7A 3T7JA 2C77A 4LBVA 1ZNQO 3L6EA 1GTL1 4DLUA 4IHQA 2DUJA 3EFBA 4YJ3B 2IT1A 3DKVA 4C6SA 3M4YA 2LCFA 5L8VA 2F8MA 4IF4A 1A27A 3KFVA 3TQTA 4M9ZA 1F8XA 1EFTA 3RC1A 3GVCA 2CXTA 3WL4A 3BXFA 1W1IA 1V5FA 4CF6A 3B48A 3HGTA 4IZIA 2F1RA 1UR5A 4RA9A 1IUKA 3UBMA 2FR1A 5IAOA 1YMUA 2LRHA 4INJA 3DMHA 2BI8A 3BIXA 4P7FA 3WOVA 4NXNB 1KOGA 1Z16A 2VHYA 3UT6A 1VLHA 3GJ6A 3U3OA 1KEVA 1WCIA 4HVTA 2HFKA 4C0QC 2TSYB 4BLUA 3DD1A 4ZOCA 4ZMBA 1DPFA 5LMZA 3ZHTA 4GAEA 3ETLA 1TEHA 2W6MA 4FLFA 4LDJA 5FLKA 3A7DA 3VU1A 4KQXA 5EJ2A 1KFJB 5IHPA 3R9XA 1XP5A 4QD3A 4CMBA 1UBRS 3H6GA 1E9RA 2FX2A 3NHAA 2VJLA 1OPXA 3L04A 5JWOA 4BEJA 5GTDA 1K06A 2XQJA 1SPBS 4LTDA 3OZGA 2E0IA 3WSWA 2ZZKA 1NQUA 2EFEB 4PSCA 5E1MA 4CTOA 5JJ5A 2GXAA 2P40A 1LBSA 2D2IA 2BFPA 3V9PA 2NXCA 3WQSB 3FMGA 2R8XA 3KVYA 3L4EA 3IR7A 4ZGWA 4GPIB 4MRMB 1EIWA 1SHTX 1UP4A 3KAQA 3MIZA 1WF3A 4QGHA 5ICCA 4RTNA 2VZ8A 4ZTUB 3LC7O 3M9XA 3PFFA 4QUDA 4DDMA 3Q87B 5JAIA 3LY7A 2AX4A 3O8QA 1REQB 2HA4A 3KZMA 1UJCA 1HV8A 1NA5A 2RHCA 3QQ5A 1DJQA 2WSSA 4RDIA 2JIDA 3FR8A 4XYBA 3T54A 5LL6P 1FF9A 1BX0A 3EG5A 1FDRA 4W8GA 3SIWA 4X65B 1LSOA 1NJ8A 3JQFA 3VVLA 4A6DA 5BURA 5JRZA 3I61A 3H4MA 3UB2A 5DLEA 3D8BA 3VX4A 4MUFA 4CCWA 4N0MA 3GR6A 4HPWA 4A6PA 3A1FA 4XGRA 3I53A 2X9NA 1F7VA 1CEXA 1FMTA 1MMFB 3IAM1 3PPXA 3V4ZA 2ABWA 3HDYA 2B4TO 4ZVVA 5H68A 2AFIA 4D3SA 4LXTA 1JHRA 2QLLA 2W93A 3V7UA 4I1VA 4M8NE 3SFVA 2PX0A 3DNPA 4DQXA 4NENA 3OTIA 4RELA 5SZKB 1HDYA 3EGIA 1I7NA 1NONA 2CMHA 4KQKA 1MAUA 3D3EA 1WQ4A 2C9OA 4LBWA 4XQ9A 1MOPA 3TMKA 3WP0A 4BNGA 4EELA 4WLFA 1B15A 1YQ9A 3SQMA 2WUVA 3K70C 1P6UA 5E6RB 3EX7C 5GV7A 1DQNA 1HKHA 2QQGA 1X2EA 1XZ8A 2CXRA 3MOSA 4TRNA 3W3ZB 3EZYA 4EJ2A 3SSOA 2OV2A 1LLQA 2II6A 5F73A 2ZBDA 2H48A 1E3EA 4LSGA 1DZ3A 5ES3A 3C8ZA 2R68A 3NH9A 3G8BA 3L6CA 1L7DA 4P4GA 1O7JA 1FJGB 2ZIUB 3HVKA 4MUKA 5KKNB 2IYVA 3EVBA 4D57A 5EMKA 3DV2A 4U7FA 1QVWA 3R6DA 4V24A 2FX3A 1EBUA 3KAPA 2VPIA 2H1OA 1S4QA 3KDSE 5AXAA 4OI1A 1OW3B 3ZBUA 5L3QB 3RO7A 2HQOA 1CRWG 1FNNA 1HK7A 3EMKA 1GNVA 5JCOC 4BO6A 4NSNA 1OAKA 4NBVA 1ZJ6A 4Y3UA 3KSBC 1EP3B 3H42B 4XQCA 1M0TA 3W7AA 3IP3A 3QG5A 1FSFA 3H97A 1UXKA 4RA9B 3I5YA 5TGZA 3HXLA 2OESA 1D0IA 2PZ8A 4HLUC 2QLNA 4CJXA 4J1TC 2HD4A 4YXWD 3GAMA 2X5XA 1OTYA 4WKCA 3ZVMA 1QGED 1H2WA 1WCIB 5AUOB 4TZ0A 1U3UA 4EJSA 1OWLA 2JBAA 4HWTA 4CM7A 2FW0A 5BV2P 1TCBA 1U9JA 1P5JA 3ABQB 2HMAA 1E9EA 2CUZA 3Q41A 1S1MA 1HG1A 4I55B 3R9XB 3A27A 2ZI5A 1F9EA 4V0SA 4Y2TA 5KIAA 1NNLA 2Q29A 3CCCA 4QNNA 4ZZ0A 1THZA 1S6YA 2GO1A 1BJKA 4OUKX 1D1QA 4HDMB 3VA7A 1OQAA 3EGCA 2YVKA 1J2YA 4KPGA 2W2QA 4Y0AA 3HWX1 2GASA 2G36A 4WD3A 3WLLA 3CC8A 3W2GA 3WLSA 3TAXA 3QU5A 4NBSA 5FAKA 5KNLA 3OIDA 2IU3A 3G0DA 2HM7A 1LBQA 2Y99A 3A28A 1R4ZA 4MR9B 4OI0A 5KTTA 2GHTA 3RLFA 1GPJA 5BOSA 1NG1A 4JLAA 1RYZA 3LGSA 4WCFB 3HCPA 1COWA 3A3OA 4RNCA 4LOAA 4WIAA 1QFMA 4AX8A 3WQBA 4F4UA 4ZYVA 5BWMA 1VI6A 4RHYA 5SY6A 1Q20A 3GJXC 2XCTB 4B45A 3IAFA 1J07A 1CVIA 5KX5A 2VTBA 4ZWNA 3E9QA 2ZI7A 3WJ2A 2BYTA 4N76A 2D4AA 3D6AA 3FY4A 2QZ9A 1PS0A 3CFYA 2IZ5A 2X86A 2UV8A 3DZDA 1E9CA 3HJHA 1GUBA 4ITVA 4NPAA 4CQMD 1J7KA 2FSVA 4LZAA 2XQVA 2G6BA 5IFLA 2PVCA 2VXBA 4URFA 3R7DA 4KYUA 1E69A 3ODPA 1N6IA 4KIJA 1NIPA 2I4IA 1UAGA 2ZTHA 3PEYA 2AVNA 2QIPA 2AFIB 3D1VA 3VR4D 1M75A 3A1EA 5KHLB 2ZRKA 4ZI2A 2DJIA 4NENB 3BXPA 1U28C 4KQGA 5EPUA 2G1UA 1CUUA 2VWQA 1ZK0A 3KM0A 4R2LA 3OZBA 1B23P 2V6FA 3N8IA 4RC9A 3FMVA 5EQFA 5I9IA 5KWVA 5ITSA 2WTMA 3DLPX 4GLOA 4KIFA 5JV5A 1Y48E 1CZLA 4Y0NA 5HCIA 1TJYA 4GPD1 1NYTA 4E5VA 3ROMA 3IDZA 4LZLA 1R18A 4PNHA 3P2OA 1ISMA 4GSLA 1XK6A 2J32A 1H1TA 4BRZA 1Q2XA 2I8AA 1SCBA 1GZ5A 1PSWA 1G5IA 4RJIA 1PWHA 1P2TA 2XGMA 1CLEA 5JS7A 1FUIA 1ESZA 3X44A 1XZFA 5ALWA 1N2SA 4QULA 3H1PA 1YTLA 2PRYA 3QVUA 4ID3A 2OXIA 3WK7A 2J0VA 2I4LA 3GCGA 4C76A 4DREA 1G38A 4B6RA 1MTOA 3L18A 1E1RA 1GGKA 4L5AA 5TIIA 2GARA 4KE8A 3PUJA 1TIKA 3OECA 1QAQA 2ZJ0A 4NYJR 5BSWA 1UJ4A 2EX4A 1ESCA 3THYB 5JZMA 3AHEA 4IQ8A 4O33A 4PLCA 1MH1A 4C7BA 4YUAA 5AKLA 4YT2A 2IUSA 4IP0A 2JBAB 2DQSA 4GMDA 1DQYA 1H05A 2O8VA 3K5PA 1OYOA 4NH0A 5EMLA 1WSAA 1WVIA 5LR6A 2JIMA 3HSYA 5SV2A 5I7VA 4U7GA 4RLSA 2CB0A 2R47A 4H6XA 1QU2A 1CNFA 3TLZA 2E89A 3HYSA 4XVRA 1P4JA 1LBHA 4UTOA 3V8MA 2YIMA 4M0UA 5EP1A 2JVKA 3G8CA 4J43A 1B6GA 2Q21A 3EAFA 4CLOA 3DOEA 4JDUA 3WV4A 3U6KA 4OUDA 2IUFA 4L5YA 2IWRA 2JFVA 3A1CA 4HAUA 1H0KA 4TLAA 5KDLA 4Z7JA 4OBXA 1T0PA 3WGJA 3H8JA 3HU5A 1C7JA 3E81A 2OA0A 4Q4CA 4GYKA 5JSZA 2O59A 4CLRB 2BN4A 5BVHB 3OP1A 4DN6A 3P45A 3PHBE 1OT5A 2EXXA 5FPYA 1H8HD 3PXAA 2A0XA 1SHZA 2H4XA 2R6HA 3BUSA 4DMKA 1EGAA 4UFNA 5T3UA 4BMDA 3UV6A 2R79A 4MIYA 4ZEWA 2JD1A 4YWHA 2X1VA 4DLYA 4L74A 1CW2B 2HH9A 3KQVA 4QYXA 3WRYA 1PNRA 4X84A 1E64A 3CWQA 3CTPA 1ECFA 1P60A 1VA5A 3ET5A 3SF0A 1ZD1A 4AXXA 4D74A 1VGVA 4JB0A 4ZQEA 5AKGA 4ZZ3A 1GA6A 4AMVA 5LQDA 5C46F 1DIOB 2H5JA 3MAGA 3E5MA 1GTJ1 1U0HC 1IUNA 1G19A 3IIJA 4ESHA 3VR2A 1ZP6A 1IJBA 3A9VA 4EUEA 5FV4A 5JXWA 2JFFA 3WAGA 1V7QA 2C5BA 3AVOA 4ZIRA 1POWA 2BEUA 1C14A 3LDUA 2W7TA 4N3NA 4UNQA 1FLVA 3E0QA 4OXQA 3GDWA 2QUJA 3TSAA 1ZM3A 5CXSA 1HFWA 2RAFA 4Y6QA 3HI6A 3OMXA 5D2CA 3VVMA 1H1LA 1E98A 1FDOA 1SUFA 1UJMA 3A25A 3CXRA 1WVMA 3UFXB 5DMXA 1U4OA 4KQFA 5J5VA 3ZE7A 1I7DA 5ESWA 3L7NA 4BVBA 5HX7A 4G56A 5E9WA 3L0BA 4P3YA 2OCAA 1TKAA 4WXPA 4ZJUA 5B6PA 2FZWA 2ZUUA 3O4IA 4MA5A 4RZHA 1C8LA 2Z09A 4J2OA 4E5YA 4NEHB 4EB3A 4AKHA 4JVMA 1A3CA 2WSIA 3BCSA 3PR2B 5E8JA 5HF6A 2ACEA 5CM8B 5IDWA 3RI3A 1VSTA 3HLTA 3PFBA 4G81A 1TFUA 4WLEA 2ZDGA 5FORA 1T0JB 5IARA 9ATCA 1E2LA 1JWLA 2JLSA 1DRKA 2DPLA 2I34A 3INTA 4L6CA 3A2NA 5EFZA 4Z53A 3FPHA 2OCBA 3ZHZA 1N6RA 3WLHA 1BAPA 1AC5A 2O2IA 3G2QA 3UUGA 1IEVA 2F3QA 1BE1A 2PX4A 2ZJ8A 3C39A 5TX7A 2Z5FA 3ZXUB 1ETHA 1DWOA 2OTCA 3AHFA 2BGUA 3GAAA 4RVGA 2GYUA 5PGMA 1WLSA 2O9JA 3PI7A 3TRIA 4FVTA 3S7ZA 5GADl 3F7NA 4FGLA 5F77A 4L5IA 1P1HA 1YE8A 2Z6AA 3WA6A 3MCTA 5JAMA 3R5JA 3H4IA 3H2IA 1VJ0A 3M1IA 4UHHA 3SS8A 4BATA 3VC2A 1GZDA 1H2FA 3O3OB 4GR5A 2VHTA 3TZBA 1LNZA 1PYDA 1BEUB 1GGFA 2DLCX 2ERYA 3CRRA 3HB4X 3ZWMA 4OV6B 1JFTA 5TDHA 3I5XA 1QUFA 2JGNA 2O2CA 2BIFA 4LJ8A 2P6RA 1VMIA 3ROTA 1DKPA 1G42A 1PSZA 1BXGA 3EEFA 3SXUA 4YR9A 4KITB 1CHDA 3PE6A 1DT3A 1SAYA 4NU5A 5HRCA 1EDOA 4PANA 4TT8A 2G40A 4K9KA 4DIFA 1PV4A 3P20A 1DIBA 2HBQA 2POQX 2QUAA 3QEMA 2B83A 4JI8B 5BWOA 3FTDA 1ZKDA 4KR9A 1FP1D 4KO8A 1DJPA 5FTNA 2NT3A 1MIOA 1K7YA 1R74A 3C5WP 3O2JA 3FDJA 4O2AA 1P2UA 4RPJA 3ZV6A 4N3GA 5IASA 3C43A 4NHEA 3TEFA 3S4YA 1W0KD 1ZRHA 5JBIA 4ZFNA 4ND8B 2FK8A 4UU0A 4YRFA 5AVJA 5LQNA 5CDTA 5AK4A 1QG0A 4HV4A 1G1AA 2WQ6A 3MWJA 4N82A 4JLNA 2XDWA 5IH7A 1YRYE 2VYQA 1JEYA 3OQBA 3KL2A 1UOEA 3AR9A 1XROA 7REQA 4LY0A 4MGHA 2PR2A 1EX7A 4EYQA 1NW7A 2P30A 3HY4A 2OV1A 3B1KA 1QIMA 3DT6A 3EIWA 4MTCA 4XX0B 2H1LA 4NJMB 4D6YA 1USUA 3O1JC 3U4HA 4MQEA 1M3SA 4US0R 5EINA 1VJ5A 5CB4A 1YWGO 3B53X 2JRCA 3TI9A 2J9ZB 2XKBA 3KQPA 3O91A 1G8GA 3PGMA 2I7XA 4GOLD 2R6GA 3C6QA 2V55B 5FBZA 1A2QA 1D2RA 4JSYA 1Q7CA 2FF7A 1DKUA 1NP7A 1RPNA 1YB5A 2CVHA 3IT2A 1ZGBA 2ONYA 4PYQA 1U8UA 3SYNA 5KNCD 4QRHA 1NN0A 4DG8A 4PE5B 3FKQA 3NM5A 5I7EA 3EEIA 3TR0A 4N9WA 3TD6A 1DQPA 4NH4A 4NPHA 2IYXA 2PUGA 2JLQA 1Z4JA 3BICA 2QP3A 2PJDA 2ZBGA 5HQTA 2ATIA 2VS1A 4AY2A 3CVYA 2R0QC 4GI7A 1S4MA 1ND6A 3IQHX 4FNAA 2B99A 2JAOA 2V96A 1Z7GA 3RYIA 3GP5A 3GGGA 2CT8A 4G1MB 2BFCA 1OLSA 1XTUA 5KTPA 1MV8A 3PUKA 5BN1A 1QANA 2VA8A 3U3JA 1GGNA 1D4AA 4ZOAA 5HP4A 1KZGB 4TXHA 1TM7E 1WSBA 2FPOA 2QEQA 4H0FA 5FPQA 1QM5A 2EDAA 2OZKA 5LKAA 3RF6A 1F0KA 3IHKA 4PIMA 3PVSA 4A0QA 1OI4A 4LRTB 3KOWA 4MRSA 3TIXB 2PS0A 2PFKA 3STXA 1ORVA 1VBKA 2YXBA 1JEDA 2G6TA 3FJOA 3KOXA 3AFIA 1E66A 1TF7A 3LKZA 4QHSA 2FWJA 2REOA 3OI7A 2UYQA 2C92A 5EE0A 3OEEA 1I3KA 3URKA 4A7PA 2F8LA 2WPDD 4MV0A 3W9YA 3L7IA 4KN6A 3ULKA 3F9IA 4GMXA 4LZPA 4MVJG 1C2YA 3F97A 4LS3A 1U80A 1E1CA 1G59A 2J6CA 1GWNA 1TRKA 4BMXA 4K03A 3G17A 4LYDA 3ROQA 5HE9A 4EI8A 1HDGO 2JGLA 2W0SA 1FY2A 3OHSX 4JZYA 3S44A 3W6OA 2QVCA 4CPDA 4V1CB 2QM3A 1ES9A 5HZGA 3D54D 4K3VA 3OUTA 3ZWQA 1G9TA 3JQ9C 1YC5A 3FD8A 3PXDA 3VDRA 2AF4C 3VYTB 3ZE0B 4BX2A 1J0EA 5DI3B 4EYEA 2H1HA 3LO8A 3WGTA 4ZC1A 4BP8A 5C4MA 1JILA 5LZ2A 2O5VA 1NUSA 3B3GA 1PEDA 1U2EA 4Q1DA 4EW1A 1ZK1A 3REOA 1LPBB 2OKGA 1DFHA 1Q17A 2CMFA 2DH5A 5CMLA 1IPHA 2AD5A 1C7ZA 1Y4AE 3AUTA 1TYEB 3JQCA 1E3WA 3QBJA 4QPPA 3ANTA 1JEYB 4YCLA 4PWYA 1LLFA 4EKDA 1XTSA 2JJMA 2YV2A 1M54A 2O57A 1WDWB 3L4JA 5A5EA 1R8SA 3LUCA 4P54A 3QH4A 2J4DA 3TZLA 2Q5EA 4FDLA 1OHHD 4NBNA 3WL6A 3ZWBA 2I4OA 3A8TA 3K4QA 4BVGA 1I6LA 1FJHA 1GKLA 4R83A 2C4HA 2RHHA 3G23A 4YJFA 2ZM5A 1FJXA 4MQEB 4D9GA 3ZJTA 3DZIA 5LJIA 3OZVA 1LLUA 1ECCA 2G7MC 5CEEA 1TQDA 3AK4A 3NRCA 3ONFA 4MGZR 3CKMA 4QGFA 3TNLA 2WBLC 4F38A 3D8UA 2HYDA 3OKFA 4CR6A 2PZGA 1GLVA 3HP4A 1KVQA 1XZGA 5EE9A 2Z4TA 4RBNA 3CISA 2WT8A 3IEIA 1D8TA 1GJRA 3QXSA 3A10A 3D6VA 3HKBB 3FOFC 4E1BA 4WZAB 1Y5RA 2PZBA 1QO7A 3C5VA 4OFXA 2Q07A 3L7MA 1NVFA 3ESDA 3SD7A 2H2IA 3L1UA 2HBRA 1MX9A 1Z63A 3LOPA 5HZHA 3C7KA 1JX6A 1PR9A 1GZVA 4MW1A 1QV6A 2AEJA 1QOQB 4QXRA 2TYSB 4F4FA 1L8XA 4GWKA 4MV1A 3R7FA 1DAGA 5T8KC 3BAZA 2Y3IA 2IYPA 2QK4A 1E4OA 1CK4A 5EE1A 4BMNA 5JXIA 1YSCA 1LXCA 4LRXA 2XAUA 2F1JA 4R05A 4BMVA 4F3KA 2JGJA 1TM2A 2POCA 3DE4X 4IGIA 3IV6A 1CR2A 5EZQA 3X43A 2C7BA 1MR3F 3ED1A 3FI0A 3COPA 3LQYA 4IS3A 2G1AA 5ALSA 5C31A 3NMUF 4CDGA 1EX9A 1N5LA 1LV7A 4W6QA 1KF0A 3IXMA 2WWRA 4FGKA 5JCOA 3GLQA 1AVTA 3UCEA 3VUEA 5DP1A 1V8OA 3N2GB 5CDUA 1AO0A 5SYMA 3UG6A 5FNVB 1PGJA 4HDNB 1D6SA 1D9XA 4Z8XA 4D4GA 1MRSA 2PL3A 2FCAA 1NUPA 3ORFA 1J00A 4Y6GB 4HLUA 3JQBC 3IVAA 3DL0A 4J1TA 4LBYA 5L3ZA 1F4PA 2BKUA 2WYVA 3PV0A 5DN6D 3WAJA 3GWGA 3BMQB 2MMGA 1FS6A 5C1BA 3IKLA 2A57A 4TVKA 3G02A 2QBYB 4MI1A 4RE5A 4B6FA 4D9NA 1N8KA 1R7RA 2GAFA 3EXG1 3GARA 4GSKA 3D0RA 1TJ4A 3ZU2A 4Z3KA 4MUEA 1HF3A 4H7HA 1RWVA 2JJQA 3NX4A 3HBMA 2RKWA 1RPJA 2P67A 1G7RA 4OHXA 3SZUA 1EVKA 1UCFA 4RQUA 3WY9A 1F4LA 1GNSA 4B09A 5IAAA 5HRAA 2IGTA 4TWBA 5EIHA 1TM5E 4K87A 5DMHA 1XD8A 3AY3A 3NW9A 4NX2A 3IQXA 4HNTA 2B8JA 2ZS9A 3GOHA 3MCZA 3FYDA 3UJ8A 4RPIA 2ZYSA 2Z1DA 4EKGA 1E3QA 5JAZA 5K6TA 2ORVA 4B4UA 5GV8A 2NADA 3WZ2A 1INLA 1YB7A 2J6HA 1T5LA 1EINA 1TQ2A 4OLHA 4L73A 2JLVA 4XPIA 4KWCA 4K0RA 1FX0B 2WF8A 2OAGA 4ACAA 5KNDA 5MN6A 1UKVY 5EIEA 3ML1A 1UMKA 1U9YA 2QVYX 2D0OB 3K2BA 1BEEA 3IIEA 1U6JA 4Y6OA 4ZVQA 3TMAA 1JFFB 3T94A 2OXCA 5BQXA 5JXHA 4XPZA 2ZEJA 3E5RA 3FZGA 5A4MS 1I0LA 1S2IA 2A1UB 2CZGA 2EDCA 5EGNA 1FVOA 3EVDA 3QVJA 1R4MB 4JR0A 4Y0VA 4I4IA 4WNYA 2P2GA 1U28A 5L9AA 3H5AA 2ZWVA 1EBFA 2R7MA 3N2YA 5AXCA 5FOQA 1QHHB 2QD2A 3CWCA 4JOBA 4N47A 3SDBA 4W1RA 1RXYA 1GFWA 3ZLBA 2I2AA 4A23A 3MTAA 4F4HA 2GAOA 2GPNA 3FHTA 2ZAIA 2I6XA 5TMEA 2WSMA 4M0KA 2CLOB 2FSIA 1I33A 3IVRA 5MHTA 1QG4A 3KT0A 3E27A 3KHUA 4P84A 1CZOA 2YASA 3NIBA 4DV4B 1E0KA 1YZTA 3JAMA 3L5KA 2BGWA 4UU1A 1KBQA 3AUXA 1JEJA 3UW3A 1PEAA 2JK1A 4OI2A 1LPSA 4NZMA 4XDHA 4JLWA 5FBHA 3UY4A 4Y2HA 4FTWA 2OHVA 5A1TA 3ICQB 1MO5A 4PRLA 4FNMA 5H9VA 3ZS8A 3W9SA 5FIUA 1MC4A 3SJAA 5ENDA 1CIVA 1GRNA 5J9FA 3PPIA 3X3HA 2WWFA 6Q21A 3O21A 1DEHA 1YZ3A 1HE4A 1QVZA 1YZHA 2RCYA 1A8HA 2FSUA 4FGJA 3O8OB 4REOA 5JDCC 4D44A 4EDFA 4MB2A 1U8XX 2C2KA 2ZBUA 3SJUA 3UMMA 1RWMA 1ABEA 3HGQA 4WKOA 3BQ9A 3K6JA 3CX8A 621PA 2V1XA 1V1MA 4UVDA 1GT91 3VJMA 1NM5C 3LX6A 1FLNA 1CLUA 4L2IA 4MGYR 4MV9A 4WLVA 5KJ6A 2H1SA 5LD2B 1U0TA 4AF6A 1K68A 1S1CA 1UPCA 3P2IA 5C8VA 3BRCA 2G4LA 1E5LA 2IW1A 3AOEC 4L6IA 3SOPA 1S8OA 3R8CA 1LVGA 2I3DA 3VR5D 3LOQA 1E1NA 5A9TA 5BR1A 2WE8A 1XJCA 2Y9MB 4DB2A 3KIPA 4LY3A 4DIUA 3FA2A 2GESA 3H11B 3M4JA 3DR3A 2HMVA 3P32A 4NP6A 1IJKA 1PWYE 2R48A 3LRTA 5ALJA 5AUPB 4LF8B 5BT8A 3G2MA 3TCNA 1WMDA 2IUUA 4UZSA 2HNBA 2ZIAA 1PBNA 4CR7A 5FFMA 4QPCA 1ANKA 1Q14A 1IK4A 6AT1A 5KWJA 2AXNA 1IC6A 3QWAA 2CYBA 5DGXA 3H3XA 2Q49A 2WVAA 4FN5A 3MJHA 3P4YA 4US2R 5HMMA 3TM5A 1A4XA 2P9BA 3LT1A 2R6ZA 2XA1A 1NQWA 5ULLA 3NDPA 4BO5A 2C42A 2W90A 1JECA 3U4DA 3EIEA 4XRRA 2WIFA 5DBOA 1NY5A 3A26A 5IMBA 3WG9A 2G06A 4EG3A 2FE1A 4PFKA 3RF7A 1YBHA 4UEQA 3V1NA 5JT1A 4RY2A 4Q03A 2VXYA 2AJCA 4R2IA 4DZZA 4IIXA 3KJXA 3MJTA 1RLUA 1W2GA 4NG5A 2YYZA 4YMWA 4Q9DA 2P1RA 4UUOA 1XVTA 3PQEA 2Q45A 2PGIA 3M82A 1S89A 3WQQA 1KXJA 3AW8A 3AYZB 2BF7A 4LZOA 3M49A 3AB8A 2Z43A 4K5QA 4AWAA 3EA0A 1NRXA 1R5NA 2H5LA 4J8PA 4MGEA 5CVEA 5FA6A 3WO0A 5KVSA 3HJNA 4FYIA 3MT8A 3E82A 3W3AA 2ZRLA 2E37A 3BFVA 4JKOA 3X1XA 2R8ZA 4YO7A 4FU0A 1UEIA 1QVRA 1BMTA 3FCYA 3PDCA 4UDYX 1MOSA 1MIHA 4R2JA 2VHXA 3GLGB 1TA4A 1C0LA 2IHJA 3FWHA 1YGPA 3GO4A 3RS7A 5LIRA 3GH3A 2E6UX 3SSAA 1NJ2A 4RJLA 4JJ6A 2JLXA 1VKZA 3IELA 3IL2A 3BXZA 3I0MA 4MDHA 1JUDA 4KOEC 2C2BA 1DCTA 1MJFA 4EGFA 2XMRA 3FGOA 5MF6A 3ZGLA 4LBZA 3QE9Y 2CVOA 3V48A 5JQGA 1C7IA 1LBEA 2O5EA 4GP9A 1KGDA 3R7AA 2NSJA 2E5WA 1CJSA 1GKYA 2EZTA 1UXJA 5NLLA 4U00A 3FSEA 1DMSA 4B3GA 2CL0X 3GEGA 3OF5A 1P6QA 1XU4A 2GRJA 4IJMA 4LGVA 3AMVA 2CD7A 2EFYA 4FJ1A 4FZVA 3LAWA 5KNCH 5ALMA 1FSZA 1NBWB 1Z5WA 3AR7A 1UWKA 1M73E 1Z82A 4JYPA 3W8NA 2HUNA 3OPQA 4FFNA 1FDIA 2CLFB 2I1VB 4FFDA 4AJHA 4AWXA 2Q7DA 4IS2A 4E46A 2YIVX 3VFDA 5HDQA 2OMEA 2H16A 3BXHA 1QDEA 5J2UF 1Z2NX 3ZDAA 4DG9A 3LCMA 1Z5VA 3GJ7A 3E6AA 3EG9A 1WXIA 4IFIA 2V1UA 3H5LA 1T6NA 2EJVA 1DX9A 3QOFA 3HFJA 4FR2A 5CR9A 4I8DA 1AKYA 4C07A 2LV8A 3VR4H 1BIFA 2X40A 4KDFA 4MUBA 3HDVA 4G1CA 3HADA 1JI3A 3SVZA 3IIKA 2VKQA 4ZDJA 2I62A 3ITKA 1ADBA 1F6BA 1W34A 1LWNA 2V45A 1G6OA 3RVKA 3BREA 3T06B 1HLPA 1E20A 1PTKA 2D0PB 1QIGA 3B85A 3L4SO 1CVRA 3OFNA 4DEYA 4EHAA 5JD4A 3FOAA 2ICAA 3MLAA 3NYIA 3PRHA 4JOQA 3EUFA 2VYCA 1LNQA 1OX5A 4HEQA 4DLBA 3QHQA 4IOJA 4C3OB 3W5HA 1R6UA 3NV9A 3G0HA 1T8YA 1N1DA 5LFAA 4LI3X 5EKSA 3ESCA 4MV6A 4C2UA 4YCAA 1WAMA 2YXDA 1JSXA 3UT5A 4EG7A 2BBSA 2WYHA 1SUEA 4HX5A 3MJEA 1ZIOA 4YLGA 3ZE6A 4WNAB 1YQEA 3G59A 2XDQB 4HH4A 4YMTA 1ONOA 4QDTA 2VAVA 4Y2PA 5BV8A 2OO3A 2VFAA 1DKQA 3AHIA 3IERA 4RJ2A 4UEKA 3QLTA 2N75A 5U1PA 5A62A 2DUUA 2QTTA 2Q8NA 3TOCA 3CUYA 4YJDA 3EGOA 2VQFB 4A36A 4IR7A 3W1EA 3AIIA 1E0DA 2YJGA 3NLLA 4BMCA 1K7SN 3GT4A 1UQTA 4C0JA 3QEAZ 1Y1PA 3EQZA 3NAMA 4F2WA 1PT6A 2J0UA 4K6CA 3ZU3A 2EYUA 4D9FA 4OJNA 4ZKDA 1M6NA 4EMUA 2ENWA 1EWRA 1Y6GA 1FDVA 4ZKEA 1JFSA 3MTEA 1M6WA 5ECYA 3BIFA 3K0SA 1N78A 1PJBA 1M8KA 2C9BA 2D2XA 4WKPA 5FYDA 3WRWA 1ORRA 1XYYA 2RBKA 3MMZA 3PK0A 5DV9A 2VATA 4A1FA 2IYWA 1P1IA 3LUHA 4G86A 5DM4A 3CN9A 2B94A 4AIIA 1KZ4A 1JBKA 1GGEA 4MW7A 3G0OA 1FDWA 1GKKA 1OLXA 3COWA 4W8HA 4KUEA 4PTLA 3LWBA 4DV5B 2FPIA 3IBYA 4Q1FA 3TBKA 1GRQA 5E2AA 5AW8A 5K0JA 4TMKA 2HADA 2X0RA 3EZ6A 1GHTA 3VTZA 1AK9A 1G1MA 2FW1A 2H7CA 1AHPA 3SKYA 4CODB 3GPCA 1JYFA 1RLMA 1JALA 1N75A 3LVQE 2WAMA 2W98A 1AN9A 2C4WA 3E3AA 1T8SA 3SJBA 4YQZA 2CBGA 1KMMA 1BVYF 3GLKA 1XO1A 4BVLA 1MXHA 4TKMA 1OASA 3OPXA 8OHMA 1AJEA 2ODQA 1RXIA 1UC8A 2JJ1A 1E6MA 4OGGA 1QS0A 1FC0A 3ROKA 4EI7A 3I2KA 3W1WA 1V48A 2AB0A 5F12A 1UXOA 1PF7E 4DS3A 4EUHA 4YV2A 3M4ZA 2G8NA 1UBLS 3HKCB 4DSOA 1YKGA 2M6KA 3H99A 3MA0A 2QN7A 4OQLA 4WN9A 4A2QA 4CG2A 5C7OO 2H4WA 3WJ1A 2F55A 3QVLA 1JLHA 4C4PA 3BZWA 1RXUA 1B6RA 1IEWA 1MXFA 1T1GA 3ENZA 3KNZA 2GLXA 3I2GA 4JSRA 2B1JA 1UOPA 4PBTA