2CE2X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPASE HRAS
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ce2X00
2G77B 2NO1A 2DFTA 3QSYA 3C15C 3OHMA 1QG2A 1R5NA 3CBQA 1MRSA 2ORVA 1ONBA 1KO7A 3LNCA 3Q5DA 1GIAA 3CX7A 5AUQA 3QIAA 5F3WB 3RC8A 3EWSA 2ZJBA 1KI6B 3UWKA 4US1R 1R0WA 3OIUA 3K0FA 2ONKA 3FB4A 4DLXA 4OI4A 2IWHA 1MKYA 1Q1ZA 1TX4B 4TN1A 1GITA 4QM6A 4ZCIA 1P73A 3PJRA 2KI5A 4QJ5A 1H65A 1NVXQ 1U9IA 1DVRA 2OLKA 4TSFD 2RH5A 4I1OA 5FPTA 4RCYA 5FBVB 1S96A 3SE0A 2G0NA 3ONWA 4DXAA 3UATA 4G5GA 3MG9A 1CBUA 2AK2A 4DUGD 1S0UA 4RD0A 3CZPA 3RRYA 2F1HA 4MRRA 1RRFA 2G1JA 1U90A 4WA7A 5BYJA 4DSTA 4EDHA 1OB5A 3WP0A 4EJSA 1GP2A 1AJEA 2NMVA 1YZGA 3RNLA 3A1TA 4MDEA 4N1AA 1OYWA 1SVMA 2RGDA 3V4RA 4TYPA 3NEJA 3KJHA 3W9YA 4B73A 3LLMA 5FR1A 3K1JA 1XEXA 2KBEA 1E9BA 2BBSA 2R62A 4WXRA 4XD7A 3OEHA 2IEYA 1HT1E 2R8RA 1KI9A 5E7JA 1GRRA 5DN6D 5G41A 1L7VC 1L4YA 1XXHE 2J3EA 3PITA 4D4LA 4IXNA 2KJQA 2ATXA 3P4XA 3U2QA 3WBKA 1OHHA 3VNVA 2GEVA 4NYIQ 3DL0A 5JS8A 1W49A 1ZD8A 4GP7A 1Z6YA 2GJ9A 3NVAA 5FL3A 2VHCA 3ZVNA 1KY3A 2FJUA 1Q22A 2GTPA 1L2TA 3JVVA 1US8A 3CR8A 4DB2A 1GAJA 2JJ2A 3MFYA 3DHWC 3KQNA 3PG5A 1XJCA 2O8EB 1ZM2A 3FPAA 4M1YA 3NEYA 2XSZA 2C03A 3LX5A 5EQTA 4PHTA 4KHZA 4NCJA 2ZU0C 3LXRA 4QGFA 3QPVA 1PJRA 4GMXA 5LB2A 3G5UA 4CEJB 2FGKA 1XTQA 3GEEA 1E2EA 1GSIA 2RHMA 4DSOA 3HDTA 3CUEF 3ZZ0A 4ITRC 1YZTA 2D06A 1YKSA 3WMEA 2BMFA 3GFTA 1GG2A 2BM0A 4JYBA 5IRCD 2EVWX 2CCKA 5EP3A 3AUXA 1NF3A 1QF9A 1YZLA 2KB0A 2G3YA 1VG9B 1IONA 4NDZA 3IBGA 2IYSA 2IC5A 2AL7A 2REBA 4CEHB 5H68A 4IDQA 4RZ2A 4W7SA 2CBZA 2ZITA 2QP4A 1A2KC 1J99A 4I1SA 1NG9A 3LXXA 2J45A 2ZYVX 2PZFA 1KDRA 3TAHA 3GPLA 1N5JA 1XJ0A 4ARZB 4NCNA 4KCGA 3KJGA 5DO9A 1YRAA 5IT5A 3SZRA 4Q4JA 2GXQA 4FIDA 1HE1C 2VLIA 2OFOA 1BOFA 1DAGA 3A36A 3OAAA 4XOIA 2AFIE 4LC0A 1GKIA 4EQ6A 2WPDA 1Y3AA 4Q7LA 1NKSA 2ZRCA 1COWD 2GDJA 2GAOA 5EJEA 4JLMA 1LY1A 2IT1A 2V6IA 4LJ9A 1EFTA 1SXJE 1NI3A 5E3HA 4O0MA 1SXJA 1E2IA 2Z4RA 3TUIC 2VH5R 3L0OA 1CU1A 4QHTA 2HXSA 3BFXA 4JKYA 1OF1A 1EFRA 4F92B 1IXSB 1XZPA 5AUPB 2AD1A 1G17A 4U5XA 2QG6A 2H17A 3ZQJA 4DWJA 3I5XA 4Q9IA 1ODFA 1CEEA 4IKEA 2ODNA 3HYTA 5KSOA 2JJ2D 5GJVC 2V1XA 3GLIA 2N1BA 3U44B 1KO1A 2XB4A 1NNEA 3A4LA 4S35A 3RVBA 4NTZA 4OBEA 5DHFA 4DEXA 2ANBA 3E70C 1W46A 2X77A 4PANA 1ZP6A 2JLWA 1TU3A 1OW3B 2C95A 1HTWA 4WIAA 4A6PA 1XD9A 1TQ4A 2BDTA 4PC7A 2H7VA 2VEDA 3WP1B 5EUQB 3OIWA 4FMCF 4L16A 5KSPA 2VHQA 1IN6A 1HA3A 2JIZA 2IXEA 4IDOA 4L8GA 4ZIRB 4NCKA 2CJWB 2OXRA 4B35A 4LHWA 3OEHD 2DB3A 4I99A 4WVFA 3SJAA 4M8NE 3T06B 1ESMA 4LZZA 2ZSFA 4Q18A 4A0GA 1DAFA 2IUSA 2V54A 3C14C 4D80A 2A5YB 4QRHA 1C9KA 1NY6A 3H84A 2BV3A 4NCIA 2ZVQX 2BBTA 1GL7A 4RCZA 4M1KA 2QQ0A 2VBCA 3AVUA 1KK0A 4IW3B 2YVUA 1LW7A 4B34A 2V1UA 3RYTC 2VRWA 2IYLD 3IEUA 3RS5A 1F2UB 3F3YA 3PFIA 2ORWA 3SC3A 1DAEA 3KJIA 4QGGA 2V55B 1FZQA 2CJWA 3WMFA 1IN5A 1WA5A 1TF2A 1OIVA 1T3HA 2IYYA 2V8OA 3L0PA 4AYWA 3EX7C 2EW1A 1KI6A 5FUXA 3RRNA 4WAUA 4LBVA 3A37A 4AURA 2P6RA 3K0AB 3G0HA 4I4LA 2O8BA 1W4RA 2F43A 4GZMA 2NIPA 5DGXA 3VX3A 2XTNA 2BBWA 1UBEA 1P62B 1EX7A 2FX3A 5AUOB 1N6IA 1KOFA 1E6CA 1OH6A 3MWKA 4Q1FA 1E69A 3X1WA 2IYXA 2J0VA 1E1RA 1RW4A 3B5JA 3IIKA 3KB2A 4LYJA 2W6JD 3BD9A 4Z8XA 4CDGA 1PLLA 4UQOA 2C77A 2WVJA 2GK6A 2Q21A 1KZGB 3NBZC 2CL6X 3MLEA 3RABA 1Q1QA 3IUYA 4CT4B 2C9YA 4EPRA 3QKTA 4EPTA 4Q9JA 2VP0A 1P7CA 3N70A 2GESA 1BH2A 1G3QA 1RVDA 3KKQA 4F38A 2W6JA 4B3DA 1T8UA 2PH1A 3Q5EA 4XH9B 1T3SA 2AK3A 1R0ZA 5LBIA 2QGNA 2W2TA 1DAKA 2OCPA 4M21A 5ELXA 3K0EA 2A30A 4A0RA 4R9UC 1JPJA 4YQFA 1NJGA 4Q4JB 2OFXA 4DVGA 4ZCLA 3V00A 5KOYA 1F6BA 2Z43A 2YNMA 3KTAB 5L8VA 1DAIA 1IN4A 2ZI6A 3C5HA 3J81k 2VHUA 3GLGE 2C2HA 3U5ZB 3ZZTA 4B3FX 3FHCB 1LS6A 2QM8A 3QQ5A 3GP8A 3WNDA 4RVCA 4PPFA 3K0SA 4N0EA 4LOAA 1OXSC 1P4SA 4PC1A 1A7JA 2QT1A 2ZJAA 1ZM7A 1WE2A 1Q21A 3GLHE 4BRUA 1G8PA 1U8YA 4CYMA 1HUQA 1YJ5A 2H18A 4M0LA 4JBXA 3U4QB 1MT0A 3D3QA 4CEJA 1DO2A 1Z3IX 2Z6VA 3IEVA 1FNMA 4QNRA 3BE4A 3KKNA 2PZEA 1AQYA 2WJVA 4F4IA 2B7BA 1H8HA 1NLFA 2BMDA 2P2LA 2Q3MA 3MSXA 3QKSB 4P33A 3UXMA 4C7OA 5CB8A 1E1QA 4JS0A 2O0HA 4Q1DA 4NONA 2G9NA 2CK3D 1ZIPA 1R0YA 4WBSA 1KIMA 2GCOB 1UDXA 4IDPA 4LPKA 4M2LA 3LX8A 3M1IA 4LJ7A 1II9A 1G5PA 4TLCA 1VECA 3WBJA 4G5RA 1OXUA 2H92A 3ZH9B 4JVSB 3AVYA 3IDQA 4LGMA 2ZRNA 5G3ZA 3LBNA 4W5JA 2LKDA 5EE3A 4EIWA 2ZRGA 2FGJA 1TF5A 1OKKD 1VG0B 4Z54A 4FWIB 4Q9KA 1P5ZB 5HE8A 3LW7A 4ESVA 5JJIA 1R8SA 3TQCA 2CEAA 3GJ4A 621PA 1NP6A 2PCJA 5GADl 4MYCA 3THOA 1JAIA 3WHLA 3CF6R 4L5BA 3IILA 2X2EA 4PO8A 4IOLA 1CJMA 2GJ8A 3VQTA 2V7QA 5FR2A 2DWOA 4URZR 4A9AA 3GEIA 3W8NA 3ZVRA 1N5LA 2PBRA 3X2SA 3LBIA 1P3JA 3VFDA 2VF7A 3DM9B 2HYDA 3BB4A 1ZCAA 3THYB 4Q1AA 5EP1A 3UG7A 2HV8A 4LV5B 4LC1A 4OYHA 4DSNA 4HZUA 5C4GB 1G3MA 1N0UA 2X19A 4Q66C 2QEQA 4ABYA 3KQLA 1K6MA 1XPRA 1X3SA 2XZOA 4DRZA 1J8YF 3GJ6A 4PO1A 4LYHA 3HU1A 2W6IA 4G5SA 4A2QA 5JFGA 1JXOA 3I72A 5L3QB 1PLJA 3THWA 1Z47A 1M1YE 2QRZA 1XMVA 3SNHA 3BJIC 3DZ8A 1NBMD 1IXZA 5FH9A 3AVWA 2IHYA 4JLPA 4Q1CA 2V9PA 1F2TA 4P3YA 4XVQA 5KSZA 4AI6A 3NXSA 1E99A 2KBFA 2ZJ5A 2OEPA 3OIVA 4NMMA 2IBMA 2Q0HA 1E2KA 4TZ0A 1J7KA 1W0JA 2FOLA 3ZS8A 5EP4A 5EP2A 1SHZA 2J59A 3GFOA 2R6CA 1SXJC 4DLWA 3KUCA 5L3QA 3THWB 3NDPA 4Q9HA 3PEUA 5BQ5A 3WYGA 3ZD7A 3PEVA 5BWMA 1L8QA 3I92A 2IS2A 2Q3FA 4KFRA 2YC2C 5GVSA 2A3RA 2QE7A 1S2MA 3NC0C 3T34A 2D62A 1KKLA 4OHZA 3LA6A 4AC9A 1XCGB 1XDBA 4B3CA 1SXJB 2HLDD 3W6PA 1AKEA 4KBGA 2QTFA 1ZNYA 3QXHA 1XJQA 3RAPR 1U94A 4AYXA 2EYQA 3NHAA 3ZIAA 1QHYA 3E5HA 5IK2D 4TMKA 3PUZA 4GP6A 1DE0A 1KK2A 3MJRA 2XITA 5EXXA 4BUJA 4MGZR 1T6NA 2ZJOA 3AVQA 3MWJA 4EFNA 5F9FA 3FMIA 1E9EA 4RZXA 4LV8B 1Z29A 1Z0KA 1NG1A 2VA8A 3T61A 3VHXA 2YWFA 1Z5ZA 4XWAA 1OHHD 3TR5A 3AGPA 1NLZA 4HLUA 3DMNA 1MO4A 1W4BA 5FPYA 5FPKA 2J46A 3W8RA 1KMQA 5B2ZA 4QM7A 2EFGA 1LNZA 4GOXA 2IYTA 4B75A 3F8TA 2A9KA 4P32A 3DO6A 3PQCA 2Q9AA 3C5CA 2R6FA 3CIOA 3ND9A 1S8FA 3CNOA 4UNQA 1U0LA 2XOKA 4DKXA 4PHGA 1KI2A 1Z0FA 2LKCA 4BFTA 4D4MA 4MKHA 1AN0A 2IX3A 4AK9A 4MRPA 5D3QA 2XEXA 5KU1A 1NBME 4PPNA 1GRQA 1XD8A 4B2IA 3VR6A 4A8JA 3TUZC 1NIJA 3IPYA 2QNRA 2I1QA 2OSBA 1OJLA 1HYQA 4Q1BA 1QZXA 1FMJA 1Z8FA 1PUJA 1YZNA 1CTQA 1DELA 1N0WA 5LD2B 4KYUA 2GJKA 1ZBDA 3LDAA 4HZIA 4GZLA 2JGNA 4ARZA 5HPYB 2OZEA 2N42A 1CS4C 1Z28A 3TIFA 1G3RA 4DCTA 4CEIA 1X8KA 2E9SA 3CKLA 1QHHB 1SVKA 5BXQC 4JYCA 4XJXA 1YR7A 2WKQA 3A1UA 3CPJB 1I2MA 4TMXA 1CJKC 5KPJA 3DKVA 1M8PA 3LQQA 5JSZB 2AR7A 5BN3A 1HQYE 3IHLA 3NIBA 5CB6A 1NLYA 4DCUA 1W2HA 4KBFA 3WXMA 4ACBA 1PV4A 3B9QA 3DEFA 2L0XA 2ZJYA 5L3VA 3OE7D 1MO3A 5EUMA 1TEVA 4AY2A 3FFAA 4QHYA 5FBQB 2QE7D 4PC3A 3SQWA 1LV7A 1NVWQ 4DLRA 4PC6A 2IXFA 2QTVB 3LH5A 4FMBB 4EPVA 3P32A 2D7CA 2FPMA 2OUKA 2WWWA 4QGAA 4LJ4A 2P0EA 3CWZA 4XWOA 5C4MA 2AD5A 1D6JA 3MGCA 4OJQA 4BWYA 4C30A 5JRJA 3RRMA 4A15A 2OBLA 2JA1A 4IJMA 1QHGA 3I4LA 2CL0X 2JASA 1RJ9A 1XMJA 1XTRA 1E2PA 4M1WA 4PPQA 2ZE5A 2BM1A 2P6UA 4V0OA 3SS8A 2ZI5A 1GNRA 5G40A 4PTLA 2FPKA 2QTHA 3PENA 5UKDA 4E5UA 4ZIRA 1XFAA 4Z51A 1N6NA 2XTMA 4PSAA 2B92A 4U02A 1Z0DA 1D5CA 2QI9C 2RGGA 4Q01A 4HAUA 3L43A 1NY5A 1VG1A 2H1LA 2QMHA 4HB2A 2XX3A 1CR4A 1G3UA 5L3RA 3VHLB 2WWYA 3HU3A 3S1AB 2FZ4A 3IGFA 3QJYA 1IN7A 1J8MF 4WZBE 5CLLA 2YHSA 2JLSA 3Q9LA 3KQKA 4YDHB 4OK5A 2WJIA 1V5WA 1VHTA 2QU8A 4HYYA 1EESA 5FPHA 1YR8A 4CIDA 1E9RA 5KO2A 1YR9A 1WRBA 3T1QA 3BH0A 3T12A 3R9XA 1II8A 4G3XA 2HDNB 2O52A 2J41A 4LJ8A 1MV5A 4O3MA 5FI1B 1KO5A 3U6KA 2LWIA 4IFBA 1A4RA 2QAJA 3L2OB 4NYJR 1LF5A 4DLTA 4DEYA 4DT1A 4PFSA 5J4HA 2QMEA 3LVRE 3THXA 3U4QA 4C0BA 3SYLA 1G18A 2OAP1 2BWJA 5EZ5A 1E9SA 3EG5A 2IK8A 5J40A 1UEJA 2F3TA 2HLDA 3KB1A 4QL3A 5KSYA 1G64A 2JDIA 1F48A 3FHOA 1RRCA 2ZR9A 5B57C 1Z22A 4HAVA 3O8RA 3CR7A 3AF2A 4MQBA 8OHMA 2J0UA 2ZYTX 5GVRA 1HURA 4E09A 2ZTSA 4DC9A 1T5LA 1NMYA 1DBSA 4JL8A 4CEIB 4I1UA 2QBYB 2HF9A 3CLVA 1R6BX 3I8XA 3T1OA 1ZNWA 5D3MB 3KXKA 3PUXA 5F9HA 5E7IA 4HEJA 3ZVMA 1W36C 4LJAA 1Q1BA 4HAZA 2CVFA 3L8YA 1QRAA 2OCBA 1JXMA 5FI0B 1GTVA 3FE2A 4II7A 4JVNA 2GCOA 3DVLA 4TLAA 5AJWA 4K81B 4PC2A 2AWOA 4TMTA 3KXLA 1RZ3A 3R8FA 1G3IA 4LV6A 1YZUA 5AUNB 2FFHA 4Q48A 1VG8A 4BZPA 3GLHA 3K9HA 2FSHA 1OIXA 3EPHA 1N6LA 2W6ID 4MYHA 3EZ2A 2GCPA 2Q9CA 2WM9B 1XEFA 1ZM9A 2OCYC 3AF4A 4JT4A 1VIYA 1IAQA 3MWLA 4JVMA 2RMKA 3HPRA 4IDNA 4NYMQ 1WBDA 1IHUA 2B8WA 4Q00A 5DE3A 2CE7A 4POAA 2OILA 2WJYA 2ERXA 4FCWA 3H2YA 5FOUA 4WW0A 4ZDJA 4IOJA 4BASA 1KYIA 2A2ZA 4D0LB 2EWWA 3KXIA 5FOSA 1L4UA 3GLFE 4DLVA 2WSSD 1PLKA 2PZGA 4OQFA 2CHGA 4QOSA 5CITA 5CK5A 4IOMA 3SJZA 5HCNA 3ZDQA 4F4JA 4X8HA 1E79D 1U8ZA 3AF0A 4YMUA 3GLGA 2ZVPX 4BGDA 4AYTA 4GL2A 2WICA 1TTTA 3AKYA 1AS2A 2CXXA 2AXPA 3K70C 2NO0A 1UBCA 1EWQA 2O8FB 5TY0A 3QBVA 1WDTA 1KZ7B 1N0VC 2J5XA 4ZI3A 2XAUA 3WRYC 1E2LA 1C1YA 2BCGY 3AVOA 1COWA 3AVTA 1SULA 5FTKA 2Q3HA 2R6AA 1F2UA 4URWR 1G8HA 1JI0A 2JCSA 4LSGA 2WV9A 4MGYR 4YMSA 4E22A 4O2RA 2XSZD 2ZS9A 5DNYB 2FSFA 1ZIOA 5DN6A 3CRVA 4PR0A 4LPSA 3S1AA 1VYVA 4TMVA 4FMDF 1RYHA 3FFBA 1VCNA 2OXCA 4GFDA 2I4IA 5CIWA 1G7TA 1CRQA 1UAAA 3V9PA 4OI2A 3KDSE 5JWRA 2RHDA 2RGNC 5EXPA 3RHFA 2R6DA 3IQWA 4P31A 3B2EA 4TMZA 1EXMA 3D7MA 1P9NA 3NKVA 4BQSA 2FFBA 3I73A 2VO1A 5BYKA 3OZXA 4IVRA 1ZM3A 1XEXB 2VF8A 4PQFA 3K9LA 4PQRA 4KO8A 1X86B 5J4VA 2XOKD 2SHKA 5CYPA 1Z0AA 2IYWA 1ZINA 4GBMA 4NYJQ 1KDOA 4HB4A 3UG6A 4TSFA 2BC9A 4NP6A 5GJCA 3AF3A 1V43A 3LAWA 1TADA 2QPOA 3SFZA 3ND8A 5KHOC 1G5RA 3RS2A 3W3ZB 1JQLB 1DTSA 3PV0A 5J5CA 3KQHA 1DAHA 2QP9X 2GILA 4LHXA 1KK3A 1EG7A 1AM4D 2WSMA 3Q3JB 3ZVLA 5DH9A 1OFUX 3RSLA 2C78A 4L15A 5HZKA 3U3KA 2C99A 3QF4A 1CKEA 3FVQA 2EFDB 3IKJA 1E0KA 1IJFA 1VDZA 3TUJC 2O8FA 5JHHB 2XNDA 1W48A 4OQNA 3W5JA 1RRGA 3TBKA 5DSZA 4B71A 1NL3A 4RJLA 1J90A 4EUNA 1CP2A 3EZ6A 3X1XA 2YOGA 3RDPA 4UXHA 3GJ8A 5HKKA 2QGZA 3X1DA 1ZU5A 2GWHA 1DADA 2IEZA 1IXRC 3IO3A 4YMTA 1XNJA 1K5GA 2JLYA 2B6HA 2GRJA 1TQ6A 5FPSA 221PA 2CK3A 1FP7A 1QDEA 4D2IA 1KKMA 2OFWA 3NBYC 3I5YA 3RS4A 3FDIA 1GNPA 2MSCB 2CHQA 3HU2A 3P20A 3ASZA 4BRWA 4JLNA 2IYVA 1UEIA 1WMSA 3IPXA 4JIMA 4LBZA 4Q9LA 4W5WA 2MMGA 3GLIE 4LHZA 5KYKA 5FBLB 2JJ1D 2GZAA 5ANRB 1LTQA 3CPHA 3P26A 1KI1A 3ZGXA 3K0CA 5C18A 2CCJA 3QVVA 1Q1EA 1ZNZA 2NG1A 1W0JD 4LBWA 1VHLA 4LBYA 4Q4LA 1G16A 3C4JA 3AP2A 1EFRD 2F7SA 1OXVA 4LJ6A 2GZHA 5A0FA 1GZSA 3B7GA 5EXSA 5EXTA 3EA0A 2ZJ8A 4GOJA 4IEEA 2JLUA 4EFMA 1VPLA 3E2IA 4ZDIA 2A7QA 3EZ7A 1W4AA 2ZXUA 4M9XA 3NG1A 5FUVA 3AVVA 3HPQA 1H8ED 2X8AA 1YHNA 4Y0VA 5KNCA 2GF9A 3X1YA 3SBDA 2IL1A 3O8CA 1Z0JA 4MKIA 5GJWC 1T0HB 3G82C 3KFXA 1W36D 1KHTA 3BIFA 4QJ3A 2VPPA 3SJCA 2PT7A 3MJHA 1XTIA 2X1VA 1KJWA 3CNLA 4QBIA 3DKPA 821PA 521PA 4BZXA 3AEZA 3D6TB 2WAXA 2QORA 1G6HA 1A1VA 2GCNA 2PEYA 4MYUA 4ZKEA 4B6FA 1U81A 3R20A 1BS1A 1R4AA 4B47A 3B1VA 5LDDC 3PXGA 4OK3A 1E3MA 1ZNXA 1KDPA 4KVGA 1P2TA 2BKEA 2JAQA 4HLDA 5M04A 1Q57A 2ZSBA 4JZKA 4LI0A 3KUDA 4W5HA 4OQMA 2B7CA 3OFNA 2NPIA 1KNQA 1E9AA 1NMXA 1FTSA 2LCFA 2FA9A 2QROA 1OH8A 5KUTA 2OHFA 3CRRA 1UDWA 1IQPA 4BFUA 4Y0AA 3SJBA 3CX8A 1I4LD 2J1LA 2GA8A 3QVUA 4C4PA 2GAAA 2OO7A 1YZKA 3JVUA 4JL5A 4EJSB 1OH5A 3SQXA 1WBBA 2C98A 1AIPA 2BEKA 2G6BA 4FN5A 4BFYA 1KO8A 1F5NA 4LJYA 4CF7A 4QXAA 1JEDA 1K5DA 1XTSA 2WAYA 4EFLA 3NBFA 4IVPA 1X8LA 3HWSA 1KGDA 3K70D 4JBYA 4KLNA 2RGAA 4OI1A 1I4TD 4TL6A 2ZRDA 4M9ZA 3B85A 4EJSC 4V0MA 1DEKA 1P2VA 3D8BA 1XXHA 3C8UA 3BBPA 2F1RA 4MRSA 5IDVA 4R2HA 2ZYWX 4FMDB 4WZAE 2YINC 3LVQE 5JCZA 1E2QA 3FWYA 2DFLA 3EIHA 5AR1A 4X8MA 4B33A 1IBRA 2XXAB 1OPXA 1T91A 3GLFA 1HY3A 2WWHA 4IRUB 1CIPA 1VKJA 3TGPA 2X2FA 1GILA 5CLQA 2XGJA 2NOAA 2WBLC 1S4QA 1IM2A 2YWGA 3FTQA 3QENA 2ZANA 2W0SA 1BKDR 4LYFA 3ZD6A 3EW9A 5FBRB 4BLRA 1QHSA 2MSDB 1NRJB 5KNDA 4YDSA 3EWAA 5SZKB 2GK7A 1UBGA 5EE5B 3K9GA 3BB3A 4YONB 4D0NA 2H16A 4HAXA 4GMDA 4TL8A 1LS1A 4AIIA 2ZE7A 2GJAA 3CH5A 1G7SA 2VQSA 4G1UC 5K8IA 4US0R 4M4SA 3HR8A 4PAOA 4QFMA 4O25A 3QOFA 1F60A 3W3AA 1G8GA 2WMOB 3BXZA 2WHXA 3O47A 4MUAA 1QHXA 3A1SA 3FOZA 1P72A 2PJZA 2V6JA 2KWIA 3IBYA 4Z8YA 2N46A 1YE8A 2ZYUX 5JSZA 2ZPTX 3QXJA 4TYQA 4JJZA 3NWJA 5JECA 4A8JC 3K53A 1GKUB 3EARA 4C0AC 4XVUA 5FOTA 3SN6A 2BMJA 2PMDA 3VU9B 2QPAA 2GVDC 3AH8A 3R8CA 3BRWD 2NZJA 2NZ8A 2C5LA 3GJ5A 4FI3C 2VP6A 1F3OA 3CPEA 3IO5A 2ZAOA 4LHVA 4Q4HB 3U7EB 2WIAA 3QI2A 1JBKA 3IIJA 2J7PA 2C9OA 2CDNA 3HR7A 1KI4A 4KXFB 1FX0B 1JJVA 1XU4A 1G4UR 3AV0B 2QAGC 2ZUBA 4TYYA 4EPXA 3SFVA 2FH5B 1XMSA 1U0HC 2GEDA 1XB2A 4R2IA 4EAQA 1D9ZA 1QVAA 2YZ2A 4BLTA 1RRPA 1U9IC 4B43A 2P65A 2NPFA 3R9IA 2ZRLA 3C7KA 1Q20A 1Z08A 2FSIA 2VHJA 4HAYA 2FEOA 4IHQA 2GNOA 2PEZA 3CF0A 1W0KA 1IJEA 1E1RD 2JLXA 3EPLA 3M6AA 2F1JA 1KAGA 2VHTA 4QNMA 1P2SA 3IQXA 1T8TA 2BMEA 2UZ3A 4KFUA 5G3YA 4HSEA 3TKLA 1FUKA 1P2UA 2OAQ1 4AKGA 2ORIA 2NTYC 2QQEA 4IDHA 2ZRPA 1SKYB 1NIPA 3B8HA 4V02A 4B6EA 4DBLC 1MO5A 4X8OA 3K09A 4HB3A 2QA5A 1FOEB 1E2NA 1H8HD 5JWHA 4AG6A 4L9SA 2PX3A 4A2WA 5LPNA 4OI0A 4L4UA 2FZLA 4XTRA 3U3RA 4MRNA 1BYIA 1AGPA 3QNUA 4RFVA 2OT3B 3QG1A 5BN5A 5TB5A 4URUR 2D2FA 2MSEB 4Q4AA 4B48A 5C46F 3TJZA 3QKRB 4TL7A 2OCAA 2XJ4A 2CLSA 1P6XA 1I4DD 1P9WA 5F98A 2IS1A 3BFKA 3F5FA 2ZM5A 2W58A 1RIFA 1BMFA 1JR3D 3TMKA 1XPOA 4DLSA 4A8JB 1IY2A 1OIWA 2ZROA 2AN9A 1E0AA 3BFVA 3WY9A 3R7WA 2NQ2C 2EWVA 4IOKA 3L0SA 3OEED 3C16C 1YR6A 3IHWA 3W6OA 1QBKC 1W1WA 2GKSA 4NL4H 1U0JA 4C3ZA 1JJ7A 1KJYA 1OFTA 1MOZA 2YC4C 5CJPA 2DR3A 3VKWA 1UM8A 4M9SA 2FFQA 1XF9A 4Q21A 4JBWA 3VMFA 3B1ZA 4MKGA 3ZYCA 1P61B 2BOVA 2J0UB 3AKCA 4TYWA 1M7BA 4H9GA 5SZIA 1HH4A 1OT3A 5DIFA 4QJ4A 4FW9A 2VIIA 2GVZC 1NVVQ 4DDTA 1T3LA 3CWQA 4DLUA 1OYYA 5KNBA 1DG1G 2PLRA 2FPLA 1G6OA 3KFVA 3QEOA 5FBWB 2A5DA 3AUYA 1E1QD 1ZUNB 3T35A 4FXPA 2ZUCA 1D8TA 4UKDA 4P4UA 1XEWX 1CJVC 2GEUA 2RCNA 4GT1A 4EPYA 2O8CA 3M0EA 4HDQB 2BCJQ 3QXCA 1LFDB 1E2FA 3AGQA 3P27A 1T4GA 5JRZA 1RC8A 1JB1A 1OXXK 5B58C 1NMZA 2RAPA 4Q47A 3EC2A 3CM0A 3DMDA 1CR2A 1E79A 5JLJA 4M1SA 2R2AA 1CLUA 2XJ9A 5JHGB 3K0CC 4F93B 1E98A 1E0SA 1FTNA 4MITA 3K8YA 4D0GA 3EZ9A 5CDFA 2B8TA 4W9MC 1AKYA 3UMFA 1JR6A 1W47A 1R5OA 4NZYA 3AVPA 1ZW6A 2GXAA 4PX9A 1W36B 1SZPA 2D7DA 1G41A 3RC3A 2AKAB 2FWRA 3QY0A 2ZRMA 3MWYW 4LRWA 1VYTA 1CXZA 1S3GA 2B21A 2ZR7A 4URXR 5J4LA 5AJYA 2QPTA 2ZRJA 2AX4A 3AQ4A 1KNXA 1S9HA 1J2JA 4A1FA 2ZSAA 1CJTC 2ZQ5A 4JLAA 3BS4A 3GLGB 3SYKA 1Z6AA 4LK2A 4O2LA 1SVIA 4OJKA 1M34E 3WNBA 3DM5A 1CR0A 4DDUA 2QM7A 1CJUC 4LUCA 2VTKA 4D82A 1SVOA 1JNYA 3KJEA 2G0TA 2JDID 5FTLA 3U7HB 3OF5A 3BORA 3SYNA 1ZYUA 4CT5A 3WYAA 3CH4B 2O8DA 3SR0A 2P5TB 2Z5FA 4PZLA 2XTZA 3CF2A 3L82B 1G21E 3LLUA 4AD8A 4UNSA 2QSYA 3QKSA 4C7OB 3RRZA 5FL7A 4DJTA 4TTPA 1ZC3A 2VP5A 4B44A 4C2UA 3KZ1E 2ZSDA 4GOKA 3K70B 1HQCA 2EYUA 2W0MA 4JLJA 4OKSA 4L9WA 3TK1A 4BFXA 1DS6A 4ZDKA 5DI3B 4P4TA 4WOPA 3VAAA 1E2DA 2ZREA 4DCVA 2D2EA 2AXNA 4PSKA 5C1BA 4KV9A 3GCGA 1VCIA 4C2TA 721PA 3A1VA 1FW6A 4DIDA 3L8ZA 3PVSA 4XSGA 2WTUA 1T5IA 2DFKB 3H4MA 4ZCMA 2ZI9A 4KYIB 1Z06A 1WF3A 3GJ7A 4NE2A 2RGCA 1TEXA 1GUAA 1S1MA 2WZQA 4NH0A 1DOAA 1E2JA 1GWNA 1H8EA 1W4CA 4DT1B 2IWRA 4CRWB 1R7RA 4TQ9A 3CX6A 2R65A 2E87A 4G0NA 5HR5A 4HAWA 1IY0A 2FNAA 3HYRA 2ZSEA 1YU9A 3PEWA 2ODEA 4FD2A 1E96A 1XMIA 1CR1A 3BOSA 5EE0A 1NN0A 2ZRFA 3PUVA 4R7ZA 2HYIC 3ICQB 4QC2A 2JIZD 4PAMA 4BZQA 2WOJA 1N6KA 2E1RA 3EC1A 3ZJYA 3ZIAD 3KQUA 2O8EA 4KSCA 2QMUA 2QZ4A 2GBLA 3LW8A 4V0NA 2JLVA 3UIEA 1D2MA 1FNNA 2WKPA 4RFSA 4H1VA 1FX0A 3H1TA 4D25A 1N6OA 1JQJC 4HLUC 2YOHA 4YXWD 3LD9A 5IHPA 1MABA 3EIQA 4UXIA 5D3MA 4A36A 2FDCA 2QAGA 1SVLA 2V7QD 2ZS7A 1YQTA 3QE0A 4HB0A 4YC7A 4QKQA 4AKHA 3REFA 5H1YA 4Q5IA 3W90A 4ZKDA 5L3SA 1OFIA 4MRVA 1OLOA 1GOTA 2BKUA 2VP4A 4PHFA 2ZE8A 4Z1MA 5B64A 4BLPA 3TRFA 2P5SA 3H86A 2ZEJA 5CDFE 2G88A 1D2NA 2W83A 2JLQA 3QPUA 4OHXA 3LQRA 1M74A 1QVRA 4U7DA 2YKGA 4P4SB 1ZUIA 4BFZA 1KSJA 3TLXA 2DWQA 2WMNB 2FV8A 2WOOA 1ZAKA 3LV8A 1RJ9B 4DZZA 1U2RA 1ZMXA 1TPZA 4PHHA 4TQUS 3UPUA 1XX6A 2OLJA 1Z2CA 2IUUA 4KAXA 1QHNA 3QF4B 4OHYA 1I2DA 3LO5A 4OHWA 2REOA 3ADDA 1BMFD 1FL9A 1N2CE 4UNPA 3ZQ6A 2ZIAA 3O8DA 3T5GA 1Q44A 3B82A 3L0IB 2XZLA 4V0LA 1AK2A 3BK7A 3N2EA 4M1TA 4URYR 1TQ2A 1J70A 3SHWA 1GVNB 4BFVA 1LB1B 5JEDA 1Z2AA 2F55A 4IEIA 1XTJA 2RKOA 4LWZA 4D81A 4QHSA 4BLSA 4XWKA 1MRNA 2FFAA 1AA9A 3WNCA 3GJ0A 3I8SA 4A0FA 1UKZA 1M2OB 1F2TB 3F0TA 1ELOA 2WKRA 4C0KA 3K0AA 4I1VA 2ATVA 3WYFA 2IYQA 4A6XA 2IYRA 1QHHA 1G1MA 1XXHB 3Q8XB 3FKSD 1JAHA 5KPDA 4M22A 4B76A 2WWGA 1A5TA 4HATA 1E4YA 4MYTA 5A4JA 3CNNA 2ECKA 1P75A 4BEBA 3X1ZA 3EAQA 4OQXA 1OH7A 2CLDX 2D4HA 3KX2A 1W5SA 5E95A 2HUPA 4UNNA 3RS3A 2CVHA 1KSHA 3Q72A 1GRNA 2W2VA 1Z0IA 1ZC4A 2A5FA 3B6EA 4C0JA 3VNUA 2V4ZA 5LD2C 1OKKA 1VYUA 5SZHB 1W7AA 2G83A 4PZYA 2G1KA 4TWZA 1MH1A 3O8BA 4MH0R 3UANA 3B9PA 3AM1A 1Z6TA 2ZRIA 2ZRKA 4IFEA 1WQ1R 2BVNA 5CJ2A 4RD1A 4DDVA 2VSFA 1KMHB 5CK4A 2ZJZA 1E2HA 2W2XA 5P21A 2NO7A 3QKUA 3QKRA 3TSOA 3EIEA 4ASUA 4AWXA 3SOPA 4C9BA 1M6NA 3AVXA 2OM2A 5HCIA 2PT5A 5AJXA 2ZRHA 3SDZA 1GKYA 4JSYA 4UXJA 4ESHA 4Z1MD 5L3SB 3PEYA 2HT1A 2IXGA 3T1TA 1SVSA 2IS6A 4A2PA 2VL7A 1D2EA 2HJVA 3AP3A 2RGEA 1XZQA 2AKYA 1AQUA 2IF2A 5K8TA 1Q12A 1YVDA 2R6GA 3Q7QA 4URVR 2I1VB 4A82A 2ZU6A 4ON9A 1TMKA 1G7RA 1NN1A 2RGBA 3LRPA 4JJKA 5KDLA 4KU4A 1N6RA 3W6NA 4BPBA 1GM5A 2ZETA 121PA 2FMXA 2GXUA 1OB2A 2AHOA 4YXWA 2C9CA 4AKIA 3N5CA 4RFSB 3UK6A 2PL3A 1AGRA 1RFLA 2DHRA 1Z6GA 2P67A 5FUWA 3KKPA 3VR2A 3EPKA 2O0KA 3RANA 3PUYA 1W5TA 2F3RA 2WIBA 3FMFA 4JKIA 4LY6A 4P0TA 5DI3A 3CZQA 4JT2A 1BO6A 4WZ6A 5G53C 1KJZA 5JMTA 1HV8A 1ZD9A 1XTKA 4GNKA 1DG3A 4B74A 1PUIA 4UJ5A 3ADKA 2O5VA 1VCOA 1W2GA 4LCBA 1FP6A 4D4KA 1X1RA 1UKVY 3U3OA 2CE2X 3QXXA 3UKDA 1A2BA 4ACAA 1S3SA 3ZLJA 2BJVA 3OE7A 3V4FA 2QRNA 3IIMA 1LF0A 2Q9BA 4I81A 4KJZA 5DI9A 3MCAA 4ASUD 2WWFA 421PA 4XTCS 3TVTA 5H8WA 4HI0E 1Z63A 3A6PC 3SU8A 1EX6A 3GEHA 2QBYA 2I3BA 3EASA 2ERYA 2YV5A 3A1WA 1WCV1 2PX0A 1WP9A 2ZAMA 3TQFA 3H0KA 4OL0A 1KI8A 1NJFA 1WB9A 1ESNA 4Q7MB 4RZUA 1G8FA 2CL7X 4JLBA 2R44A 1SGWA 2NO6A 1B0UA 1LVGA 1JALA 5KDOA 3GQBA 1D9XA 1R5BA 4HUQA 1EFCA 4B32A 4FCTA 1G5TA 2XNDD 5DHAA 2F43B 4GSYA 4YMVA 2O8BB 4C0HA 1NVUQ 4DSUA 1RPZA 3BH7A 3VR4A 2P3SA 3OEEA 3NC1C 1TL7C 2FN4A 2JATA 5HKKD 1UADA 3LWNA 2WWIA 4DLZA 2DBYA 1NVVR 2F1IA 2H5EA 3MAAC 1KMHA 4WXPA 4QBGB 4PQYA 3VR5A 1G8YA 1ZU4A 2TMKA 3E1SA 1II8B 3NH9A 2DYKA 1SQ5A 2HT6A 3A58B 4HZUB 4V03A 4F7WA 2BBOA 2AFHE 1CF4A 5FFMA 4S2EA 3BAFA 4BECA 1ZVQA 1C4OA 4QGHA 2IUTA 3THYA 5E4FA 4ZO4A 4DCSA 4UNRA 4F4CA 3OESA 2FG5A 3SEAA 3FHTA 4B3GA 1OSNA 4CW7A 4BE7B 1T0JB 2GXSA 5JI3E 5TMPA 1W44A 3I3SR 2O8CB 2QMOA 4TQAA 1U99A 1UF9A 3LFUA 3BERA 3QG5A 4ZV4A 2Z83A 3QXSA 1JR3E 2CNWA 1RYFA 2EU8A 1HEIA 1KY2A 1B23P 5GJBA 1XCPA 2F9LA 4KLZA 2NO9A 3U7GA 4LDJA 4RD3A 2DY1A 3UMSA 2KSQA 3NBXX 1R8QA 1RKBA 1Z6XA 4QBFA 3NDBB 2K5UA 2YJTD 3PIRA 4Q7KA 4CGZA 2CCGA 1SVWA 1X6VA 5AJZA 3TH5A 1N3BA 3WRXC 4N0DA 2IS4A 4A0HA 2WJJA 2Y8EA 4ERNA 3B13B 5FOWA 1TAGA 4U00A 1EFHA 2J7PD 5AK0A 1OFHA 3TNFA 1GL6A 3UWOA 1OXTA 2J0QA 1FUUA 1S1CA 1E9DA 3R7WB 2D3WA 5IF9A 1KTVA 3QBTA 2YYZA 1HE8B 1FQKA 1RE0A 2R9VA 2WPDD 4M1OA 4PAQA 5LB4A 3MRSA 3B1WA 3VTKA 3ADBA 1NKTA 2RGNA 3TR0A 1ZRHA 4B2LA 5TV2A 1EWRA 1TNDA 3WHKA 2QL6A 2WJHA 1SXJD 5JEEA 1A82A 1TF7A 4GDFA 1QHIA 4HUQB 4J0QA 3Q85A 1DAMA 1UFQA 1JPNA 5B30A 1T9HA 1KO4A 3LBHA 3R9WA 4QBHA 3MD0A 5CM8B 3U44A 3OAAD 3I32A 1ZD1A 2XZPA 3QUSA 3TE6A 4LJ5A 4D4JA 4TTQA 3JZAA 5DYIA 3GMTA 3FKSA 5BW8A 2A5GA 4NYIR 3TW8B 3CRW1 2J9RA 3RSOA 1YZQA 3SBEA 4F91B 4US2R 2QN6A 3FKQA 1MABB 5AJVB 5JJLA 4ZPXA 1N5IA 1IN8A 2JJ8A 1VCMA 2EFEB 3TSWA 2QSZA 2UVQA 1KSGA 3PUWA 3NH6A 2FF7A 1XPUA 3K09C 2CHVA 3CONA 4OK6A 4QG7A 4MDFA 2VP2A 1E2GA 4KFSA 4H1UA 3T5DA 3KL4A 4XSHA 1FQJA 2ZE6A 5EE9A 1NN5A 2J87A 2ZS8A 3TVDA 3GFPA 1VIAA 4E03A 3DOEA 1N6HA 1XP8A 5FUYA 1K8RA 2CNWD 2W00A 3CO5A 2QT0A 2OE2A 1YRBA 4MKFA 4NYMR 4NCHA 3I61A 3MMPA 4C0SA 4RD4A 1G9XA 2FE4A 5FTNA 1US8B 2F6RA 3BB1A 5FOXA 2J7KA 2REXB 2ZI3A 1XBTA 3CRMA 2IHBA 3AP1A 2H57A 1DARA 4M9QA 4TL9A 3RS0A 3NHBA 3DOFA 3EPJA 5AWFC 4R98A 2ZR0A 3ECCA 2D74A 1ANKA 2MMCA 5TDHA 5TVKA 5JWOA 3VKGA 2DCUA 4JLDA 4BLQA 4TMWA 4Q4HA 5DISB 4KI0A 4V0KA 4RZ3A 4BEJA 4CZ2A 5FL7D 3U3JA 3DZDA 2EQBA 4XD7D 3FYHA 4YLGA 3THXB 3SI7A 1AZSC 3N2IA 2ZRAA 3VU9A 4B2PA 5JBQA 1JEEA 1G19A 3CW2A 4TYNA 1KDTA 3VKHA 4M53A 1TUIA 5IK2A 1FPMA 4NKRA 5FOVA 2HJGA 2ODWA 4RSGA 5JCPA 3U3MA 3OFND 1JECA 5JS7A 5KDDA 2WWXA 3P4YA 3EXAA 4MGKR 3I62A 5HTKA 2WSSA 1QG4A 1XEWY 3OIYA 1Q0UA 1E2MA 4RKEA 5FTMA 4D6PA 5JI2E 4TTRA 2GJSA 3REGA 4DCNA 4AKEA 2EFCB 5HE9A 2JLZA 3D31A 4MGIR 2IW3A 1X1SA 2ANCA 4IVQA 2ZJ2A 4GI7A 1XCMA 1EK0A 2YOFA 2FSGA 1ZCBA 3C41J 3W5IA 3A8TA 2GHIA 4HLCA 3T1VA 3TAUA 2C96A 4HUTA 1E0JA 3JZMA 4DDWA 2DPXA 1DPFA 1OV4A 5H70A 1XD2B 1VTKA 4FWTA 1UPTA 4NBSA 5EE1A 3EZFA 4MA4A 1CULC 4V0ME 3A4MA 3BWDD 2VYFA 4Q7JB 2BIFA 3DDCA 4X8LA 4ZDWA 1G4AE 2HCJB 4DIEA 2PMKA 1R10A 2RB4A 1II0A 2Z0MA 4OHVA 4Q1EA 5K8UA 4KVAA 3UMRA 4FINA 3GLIB 3TW4A 2F9MA 5DLQC 1W0KD 3EA5A 1SHKA 1NBMA 1NSTA 2NGRA 1E94E 1E9FA 4KSBA 5CIQA 3QEJA 1MR3F 4CVNA 2AWNA 3Q7PA 3QF7A 1ZM4A 4XIGS 3M4YA 2P6NA 3FMOB 1IY1A 1GL9B 4RKFA 5KTYA 4M1MA 3RWOA 4C0LA 3AKEA 4AG5A 3U61B 1OE0A 2IF0A 4RY2A 4BLOA 4R71A 5JZVA 1NN3A 3B1XA 1M7HA 4Q19A 2CMKA 1G7CA 1P9RA 5C2JB 4XVRA 4JVLA 3K9NA 4TZ6A 4GPTA 4TT3A 5K8LA 2JJ1A 5J4KA 3NTUA 2OBMA 1IOZA 1UKEA 2HCBA 2IA5A 3FMPB 4B3XA 3ETLA 4EQ6B 2C8VA 4RD6A 4P4SA 3PR1A 2FEMA 2ZI4A 4TLDA 3W34A 1GDDA 2QENA 2Q6TA 1HT2E 4E07A 3AB3A 3GLFB 2BJWA 1GNQA 4NHOA 2XXAA 3U7FB 1FMLA 1X8JA 2GZDA 3ADCA 1N5KA 2ASEA 1XD2A 1O87A 4Q03A 5DYGA 3I1FA 1UKYA 3FGNA 3VR3A 1EGAA 4BFWA 4LX0A 2O0JA 4DB4A 4K46A 4PSVA 2OESA 2EFHB 4YMWA 3HJNA 4DLYA 3B78A 1ETUA 1AS0A 4A4DA 4CEHA 3BC1A 1S9DA 2QAGB 2UZIR 1CRPA 3QPWA 2YWHA 1NSFA 1KAOA 1XWIA 3LY5A 4JSTA 3PCRB 3VX4A 2C04A 2V3CC 2CLCX 2JLRA 4MUBA 3RWMB 1U8AA 2ONJA 2VSOA 1SKYE 2ODBA 3BH6A 1KI3A 4C0QC 4KODA 3AKDA 2GBLC 3U6BA 3GJ3A 2WJGA 4DUGA 2HXYA 5FTJA 4JMPA 4HDOB 3GD7A 2Z4SA 2BEJA 2HF8A 3KKMA 1EFUA 1N25A 1XRJA 1KI7A 1Z83A 1Q3HA 4IXMA 1KSFX 1G291 2PLFA 2BHRA 2ZRBA 1G20E 4RD2A 5F2EA 3WMGA 4ZI2A 1E32A 3KKOA 1SKQA 1Y63A 2OBNA 2A78A 2PCLA 3ZS9A 1BYUA 4UJ3A 4HDCA 4Q4AB 2VP9A 3GJXC 5HZHA 4NPHA 2PJRA 5SZJA 1VMAA 3SHFA 1P60A 1Q3TA 3ZZUA 1R0XA 3A4NA 4PXAA 3B1YA 1AS3A 2ZI7A 4PO9A 3ASYA 2JEOA 4JL6A 4N3NA 1PZNA 2GF0A 3CRQA 2DWPA 1WXQA 3CB4A 4TLEA 4G01B 4PPGA 3P1JA 1KK1A 4JLVA 5TXGA 4EKDA 5A5GA 3HP1A 4TLBA 3VR1A 4G5OA 3U60B 5J47A 2KE5A 4Q02A 3KTAA 2XB2A 1E9CA 5CM9C 2QP3A 2A5JA 2GETA 3TSZA 1Z07A 3GLHB 1TQDA 4KITB 1UJ2A 1BIFA 4LYAA 1E4VA 4FMCB 4KFTA 4A92A 4EPWA 1ZJ6A 3B60A 2XNSA 4G5QA 1R2QA 4OQLA 6Q21A 3RLFA 5E7MA 2FU5C 5CYOA 1MO6A 4TT3D 4HLQB 4D26A 2VSXA 1U98A 2J0SA 3AF1A 3BGWA 4DHEA 4K8OA 4JLKA 3K0FB 4FCVA 5J4YA 1GFIA 2RGXA 3DPUA 2HEIA 3MUFA 1FFHA 5TARA 2O8DB 1O3YA 2OG2A 4LHYA 4BFSA 1TUEA 2IYZA 2UKDA 4JLOA 2OV2A 1UBFA 4NU0A 2DFNA 2QUZA 2ZUDA 1DO0A 4PZZA 4GRAA 5BN4A 5JJKA 3ICEA 2QY9A 3RS7A 3T15A 1ZUHA 1TU4A 4ILEA 1AZTA 2IYUA 1JR3A 1M7GA 1PVOA 1N6PA 2H8KA 4B3BA 2YWEA 5EZ6B
chains in the Genus database with same CATH superfamily
2FPOA 4PVDA 1QG2A 2PGXA 2ZRQA 3L1IA 4H6VA 3T5BA 4EGSA 2J3JA 5AVOA 1YRQA 2VNHA 1K7FB 3CSSA 1GNTA 3Q5DA 1ID8A 3L8MA 2JFNA 2PX6A 3H9CA 4J16C 3QIAA 1J39A 2JI8A 4MSUA 3ENWA 2DF8A 3EWNA 2ECOA 5AI5A 3WGTA 4FFWA 3UWKA 2SCUA 4US1R 1R0WA 3EGEA 3OIUA 1BCRA 1U80A 1F06A 4TN1A 1QDLB 3RSQA 2RHHA 3PPWA 3TDNA 2I80A 1HGXA 4PZ9A 2OLKA 5A5VA 1PFYA 5BSWA 1FUEA 3U37A 2B6NA 4BMNA 4RCYA 4OLJA 1N7HA 1S96A 2YJ3A 4Y6LA 2G0NA 1AQLA 1QPBA 3SE0A 4DXAA 1DCTA 4U2EA 1T4CB 3GJRA 4IJQA 5KYGA 1EFKA 1UJMA 2L69A 3OT4A 1USUA 1RRFA 3T38A 1C1XA 1E8NA 5F5LA 5BYJA 1WEHA 4WA7A 4E2ZA 4QD3A 4AN4A 4BVHA 1E66A 1XLUA 3NU1A 1YJBA 3TSAA 4MDEA 2I2CA 5F5NA 4N1AA 1T0IA 1H66A 2JFZA 4NEGA 3CVXA 1B14A 4WY5A 1HRKA 4EGCB 2QRVB 4R0MA 2DQKA 4L5CA 2QPLA 4YJFB 2ZQYA 3I1YA 3OZVA 4CL3A 2AZ4A 3IBTA 4C2AA 2Y76A 1GRRA 1KBQA 3WHIA 3OLXA 3WGHA 3N7UA 1L4YA 3EY4A 3OURA 2IJGX 4PZAA 4HGYA 1WUYA 2RHRA 3MWEA 4QYIB 1B16A 1ONOA 1XQ1A 3B3QA 4XWGA 5NULA 3T3IA 3U2QA 4BMOB 4GMHA 3T3HA 4J16A 1EXDA 3MTGA 1W49A 1L7NA 3OZAA 1J8FA 3BDAA 1KF0A 3ZVNA 2OLEA 3D9QX 5JASA 4B83A 1Q22A 1ZSNA 2GTPA 5SYMA 4BBAA 2R5FA 2X14A 1US8A 3HDVA 4R9SA 3RT7A 5IX8A 3CG0A 1U02A 3LKVA 2V8BA 4NI5A 1ZM2A 1E62A 4ZT4A 1K0FA 4IIJF 2XSZA 2C03A 3OCJA 3D0OA 3RV3A 4WXEA 5IWAB 4PHTA 4JU9A 4KHZA 1JTEA 2CDBA 1AUPA 3QPVA 4J29A 4TVBA 2BGGA 3G5UA 4CEJB 3L0ZA 4DSOA 1DIRA 1QYDA 3AU9A 3UB4A 3HDTA 4WJZA 3WGZA 5GOTA 3ZTTA 3NNNA 4LG1A 3GLSA 2HRZA 4G56A 1QRRA 1T2EA 4KAFA 4ETIA 3S6JA 5IRCD 4EEXA 4NZPA 4JR1A 2X2OA 3AUXA 3KZXA 1QF9A 1YZLA 2QVCA 5T4EA 4L6IA 5ESDA 1VG9B 1IONA 1JQ5A 3DEZA 4FEAA 3ZK7A 3IT0A 2CJFA 4NDZA 3KEOA 3IE0A 2PZKA 1CFJA 1OMOA 2IYSA 2DJIA 2IC5A 4EHLA 3UOWA 1YO6A 4BNTA 3MHTA 3O8OA 1QONA 2GEJA 2CBZA 3FGZA 3QVJA 3HKEB 3PNQA 2GCIA 1NG9A 4OHMA 1DRUA 2CMDA 2AZTA 4LTDA 4M7OA 3GPLA 1N5JA 2P78A 3EMVA 4CMHA 1XJ0A 2I3GA 2OTCA 4ARZB 3TVYA 2YYYA 2QRPA 3KJGA 1QYXA 1K92A 4HNAA 3M81A 3QEMB 2GXQA 4PXSA 5HRCA 3M5CA 5KJCA 1DUIA 1EVKA 1ZIDA 1R6XA 2QUAA 3I9OA 5CD1A 1DAGA 2OHGA 2BE9A 3P71T 3JV7A 1GZDA 5AT1A 2AFIE 2X8JA 4UMFA 4Q3OA 1UL1X 4KWHA 3WGKA 5K8VA 1H9BA 4CM6A 2C4VA 2GCEA 4RHFA 4Q7LA 5C5IA 3STUA 2GAOA 1T9BA 2FPSA 3A0UA 4J1TA 1KS9A 4AXBA 5EJEA 4EO4A 3BZWA 2QN7A 4JC8A 1EFTA 1SXJE 4NNJA 5DHQA 2DAPA 5E3HA 1GV0A 5CVVA 1IUOA 1K4MA 1VPEA 3TUIC 3VISA 4RTPA 2VH5R 3ANNA 4QHTA 1IE3A 1NASA 1EA7A 3TLJA 4ZMRA 1YQ9A 2PR2A 4LRXA 3CLSC 3NW9A 2GK3A 3NM6B 1X7HA 2XLCA 2XV1A 3HBLA 3K2EA 5JDIA 3I6ZA 3OPMA 3UT5B 1I9CA 1G17A 1HDOA 1IPHA 3M4NA 1QVZA 4IJ5A 1NNSA 5BNTA 4Q9IA 4R16A 4IKEA 3HYTA 4YV1A 1FYEA 2V1XA 1XF1A 1D03A 5GJVC 3DTNA 1BC5A 1KO1A 2BKVA 4MRAA 4ND7A 3REQB 8LDHA 5HZGA 5LCXA 2ZUFA 2VSYA 5DHFA 4JOBA 3IRUA 5CFRA 1FNSA 4NENA 1W0CA 4PANA 1ZP6A 3AIKA 4QUIA 2JLWA 2HQSA 3EHDA 1CS0A 1WQ4A 2W6PA 3I0MA 4IIHA 2C95A 4QQRA 5LDDC 1R6UA 4A6PA 1XD9A 5BUZA 1I0ZA 2BTQB 2PAFA 5AI0A 1YU6A 4QRDA 3S7TA 1BX1A 1U3GA 4MJ7A 5EUQB 2VDLB 2PUFA 4JX8A 4L16A 4ZEXA 5KSPA 6LDHA 4HN9A 4F7DA 2JIZA 5CG1A 1XQWA 4ZIRB 4WVLA 2OXRA 4ZVMA 4B35A 3H5OA 3BGVA 2OV6A 1BEUB 1Y9AA 3L41A 2V98A 1RJEA 1P7ZA 3H65A 1I7SB 2Z95A 1L5VA 1E7RA 3AZQA 3DBVO 3H7AA 4LZZA 2WWVD 1DAFA 1FMCA 2VC2B 4FR2A 3GB9A 4FZJA 3R2JA 1VOTA 1NY6A 4GX5A 4PZDA 2GPTA 3H18A 1CDZA 1OFVA 1GKKA 2BBTA 2ZVQX 3EEYA 4KVZA 4RCZA 4QATA 2VBCA 2CT8A 5G1PA 3TLGA 3AWDA 1OTYA 4Y9DA 3RYTC 2VRWA 1Y8RB 3I2FA 1CC1S 3IEUA 3LY8A 4RVNA 3JD1A 1QO9A 3HUDA 3OC0A 4ZA2A 3GW8A 3SC3A 4HEQA 4IHJB 2CV0A 1SD2A 2HPVA 5DZSA 1FZQA 2XYPA 3P0RA 3WMFA 5KTOA 2V8OA 4IIFA 3LKBA 4AN1A 4EUEA 3CVUA 3EX7C 1E7YA 4BX3A 4I66A 4LBVA 3A37A 4MYRA 3X3HA 5A03A 2HA6A 4I4LA 5T7BA 2P6RA 1FXSA 3PLAE 2NIPA 3M9WA 1C81A 5DGXA 5AM4A 2XTNA 4OSPA 2BFMA 2PTHA 3WDKA 1I30A 1UBEA 5E8JA 2XBMA 1MOSA 1EX7A 1J0AA 1R4ZA 1A9OA 1R0BA 4M1QA 5D5PA 4GNRA 3X1WA 4TMFA 2IYFA 4D43A 4EI2A 4IJ6A 5AW0A 2J0VA 1E1RA 3RUFA 1RMQA 5HFNA 1TZ2A 3B5JA 3FJOA 3S7ZA 3IIKA 1A69A 4ZXPA 1NMSA 4LYJA 5L6LB 5CDHA 3NHZA 2QVXX 1PLLA 4UQOA 4I5GA 2X58A 4IM7A 1ZQ1A 3NBZC 4KK4A 1AGNA 1LZKA 1T8WA 1JG6A 3N0RA 1Q1QA 1CZRA 1KFEB 2EHJA 4X00A 1XSEA 4F11A 4L8WB 1F4PA 5HUJA 1PNVA 1CZUA 2XNHA 4FKZA 2VP0A 4Q9JA 1YV9A 1JAXA 4V39A 1GQOA 3PEWA 4IRMA 2GESA 3HLKA 3RFCA 1BH2A 1PT5A 1G3QA 5F1OA 3HRIA 3TZQA 1PSDA 1KZ4A 1RVDA 4FYXA 4IWNA 2W6JA 3CVOA 3HYLA 3S5JA 4B87A 4F38A 1J97A 1XQYA 2IBTA 3DBHB 3FPHA 5GVRA 4XH9B 3VZPA 1XI2A 4D9BA 4HXYA 1R6TA 3UGKA 2QGNA 4HEHA 3UPDA 5G1OA 4QE3A 4DMRA 4DZRA 2AJTA 13PKA 2CMHA 3DLAA 2ESRA 4P3XA 3FSGA 3BREA 4B3MB 4CQMB 3OTOB 4L4ZA 1RQPA 2XW6A 4B31A 3VUEA 3E22B 1SBQA 3AERA 3LC1O 4Q4JB 4Z9YA 2R7NA 1TVKB 3WO1A 4ALJA 3SNKA 3ZTYA 2QJWA 1DINA 1SR8A 2Z43A 3KTAB 4K2HA 5L8VA 5M2QA 4AY6A 4BCCA 4PPYA 4PNZA 2OSVA 5H83A 4ZYUA 4Y6PA 2VHUA 4M60A 3L9WA 3T1NA 4E5SA 4UM9B 3FHCB 3UOGA 1LS6A 1NJ8A 1CK4A 1XZAA 1J5XA 1A9RA 2JK1A 3RTEA 4PPFA 2GFQA 3NJRA 3K0SA 3AB8A 5HF8A 2OGSA 3GXOA 1P4SA 1U0FA 2ZJAA 5DTMA 3PDHA 3U9LA 2EW2A 1L4FA 4KTVE 4IV5A 2PANA 2Y0CA 2H18A 1Z36A 3NMUF 1O9HA 3LRTA 4A91A 4X6LA 1Z4QA 2D1FA 4P53A 1C9JA 1JA0A 2JAHA 2R84A 3PQ8A 2IYEA 1B93A 2PUGA 4J0DA 1U9YA 4FZ5A 1JILA 5HM6A 5ICSA 2PZEA 1QKIA 1AQYA 3LE8A 1Z5WA 4F4IA 3TTTA 2B7BA 2P2LA 2W6OA 3RM3A 1L8XA 2CEKA 4U2FA 4C7OA 1AGXA 3WIDA 2FN3A 1X80A 2H1VA 3MTDA 2EFJA 4TZTA 3RAEC 3QVXA 1T26A 4WBSA 4ZJZA 3T52A 2CV2A 4IQFA 1JH8A 2FWJA 4ON9A 3QYFA 4LJ7A 3M1IA 4QUEA 4PNEA 1CERA 3EIXA 3GNSA 4TLCA 4GE0A 4OF4A 3PUJA 2H92A 2DQSA 1N1EA 2VYVA 4NG5A 2ZRNA 2JGEA 2YZMA 5EE3A 1GPJA 1VLQA 2ZRGA 2WIGA 4DMLA 4W5TA 4Z54A 2WJWA 2ZIXB 3LHIA 2XUPA 4Z4QA 2OZLB 2QKYA 1P5ZB 2PKRA 3PD0A 1PQYA 1IBLB 2XKKA 4ESVA 1G60A 5GM1A 1ITZA 5JJIA 1FFXB 3TQCA 4F2HA 2QZPA 1XA0A 1X0VA 4R2MA 5GADl 1DFHA 1PE0A 2QRMA 4AUNA 1CJSA 1JFLA 1FY2A 1MFPA 4YUVA 4EB6A 2PT9A 5FIUA 2CF5A 4PO8A 4DQXA 1CF9A 4W4TA 1V5FA 2BL4A 1CJMA 2ISQA 3V7FA 2GJ8A 1AQJA 5FR2A 4HH0A 5G0VA 4A9AA 2J3DA 4NC9A 3ZVRA 4AUEA 1P17A 4P2GA 2I4TA 2VJMA 3TGWA 2PD4A 4KKXB 3J7AC 5AOAA 1QH0A 3BB4A 2R11A 3THYB 2X2PA 1U3DA 1Y6RA 4GZ3A 2Q1TA 2H4YA 2XBLA 3MINB 1OBHA 3EMDA 4Q1AA 5EWLB 3TZBA 1DEHA 4MI3A 5JUWA 3UG7A 5F33A 3IUQA 4RK1A 2RCYA 3H97A 2IUEA 4I46A 4ZVRA 1WCIA 3FZQA 4Q66C 3MNFA 1TC2A 4NJOA 4ABYA 1K6MA 1YB4A 1ZSVA 2BR3A 3NR2A 3COVA 4ZVQA 4RKWA 5MDHA 4AAYA 3GJ6A 3DMYA 2APJA 4BQRA 1PR0A 5J43A 3IDSA 3PHJA 4M9RA 3BWYA 3HU1A 3AFOA 1HEYA 2KHZA 5KOYA 1X1EA 1Z88A 2PA0A 2E85A 4A2QA 2PY6A 4N54A 2A88A 4QFBA 5F73A 4JJGA 4TXHA 1B6GA 4H6WA 4ZC1A 3IUSA 2P90A 1ESDA 3BJIC 3T99A 4FBGA 1ZH8A 5B7QA 4Q1CA 5JPDA 1F2TA 1VIDA 2H00A 2J9XB 4ZYZA 1E99A 1XQXA 1FLVA 2KBFA 2ZJ5A 1MC4A 4ARUA 3IMKA 3OIVA 1E8MA 5GWXA 2Q0HA 4GYYA 4TZ0A 3PNMA 1SHZA 1X2BA 1SK8A 2XDWA 1R6AA 3BKWA 1SXJC 2WYVA 3KUCA 4RA6A 4YV7A 3LUGA 1L4LA 2V6BA 1Z25A 4EG6A 3WYGA 5B58T 2R0QC 1UJ5A 1FLNA 1XPJA 1I1QB 1Y33E 3V1MA 4ZAYA 3K9WA 4YBRA 3CW8X 3DVAA 4E5MA 1FZTA 2CUNA 3DV2A 1HETA 1QTIA 1UOQA 3AR2A 4U3JA 3RTBA 4FFOA 2OORC 3C3EA 3NC0C 4YAWA 2Y1EA 3T34A 1WZUA 1XCGB 1XDBA 3FFTA 2M6KA 1AKEA 4KBGA 2Q27A 4UCWA 4AY4A 5JR3A 3GDHA 3AI3A 1XJQA 2VJDA 4IIJB 4JNCA 2H11A 1U94A 3PI6A 3K73O 4MV9A 5IK2D 2VZEA 2Z04A 1P9LA 1Y81A 5FAXA 5MF6A 3ZHZA 5KU7A 2XITA 1NUTA 3IX7A 1QUEA 3AVQA 2ZIZA 2MJLA 1X94A 2E37A 4REQB 3ZD8A 3I9JA 2ZZNA 3MT9A 4AG3A 1MJNA 3L8HA 1J0EA 1OAAA 5FA5A 1G8SA 2YWFA 3EQ2A 1Z5ZA 2ZTUA 1PFQA 1H6BA 3AMVA 3KM0A 4GP9A 3TR5A 3AGPA 4BVKA 2F8SA 3DMNA 2QLBA 1W4BA 5FPYA 2G4CA 2J46A 2IU6A 1PQUA 4DM4A 2YR0A 2GDZA 1XJ5A 4N3AA 2VTDA 4LF5B 5SICE 2ATIA 4GOXA 1MU0A 3EEBA 2IYTA 1RP7A 2Y1KA 1YB5A 4WNAB 1DKUA 1QJCA 2A9KA 3D6UA 4CIVA 3PLRA 5F1PA 4EMUA 3W7BA 2VYCA 7ABPA 1Q1NA 2KX7A 3L7MA 3FSJX 3CIOA 4JJ8A 2HIGA 1U0LA 2XOKA 3CTMA 1KI2A 4GOOD 2YIMA 1Z0FA 3RSSA 1EQAA 3IAS6 4RJKA 4BFTA 2CNBA 1E3TA 2GEKA 1DHTA 3AIOA 2IX3A 1F9EA 2VH2A 2J6HA 2XYHA 5D3QA 5DNAA 3HCOA 4AK9A 4YGYA 1NBME 4C7JA 4POOA 5ES4B 1OZFA 4PPNA 5ICFA 4TWBA 1PZFA 4YN3A 4ZPJA 3VR6A 3WVNA 1Y8CA 2FEXA 2Y92A 1PS0A 1YI8A 4IILA 4XB2A 2QNRA 1Y34E 3PNBA 4COKA 1S2LA 4EF4A 2C7QA 4MUGA 1E3JA 7REQB 1LVUA 2BHSA 2FEAA 2Z8YM 4Q1BA 3TIVA 1NE2A 1Z0ZA 1CTQA 1I0LA 1NONA 2VRBA 3KPUA 3JRNA 1C3OB 2QN1A 4O4IA 2B2NA 3NJ4A 1V11A 4YMHA 4AVYA 1QPGA 4H18A 4M7PA 2GJKA 4GI5A 4AWAA 5K7SA 4FYMA 2AA3A 4H7IA 2QZ9A 4U2KA 3LDAA 5FORA 4EG0A 3HKCA 4I6GA 5IF3A 4ARZA 2FLWA 3TI9A 2J4DA 4BO7A 1HF3A 3KG2A 1RQNA 2Z2ZA 1MB3A 3CN7A 4QOHA 3R3ZA 4DCTA 5JY1A 5F51A 4CEIA 3IL2A 2H85A 3A3KA 1TB4A 4NCXA 4PX3A 3I8OA 5EJ7A 2I4OA 2W71A 2WFZA 3K1AA 4OV6B 1YR7A 2O23A 3A1UA 2X3UA 1HDZA 1OI4A 2O6LA 3CPJB 4XQGA 3E5NA 1P33A 3DEIA 4ZQCB 2WE7A 2AEJA 3D59A 2X7HA 3DAHA 3L0YA 4DPKA 2GA9A 5C1OA 4OLBA 3N7TA 3ORSA 2NVUB 3DEFA 3DFIA 3ZCUA 4RTNA 2VDKB 2ZIEA 1N0HA 3JQFC 4EMSA 2VUUA 4V0RA 1J49A 1B42A 3GO4A 4RK4A 1LV7A 3FGOA 3CMMA 3M6LA 1NVWQ 1TAHA 1J5PA 1OWMA 2KLBA 2JC3A 3IMCA 2VDJA 4MW6A 3TLKA 5LWQA 4KRFA 2CGEA 4MUIA 1HC7A 1UR5A 2OV4A 2OUKA 4QUDA 5IAEA 4AY5A 5IDXA 4Y98A 1MC1A 3FZEA 4GF5A 4AX4A 2AD5A 2C1ZA 3KZOA 1PW7A 4OHPA 4MIEA 3VPFA 3UMYA 3RRMA 4A15A 2JA1A 3EQ6A 4UM5A 2VZ8A 1FTYA 4KVFA 4F9FA 1RJ9A 4XYLA 3GPDG 2H1HA 1XMJA 4IGIA 5IBRA 5K0LA 4OYYA 1FXUA 1WPXA 1YDWA 4N9QA 4M1WA 2ZE5A 2VAMA 2PBFA 2F9FA 1Z6QA 4H0FA 3UB3A 5SYAA 3UWDA 3V3KA 3MN1A 2P6UA 3K5PA 5CUQA 3ADPA 4BMVA 2Y2UA 2JFOA 1YJAA 4HDKA 1L9XA 5T4HA 2AVNA 1XFAA 3L79A 4HQOA 3O5AA 2G9ZA 2JFXA 3EVFA 3G9UA 3MCUA 3PF9A 4G37A 2B92A 4FJ0A 1Z0DA 2WSIA 4OL9A 1OPRA 2AC2A 2AOTB 3OQ6A 2Q4EA 2IV7A 4EITA 4XGKA 1RABA 3U44B 1JEOA 3ZIUA 1NY5A 1SUSA 1VG1A 2FMUA 2H1LA 2LGJA 2XX3A 2NYVA 4HB2A 1AKUA 1CIVA 1JNXX 1TFRA 3S1AB 4TS9A 4ERXA 3HBJA 5K3DA 3WYDA 3IGFA 4FNOA 1FSSA 2I0FA 1QC5A 1J8MF 3E9DA 3QJYA 2ZCUA 4QU0A 1EM8B 1W6UA 4WZBE 5CLLA 5ER9A 1OZGA 2JLSA 3DMPA 5FNVF 3T1YB 4WLVA 4MWGA 4BVLA 1N36B 4U63A 2WWRA 2OHOA 2V0CA 2WJIA 3P2OA 4RIGA 4HYYA 4P0QB 1RXYA 4JP8A 4U2BA 1QZUA 5IVKA 1E9RA 1N4DA 2BSAA 5KO2A 4P4NA 1P31A 5DF1A 3VRHA 2I4RA 5IJ9A 3D2CA 4TV8B 1II8A 1HXHA 1ODSA 4J4HA 2HNBA 4WGFA 3TTVA 3V3TA 4DIKA 3MA0A 3AXTA 2QIPA 5IJWA 4OPMA 5FI1B 4GDMA 5I7FA 2G5GX 3L7BA 3FPKA 2ZPAA 1MEEA 3D5EA 1A4RA 2QAJA 4EY4A 3SAJA 5I4BA 4TQGA 2CLOB 2KLHA 3EIOA 2PKYX 4PFSA 2QMEA 3LVRE 3OOYA 5HIAA 1G18A 3EHEA 2NYRA 2X3YA 4D0RA 3DYBA 2Z2XA 2OAP1 3K4QA 3EGWA 5C7LO 5IYZB 3EEOA 2BWJA 1LLQA 1V5GA 1UEJA 3JQ9A 3KB1A 4DPMA 1KZ1A 3N8NA 3PIDA 3NBMA 4MMYB 4WBNB 1RRCA 1W5BA 2ZR9A 3PYLA 1SO8A 3F7MA 1RWNA 4X1OA 2ATCA 2Y1FA 2ZYTX 5CNJA 1HURA 4BQQA 2ZXFA 4JROA 3LWZA 4B45A 1SRRA 1T5LA 1ULUA 4R6XA 4S2UA 3RYFB 4DC9A 4I1UA 3U81A 1SOUA 3CY6A 1R6BX 1P7PA 3CJQA 3I8XA 1KQFA 3PUXA 4NXMB 4JU8A 5F9HA 5JXJA 1W36C 2IKSA 2P2CA 3GBSA 1E4OA 2OCXA 4Y6GB 2CVFA 3LLSA 1QRAA 3WK4A 3ZWDA 4KHPB 3ZZ1A 4II7A 4JVNA 5AOCA 1YA4A 3LT5A 4RACA 2GCOA 3C7DB 1Z2OX 3FYUA 2WD8A 1KEWA 4UAGA 4TMTA 4W9RA 1JQKA 1WJGA 3EDQA 4LV6A 1E20A 1O95A 2V97A 5AUNB 2FFHA 3MD9A 1O94C 1UXGA 4X1KB 5I45A 1V37A 5AH0A 2FSHA 2BJHA 3AWIA 3ANXA 1TKBA 2OK7A 2H4WA 4G85A 3EPHA 4MYHA 3EZ2A 3T7CA 4MQEB 3B38A 1XEFA 5LKRA 4TTJA 1Y98A 3JY6A 5C8YA 2RMKA 2XGMA 2P9ZA 3JWEA 1ZK4A 4NYMQ 2COUA 3T0GA 4HQ0A 1IHUA 4LKOA 1T1IA 2YVLA 4MV8A 4DYDA 3G7NA 3PYMA 1OA1A 4POAA 4AMYA 3GI1A 4WW0A 4Y2YA 3G2KA 4MR7B 4IOJA 4JV5B 1F0KA 1JDTA 1X1TA 3LL7A 4J03A 2EKLA 3H04A 4FQ5A 2WFLB 5ARDA 1DKRA 1FC0A 1L4UA 3Q8MA 2K2QB 3C2QA 3PL1A 2WSSD 4DLVA 1PLKA 4QOSA 5CITA 2HK6A 3WWCA 4M98A 1PZGA 3QMPA 3IVAA 5JDCC 2WM2A 5C8YF 1U1IA 2A9RA 4YMUA 2RAFA 2QD5A 5FNVB 2ZVPX 4BGDA 4GL2A 2WICA 1V9LA 1TTTA 4PCUA 4WN9B 1NV9A 3TO5A 1UBCA 4RU1A 2PUBA 4CE6A 3EGIA 5HDBB 2O8FB 1AKRA 4G9BA 4EHAA 2ECPA 4F2WA 5FOQA 5JO0A 1DBIA 2ATEA 4ZI3A 2Q99A 4CLOB 1O5OA 1EUZA 1T0UA 5K0GA 4LNUB 3EH2A 4CDMA 1KVTA 2VNAA 3AVTA 4KPEC 3F5MA 1VZ3A 3IEXA 2PLWA 4URWR 3RFTA 2XYQA 1SCNE 1Y8RA 3LC7O 2BLLA 2JCSA 1NPYA 3ZU5A 5EMKA 1P1RA 1HPLA 3QVGB 4O2RA 2XSZD 4HWKA 1ZRMA 4XFDA 4MUXA 1P0FA 3DQPA 1NKVA 4QASA 3S1AA 1XRNA 1XRSB 1RYHA 2OXCA 3B6ZA 4B4DA 2WU1A 5KOIA 1G7TA 2ZYIA 1PGQA 5F35A 2A86A 1YCFA 3HK2A 3T4UA 3UKJA 3E3LA 2EKPA 4RDHA 3VR5H 2B37A 1CNMA 5IU6A 3RHFA 4RPCA 3HTXA 4P31A 1BHSA 5F4BA 1ZZEA 3QFFA 4HMOA 3WLEA 3D7MA 3I3OA 2VUHB 2PKQO 4HFNA 1QGUB 4XGIA 1Z68A 5BYKA 3MWFA 3IQDB 3OZXA 4IDDA 4IVRA 2R5WA 1V6CA 2X5OA 3JD4A 3HB5X 2VF8A 1TJ5A 2JCVA 2QR2A 4PQFA 5GQSA 2JGDB 1NURA 5DT9A 1PNRA 3C3DA 3VAZA 3DD1A 1JFFB 2OGWA 2SHKA 1Z0AA 3F78A 5CYPA 5REQA 4D9KA 1YI0A 1DC8A 3I1IA 2Z3WA 4NYJQ 4HB4A 1P4HA 4MEBA 2BC9A 2ZDHA 5GJCA 3TKAA 4U4AA 3EPPA 3JX9A 3NB0A 4DCOA 2JH8A 4EYEA 1LRLA 2Y1WA 5H9WA 3QVOA 4DBZA 2B34A 2QPOA 3C6BA 3BEOA 3SFZA 5C8ZA 4QULA 4W5RA 2VPYA 2H3EA 3FX2A 1DTSA 2PK3A 3IAM1 1N2XA 4UZSA 1LSUA 3EPRA 4UU0A 2GILA 1LTKA 2IXDA 3I9LA 4LHXA 2H1IA 1EG7A 3LBYA 4L6CA 4QYXA 1WNFA 3R76A 1IXKA 5AKHA 4DG9A 3RSLA 3DT8A 3KCNA 2C78A 3IV7A 3AETB 3U3KA 2XKAA 5AIBA 2GBCA 4KR3A 5I4CA 1WSBA 1J8QA 4JC5A 1D6MA 1DRKA 1IJFA 3EULA 4FE7A 4RY0A 4ARBA 3CCBA 1KAHA 2QXYA 2XNDA 4P82A 4QYWA 1J8VA 3W5JA 1ZLXA 4K9KA 1RYYA 4YR7A 3B70A 1X7ZB 4RSHA 3T1TA 3YASA 1V3UA 1PT8A 2A9FA 3EXG1 1ODTC 4UXHA 3R3JA 5CD9A 2QGZA 2IQIA 6REQA 2GWHA 3QU9A 1IXRC 2XWJI 4BTLA 4BQFA 2EGHA 2YBEA 2B6HA 2YRXA 1TQ6A 4KC0A 5FPSA 4UHJA 4J6EA 4YRKA 2RC5A 4D8YA 5FBZA 3WE7A 3HU2A 4MW1A 1HKHA 1MGPA 1EQ2A 5IN5A 3HJUA 4TTSA 3IODA 5I8PA 4JLNA 2KYRA 1P0PA 1TZMA 2ZYSA 4GPEA 5TR9A 3GLIE 4LHZA 5FBLB 2JJ1D 2NZXA 5LYYA 5BRAA 2C4TA 1LTQA 4DR5B 4FVTA 3OO1A 1A9PA 5IUJC 1NNUA 1VJRA 4E1VA 2AOVA 1ZL0A 5E38A 1FVHA 4Z4GA 3QVVA 4H2DA 4LBYA 1W0JD 4LBWA 1VHLA 4HADA 4U6QA 3C4JA 4LGYA 2P68A 1BOOA 1EFRD 5BRJA 2D5CA 2BMAA 1DAPA 4Q16A 1V7CA 4MS3B 4E32A 2H9IA 4UUAA 3K8OE 3UJ9A 4BY9E 4GOJA 3WIEA 1Q77A 2QNBA 1M72A 3C7TA 2ZXUA 4QDUA 4AJ2A 1NBHA 4RTKA 4WA8A 2X8AA 1WUTA 4Y0VA 3OQ1A 1YJ8A 2BGIA 2GSWA 2H1RA 5F2KA 4FGUA 2X7XA 5GJWC 4CMIA 1Y8ZA 1ZGAA 2JGKA 2P6MA 2EG5A 4G8BA 1D2HA 1Z4PX 2PT7A 3TBHA 3F6RA 3UW1A 3DNPA 4LHEA 3PNPA 5GV8A 5C31A 4BZXA 4V1CB 1BROA 3LHSA 5IKEA 1EHCA 1P77A 3QTBA 4FHFA 5CFQA 2B8NA 4I5EA 4MYUA 3BRSA 4HRYA 4QYTA 1FYXA 1U81A 2Q0XA 4AQ7A 3L40A 1BS1A 1TZCA 3QEMA 4RPLA 3I76A 4B47A 4X1YB 4D45A 4GYKA 3B1VA 4XYGA 2VXYA 3RRFA 3TE7A 1EIWA 4Y8VA 2QXUA 2R8ZA 3KKKA 4KPFC 4ENVA 3VU0A 1X7WA 4MMZB 1BWSA 4QECA 1H94A 5IVPA 1UWVA 4C87A 2ZSBA 1USGA 5DYNA 3ANTA 5BV7A 2B7CA 4QDZA 3OFNA 2QW1A 3ZG6A 2YYAA 2FA9A 5FADA 2YZKA 5LQSA 4DOMA 5JNSA 1T1SA 1OH8A 1PUXA 3H2IA 2W2LD 2P8JA 3CRRA 1UDWA 1IBCA 4XGQA 4ZVNA 3QWIA 2I6UA 5JAQA 4C4PA 2OO7A 3JVUA 3A1FA 4FJ2A 4DLAA 2WAMA 4JL5A 4F5ZA 5KI6A 3U4DA 3DWEX 3FETA 4JP1A 1AIPA 2BEKA 4LGCA 3VVMA 4J0FA 4BFYA 1HDRA 4PV7A 4FC7A 1KO8A 1NVAA 4RHEA 1EFLA 2PGNA 1H2YA 1K5DA 1XTSA 3E9CA 3IELA 4BMYA 1D4OA 1NW3A 1TVEA 2O2ZA 3HWSA 1T13A 3N53A 3Q3VA 4B46A 4D9GA 5KHLB 1CNEA 4JBYA 1WB6A 3PD1A 4TL6A 2CYBA 1RU3A 3GR6A 4LWQA 1PVDA 4ML3A 2O14A 1NGSA 4V0MA 3R3SA 2BFAA 3OD5A 2X8LA 3D8BA 1HDGO 4RA6B 1B41A 2O2HA 3BBPA 1M2WA 5IDVA 3E0QA 1VYHA 5DU2A 1IHDA 1ZWLA 4Y9SA 4BLUA 5JCJD 1WXIA 4DA4A 2QJRA 2F4VB 2JAPA 3PNSA 3H3FA 2BFBB 4Y2TA 1IBRA 3A6HA 3PCTA 4YALA 3ZW9A 1OPXA 4DHWA 8ABPA 4Y2GA 1CUHA 5JSKA 1PRYA 2WWHA 1ENYA 2X1HA 4RE6A 1FK8A 3ZBPA 4M99A 1CIPA 5E0OA 5JC8A 3IMEA 3F3SA 4HFJA 1ACMA 1PJAA 1D07A 3BD6A 3IR5A 1S4QA 1GRCA 4J2OA 3NM4A 4J0GA 4PRKA 2BSXA 3DZKA 2YWGA 4WT7A 4XWYA 3R24A 2NSJA 3RRJA 1EP1B 3U4GA 5EHGA 4ARSA 2JW5A 3TZCA 4O4JA 1KJQA 4BLRA 1KPIA 1XZMA 1SOAA 4MA5A 4YRRA 2Z4TA 3GIDA 2H8GA 5KNDA 1U28C 3BFPA 3C24A 3KR9A 1WCIB 5SZKB 3W9UA 3DTYA 2V5VA 3K9GA 4YI3A 4L2IA 2FSUA 2IP4A 4BX0A 1Z3CA 2H16A 3ZGYA 5DM4A 2R87A 2Q5HA 1XTUA 5A3RA 4BO5A 1LS1A 3KL2A 3ZDDA 3GEMA 5F9MA 2MYTA 2GD6A 1ESZA 2NNLD 1UT5A 2D3TA 2XA9A 1NYTA 2A9OA 3C39A 4F1WA 1OWLA 3AYXB 1A5BB 3HR8A 5HW0A 4O25A 1U8UA 5KVCA 1G8GA 4CKXA 5EWJB 2WHXA 5KQSA 3L6EA 4QXRA 4EECA 5HF6A 1FMTA 1PU2A 4UDXX 1UBRS 1XZEA 4HZGA 1F8YA 1P72A 4MDYA 1JF8A 4S24A 1UCFA 3IBYA 1XZIA 3ASVA 3NJ8A 5TPZA 1PZHA 1S7GA 3NWJA 4ZARA 4IHJF 2OQRA 4XVUA 4H0CA 2NUPA 3TXXA 3WLSA 3KNZA 1QIGA 2GVDC 3PE3A 3R8CA 4MEAA 3BXPA 4P4LA 3SQDA 3WGYA 5EJ6A 3OBIA 3X2EA 4R84A 3VPSA 2VP6A 1KORA 5BORA 3CPEA 4NARA 2ZAOA 4Q4HB 2QRUA 1EVLA 2WIJA 3FPBA 1JBKA 4KXVA 1ODCA 2YW2A 1BWRA 3OF2A 5BQOA 4DR4B 2RGUA 2ZPUA 4X3CA 2NO4A 3EK2A 1KI4A 1XU4A 2VXOA 1H42A 5TC4A 2PMCA 3ESCA 5KYTA 2HPHA 3ETHA 1LNQA 5K3BA 3SFVA 1XMSA 1AE1A 1G4HA 3MMXA 1H5NA 4R2IA 3T9FA 3HG7A 3OC6A 4Z7OB 1D9ZA 2G40A 2P4QA 4BTVA 4BLTA 1WXXA 4WKBA 1U9IC 3PQ3A 2DEUA 2JAWA 2P65A 3IFSA 2B36A 4HRAA 1SUCA 1VSBA 2XMDA 2QT9A 2ZRLA 3NTXA 4RZQA 5H80A 3TINA 2WYUA 5B6JA 5JXHA 8ADHA 3BA1A 4GECA 1ORWA 1W0KA 5ALUA 4KLRA 4ZOEA 3IUMA 1FNCA 1WSAA 1GQSA 3IP9A 1ZGBA 5LQJA 1KAGA 3LDUA 2PU5A 2BGUA 5BSUA 4WZBB 2W2OA 3LDFA 1N92A 3F5QA 1T8TA 5JH7A 1S4MA 3W2HA 1HK7A 4NU6A 1ZDMA 1FUKA 5KYYA 2ORIA 2NTYC 3IH5A 3OHSX 4MQFA 5CXUA 4EA8A 2WDZA 1J06A 4ALLA 4Y1GA 4U0KA 1QRUA 1F1JA 5DCYA 1KPGA 1O4VA 4AS2A 1G55A 4HKTA 1L4GA 2CN1A 1PR9A 3VI4B 5JNVA 3A2LA 1BDJA 3HXLA 5AVZA 1ABFA 2WYWA 3VUFA 4UTVA 3BJMA 1SQ6A 4AG6A 3NYQA 1ESEA 3U3RA 1PYOA 3AEXA 3GZTB 1B6SA 1OU0A 1ULZA 3MMZA 2OT3B 2LCIA 3PS9A 3Q3EA 4FDLA 5JFTA 5TLSA 2G9UA 1C4KA 4IDBA 4URUR 3BD8A 5TB5A 3ROPA 5CYGA 1SOMA 1U2GA 2YFHA 1WSDA 5IVDA 3IAEA 4L22A 4TYMA 4TL7A 3CIFA 4IMPA 1N34B 5IJ0A 1P9WA 3F74A 1AZLA 1TFUA 4H7HA 4D9CA 1ES9A 2C4NA 2K4MA 3TMKA 2Y99A 4B3TB 1V1MB 4MI6A 4J75A 2CHEA 5BSKA 4X62B 4A8JB 1IY2A 2GF2A 1WVIA 3LQFA 3VBCA 5LL6P 1OIWA 2ZROA 2AN9A 4D3ZA 3BFVA 3U7QA 2NQ2C 4AO7A 5KYWB 3MB5A 1SXQA 4RVFA 4XA8A 1K9SA 4XLTA 2BEWA 3WIBA 1BKYA 2C3MA 1U0JA 3DLPX 3PSAA 3G8BA 3RSHA 4AP6A 1NI5A 2W2QA 3AY6A 4X6XA 3AR6A 3ZGOA 3VKWA 4B8WA 3B53X 3I9V6 4C3VA 5A5FA 4DIFA 2QTBA 2B1QA 1V9SA 4I55A 4QQFA 3E61A 3VMFA 4KNWA 3KEMA 2CLMB 3WJAA 1DTWA 1P4JA 3AKCA 3QEBZ 2YCBA 4JWKA 5ECWA 4H9GA 5SZIA 4H0NA 1DG9A 4O4LB 3N2KA 1Y3IA 5BMOA 5A4AA 5CCXA 1NVVQ 1YVEI 4DDTA 2VJQA 1GADO 4R6WA 1H1LB 1NE7A 1T3LA 4DLUA 1OYYA 4EZIA 4DA0A 1DG1G 1CPYA 3KFVA 3IPRA 3LZ6A 4XDGA 1IB6A 4ARCA 3G6WA 3DVSX 3HZOA 4C6RA 4MRMA 3AUYA 1E1QD 1QCCA 1XRQA 3PXXA 3RSFA 3T35A 3J81A 3LLVA 1XDWA 3L6DA 1CJVC 2GEUA 1NFFA 2RCNA 3M0EA 3G9TA 2DE0X 1DC3A 3E5RA 4HDKB 4RNCA 5H7XA 4A23A 4A8TA 1XK6A 3P27A 1T4GA 4EDFA 4RMJA 5DHTA 4R8RA 2C3UA 1JIXA 1NMZA 4E12A 2JGFA 3ZZMA 3CM0A