2CE2X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPASE HRAS
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ce2X00
2CE7A 3A1TA 1QHNA 4PC6A 2AN9A 2FEMA 2RAPA 1H8EA 3X1DA 3VX3A 4LHWA 1FTSA 4B6FA 1ZU4A 5E7MA 2QSZA 2V7QD 1IY2A 1FZQA 1COWA 1E4VA 1GOTA 4XOIA 4JLBA 3TR0A 1DTSA 1E1RA 1T5IA 2FA9A 3Q72A 4DLTA 1WMSA 3AKCA 4URVR 4URWR 4EQ6A 2PH1A 1OF1A 3B5JA 4LC1A 2GHIA 4R98A 5L8VA 4KITB 4UQOA 4ACBA 2YKGA 4C0HA 4PC2A 4MYUA 4I99A 3FWYA 3UG6A 4DDWA 3B78A 3C5HA 4IXNA 4KV9A 4U00A 4TTPA 3GMTA 2O8DA 1P2TA 1ZNXA 1XMSA 3F0TA 1OXXK 1P5ZB 3CF6R 4V0KA 4D4MA 2XTZA 5E3HA 2ECKA 2FFQA 1GUAA 1DARA 3E1SA 4DLYA 1W7AA 2ZUCA 3TAUA 1E2FA 4P3YA 1ZIOA 2QI9C 1SVIA 3VR4A 3O8RA 2ZJBA 5AK0A 4EQ6B 4KBFA 3KQUA 1NVXQ 3OESA 1U0HC 3KFVA 4IXMA 2WTUA 4KXFB 3WYAA 1Z28A 3SJZA 3SBDA 4IOJA 5LB2A 2FDCA 4A36A 4CEJA 1Q1ZA 3T61A 4IDQA 5CLQA 1J70A 4LOAA 1YR9A 2R44A 3JVVA 2PX0A 2QL6A 2W6JA 4IFEA 4TYYA 3BFVA 4YDSA 1KJYA 4RKFA 2O8BA 2QAGC 4DCVA 1MRSA 1GNPA 1YJ5A 4M1KA 2AHOA 1S0UA 2V6JA 1FMLA 2GEVA 1W0JA 3NDBB 3EWAA 4DDTA 4B71A 3K70D 4DCTA 5FL7A 1U8YA 4GBMA 4PPNA 4C4PA 4EFMA 2PJZA 3AVQA 2Z0MA 2JDID 1QDEA 4IW3B 2C04A 3DL0A 3SFZA 4L9SA 3P4XA 3TR5A 3DVLA 5IF9A 1Z83A 1R10A 1LS1A 5H70A 3AKYA 1T3HA 2UVQA 5FTMA 3SJAA 1CBUA 1FP6A 1E2PA 3IHLA 3LV8A 2WJHA 3U2QA 3I1FA 3KB1A 1GRNA 3KJEA 1BYIA 2CLSA 3QF4A 1XEWX 2FX3A 2GVDC 3VFDA 3GLGE 1CJUC 4LHXA 4OK3A 1CJKC 4ARZB 5LD2B 4BZXA 5EUMA 2BDTA 4TLBA 2NMVA 1U0LA 3AKDA 4JLOA 4XD7D 3QBVA 3TE6A 1T3SA 1OLOA 2WWFA 1YVDA 4XWAA 2ZS7A 3NVAA 1DG1G 3UG7A 4HZUB 2F55A 1TEVA 2ATXA 5TDHA 2G0TA 3K9GA 5FOTA 2G77B 2BHRA 1Z47A 5F2EA 5FBVB 2FU5C 1W0KA 1W4RA 2HJVA 2WAYA 3AP2A 1XMVA 2L0XA 4DEXA 4URXR 1EESA 5AUPB 4GSYA 1ZC4A 4B32A 5E95A 4I4LA 1FTNA 4QXAA 1ZINA 2ZYWX 5EP3A 4HB4A 1CXZA 3G5UA 4NCNA 2OAP1 1E96A 1K5DA 1W46A 2A30A 4D25A 4P4SA 2VP9A 2A5YB 3RWOA 4WXPA 2IYVA 2FH5B 1PV4A 2PMDA 2C9YA 3QPWA 3LD9A 2ZRCA 4PC7A 2DCUA 1OKKA 4TTRA 4TMZA 3W6OA 2O0KA 3HR7A 3GJ4A 4LV6A 2CL6X 2CK3A 4FW9A 1OFTA 4KVGA 2D3WA 1E79D 2IL1A 5JJLA 2ZYVX 5J4HA 3MJHA 1N0VC 4C7OB 2YOHA 1WRBA 3H1TA 4S2EA 2O8EB 5KU1A 1N6RA 1CJTC 2VBCA 2NO1A 2ZRBA 5CIQA 4CGZA 2R6AA 1G21E 2R6CA 3NBXX 1UDXA 2W83A 3CZPA 4OQXA 5IK2D 1E9AA 3IPXA 1F6BA 1R0ZA 3QEJA 2J1LA 2O8FB 3NEJA 4BLPA 3R9WA 4DB2A 2F1JA 3MWJA 5FH9A 4JLMA 2AD1A 1WXQA 1NY5A 1OYYA 5SZJA 5L3QB 1NP6A 1GKYA 5FPYA 4GMDA 4B74A 1GL6A 3NXSA 1ZIPA 5KO2A 1GRRA 4V02A 4WAUA 1XTIA 3THWA 4C0BA 5DLQC 3AH8A 4FIDA 4C0QC 2I4IA 2OCBA 2ZJYA 4LBVA 3AF2A 5L3SB 4PAMA 2PCLA 3GLIA 1KK1A 2XJ9A 4B3FX 4Z1MD 1NJFA 4FCWA 3AVTA 2OLJA 2YWFA 4N1AA 3B2EA 2KI5A 1E2DA 2XNDA 1UBCA 1GNQA 3TH5A 4H1VA 3K9NA 5EE9A 4Q02A 3U4QB 4TQUS 4AKEA 4NCHA 2F1HA 1KSJA 3TQCA 3U3MA 5FBQB 4E22A 2CHQA 3I8SA 3NHAA 4PSAA 2XZPA 4Z51A 1Z08A 3Q9LA 2ODWA 4KFUA 4JLNA 5DISB 4EFLA 3NBZC 3KJHA 5FR2A 1XD8A 3LA6A 1GZSA 4MYTA 4TL6A 4DCNA 3KXKA 2FSGA 2WMNB 4FMBB 1PLKA 1XXHA 5JHGB 3AKEA 1Q1BA 4PHGA 1L2TA 5KSPA 3BS4A 1G9XA 4YXWA 3X1XA 2HLDD 2VRWA 4QHTA 4RZ2A 4B48A 1CR1A 2OZEA 4QC2A 1KI1A 2Q21A 5JWOA 3QSYA 2GTPA 5AUNB 1KSFX 4ASUA 3GLIB 4FMCB 4X8MA 1G6HA 4W9MC 2F6RA 3RS0A 3PIRA 1S3GA 1FQJA 3O47A 4B3XA 1B23P 1UF9A 1R5NA 3NC1C 4UXIA 4M1OA 2GNOA 3OEEA 1YR6A 4L8GA 4GOXA 4MYCA 5IDVA 1Z22A 3FE2A 4URZR 2EW1A 2FNAA 2FSHA 4IDPA 4KFSA 1LY1A 1XCGB 3MRSA 2Z43A 4PZYA 2W6IA 3FKQA 1N5JA 3FMFA 1F2UA 3NC0C 1VPLA 1ZMXA 3AGPA 4LHYA 1U9IA 3IIKA 4XVUA 2ZI6A 4ZV4A 2BM0A 3CH4B 3U5ZB 1ZCBA 2XZOA 1ELOA 2IYZA 4Q7MB 4EPYA 4EJSB 4C2TA 2ONKA 3LLUA 3T5GA 4UNSA 2QAGA 4LPSA 3B1XA 2A7QA 4QGFA 2ANBA 1FOEB 2IW3A 2N1BA 2YOGA 5EQTA 4MGKR 5L3VA 1XBTA 4NYMQ 2P5SA 4M9QA 1FUUA 4EJSC 1E0KA 2JJ1A 1IXRC 4OJKA 1UKEA 3ECCA 4LV8B 4B76A 4A0FA 3GLFB 2ZSFA 2QRNA 5FFMA 1CU1A 1G5PA 4LWZA 4S35A 4QM7A 5AR1A 3RSOA 3ZZUA 3B13B 4D4KA 3R7WB 2R62A 2XJ4A 3CPEA 2DFTA 4RD3A 1R0XA 5E7IA 4G01B 5FPSA 4Q4HA 4AYWA 3VU9B 4AI6A 2WBLC 3OIYA 4DBLC 1K6MA 5J4YA 2ZI3A 3ZVLA 3L8YA 4Q7LA 4XWKA 2F9MA 4ZO4A 2G0NA 5GJVC 3CF2A 3EZ2A 1OJLA 4YMVA 2HCJB 5DHAA 1P2UA 2D62A 3WRXC 3NDPA 3UPUA 1C1YA 3HP1A 2EWWA 1R4AA 1E4YA 3NBYC 4RJLA 2PCJA 2VHTA 2VLIA 3EPJA 2AD5A 2FGKA 4IOLA 3T1VA 2PT5A 2IHBA 2WKQA 4Q1EA 4BUJA 1Q3TA 5JMTA 1IAQA 4QHSA 5IK2A 4L15A 1P2SA 1R5BA 2BBTA 2HV8A 4FMDB 1TQDA 4FINA 1Z0KA 4B35A 3AVVA 1UJ2A 2KB0A 3L8ZA 5DH9A 1KSGA 5J4VA 2OFXA 1HEIA 2B6HA 2FG5A 1G3RA 2VA8A 3GJ0A 2CCKA 2ODBA 1DO2A 2OBMA 4UNRA 1XTJA 5GJBA 1HT2E 5ANRB 3U6KA 1DAMA 1V5WA 3WMEA 2YHSA 5G3YA 2CEAA 5JLJA 4M2LA 3MD0A 4MH0R 4O3MA 1BYUA 3I4LA 2DWPA 3CB4A 1U99A 1NMZA 4QGHA 1CRPA 2VSOA 4P4SB 1NMYA 1OYWA 4RD4A 4IDNA 3MUFA 1HQYE 3GFPA 1G17A 3I8XA 4ON9A 5F98A 3U60B 3UXMA 2ZRPA 3WY9A 1XTSA 3BH6A 3OIWA 1CULC 2QORA 2PZFA 3PUWA 3J81k 2EFCB 121PA 3QXHA 4KI0A 1VIYA 3B1VA 5A0FA 2QM7A 3HYRA 4II7A 1US8B 5HTKA 2J0SA 4MITA 2IS6A 1KI3A 3KDSE 4OQMA 3M1IA 4C30A 1OFHA 1E2NA 1RE0A 2ZRLA 1QG4A 3QUSA 2AX4A 3VR2A 2YOFA 5HZKA 1ANKA 1NJGA 1KKMA 4DLUA 3QENA 2IS4A 2FFAA 1Z0AA 3TSOA 3LQQA 4MUBA 4Q1DA 5KNDA 3GLFA 1W1WA 2A5FA 4XWOA 1N0UA 3AUXA 4DC9A 1E79A 2FZ4A 1AQYA 4Q00A 1N6KA 2X77A 4Q7JB 1M2OB 5CYPA 3ZZTA 4NCJA 4D0LB 5FUWA 2Q6TA 2GEUA 4ITRC 4CDGA 5HKKD 1NN5A 1US8A 5FL3A 2O8CB 3OFND 1WB9A 2AXNA 1CF4A 1M74A 1QVAA 1HQCA 4HEJA 2EQBA 4LBZA 4KLZA 2EFEB 4QRHA 4ERNA 4HDOB 2GF9A 4JL8A 3BIFA 5HR5A 2ZJ8A 4TYPA 5AUQA 5JFGA 3QKSA 1JQLB 1DAGA 1F5NA 1E9BA 1E2MA 3FMPB 3KKMA 2V54A 2FF7A 3GLHE 4HI0E 3KTAA 2QSYA 4PPQA 1HV8A 3OEED 1RPZA 1PZNA 1R2QA 1U9IC 1E2GA 5KPDA 1E2LA 2ZRAA 3LW7A 1OFUX 4NDZA 5AUOB 1GKIA 4M9XA 1KK3A 2Q9BA 3WNCA 2QPOA 2NPIA 5TXGA 3RHFA 2QMOA 3H4MA 2G1KA 2GCPA 2OCAA 2GF0A 2GCOA 4P4UA 1E9DA 1QRAA 2ZAOA 4DVGA 2C5LA 2LCFA 3DHWC 3CRMA 3BD9A 5UKDA 2D06A 2FFHA 1U98A 1BS1A 1KO7A 4ABYA 3CW2A 4O2LA 4ZI3A 4GL2A 3H2YA 1EXMA 2C8VA 3C16C 2WZQA 1E99A 5AJYA 3C41J 2WAXA 3CNOA 4NYJQ 1QHYA 4MGZR 3KTAB 4C0SA 4TT3D 1XMJA 2FZLA 3PJRA 3D6TB 3SR0A 1XMIA 4ARZA 3UANA 1TUEA 4RSGA 2GBLC 2WPDA 2Z5FA 5E4FA 2WJVA 1KO8A 2KSQA 5FI0B 1XD2A 2KJQA 2DHRA 3U4QA 1OPXA 1J7KA 3NTUA 4KHZA 2YNMA 1NBME 3OAAD 3R8CA 1W44A 2C78A 2LKCA 3GFTA 3Q5EA 4RCZA 3R7WA 3K70B 2PZGA 5G3ZA 5KPJA 2X8AA 2P0EA 2GJSA 2NO0A 5GVSA 5DN6A 2ZI9A 2XOKD 4MQBA 2P3SA 1MKYA 4WBSA 3F5FA 5KDLA 4KLNA 4HZIA 3B85A 2VHQA 4OYHA 5CITA 3SC3A 3VKGA 4JVSB 1YU9A 1M7GA 1LTQA 3CRRA 4JZKA 3AVPA 2ZRFA 1ZM9A 4ZKEA 3I5XA 3BBPA 2GZAA 4A8JA 1VYUA 4KFTA 5AWFC 4J0QA 2CCGA 3T15A 4BZQA 5EZ5A 3AM1A 3OHMA 5FUYA 1IONA 1S96A 2VP2A 3LY5A 2VP0A 2ZEJA 3B9PA 2XAUA 1CS4C 4Z8YA 3GEIA 4TLCA 2WVJA 1XU4A 2ZE8A 4F91B 4HB3A 2P6UA 1ZD1A 2IEZA 1AK2A 1G7TA 1N25A 3OAAA 2IK8A 4U5XA 1ZYUA 3TIFA 3QKSB 1TADA 1A5TA 1R8QA 4I81A 4RKEA 2B7CA 3CZQA 3JZMA 1R6BX 1OSNA 1JEDA 2G6BA 2H18A 1KJWA 3IHWA 4IEEA 2OSBA 4DLXA 2ZJOA 4UNPA 5EP2A 5TVKA 4GFDA 4PC3A 4V0LA 1KMQA 4RFSA 1XFAA 4A6XA 3CX7A 4FCVA 2LKDA 3RYTC 4BFWA 1A1VA 4TZ6A 1GNRA 4BEJA 2O8DB 5B2ZA 3LO5A 1JR3A 3GD7A 4Q4HB 1XPRA 1P9RA 5L3RA 2EFDB 1QHXA 2ZR0A 4HLCA 1A4RA 2WM9B 2Z4RA 1VCIA 2O0JA 2WJJA 2RB4A 4PZLA 3V9PA 3W34A 3T1QA 4HB2A 2BV3A 2D7CA 3EC1A 1KK0A 3NH9A 5FUVA 3EAQA 3PG5A 3U3KA 3TMKA 4XSHA 2XXAB 1G3UA 3GCGA 5CJ2A 2GAOA 5D3MA 5CIWA 1W49A 2Q3MA 1NN1A 1FNMA 4GZLA 4JS0A 3DDCA 3ZH9B 4A92A 1XRJA 2IYXA 3HPRA 4HB0A 4LJ4A 4EJSA 1FPMA 3IO3A 1XF9A 5GJWC 2J9RA 1RW4A 3ASYA 2ASEA 1EFHA 2WJIA 1V43A 4Q1AA 1OT3A 3LAWA 1EK0A 1GVNB 1HE8B 4PPFA 3ASZA 2V3CC 3WNBA 4A2WA 1DEKA 3UK6A 1GKUB 3P4YA 1IM2A 1UBEA 2JLUA 1WBBA 1DE0A 4Q21A 2GZDA 1TUIA 2OT3B 2QTVB 4JBYA 3VQTA 3EIHA 1FFHA 1MO5A 4LUCA 1P7CA 3HDTA 3AUYA 4QL3A 1XB2A 4TWZA 1GSIA 3IBYA 1IY0A 5A4JA 2G88A 4XIGS 3AVUA 5TV2A 2NQ2C 4MGYR 3WNDA 2IYSA 1OE0A 1S1CA 1NLFA 4KFRA 1ONBA 5JCZA 2ZI4A 2BBOA 4KSBA 2V8OA 1KY3A 1MO4A 3OF5A 3WP0A 1GAJA 1QHSA 2WIBA 1MO3A 1J99A 3HU3A 4F4JA 4IEIA 2RHMA 3BGWA 3SHWA 4LYJA 1GG2A 1XP8A 4DB4A 1SVMA 1IJEA 3L0IB 2ZITA 2FV8A 1XXHE 4QG7A 2VP6A 3RANA 1MOZA 2WJGA 3A4MA 3DO6A 4GDFA 1JB1A 1D2MA 4PXAA 1G18A 3OEHA 2MSDB 3ICEA 4MDFA 1IN4A 4TN1A 1Z6GA 4JLPA 4R2HA 2XX3A 4OI4A 4CW7A 3LWNA 5HE9A 4PFSA 2GESA 1IHUA 3FFAA 4OI2A 2VSXA 4CVNA 3QG5A 3LDAA 4ZDWA 4DCUA 1IXZA 3DKPA 1AM4D 2G1JA 1QBKC 2FMXA 3GJ7A 4JLVA 4JVMA 2F7SA 5FBLB 2ZETA 2HT1A 3MGCA 3UATA 3ADCA 2RGXA 1R5OA 3QY0A 3DOEA 1G8PA 3KKNA 3N5CA 2VHJA 1Q21A 3TUIC 4OHWA 4D4LA 2F1IA 1E0JA 1FQKA 3EIEA 2OBLA 3PITA 4A0RA 2V55B 3ZVNA 2IWRA 4GPTA 5BYKA 2P67A 1GM5A 3C7KA 3SYKA 1KSHA 3REGA 1OIWA 4DLSA 4PO1A 2AL7A 2AKAB 1T9HA 2J0QA 4KO8A 1R0YA 3GLGB 2OXRA 1XX6A 4GZMA 1TF2A 3W90A 4HAZA 1JJ7A 1Z0FA 4R2IA 4RZ3A 1T4GA 4CF7A 2ZTSA 1G8YA 1U94A 4KU4A 1X8LA 2CHVA 1W36B 3R9IA 2JJ2A 3SHFA 4A9AA 3B1YA 2H5EA 3PUVA 3AVOA 3W8NA 4B6EA 2YWGA 4BQSA 2V7QA 1QF9A 3A36A 4JYBA 1TTTA 3AF0A 3QPUA 1KMHB 5J47A 1QHIA 4KVAA 1H8ED 2O5VA 3IBGA 3R9XA 5L3SA 1E1QA 3ZVMA 4UNNA 4Q9KA 5K8TA 4U7DA 2QBYB 1NKSA 5BN3A 3IEUA 2E1RA 1WP9A 3FFBA 2J45A 3K0CA 4M9ZA 1YZUA 1I2DA 5DI3B 5FBRB 4G3XA 1T91A 5AJXA 1XD9A 4TYWA 3EA0A 4Q48A 2OUKA 4ACAA 5FR1A 3RS2A 3ZS9A 1S9DA 1N6PA 4ASUD 1E98A 3IGFA 5C18A 1ZM4A 1NIJA 4IJMA 4YXWD 1XTKA 3X1WA 2BBSA 2BEJA 1G20E 2GDJA 2YZ2A 1SVWA 4MRRA 1KOFA 4C0JA 3TUZC 5KHOC 2KWIA 3Q7QA 5EP4A 4XSGA 4A1FA 1PUJA 4ZDKA 2ZRIA 5EP1A 3WMGA 2ODEA 1ZJ6A 3QPVA 4ZCIA 4OL0A 2ZROA 1P72A 4JT4A 2J3EA 2Z4SA 4BGDA 2IYRA 4LI0A 3ZDQA 1MO6A 3O8CA 4B44A 2JLWA 3WRYC 1AN0A 1BOFA 1DS6A 5JRZA 5AJVB 3MMPA 4AKHA 1YR8A 3Q7PA 4M9SA 1T0JB 1Y63A 2DWQA 1AA9A 1AQUA 1ZRHA 4B2LA 1UBFA 4LPKA 3U3JA 4IDHA 4LK2A 3G0HA 3ZLJA 1JAIA 5G41A 4Q4JB 5LD2C 2P65A 2OV2A 4PQRA 1HURA 1LF0A 2BMEA 4ZCLA 4RFSB 3FVQA 4ZKDA 1II0A 3CNNA 2UZ3A 5DI3A 2GETA 4RD1A 1TPZA 3DKVA 2PZEA 3NWJA 3PXGA 5JSZA 1XDBA 4QNRA 4IFBA 1M34E 1N6NA 2IYYA 1AIPA 3KZ1E 3PUYA 1IXSB 5HCIA 3MWYW 4OI0A 1E0SA 4QHYA 1O87A 3PCRB 5IRCD 2GXUA 1MV5A 1COWD 1ZVQA 3VR6A 1RRCA 2D7DA 2EWVA 3MWKA 4Q18A 2OCPA 3VR3A 2OM2A 1T8UA 3LLMA 1L8QA 2JLRA 4IOMA 1RYFA 3UMRA 2H17A 1KDRA 2R6GA 2YC4C 3K0EA 2XSZD 2O8BB 821PA 2RGCA 3EWSA 1RVDA 1DPFA 2JCSA 1SVSA 1W36C 4MYHA 2NTYC 1EG7A 1JALA 1UKYA 1WF3A 2P6NA 2GJAA 3A4NA 1H8HA 2XNDD 1N6OA 2XITA 2WSSA 2ORVA 2IUUA 3IIJA 1JECA 2VTKA 1OIVA 4B33A 2QU8A 4TLAA 2FFBA 3MSXA 1SVLA 3VX4A 2QUZA 1IJFA 2CK3D 2ZQ5A 2HF8A 2YYZA 4XTRA 3UIEA 3CRQA 3SEAA 4LC0A 3MG9A 4Q1BA 4Q4AB 4A0HA 3LX8A 3RS7A 3WXMA 1AZTA 1Q20A 2W0MA 4B34A 1YQTA 2G83A 4Q01A 3K09C 5JEDA 3QVUA 2ZE7A 2KBFA 2AWNA 4D80A 2K5UA 1OB2A 2AWOA 2IX3A 3QIAA 2R8RA 4BFXA 1W48A 2BCJQ 2VHCA 4K46A 4O0MA 4HAUA 4RD0A 1AS3A 4ZPXA 2QN6A 2HYIC 5KNBA 3UMSA 3KQNA 3AB3A 1Z29A 3FTQA 3LVQE 1OHHD 4QGGA 5DIFA 4CEHB 4A8JB 1LF5A 1Z0IA 3HU1A 1DOAA 3BB3A 1RRGA 5DYGA 3IIMA 5TY0A 5GJCA 3AVXA 4CEJB 4OI1A 1ETUA 1UADA 3K0AA 1OB5A 1ODFA 3GJ8A 3CPJB 4CYMA 4OQNA 1J8YF 3VAAA 1UBGA 1F48A 4B2PA 1EFCA 1D8TA 4TL7A 3GEHA 2IUTA 1G7SA 1QHGA 3I92A 4JSYA 4N3NA 4NZYA 2W0SA 5SZIA 4EFNA 4TMVA 3OZXA 3D3QA 2WWHA 3V4FA 2OO7A 4AG6A 4WZAE 3IO5A 1P75A 1D2EA 1KKLA 4BECA 3KX2A 5C4MA 4BRUA 2JIZA 4P32A 5B58C 3TLXA 2OFWA 2ZXUA 4AKGA 3PEVA 2DYKA 4Q4AA 4X8HA 2E9SA 1M6NA 1RRFA 1XD2B 4M1YA 1M1YE 3B60A 1QVRA 2IBMA 5SZKB 2QEQA 5H1YA 1U8AA 4EUNA 2IF2A 1SHKA 1Z2CA 4I1UA 1E32A 3AEZA 5CK5A 3SDZA 1X1SA 4ZIRA 3N2IA 1NF3A 1VCOA 2NO7A 1YZGA 4JKIA 5H8WA 1Q1QA 4Y0AA 4JLAA 2ODNA 4I1OA 2DFNA 3CR8A 2WSMA 2C9CA 2PX3A 4M1SA 3WMFA 3VNUA 1Z06A 2BOVA 2SHKA 3FHTA 2NGRA 2QM8A 1QHHB 5EE5B 4KJZA 4P4TA 4PHTA 4Q66C 3GLFE 2WWWA 3QKRA 1G1MA 3BH0A 2R6DA 3GJ6A 3UMFA 1BIFA 1FNNA 1E3MA 1IN6A 1TEXA 4NKRA 1TQ6A 2G9NA 4O25A 1LFDB 1TAGA 4TQAA 3SZRA 4NTZA 1LNZA 5FTLA 2A2ZA 3WHKA 2KE5A 2V1XA 1ZBDA 4A0GA 5JI2E 2WWIA 4V0NA 1W36D 3RC8A 4WW0A 3QKTA 2XOKA 4W5HA 2VO1A 4LX0A 3TW8B 4Q47A 5TARA 5BXQC 1W47A 2Z83A 4EDHA 2QTHA 2NZJA 1KNQA 2EYQA 2ZJ2A 4DLZA 2J0VA 1P61B 3CX6A 4DZZA 1KI6A 3D8BA 1EGAA 4AK9A 3QQ5A 2QG6A 3D31A 3VR5A 1YHNA 5FL7D 4AYXA 4X8OA 4O2RA 4Y0VA 2GA8A 1HE1C 1S8FA 1UFQA 4TLEA 3MLEA 1DBSA 4F93B 3L2OB 2YC2C 2YWHA 2R6FA 4G1UC 3THOA 2GAAA 4Q9JA 3QXCA 4F4IA 2V9PA 1E2KA 1UKVY 1Z6AA 2WPDD 2H16A 4G5QA 4G5OA 2BVNA 3EX7C 1E1RD 1XWIA 2AFHE 1XEWY 4LJYA 2FGJA 1GL9B 1NVVQ 4Q9IA 5CLLA 3H86A 4LYAA 3RS5A 2QAGB 3T1TA 4DSOA 3H84A 4FMDF 3SS8A 2NOAA 2O0HA 2F9LA 1KAGA 4WZ6A 2CLCX 2OBNA 2J0UA 4AYTA 4BASA 1U8ZA 3FHCB 3FKSD 4N0EA 4NYJR 3IDQA 3AV0B 2I1QA 2VH5R 2C2HA 3V4RA 5DN6D 1HYQA 4MKGA 3K1JA 3QKUA 1YZTA 1G64A 1E9CA 1GFIA 2WKRA 4G5SA 2E87A 2BJVA 2GKSA 1IN5A 5M04A 2Q9AA 5EE0A 2AK3A 5EUQB 2C96A 4NL4H 2ZRJA 3RRMA 1GDDA 2J87A 1VG8A 1NSTA 5CB6A 2J5XA 3ZIAD 3PUXA 5BN4A 1NL3A 4B47A 5FTJA 1ZM7A 1L4UA 2W00A 5FOVA 1Z07A 1T8TA 2QY9A 5HPYB 2O8CA 2IYQA 3I61A 4A2QA 3A1VA 2W2VA 2GZHA 4MRVA 4FI3C 2CXXA 1Q3HA 2ZR9A 5HE8A 5HKKA 2A9KA 1M7BA 2VYFA 4RFVA 2QP3A 4TSFA 1BO6A 3K0AB 2J0UB 4POAA 3RRZA 1J90A 3GJXC 1KY2A 1S9HA 3KQKA 1SQ5A 1OFIA 4YMWA 2LWIA 2C03A 2VL7A 5P21A 2CMKA 2JLQA 1CR0A 4FCTA 4TMTA 1G3IA 3CONA 3KXIA 2ZRMA 2RGNA 3QJYA 4NPHA 4BFYA 4C2UA 3QKRB 3IQWA 1G5TA 3U7HB 4HLUA 3BE4A 1VG9B 1Z0DA 3FOZA 1TL7C 3EA5A 2IYUA 3W3ZB 3TUJC 5BN5A 4AY2A 1KO4A 3AGQA 1VHLA 3KKQA 1AGPA 4CRWB 2GBLA 2QE7D 2WKPA 2XNSA 4NHOA 5FPTA 4BFUA 2JJ8A 4MRNA 3U3OA 3QF4B 1A2KC 2WICA 4TMKA 5K8UA 4Q7KA 2IT1A 2ORWA 2ATVA 3L0SA 2OCYC 5BWMA 4JJKA 2DR3A 2PLFA 3BC1A 3ZGXA 2BCGY 1FX0A 2IXGA 2UKDA 2VP4A 1VDZA 4OHYA 3EPHA 4OK5A 5L3QA 2O52A 3LXRA 1QZXA 2ZUBA 2CVHA 2F43A 1JR3E 1VYVA 2ZJ5A 2FJUA 2ZE6A 3LBNA 2DY1A 3FPAA 5BYJA 3WBJA 1SKYE 4LRWA 2A78A 5CYOA 2OLKA 2HYDA 3C8UA 3RAPR 1W5SA 4YMUA 2BMJA 2PEYA 2AK2A 2JEOA 1XPUA 3CR7A 4CEIA 3M0EA 4LYHA 1OH7A 3KUDA 1Q57A 3KKOA 2ZI5A 5JECA 4DUGA 2EU8A 2DFLA 4NU0A 2ZM5A 1CEEA 4QJ3A 3T35A 1KI2A 3C5CA 4QKQA 2FSIA 1A2BA 1XEFA 4C0AC 5KYKA 2CVFA 4LJ5A 1X6VA 3MCAA 1G3QA 3CRVA 3BK7A 4UJ3A 1IN8A 3CUEF 1RJ9A 3U44A 4B3BA 1IQPA 1HH4A 1EWQA 1XEXB 4EPTA 3SYLA 4CT4B 1ZU5A 1SXJB 3CBQA 1WBDA 1U90A 3QOFA 5KSYA 2F3RA 3SYNA 3EW9A 4OKSA 3RSLA 2GWHA 5AJZA 1G291 4OK6A 3P1JA 1D2NA 4LJ7A 2ZS8A 5JSZB 1R7RA 3ZJYA 4DDUA 2CL0X 3HJNA 1G8HA 2ZSEA 4KAXA 1W0KD 2FWRA 4DLVA 1DVRA 1YE8A 3I73A 1E9SA 1F2TB 3AP3A 1NLYA 3SE0A 3THYA 3EXAA 2XB4A 4RZXA 2G3YA 3SN6A 1SKQA 3QXJA 1DAIA 3RWMB 3GJ3A 4BFTA 5JS8A 2VF7A 3C15C 4A8JC 1Z63A 2YVUA 1KNXA 2IXFA 5HZHA 2NZ8A 3VHXA 5K8IA 2WWYA 2WIAA 3U7EB 3FMOB 4QM6A 5KNCA 3SFVA 3W5JA 1KI9A 4I1VA 4WA7A 4BEBA 2ONJA 4TSFD 1AKYA 3C14C 3DM5A 5JBQA 2XB2A 3DZDA 2IEYA 4LZZA 1JPNA 3EARA 1F2UB 2QP4A 4JLJA 2JLVA 1NKTA 3E2IA 4C3ZA 1RFLA 4TLDA 1L7VC 4RD6A 1KIMA 1CJMA 4KYUA 3KQHA 2O8EA 1SXJE 1JPJA 3F3YA 2RGEA 2BIFA 3ZIAA 4LHZA 4C9BA 4LGMA 2HUPA 1CRQA 1NNEA 3HYTA 4QJ5A 1G8FA 4US0R 4ZIRB 2ZSBA 2HXYA 1Y3AA 5DI9A 2JLZA 3ADDA 2QBYA 4PSKA 1UEJA 1BH2A 5JS7A 1W4AA 4E07A 1VYTA 2X2EA 3KFXA 1KDOA 1SKYB 1I4LD 5FOUA 2GJKA 2Q0HA 1TX4B 1PLLA 1A82A 1ZUIA 5FOWA 2H1LA 2JLSA 3A4LA 3LRPA 3PV0A 5G53C 3EZ6A 3ND8A 4UJ5A 2W6JD 4ZDIA 2QPTA 2B8TA 4QOSA 1DO0A 1WA5A 4AIIA 2MSEB 4GP7A 3IEVA 1NSFA 4YDHB 1LV7A 5FOSA 2QPAA 5EXPA 5J40A 5DE3A 2FPLA 2I3BA 1YR7A 3OFNA 4LJ8A 1E2HA 2WWXA 3S1AB 3THXB 2ZRNA 4KSCA 3B8HA 5JCPA 1P9NA 3BFXA 1YRBA 2CLDX 3F8TA 2ZREA 4GOKA 3W3AA 3TRFA 1ZC3A 2QAJA 3EASA 4UNQA 1G16A 4HAYA 1H65A 2RGGA 1AJEA 3QXSA 3CRW1 2IYLD 3SJCA 4EAQA 4YC7A 4DDVA 1VHTA 3WYGA 4UXHA 2OILA 3P20A 4M22A 4M53A 4A4DA 2V6IA 3E70C 2IS1A 5FTKA 3I3SR 4QBHA 3THYB 3JZAA 3AVWA 5JWHA 3TQFA 4L9WA 4F92B 3A58B 2QNRA 2QTFA 4AC9A 3LBIA 1SVOA 4Z1MA 1E69A 3X1YA 4RCYA 3KUCA 1CIPA 4N0DA 3U7FB 1KTVA 4AKIA 2X19A 2WOOA 1HT1E 1D9XA 1Z3IX 4TMXA 3GP8A 1TF7A 3UWOA 4D82A 2A3RA 1JR6A 4JLKA 1KMHA 5CJPA 1N0WA 4LYFA 4K8OA 1WDTA 4EIWA 3THXA 2VF8A 1VTKA 4GMXA 4TYQA 5FPHA 1ESMA 3D7MA 3A1SA 3NIBA 3U7GA 1TQ4A 1KI8A 4ESVA 1XZQA 4QFMA 5LB4A 1KZ7B 1VG1A 2ZRHA 3EZFA 1GIAA 4GNKA 1X1RA 4DT1B 1KYIA 3PEUA 2D4HA 4AG5A 1KO5A 4NP6A 2D2EA 3T5DA 3OE7D 2IS2A 1NG1A 5DGXA 2IWHA 3SJBA 2XZLA 3TNFA 1NBMA 3EPKA 1II8A 5C2JB 3B6EA 4HAXA 5EE1A 4C0KA 3PEYA 3EZ9A 3W5IA 4Q9LA 4BLQA 1MABA 4OQFA 1MR3F 1P6XA 1XTRA 4MDEA 3W8RA 3CPHA 2NPFA 4L5BA 1YZNA 1J8MF 4A2PA 2HJGA 1ZD8A 3IQXA 4OHXA 1R8SA 2R65A 3K0FB 1CJVC 3PENA 5JJKA 4KBGA 3U3RA 4YONB 1BMFA 2A5JA 1OXTA 2PMKA 2WSSD 4MKFA 4XH9B 3ZZ0A 4RZUA 3EIQA 3BORA 4HUQA 2C95A 4US1R 2QROA 2PT7A 2FPMA 1I4DD 2I1VB 5B30A 1W4CA 1UAAA 1R0WA 3OE7A 4LJ6A 4IHQA 3TW4A 2JGNA 1U0JA 1HTWA 1WE2A 1XCMA 5FOXA 2PBRA 3PEWA 1OHHA 2ZYTX 1TMKA 3CLVA 4HSEA 2RGAA 4JVNA 1E2IA 4GRAA 1X8JA 1ZM2A 2CHGA 3LXXA 4KCGA 721PA 5KDDA 3A8TA 2XTNA 1AZSC 2O8FA 4QBIA 2XSZA 1NLZA 3FGNA 3FKSA 2QT1A 4WVFA 5FTNA 3A1WA 4HUQB 1S1MA 1KAOA 4UKDA 3O8DA 2GXSA 2W58A 4JLDA 1D6JA 3HPQA 2GRJA 5JEEA 4D26A 1I4TD 2Z6VA 4DKXA 1RIFA 1XZPA 4PX9A 4R7ZA 4B3DA 5JJIA 1IBRA 3GLHA 1KO1A 2EYUA 4W5JA 4WXRA 1N5LA 3ND9A 1OXVA 1P3JA 1P62B 1YZQA 1MABB 3BAFA 2NIPA 2N42A 2DWOA 2H8KA 2ZRDA 3CF0A 1FP7A 2OHFA 1XJCA 3MWLA 4FD2A 5JRJA 3PUZA 4A82A 1OH5A 4E03A 2UZIR 3K8YA 1RYHA 3RRNA 3W9YA 2C9OA 2ERXA 4YMSA 4XVRA 2A5GA 2V1UA 3B9QA 3CX8A 5LDDC 3M4YA 3ZQJA 1RKBA 3WBKA 4M1TA 3KL4A 2QP9X 1G3MA 2QGZA 3C4JA 1AS2A 4AWXA 1FUKA 3CKLA 4P0TA 3SU8A 3ADKA 2D74A 2BBWA 1W0JD 4A6PA 4ESHA 1IY1A 3GQBA 3MAAC 4MGIR 4NH0A 3TSZA 2P5TB 4URUR 2VP5A 4PQYA 4D0NA 4DEYA 1NN0A 2BKEA 1CP2A 5K8LA 4FWTA 1DAHA 1MH1A 2HLDA 1ESNA 2CDNA 1QHHA 3NH6A 4BWYA 1JI0A 1RC8A 5D3MB 3PFIA 3RDPA 3RVBA 1X3SA 1RRPA 2FOLA 1SGWA 2IXEA 1DADA 2CCJA 4L16A 2BWJA 1HY3A 4GI7A 4BFSA 1BKDR 1F60A 2ANCA 2AR7A 3SOPA 2F43B 4IOKA 1PVOA 2PLRA 4JMPA 3NKVA 2F1RA 5EE3A 4OQLA 1AS0A 1EX7A 3RLFA 2BJWA 4P31A 4CT5A 1ZAKA 2IC5A 2OESA 3TSWA 4ZDJA 3GPLA 2BMDA 2NG1A 4OJQA 1S3SA 1OIXA 2BEKA 3SNHA 3VU9A 1ZNYA 4JKYA 3P26A 8OHMA 1Q44A 1N3BA 2QENA 1CLUA 3L0OA 1XNJA 2WWGA 3K0FA 2VPPA 4IRUB 5FUXA 5KDOA 4HDCA 3CNLA 3K0SA 3K09A 2TMKA 3B7GA 1SXJC 3LVRE 3R8FA 4LBYA 4TMWA 4V03A 3DZ8A 2ZJZA 4PTLA 3TJZA 1E94E 4LJAA 3K70C 1W4BA 2B92A 2JJ1D 3GEEA 4V0MA 3QG1A 3QVVA 3LQRA 2CJWA 2JIZD 4B3CA 5FI1B 4M8NE 4LSGA 3KJIA 1OV4A 1OXUA 1XEXA 2BMFA 1C4OA 4DIEA 4G5RA 4PSVA 1FW6A 4DHEA 1OH8A 1NRJB 4V0ME 3L0PA 3LH5A 1I2MA 2GK6A 1G4AE 1GRQA 4WOPA 2J7KA 5JZVA 1W2GA 5KOYA 2FEOA 1MRNA 1X86B 4W7SA 5DO9A 3CM0A 3H0KA 4P33A 3REFA 1SVKA 4DUGD 1GWNA 1LB1B 2HEIA 3ZQ6A 5CDFE 1CR2A 2W6ID 5JWRA 4NYMR 4GT1A 3QBTA 2BKUA 2YWEA 2DB3A 4Q1CA 3WP1B 4PO9A 5DSZA 1F3OA 2ZU6A 4DRZA 5EXSA 4HLQB 2Q3HA 4M4SA 2FSFA 5CDFA 2YV5A 1NIPA 3LW8A 4LJ9A 4CZ2A 3G82C 4JSTA 1XTQA 2VSFA 3KJGA 2OFOA 3NEYA 2GCNA 1RZ3A 3K9HA 4MA4A 4W5WA 3WYFA 5C46F 1LVGA 2RCNA 2C98A 5DYIA 5KTYA 4DSUA 5ELXA 2DFKB 1KI6B 4BLRA 1VECA 4LV5B 4DIDA 3I62A 2REBA 2AKYA 1UEIA 1NVVR 4JVLA 2QGNA 1D9ZA 3O8BA 5DHFA 1TF5A 1NVWQ 5C1BA 1VCNA 1NG9A 2V4ZA 3BB1A 4BFVA 4TQ9A 3KB2A 4JT2A 3TKLA 2VEDA 1T5LA 2X2FA 4EPWA 5IT5A 2N46A 2H7VA 4ZI2A 1SHZA 2QQEA 2WHXA 5BW8A 4D2IA 3U61B 3BXZA 1EWRA 3I5YA 3IKJA 1T6NA 2ZSDA 5KSOA 3CWQA 3A1UA 5A5GA 3LFUA 4MRPA 3T06B 1OH6A 4LBWA 2PJRA 1ZD9A 1E6CA 3AF4A 3ZD6A 3X1ZA 1ZM3A 2ZUDA 4CEHA 5F9HA 4WZBE 2WV9A 3T34A 1Q1EA 3TVTA 4G5GA 4TTQA 4MKIA 3HWSA 3AQ4A 2RGBA 4D0GA 1GP2A 1S2MA 2ZI7A 2GXQA 2REXB 1SXJD 3BJIC 4X8LA 4D81A 3THWB 4Q5IA 1JR3D 1SULA 4OHZA 4D4JA 2OG2A 4HUTA 3W6PA 3K0CC 4MRSA 3BH7A 3PVSA 4TL8A 1G4UR 4PHFA 1JQJC 1VKJA 2RMKA 4FMCF 4TL9A 1KI7A 4JJZA 2QA5A 3ZVRA 4BLOA 4DT1A 3AF1A 3SBEA 1EFTA 3GLHB 1IN7A 3QF7A 1DG3A 2EVWX 5GVRA 1YZKA 4JYCA 3CO5A 4DLRA 4ILEA 1E2QA 1KI4A 1W2HA 4V0OA 4FXPA 5SZHB 4B2IA 3AVYA 2RGDA 2Q9CA 1YZLA 4MKHA 3QE0A 1Q0UA 1S4QA 4QJ4A 5HCNA 2ZPTX 5B64A 3L43A 4HDQB 1KZGB 1UKZA 1Z2AA 2DBYA 4L4UA 2H57A 1G41A 2WMOB 5J4KA 2REOA 2FE4A 2ZVPX 3TBKA 4U02A 3LBHA 3UKDA 1BMFD 1XPOA 3GLGA 2QMEA 2B21A 2RGNC 4RD2A 3VHLB 2QMHA 2IUSA 4M1WA 4XTCS 4Z8XA 3P32A 3KKPA 1ZNWA 1N6LA 4PANA 3Q85A 2NO6A 1TQ2A 2GJ9A 2VHUA 1Z6XA 3EG5A 4B75A 621PA 3WHLA 1P9WA 4DWJA 2QE7A 1G5RA 4A15A 3CH5A 4US2R 3JVUA 4H1UA 5IHPA 4EPXA 3V00A 4DXAA 6Q21A 1NY6A 1JBKA 1JXMA 1CTQA 1JXOA 2RHDA 2GVZC 3OIUA 2GXAA 2RKOA 2CL7X 4AURA 2ZR7A 4NYIR 1DAKA 1G8GA 1VMAA 2Q3FA 3EC2A 1OW3B 3FDIA 5AJWA 1IOZA 1Z8FA 4Q03A 1ZP6A 2YINC 4CIDA 2C99A 5D3QA 1G19A 3BWDD 4XD7A 4NCKA 3T12A 5B57C 4YLGA 2XXAA 1E2JA 3N2EA 4LDJA 2PL3A 1TU4A 1KK2A 3M6AA 1DELA 5TB5A 3P27A 1TU3A 3FHOA 1P60A 2CNWA 3PQCA 3KXLA 3RRYA 2IYTA 2VIIA 4CEIB 4IVQA 3X2SA 4EPVA 3TAHA 2R2AA 3Q8XB 1WCV1 2X1VA 5EXTA 1KDPA 1PUIA 1KHTA 3AP1A 4PHHA 4LCBA 5E7JA 1OXSC 4Z54A 5DNYB 5GADl 5EZ6B 3FB4A 4JIMA 4PC1A 5KUTA 2XTMA 2MSCB 3B82A 3FYHA 1AGRA 2IA5A 2A5DA 1ZNZA 2B8WA 3FMIA 4R9UC 1O3YA 2ZJAA 1E2EA 2GILA 4NCIA 2J46A 2AFIE 2GJ8A 2W2XA 3QXXA 4IKEA 1JEEA 2ZAMA 3BERA 1PLJA 1E1QD 2J59A 3BB4A 1FMJA 3IPYA 4XJXA 3ZYCA 5C4GB 4G0NA 5TMPA 2XGJA 1J2JA 2R9VA 4PQFA 3VMFA 4QGAA 3U6BA 3SQWA 1U81A 2DPXA 3VKWA 4IVPA 1EFUA 1G7RA 1E9FA 4Q4JA 1N6IA 1P4SA 1YRAA 2B7BA 4H9GA 1E9EA 1E0AA 3VR1A 1YKSA 4TYNA 4KYIB 2JJ2D 4F7WA 1NI3A 2MMGA 2VQSA 3L82B 2XEXA 3N70A 3IUYA 4E09A 3LX5A 3MFYA 1ZUHA 1JJVA 4I1SA 2JLYA 2ZRGA 4B3GA 3EPLA 3A6PC 1T3LA 5CB8A 2QQ0A 4EPRA 1DAEA 2C77A 1UPTA 3GLIE 4HLUC 2QZ4A 2CBZA 3NHBA 4Q19A 1E9RA 3I32A 4BE7B 2CJWB 1NVUQ 4GOJA 1F2TA 2OXCA 1G6OA 1HA3A 1KDTA 4BPBA 3NG1A 1D5CA 4DSTA 2HCBA 3EZ7A 4PR0A 5H68A 2JATA 4RY2A 3W6NA 4YQFA 4B73A 1KGDA 2ZANA 1JNYA 2J7PD 1M7HA 2IYWA 2P6RA 4C0LA 4D6PA 1N2CE 5J4LA 4NONA 1KJZA 3ONWA 3R20A 5BQ5A 1Z6YA 2ZVQX 5EXXA 1OKKD 221PA 1GTVA 2IHYA 2ZU0C 3K9LA 4LHVA 5CK4A 5CM9C 3RABA 4Q4LA 4TT3A 2HXSA 4NBSA 4NYIQ 1UDWA 3U44B 3Q3JB 3TGPA 4JBWA 1B0UA 2EFGA 4PAQA 4PPGA 1P2VA 2MMCA 3OEHD 1G7CA 1Z0JA 1ZUNB 2CNWD 4HATA 4HZUA 1CR4A 1SXJA 2Y8EA 5J5CA 3RNLA 1CKEA 4DCSA 1X8KA 4DJTA 4FWIB 2WJYA 4WIAA 3ETLA 2QT0A 4BZPA 2HF9A 4OBEA 4URYR 1SZPA 3ZS8A 1NMXA 3QNUA 2IF0A 2OAQ1 3RS3A 1AKEA 1H8HD 2F3TA 4B43A 4F4CA 4MUAA 1M8PA 5FPKA 2FN4A 421PA 4FN5A 4C7OA 4QNMA 2JAQA 3TVDA 1XJQA 4F38A 2KBEA 4RVCA 2D2FA 5LPNA 3VKHA 1L4YA 1PJRA 3DMNA 3OIVA 3DEFA 1JAHA 3BFKA 1MT0A 4M21A 3MJRA 1WQ1R 2JA1A 3VNVA 3PR1A 3BRWD 5JI3E 2HDNB 2ZYUX 1N6HA 4JBXA 2RH5A 2ZE5A 3CIOA 2W2TA 4NE2A 1LS6A 5KSZA 4DSNA 2H92A 4EKDA 5F9FA 1DAFA 3Q5DA 3QI2A 1II9A 4GP6A 4HAVA 4PZZA 4XVQA 4YMTA 3HU2A 1QG2A 4OHVA 3T1OA 4E5UA 1XJ0A 2AXPA 3ADBA 2EFHB 4TZ0A 1GL7A 2GEDA 1U2RA 1HUQA 1VIAA 4PO8A 5LBIA 4DLWA 4NMMA 1ZCAA 4ZCMA 5JHHB 1K8RA 2OE2A 1NBMD 1XXHB 1ZW6A 3NBFA 4BFZA 3AF3A 4K81B 3HR8A 1EFRA 1Z5ZA 2BC9A 3DOFA 1RJ9B 4M0LA 3DMDA 1TNDA 2YJTD 4HAWA 4BRWA 3QEOA 2ZSAA 3UWKA 2ERYA 4QBFA 4AD8A 1EFRD 4IVRA 4HLDA 2NO9A 2ORIA 4JL6A 1P73A 1Q22A 2HT6A 1GILA 1VCMA 3IILA 2CE2X 1XCPA 4Q1FA 4KODA 5CM8B 2GCOB 4BLTA 3S1AA 4LY6A 2JASA 3B1ZA 3GJ5A 5F3WB 3E5HA 4PAOA 4UXJA 3VTKA 3BOSA 2FPKA 1T0HB 3CWZA 1A7JA 3K53A 3LNCA 1LW7A 3SI7A 4R71A 1K5GA 4BLSA 1GITA 1N5KA 1NN3A 3GFOA 3KQLA 2J41A 3DPUA 2ZRKA 2JLXA 2P2LA 3B1WA 4Q9HA 1N5IA 1EX6A 1W5TA 2BM1A 4IDOA 3RS4A 3ZD7A 1FX0B 2GK7A 3SQXA 1II8B 3I72A 2ZS9A 2WOJA 2QMUA 4M1MA 5FBWB 4QBGB 521PA 2PEZA 1Q12A 2ZIAA 3TK1A 2JDIA 3RC3A 3ICQB 1Z6TA 2OEPA 3A37A 1C9KA 5EJEA 3DM9B 2J7PA 1VG0B 4HYYA 4JL5A 2QRZA 5G40A 1UM8A 1FL9A
chains in the Genus database with same CATH superfamily
4IIGA 3FN4A 1R6VA 1TVCA 3HVRA 1QFXA 4W63A 3OQIB 4B6FA 2XDWA 4DE5A 4AMBA 5E7MA 4DRYA 2QSZA 2V7QD 3GFQA 4KPFC 5I9IA 3AUTA 3ZQKA 1UBTS 2YMLA 4RF4A 6PFKA 2W90A 3DDZX 3BQ9A 4KQ2A 1IWPB 2FN9A 4JLBA 3WHIA 3CY6A 2CFRA 4FNAA 1U2QA 3HFJA 4G63A 3RBVA 4OX9Y 3EVFA 2I65A 3G0OA 4GBJA 1H0SA 4WINA 1V4BA 1ZI8A 3F6EX 5CA0A 3JQAB 2NSYA 5HQTA 4LC1A 4R98A 2QN8A 3GNQA 1CQIB 3A6GA 4M89A 5AVVA 3R5FA 2YKGA 3EXFB 4LXIA 2ZRQA 1KJIA 2ZTLA 3JWJA 4DDWA 3ZJTA 3C5HA 3L8HA 3VR6H 4IWXA 2FUG6 3WL4A 3DR5A 2QQGA 3LLSA 4HGRA 1D4FA 1F14A 4OLJA 5J2TF 3G8YA 4F3KA 1NX6A 2PLAA 1P81A 1V4VA 1P5ZB 1ZHFA 4FHZA 3RYHB 3ZCQA 5NULA 3CF6R 3ND7A 2BR5A 1GGVA 2PR7A 3RF7A 1DARA 1YQ9A 1JSRA 3E1SA 3NIDB 3OPXA 3PDIA 5IMBA 4DLYA 1M8GA 2O1SA 1E2FA 3MJEA 1ZSVA 2QI9C 1C8LA 1PT6A 3WAKA 5SY4A 1ODLA 3NRCA 4ZOBA 4EMSA 2G09A 3S1SA 4HC4A 1NVXQ 1YA8A 1U0HC 3KFVA 3IAM6 1CUCA 2IV2X 4X6UA 4KXFB 5KCMA 5KYWA 3LF1A 1N9GA 2IZOA 4OIMA 4EQZA 2YZKA 3ELUA 5I4IA 2FDCA 4OREX 1AE1A 1Q1ZA 1X2EA 1V1RA 2CMHA 2G7ZA 4GPZA 4N01A 3U7RA 4O59O 1WLYA 3JD2A 4MGHA 4LOAA 1YR9A 4AX4A 2QL6A 2W6JA 4JQOA 1IJKA 1G5HA 5JJ5A 3QBJA 3B36A 4LNAA 4YDSA 3TZQA 2VNKA 4ZWNA 3ZN2A 2O8BA 3PNOA 4AG3A 4IDGA 1MRSA 1YJ5A 2AVNA 3GHHA 4NE7A 4P3XA 5F1KA 4LOIA 1ESZA 4M1KA 2AHOA 1ZGCA 1HLGA 2YS7A 3DAYA 1B26A 1ZN2A 3RWBA 1LDNA 2GEVA 1W0JA 3NDBB 5FJIA 1NATA 2I7DA 3IUNA 5FNVB 4GBMA 2DPLA 2QRVA 2VPIA 3E35A 3IT3A 2PJZA 2X41A 4ZZ1A 1YOVB 2JDID 1M1NB 3EY4A 4PLYA 1FNDA 4WK0B 3GWZA 4ZODA 4L9SA 4CLRA 3P4XA 1XTPA 2C4HA 3QTBA 2PKQO 2OBXA 1JNXX 1Z83A 2XADA 3K15A 1LS1A 2Q28A 1T0IA 2EJTA 3UENA 3AKYA 2PS1A 5HHTA 3LMKA 3ZWPA 1FP6A 1YZFA 1E2PA 1K2WA 3F5MA 4L3OA 2AW3A 4PLPA 1ADGA 2P30A 4R9RA 4MP8A 2XGOA 4YYZA 5GM1A 2QX4A 3KB1A 3LXMA 1BYIA 2CLSA 3OZEA 3WLEA 2AJ8A 1ULAA 4PBSA 5FP0A 4R8SA 3OM1A 4TXLA 3X0DA 3QKIA 2VHXA 2GD2A 3ANSA 3A4VA 2Q5IA 3WQQA 1Q17A 4NOKA 1N2EA 3KHTA 3R8XA 4WT7A 2I6QA 2X9LA 4NJOA 3R5JA 2YN4A 4UUBA 4ZO9A 1U0LA 1XRMA 1IN1A 1S2DA 1X87A 3QBVA 2GZSA 4N8SA 5SYNA 1ZAYA 1L1QA 4NH4A 4XWAA 2R25B 3O92A 1OBCA 2BFBB 3OECA 2XT0A 4I4TB 2C7QA 3T4EA 1PR6A 1MTZA 2J3JA 2ATXA 3LDFA 5ALUA 3K9GA 5FOTA 4CM4A 1T2CA 2BHRA 1AUOA 5DTRA 5F2EA 2HJVA 2WAYA 2BT4A 4KQIA 1OZFA 3RTEA 4MEBA 5MGBA 2CLLB 4O1HA 5AUPB 1T1IA 1ZC4A 3G2OA 4KXNA 2OZLB 1DDOA 1FTNA 3FUUA 1ZINA 3OURA 3M9WA 3MGBA 3OHSX 3OX1A 5ARDA 1L4KA 4I4NA 4HB4A 5JRDS 1CXZA 4NCNA 1ZW1A 2HMUA 4QDZA 3HB0A 3P9CA 4NNJA 3AMVA 1J6UA 1L4GA 1GAXA 1ABBA 5AK4A 2FF5A 2FH5B 4EUKA 1PWXA 1X8XA 5A9SB 2C9YA 1XLUA 5ERYA 1Z5GA 2ZRCA 3HKEB 3GGSA 5EMHA 1EQUA 2PD4A 4TMZA 3VGPA 1CEXA 1CV2A 2O0KA 4EWLA 4OLBA 3HR7A 4LV6A 1ML3A 1D6SA 5CNMA 5FV7A 3FMVA 3BMNA 3IT0A 3RT9A 3TNJA 5J4HA 3HA5A 5GONB 1N0VC 4K6OA 3TTSA 1WRBA 3AU8A 3C6KA 5KU1A 4JBGA 4BBZA 2CVPA 2ZRBA 3FSRA 4JHXA 3LFTA 1G21E 2EJCA 4LOLA 2J67A 3L9WA 1I0LA 1ZNQO 1U1EA 5AKZA 4KIUA 2VJKA 1GLNA 1BKSB 5BV8A 3C2QA 2G9ZA 4OQXA 4YREA 2Q4RA 2XB9A 5DP1A 3QEJA 1IHXA 4WNAB 4YR7A 1U8TA 3DZIA 4ML3A 5LMCA 1JZQA 4DB2A 4XPZA 3IOCA 1RADA 3AUAA 1WNFA 2FLWA 1LPNA 2EJBA 2JHGA 3EZNA 4YT4A 3ZGNA 3HC7A 3HJHA 3PZBA 4JLMA 3Q7EA 4XJSA 4HGNA 2RH9B 4U2FA 1YQUA 4LF9B 4BO6A 4CI0B 5SZJA 5L3QB 5C9ZA 1XLTA 1JGTA 5FPYA 3RJ5A 2BGNA 5IN5A 5LUAA 1TRKA 4HFRA 3PXXA 2OVFA 1GRRA 1EFPA 1OGIA 2IUEA 2ZWOA 2JBWA 3ZHUA 3L77A 4J0HA 3CLTD 1A8IA 1FRFS 2AR9A 3AH8A 1NYQA 3P0JA 3DDOA 3MWEA 3C5EA 4REMA 2ZJYA 3CBGA 3R0ZA 4CG3A 2BEVB 1CIVA 1PV2A 4PAMA 3ZY4A 2DSTA 5DXFA 4QU9A 1JAZA 2PV7A 4E13A 4N5DA 2IUYA 4Z1MD 4N1AA 3AVTA 4KI7A 3AI3A 3UICA 2XNDA 4DPMA 1UBCA 3MIZA 5F64A 3DCYA 3TH5A 1C0KA 3K9NA 4H1VA 5EE9A 4X44A 1WQ4A 2NSJA 3H9EO 4YCBA 1YIAA 3I23A 1TA0A 4ND8B 4UCFA 4J3NA 2CV0A 3TQCA 1GT6A 3U3MA 3D0QA 3R7BA 3ZE7A 4PSAA 3VZSA 3EDMA 1XKTA 3D2AA 3DE1X 4YNBA 4KFUA 3QWFA 3NT4A 3AM5A 1SWWA 1U3FA 2XOXA 1RYYA 3FNQA 2QS9A 3FX2A 3NBZC 4YT2A 2CKDA 2I54A 5FR2A 4NIMA 3FRJA 3LA6A 2Q46A 1CETA 3IV6A 3JALA 4BNFA 3AEKA 4Q9DA 5EHNA 3VR6D 2P8SA 2IBSA 5J23A 3FNHA 3GZTB 4GOLD 1NV9A 1RYDA 3N5KA 4U2DA 4DCCA 1M83A 5K3EA 2E37A 1YH3A 2DUNA 1G9XA 2RC5A 4LCJA 2XQJA 5L40A 3U81A 2UV8A 3OQIA 2GFIA 4QHTA 3GVCA 1G98A 1SD1A 4RZ2A 1PL8A 2QG4A 4RXUA 4RULA 4I8IA 1IUKA 2OZEA 2W2QA 4FYVA 4QC2A 3RSCA 3DVAA 4L4XA 4ASUA 1DKLA 2PKYX 3GIDA 3WAGA 1BHO1 1DJPA 4GZ6A 4X64B 2QIPA 4MOWA 3KQQA 5DM4A 2NU7B 3SX2A 2F6RA 5FJJA 3RS0A 1S3GA 2PGOA 1TTHA 3HCOA 3O47A 1B23P 1H9CA 3SCZA 1JV2B 1GA1A 1R5NA 3JYLA 1Z0SA 2V45A 2OVBA 5FQOA 5BQFA 3OEEA 4MA5A 3SZOA 4RS4A 1Q2UA 4URZR 4JYAB 2FNAA 4FDAA 4IIDA 3UB4A 5L51A 1NVMB 1XCGB 3JQDA 1L5HB 4X1KB 3UK2A 6YASA 1LK0A 1M34A 2W6IA 4PZYA 1CUSA 3GFRA 4C89A 3BK1A 4B9AA 1WOYA 4RADA 3QU9A 2FMKA 3GK3A 3G2PA 5AK3A 1FU7A 2PSSA 3IIKA 1RACA 4TXMA 4ZTUB 4WXEA 1ZCBA 2XZOA 1TYEB 2IXTA 3U4DA 2ISCA 2IYZA 4QYMA 4UAJA 5K0CA 2WUGA 2DTXA 1VGVA 5IDYA 3OQJA 4C2TA 3LLUA 3PL5A 1I5RA 4KO4S 4QGFA 5EQTA 1LQUA 1PL6A 5GIOE 4O3FA 2ETVA 4JT8A 4MGKR 1QXSA 2OCLA 3GDGA 3ICPA 4REOA 5L3VA 1G9TA 4LGCA 1FUUA 2CV1A 1HYEA 3DKKA 2QG9A 3DTYA 1X9IA 1IXRC 3CT6A 4B3DA 2QN7A 4O2AB 2G76A 2QMZA 2C9BA 4INPA 4AUNA 5EJMA 5ED4A 4A0FA 4J4BA 2AQIA 2B78A 1WZEA 1YCGA 1G5PA 1X7HA 4ZEOA 1YCHA 1RC1A 4FJ1A 3HKBB 4BYMA 4WDRA 2X8BA 4KRYA 2D5LA 3WFZA 5K6AA 3ML1A 1FDTA 3HRHA 2VHEA 3WRWA 3ZZUA 1R74A 3IE0A 3HYCA 4KREA 3R7WB 4WBXC 3TBHA 5E7IA 4RD3A 3KNZA 4LS3A 4KQWA 4YCDA 3X3HA 4D9HA 1P4RA 1V3TA 4KRGA 1VPVA 3WL7A 3O3MB 2Q3CA 1K6MA 4PQGA 2C3PA 5BNIA 5K0JA 2HW8A 3NV7A 4ZOLB 2I8CA 2YNMC 3R6TA 4JUDX 4GQBA 4MR9A 3DHNA 2PXCA 4TRJA 4HVLA 1UT5A 2PQMA 3CE6A 4J90A 4ZO4A 2G0NA 2Q50A 3FD8A 3C3PA 4IILA 3PTZA 5GJVC 3CF2A 3EZ2A 1OJLA 2GT1A 4YMVA 3WLAA 1U28C 5FPPA 2C2YA 2HCJB 5DHAA 1P2UA 4WESB 5DNAA 3NDPA 4MIKA 3HP1A 5FEMA 1P80A 3UAOA 3KKZA 4P7GA 2VLIA 2H54A 3W06A 3HJGA 2Z2KA 1QG6A 4IOLA 5KQSA 5L7TA 1SY7A 2Z5LA 4LOHA 3IB6A 3VM6A 2I80A 3H5AA 5K7SA 1EIWA 4M9CA 3PRYA 1B6TA 1P2SA 1UCFA 1R5BA 2ZIZA 3VO1A 1QYXA 1TQDA 3ZC3A 3QE3A 5ADWA 1E6EA 1Z0KA 3MJVA 1KWGA 4HQLA 3T5AA 5K0ZA 4G85A 2XIQA 3L8ZA 3TCNA 2M32A 3NHZA 5J4VA 5I47A 3LWZA 2QZPA 3C1AA 4QUHA 4RTLA 3IP6A 5GV8A 1DQYA 4C87A 2CCKA 4M8IA 2HM7A 4EJ6A 5GJBA 1HT2E 3I9LA 1RXSA 4U3JB 1U2GA 1DBVO 5ALLA 1M1XB 3G02A 3OETA 1DTWB 4BU0A 3MD0A 2FPPB 1E6MA 2DWPA 4M4SA 4WOCA 4CU2A 5K0FA 2PGDA 1CY4A 1ICIA 3D8UA 2VAPA 5HCUA 1G5QA 4WGGA 2IV3A 3GFPA 1DIAA 3I8XA 4ON9A 2VPZA 3IXLA 3WGOA 4ZP1A 3U60B 3UXMA 2ZBRA 4HDRB 1HF3A 1XTSA 3OIWA 5AHKA 3PIDA 2VQ6A 2BFEA 3GRCA 2RGRA 1EUDB 1F8GA 3QXHA 4KI0A 1QF7A 4YUVA 4E3ZA 1QTRA 5EHGA 3VHQA 5A03A 4MITA 2QX7A 3V33A 1SBQA 4Q37A 3CW9A 4XM2A 4CM4B 5TF0A 4OQMA 2B34A 1Q77A 3ZHYA 4ZI7F 2WYOA 1MAWA 1EDOA 1OFHA 4B3RB 3W8FA 4G4JA 1QG4A 3VNRA 2AX4A 1F8YA 2PRIA 3FVTA 1FSZA 3H2IA 3VI3B 5EEHA 1Q15A 2G5PA 4ZAXA 4B87A 4DF3A 1ANKA 4H6XA 4AF8A 2GEKA 3A0RB 3SYTA 5FWNA 2H1WA 4DLUA 1BWQA 3QENA 1P29A 5KNDA 3DBIA 3QVLA 2G63A 3GLFA 2P5YA 3IEXA 4FFPA 1JR2A 2R8PA 4XWOA 1N0UA 1YONA 4DC9A 4DQXA 5T4HA 1P0QA 2FZ4A 4BO4A 1N6KA 2X77A 2MR6A 1FUEA 4CUZA 4D0RA 1CDDA 4GEGA 3P97A 1UP4A 3M3PA 4D0LB 5FUWA 4DA9A 1RZVA 4RELA 4CDGA 3Q8WA 3ZG6A 1FPQA 2O8CB 4HXEB 3V7WA 1WB9A 4LRTB 4NAVA 4TV8B 1H69A 4CKEA 4KLZA 2FPSA 2EFEB 4AO7A 3TIIA 4K86A 1KZ6A 4BMXA 4EHJA 5IH3A 1U3WA 2VRNA 5CX1A 2Z1NA 3SKYA 3IC5A 4S0XA 3D4BA 3QM1A 3A14A 2JGLA 3WSTA 2RKWA 5TPWB 1V8PA 3FCUB 5EPOA 2WFAA 2IDKA 5JFGA 2HKIA 1DAGA 2FSVA 1RYNA 1CUBA 3F96A 1QRRA 1E2MA 4ZN6A 4XYMA 4RDCA 2X58A 4UBMA 4WQMA 4ITVA 3AJDA 4PPQA 4KHPB 3JSXA 4N3GA 1U9IC 4E30A 2IY9A 4ROTA 1F4PA 2C9MA 3ZX5A 3GC6A 1V3UA 4WXMA 4NESA 2HMAA 1PU2A 2EW8A 1Z8HA 4LYGA 1Z9BA 1LDEA 1MA0A 2BLNA 2L69A 5AUOB 1ABEA 1WCIB 2QPOA 5I8ZA 1ZRSA 4WBNA 3H4MA 2LW7A 1JMYA 1ZISA 1O77A 1PI3A 3IMFA 4B7AA 2GCOA 1VLQA 4EELA 5DWVA 1E9DA 5I9SA 1KDVA 3MD9A 2C5LA 1YUMA 2IDMA 3MMXA 1CERA 5BMVF 3PKIA 5IJ0A 5ECGC 4DIKA 2D06A 2FFHA 3FNGA 3DZHA 1BS1A 1JDSA 5CH8A 4O2LA 4WKBA 2HQRA 4OTZA 3H18A 4I66A 5DLYA 1E99A 1DO8A 2OB2A 3TQTA 3N53A 3LCCA 4C0SA 1QHYA 4MGZR 3KJXA 3KTAB 4TT3D 1NQXA 2RDMA 3KQPA 4PYLA 2COEA 5HBRA 3ZE8A 5HWSA 3QZUA 3WDMA 4RSGA 4NS4A 5JALA 2GBLC 3CEJA 3GUVA 2Z5FA 1EGQA 2GD0A 3JQFC 1KO8A 1K4MA 2A92A 2KSQA 2NVUA 2QVXX 3GPIA 7YASA 3VA7A 1XD2A 2ZB7A 4M0CA 1U7TA 3N76A 1UOOA 3K1TA 2UVDA 2LD4A 3AY3A 4RCZA 2C78A 2LKCA 5KPJA 1N5DA 1YS1X 2OAGA 4KO3S 2I4OA 2X8AA 4RJTA 2EFYA 2HK6A 2Q1SA 2OV8A 4XLLA 2QUHA 2QTAA 4HRXA 2VUUA 4W6ZA 2NO0A 3TQRA 5DN6A 3HA7A 4WBSA 5EHQA 3F5FA 3M5DA 1A8SA 1QVWA 3DCIA 4HZIA 4OA8A 5DRYA 4W82A 1Y81A 1U5BA 2VHQA 3OM8A 4IEFB 3KEGA 4PVCA 3SC3A 3VKGA 2OQIA 2HA6A 1Z6ZA 2V1UA 2Z9CA 1B43A 1E61A 4GVLA 4A6EA 4X94A 2ZRFA 1ZVJA 4XWGA 4ZKEA 4AJIA 4UFNA 2CFCA 2ZZKA 4D3DA 1XRPA 2XWPA 3D7SA 1BE8A 4B81A 3TZ6A 4RK5A 4IKOA 3MT7A 3NBKA 4FEGA 1CZRA 3S8EA 1QS0A 3T15A 1ZIXA 4OU4A 5H4HA 5A7GA 1CLEA 2GCIA 1ABFA 3TEJA 1VC2A 5DWQA 3VVCA 2VP0A 3B9PA 4F0JA 2XAUA 4G26A 3TN7A 2JW5A 1AO0A 1A5SB 3GEIA 4LXUA 3U4GA 4AUKA 1KOGA 1NW3A 4F97A 4TKLA 1XU4A 1TTPB 5CVUA 5IYZF 1V47A 3EY9A 2JHFA 2IEZA 3I53A 3BKXA 3DXZA 4IJWA 5H0IA 3OAAA 4U5XA 3H2BA 3H1GA 1ZUNA 4YECA 1R8QA 2V6FA 2PZBA 4I81A 1AHHA 2AX3A 3AZQA 2GN6A 4P4NA 2B7CA 5B7PA 4FHDA 4OXXA 2C0CA 1PHPA 2G6BA 3GH3A 4OP1A 5A06A 4KL8S 4J2TA 1HRDA 2XUGA 3VDRA 3PFGA 4C5BA 4DLXA 5JQGA 4FD3A 2O2HA 3F47A 3ZDEA 2X3UA 2JAXA 4I19A 4X6XA 3IA7A 4RFSA 4URFA 2Z1DA 1FTYA 4DJAA 2JANA 5KTYA 1CWUA 1TYDE 2WUWE 1LCIA 2A9QA 4TZ6A 2XW6A 4BEJA 1S2NA 1NMEA 3LO5A 1JR3A 2H4JA 4Q4HB 5EIFA 4DFDA 2I3DA 1I2CA 1P9RA 1OUMA 2R751 3H2SA 2EFDB 3HGTA 2ZR0A 4YDRA 3LCMA 4FBLA 3V6LA 4Z49A 5A4KA 3V4ZA 5DXJA 4BTVA 5KNBH 2WJJA 1T2UA 4FT2A 4PZLA 3MT9A 4FR2A 4EUSA 3W34A 4MIOA 2BV3A 1FNSA 3RK1A 1N2CB 4UM5A 3O3NB 2OMEA 2A9OA 2X0JA 4HNAB 5B5SA 2XXAB 1RBZA 2HL6A 4FP9A 4UTOA 4JN6B 2VDLB 4PN3A 1GPDG 3GVPA 3MMNA 3TZKA 3OJCA 3LUCA 4YJHB 2CNOA 3ZV6A 2FK8A 1LWOA 1KARA 1FNMA 3KBOA 4L3WA 3PQEA 4FYYA 1YDFA 2HIHA 3EVAA 4MWDA 3O03A 3DDCA 4JS0A 3P2OA 2ZJ1A 3DWGA 4WN9A 5DPMA 5IAGA 5L6LB 3B6JA 4DHWA 4HB0A 1ADBA 1YNSA 2B2XA 4G0WA 1XF9A 4IXTA 4LE0A 1RW4A 3ASYA 3CVYA 1D2CA 1JG2A 3BWYA 4RK7A 1V43A 4MA0A 3G59A 1KIAA 1OT3A 2GBIA 3BCUA 3IQHX 1E6UA 1J9GA 1P17A 2IDZA 5KX5B 1CPYA 1UPCA 2DQYA 3CLRD 4J43A 3WNBA 2G25A 1GEEA 1DEKA 1F3LA 3TQOA 3U16A 1V39A 1DOZA 1UBEA 2P79A 3H5WA 3I34X 3EVEA 1QCDA 4Q21A 2ZT7A 4A8HA 1I7LA 3JQQA 1TUIA 2OT3B 1XLWA 2C5BA 4Y98A 1C3XA 2VF5X 4RPLA 4ZVTA 1PV4A 2LNDA 3CF4A 4EO7A 3HDTA 2OHXA 4FGKA 1DV2A 1SM4A 2H0QA 3AESA 2Q6KA 3WO0A 3AR6A 2ZM6B 3L92A 4RORA 1GL3A 1O58A 5B1DA 1GG5A 2BTQA 3H3FA 3AVUA 5LDHA 3S2EA 3JY6A 1BXGA 1RQRA 3PC7A 4LVOA 3P0RA 3Q7RA 5JG7A 1YFJA 1N32B 1B0AA 2DUUA 2B98A 2HSGA 3M33A 4GX1A 4OXKA 3WP0A 5BQXA 1QHSA 3OO1A 4DCJA 5HYVA 3VISA 4DB4A 1IJEA 2QX8A 3WBFA 1CE8B 2VXBA 5CNIA 5ALQA 1FMCA 4MINA 4CIXA 2WG1A 1ZLXA 1N1DA 2R84A 4O63O 4GDFA 2P2SA 4R40A 4IFIA 1I6LA 2G1AA 4L74A 3HFGA 1IN4A 1FFAA 1Z6GA 2CB9A 2XD4A 3EIOA 2RJOA 3IP1A 1ZA1A 3RAJA 1I0IA 2MINA 1GKLA 2D0DA 2WAMA 3K6JA 2GESA 3LWNA 4YP5A 4DLNA 3K30A 3JCZA 4CVNA 4EO4A 4W1SA 3RUFA 4Y1RA 2G1JA 4C6RA 5KX5A 4JVMA 2JPDA 4K6HA 3M81A 1JHXA 4WLFA 2RGXA 2D0PB 5AI4A 1G8PA 1NTOA 5JDCC 4O29A 3TUIC 4PZPA 2B3TA 4PPYA 4CKEB 1ISJA 4F4UA 2XOEA 2XYHA 4X1IB 1E2UA 1FQKA 5MFPA 1T2FA 2NTJA 1D2AA 4HNTA 1E1LA 1MX1A 1QIFA 5B4TA 2VXYA 2PH5A 1GUZA 3D0OA 3E27A 4GPTA 1E3EA 5BYKA 1QH8B 4L4ZA 4NICA 3S3TA 3TLJA 1I4OA 4N8EA 4YH1A 3VBCA 3ZW8A 1GQOA 4S1PA 4YUWA 4IG9A 3TRJA 3REGA 4F2GA 4IJ6A 2AKAB 1T9HA 3JAKA 6REQB 3ER8A 2CXSA 2OXRA 3Q2IA 1QIEA 1XX6A 3KELA 1TF2A 1E2BA 5P8WA 1JJ7A 1Z0FA 2WM3A 3WV4A 1XCJA 1T4GA 4CF7A 2JHPA 4JKOA 2B25A 3DBVO 4IDFA 4ZZIA 1W36B 4CRWB 2D00A 2G9UA 2NZYA 1OLUB 3B1YA 4A9AA 3TI7A 3T5PA 4RTKA 4V0RA 1DV1A 1ADFA 3ILVA 5B53A 3I4FA 4BQSA 1GARA 2QM0A 5CCDA 3ZWXA 1DBQA 1U9CA 2QLFA 2JKZA 3DLTA 3CXRA 4ND3A 3HY3A 1EUDA 3S99A 1RXVA 1KAQA 3FPSA 2CLKB 9MHTA 3H7IA 1EFAA 1KYYA 1JTFA 1E1QA 4NG4A 2FPRA 3BQMB 4CTKA 3ZVMA 8MHTA 4B4VA 3L6OO 3CVXA 2VNJA 2A14A 3UAGA 4BP1A 4AN1A 1V8DA 5ELMA 2XPCA 3K0CA 2QVBA 1I2DA 1PTJC 1WMEA 4G3XA 5J5VA 2I6GA 3E3LA 4GP9A 4D97A 3BF8A 4UCQA 3M2PA 5FR1A 4XR4A 2OBFA 3OLYA 3QEAZ 1KY5A 3IPRA 4CLHA 3IGFA 1TA9A 3UT0A 3KU1A 4KR7A 2HQOA 2QRPA 2VH2A 4WKOA 1M0WA 4YXWD 1XTKA 1S6YA 4P92A 3FGZA 3X1WA 2BBSA 1NQUA 2WU3A 4IS2A 1IVNA 1O2DA 2HGZA 1EBUA 1SVWA 5F51A 5CD9A 4D9CA 1VA4A 2ZYAA 3TUZC 1C5KA 5KHOC 3ZDRA 1EEXB 1CQPA 1OGJA 4A1FA 2ZBEA 1QV9A 3LVFO 4ZRDA 5CB0A 5KOHB 4RH3A 5K0BA 4X62B 3BA1A 3RVJA 3BMCB 2V0GA 2ODEA 5AVKA 3G2HA 4ZCIA 3QPVA 1SIUA 2WF8A 3T95A 2ZBPA 1HNXB 3QX8A 4G25A 4HUJA 4N48A 4P3PA 1NR1A 4RXTA 1I7DA 2EATA 3ZDQA 1N92A 3V1UA 3O8CA 3PQFA 3RYIA 4E2WA 2L42A 2XWBF 4A26A 1BOFA 2QRGA 3AM4A 3QUTA 5JRZA 1BHJA 1M72A 4QODA 4IRMA 1YR8A 4YGYA 4MUNA 3Q7PA 5TX7A 2JI4A 1Y63A 5IASA 1HFJA 4XM1A 2DWQA 4RVOA 1ZRHA 1HBJA 2A4MA 3IELA 3H19A 4LPKA 4IDHA 1ULZA 4LK2A 4KQMA 3W8DA 5G41A 3WLHA 4Q4JB 5LD2C 2P65A 1JIIA 3COVA 3SR4A 1VYHA 1HURA 4MVCA 4Y9SA 1XMOB 1CZKA 4KPYA 1N4AA 2NX2A 4P36A 3AHIA 4RFSB 1KWKA 4XUDA 1OI7A 2GKGA 1IBSA 2OQVA 3U37A 3FPEA 1JT9A 3UMYA 1TPZA 3UAZA 1I3MA 3DKVA 3ZZ1A 1V48A 3HNPA 4QNRA 1KDYA 2EIHA 3RGWS 3CU5A 4UOZA 4LY9A 4POOA 3GRRA 3GNTA 4J6FA 3KZ1E 1G38A 1Q7TA 1NNSA 3WWDA 5IRCD 4QHYA 2IOQA 3CUUA 1PGPA 3AL3A 3P0HA 1ZVQA 2P3OA 3QITA 2EWVA 3RCBA 3ZQUA 3UH1A 3QMWA 3U48A 3VPBA 1VMEA 5KNCD 3IUJA 3NVDA 2OQ2A 4HNAA 4PNHA 2YUIA 1T8UA 2NU6A 4UEJA 4DADA 3WB9A 3W5HA 2HU7A 2JLRA 3E58A 4IOMA 3C6XA 4YCSA 1CQXA 2Q2OA 2H4FA 2JBHA 3B38A 3DUWA 1A4UA 1RLIA 2RGCA 3EWSA 1SVSA 3H2GA 4BQEA 3TXAA 4JWKA 2PL5A 2D5IA 1JU4A 3SJUA 4RTQA 1QJ4A 4UVGA 2IVFA 1T9AA 1U0NA 1VJGA 3I12A 1MB0A 1HE3A 3AIIA 1NUQA 4PY2A 1N6OA 5EQJB 3U9TA 4DCGA 2XITA 3NT2A 4JOBA 2ORVA 4I5FA 1YOBA 3UJ8A 4OX9B 4B33A 1A7UA 1I30A 2LP4Y 1THZA 2FFBA 1ADCA 2QU8A 3LFHA 4TLAA 2QUZA 1IJFA 2CK3D 1KP3A 2HF8A 2X1MA 5EY5B 4XTRA 3SEAA 1EK5A 4EG7A 1ZH8A 1Y1RA 5JIBA 4Q1BA 4Q4AB 4BAGA 3RS7A 2AE1A 1PDWA 2OWEA 4RGVA 4M7RA 1AZTA 1FFXA 3N58A 4ZREA 5J2TA 2FUKA 3M8KA 1EUCB 2X2PA 3GRPA 2PN1A 2I5PO 2AWNA 3LHSA 1BW9B 4O2BB 1JQDA 1RWBA 5DYYA 4WEOA 2AWOA 1E3QA 2NZXA 2VC2B 4FLEA 3QIAA 4Q3OA 1FFBA 1ZDMA 1W48A 2F3QA 2VHCA 3NJRA 4K46A 3RVPA 4B6RA 3RKRA 4MHTA 4OH1A 4D8YA 2RD2A 2ZSJA 4RMGA 4MLZA 5E4YA 1GPYA 2RJ3A 1IJBA 2FZGA 1XWWA 2YMQA 3OKAA 4HGZA 1DUSA 3FTQA 1SUAA 1OHHD 3LVQE 5DIFA 4K26A 4OFWA 3TXYA 4A8JB 2NADA 5C8DA 2IU3A 1DOAA 3HU1A 4TLMB 5DYGA 3V4SA 4LXQA 3SC4A 1G0NA 2GYVA 2Z8XA 4UW9A 3WXBA 1ODFA 4L75A 3WVNA 4IDCA 4OQNA 2WTMA 4JCOA 1JDBC 2H1IA 2OFPA 4Q1VA 4R9NA 3U31A 2R7KA 4II2A 4CWAA 4EF6A 1BXKA 1D8TA 1QM5A 1PG2A 5COAA 4C0WA 1G7SA 1QHGA 1T3ZA 2YV4A 3BL6A 4N3NA 5GMOA 3TX2A 4TMVA 4Z0PA 1ODCA 2LIPA 4BYGA 1SG6A 2WB2A 2JGRA 5JH7F 3U09A 2CF6A 1YB5A 3E22A 1KEEA 3QYJA 1FX1A 1MFZA 1P75A 2FX2A 2P40A 1UXOA 5IWAB 3WNQA 5C4MA 3G6KA 4P32A 2OFWA 3O2SB 1QOPB 3P4UA 2ZXUA 4Q4AA 4MPRA 1RRFA 1VJ1A 2PM8A 1E0DA 1M1YE 2FZ5A 3BRQA 3DF9A 5SZKB 2OXTA 3TLBA 5KVCA 2YXNA 3EHDA 4MRAA 4ZMSA 4WNIA 4XFJA 4KGDA 5ENZA 4YV7A 3EFBA 4BWGA 1E32A 1QO9A 1XRNA 5F12A 3UKJA 1SCIA 4EW3A 2PWPA 3O9MA 1HL7A 1Y5IA 4HJXA 1L5FA 5LXTB 1NF3A 5H8WA 1YZGA 4JKIA 4KZPA 4PLFA 3JPWA 4NJEB 4JLAA 4LHEA 1MVNA 2ODNA 2DFNA 4ZQGA 4ZVOA 3KD2A 2I0FA 2AG5A 2PX3A 5BSMA 4M1SA 2ID7A 3WMFA 3VNUA 1YJBA 1C41A 5CVTA 4B3MB 2SHKA 2JGKA 4Y9RA 5E3IA 4EJ0A 3P5BA 3NHWA 4DV6B 3V2UA 3CZ5A 3G79A 4Q66C 4YRFA 3OICA 1FBTA 1L7DA 3QKRA 3W3AD 3TSCA 1I80A 3BH0A 2R6DA 3GJ6A 3GQBB 2CYAA 1FNNA 3PYMA 2PWYA 4G84A 4UULA 3UMFA 1QIKA 3GJSA 4NKRA 1GV1A 2ZIWB 3KZVA 3P0FA 2G9NA 1TVKA 3HCCA 4TQAA 5A3SA 4NTZA 4EZIA 5FTLA 4DJJA 3AUKA 1DOHA 3WHKA 2KE5A 4E4RA 3ABOB 4KV7A 1QWOA 1AURA 3ROEA 3U3ZA 4QYWA 5CBKA 3RC8A 1XYYA 3LIPA 4RQAA 4WW0A 5CR9A 3PRKE 3GOHA 5CUQA 3E9QA 3QX3A 2XOKA 4F3YA 2HQSA 2X15A 4YAOA 5KYTA 3UUEA 2XCQA 5FD8A 2IU6A 3TW8B 4EBBA 1UFOA 1VLLA 1BN7A 5IBCA 5I4BA 5B3AA 4G1EB 1T5BA 1UAGA 1WPGA 2E55A 3FYCA 2GN8A 5AKYA 5EZYF 5L45A 1Z4OA 2QDKA 2WD9A 5DX0A 5AIBA 1UQTA 1EGAA 3QQ5A 3IEMA 4YA6A 2J08A 5ITWA 1VMDA 4UU8A 4DQ0A 4Y0VA 4FK8A 1Y7TA 2FEKA 1FU8A 1W5AA 3CG0A 1HE1C 4RH1A 4D8VA 3MLEA 3S0JA 2QXYA 4J2HA 3FUCA 2IU4A 3NHLA 3CNQS 3THOA 4Q9JA 3DEYX 3QXCA 3TRKA 4BEWA 2QZJA 1AGXA 1Z6AA 4GGMX 3BVPA 1Y1TA 2EXXA 2AG1A 4G5QA 1PBTA 2TMYA 4U8GA 4DVJA 1SB9A 2GXAA 1W30A 5HOQA 2AFHE 1Q84A 1XEWY 4I36A 2FGJA 4LJYA 3M6UA 3UM9A 3RS5A 1JLRA 2P1ZA 1KEPA 2QAGB 1T43A 4EI2A 3AG6A 5ALGA 1MZPA 3ISTA 2IP1A 4C6SA 2F9LA 2JBAB 2NXNA 3HFSA 1KZ4A 5C51B 2J0UA 2TYSB 3KTFA 4N49A 1E3TA 2TMGA 1OD6A 2ZXFA 3GZJA 3IVRA 4OGWA 4AJKA 4QGSA 1MCZA 2FQQA 2X5JO 3KT0A 1XZLA 4QWMA 3V4RA 3JQBA 5LM3A 4J0IA 5KQMA 1I7PA 1V1RB 2XLBA 2OZKA 1GFIA 2XMRA 3D6MA 5H82A 3WK6A 4BS9A 2E87A 3T7KA 3W8EA 2XQKA 5TMEA 5BSFA 2HPZA 3HSYA 4CTNA 3IV7A 5M04A 5EE0A 1QGOA 5EUQB 5EAIA 1F7VA 1Q50A 1CRWG 5IULC 4ZMRA 5DOZA 3RRMA 1GDDA 4MTCA 2J87A 1VG8A 3OEWA 4FE3A 4TM8A 3LC0A 4Z4GA 2XCIA 3LCRA 3JTMA 1X80B 5CB6A 1K5HA 2J5XA 2AEJA 1RXWA 1N2HA 5HXAA 3PUXA 2AJCA 1J0CA 4CNBA 1OFGA 5BN4A 4B0OA 4QXMA 4BMOB 1N78A 2G4VA 1YU6A 2IOYA 3FNRA 3IQFA 3NHYA 4DCOA 3ZGZA 2JAPA 1SVUA 2V65A 4TV8A 4H1WA 3OE4A 4NQZA 4MW9A 1T8TA 4H16A 2FG7C 5HPYB 2IYQA 3I61A 2O8CA 5FRDA 3A1VA 2W2VA 3ACDA 2GZHA 4A2QA 5CFNA 5TR9A 4UVHA 5HE8A 5HKKA 2AKEA 4B5LA 2VYFA 1ZFNA 3DXXA 1NBAA 4RFVA 2LVBA 5CT9A 1C9EA 2BMWA 5JSUA 1NAHA 3L6UA 4FQ7A 2OO5A 4H2DA 3DQQA 4IUBS 1J90A 1KY2A 3KQKA 1H2AS 4YMWA 3ROTA 4C7JA 4B3SB 2LWIA 4HGQA 2BHLA 1G66A 2H7XA 4RLSA 3I58A 4D43A 4C43A 1GNSA 1ICEA 1IZ9A 4FCTA 5B3JA 4P38A 3X44A 3K35A 3HO1A 4LVCA 1PFYA 2AOUB 4IUYA 4L8FA 5E8RA 4A73A 4F45A 5FUMA 1K8QA 4QOGA 3NIWA 3KJFA 4M6WA 5EEGA 3ZY5A 1LBIA 3IV9A 4C2UA 3QKRB 1AHIA 3IQWA 2I3ZA 1DJQA 1EIZA 4JI3B 4ZHQF 3I9MA 1ZGZA 2QU7A 5KEIA 3H11A 5I7AA 3EA5A 4ZJUA 3NATA 3LDHA 3W3ZB 3TUJC 5BN5A 1J1UA 1VHLA 1WKBA 1AGPA 3WGQA 1TW2A 2C2XA 2GBLA 3ETDA 2ZULA 3CN9A 3DLCA 2H1VA 2JJ8A 4MV0A 4MRNA 3R41A 3LA8A 3ABSB 3RU3A 4A91A 4TMKA 5K8UA 2VYVD 3ZTTA 2VQDA 3FRHA 3Q9UA 4XDZA 1PFWA 3CS3A 3AHFA 1FCJA 2OCYC 4FFBA 1ZN7A 1RHUA 4JJKA 2WJWA 3PNYA 2LE0A 4QBKA 4ZJZA 3NANA 3TQIA 5KKCA 4RHEA 3ZGXA 5M7EA 5E9QA 4XIJA 2EDAA 1VDZA 1P19A 3EPHA 4QPPA 3W5BA 1NFFA 3L8EA 4DCPA 3LXRA 3LUJA 1QZXA 3CZ9A 1WVMA