2CE3A

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
177
structure length
167
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 63
structure length 167
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2ce3A00
3PZKA 3RSIA 3QYRA 3DJAA 4LK5A 4FN8A 1JXZA 1OD4A 3TT6A 3HINA 4ELXA 5E0SH 3H81A 3V5EA 1YG8A 1HNUA 4RYFA 1HZDA 4JCSA 4ZDEA 4ZU2A 5G1RA 2W3PA 4FNDA 1W2XA 3MFMA 4NEKA 5FUSA 4GHNA 5DU6A 1SG4A 4FN7A 3HRXA 4FB8A 5JBXA 2ZQQA 3H0JA 2GTRA 5DZKH 3GKBA 4K3WA 4U0HA 2J5II 4IZCA 3JU1A 3T8BA 3GF7A 1Y7OA 3KTGA 2F9IA 3ZWCA 3TLFA 3ZW8A 3QREA 3TDCA 3MT6A 2J5IB 2F6IA 2VSSA 4KNPA 4F47A 2VSUC 3V5IA 3TVUA 5DTPA 3KTHA 2VSSE 5MGBA 1DUBA 3LAOA 2J5GD 4U18A 3QK8A 4K29A 2Q35A 5JBWA 5G1QA 3TVWA 4JYJA 4JCTA 1MJ3A 2VX2A 3H02A 2A7SA 5G1SA 3T3WA 3BPPA 4ELWA 1WDKA 2CBYA 4ZDCA 4OLQA 5CTBA 3M6NA 1NZYA 3L3SA 3N6RB 1UYSA 2VSUE 3HLN1 3TRRA 3Q0JA 1Q52A 4L8KA 4WZ8B 1TG6A 2C8TA 3T89A 4QFEA 4JVTA 3PE8A 4RYFH 1RJMA 3Q1TA 1XO6A 1UYTA 5IKLB 1N6FA 2DUBA 3U9RB 2ZL4A 3K50A 4QIJA 2PBPA 4ZDFA 3QWDA 3HP0A 3P2LA 4ASIA 3TT7A 1PIXA 4IZBA 4OMRA 1FCFA 4KWBA 3G64A 3H0QA 3QMJA 3RRVA 2F9IB 4U1AA 4G2RA 1UIYA 1FC6A 5C9GA 2F9YB 1OD2A 3R9QA 5KJPA 3OMEA 3ZWAA 2ZL0A 3NJBA 3SLLA 4EMPA 3DORA 4FNBA 3MOYA 4EMMA 1TYFA 1EF8A 4JSBA 4JCRA 3TZ3A 4MI2A 4U0GA 2DEOA 4Q1IA 3NJDA 4FZWA 2VREA 1DCIA 3QKAA 3IB9A 5E0NX 3R9SA 3WG5A 1SZOA 4ZDBA 2Q2XA 5KDRB 3GMAA 5INFA 4MOUA 4NNQA 4OG1A 2WTBA 4Q0GA 1NZYB 5FIFA 5INGA 4I4ZA 3QXIA 4HNKA 3BF0A 4WYOB 4IZDA 3IBBA 3QXZA 3FDUA 1FC7A 4ZDDA 1N6EA 3GF3A 5CTCA 3LKEA 1ON3A 3HE2A 2A81A 1EF9A 4FJWD 4U19A 3H0SA 2F6QA 1XX4A 4B3IA 4DI1A 4WCZA 1YG6A 1HNOA 2X24A 5DUCA 2PG8A 4JCQA 4ELSA 1RJNA 1UYRA 4KPKA 3ZW9A 4B3HA 2IEXA 3U9SB 1O8UA 5DU4A 2ZL2A 4MXIA 2VSUF 3U9TB 3BEZA 3K8XA 5DTWA 2X58A 4Z0MA 3SWXA 5DUFA 4EMLA 3KTIA 4JJTA 5DKPA 2FW2A 1VRGA 3P5MA 3OT6A 3PEAA 1X0UA 2BZRA 1FC9A 1XNWA 3M6MA 2ZL3A 4FZWC 5E0SA 2A7KA 3STAA 1K39A 1XNYA 2FZSA 3R6HA 4GM2A 1K32A 4JOTA 1UYVA 4KD6A 3GLMA 1N6DA 2J5GA 3KTJA 2HW5A 4U0GH 4YLHA 4HC8A 1WDLA 3Q7HA 3I47A 3TV5A 2Q34A 3P85A 4JYLA 2D3TA 1J7XA 1XNVA 4L6WA 5DZKA 5C90A 3ISAA 1WDMA 2UZFA 4B3JA 3H0UA 4RCNA 3ST9A 2QQ3A 4I52A 5INIA 3VIVA 4K2NA 2F9YA 5DU8A 2CE3A 2EJ5A 2ZQRA 1WZ8A 3RSTA 3T8AA 1Q51A 3KQFA 4JFCA 2J5IA 3FF6A 3R9TA 3PGQA 1EY3A 3ZWBA 5DL1A 4QIIA 3T88A 1PJHA 3MYBA 2VSSF 3OC7A 2VSUA 5KDRA 2FBMA 4JWVA 3R0OA 1ON9A 3Q0GA 2J5SA 2NP9A 3KTKA 3IAVA 4I42A 2PPYA
chains in the Genus database with same CATH superfamily
3PZKA 3RSIA 3QYRA 3DJAA 4LK5A 4FN8A 1JXZA 1OD4A 3TT6A 3HINA 4ELXA 5E0SH 3H81A 3V5EA 1YG8A 1HNUA 4RYFA 1HZDA 4JCSA 4ZDEA 4ZU2A 5G1RA 2W3PA 4FNDA 1W2XA 3MFMA 4NEKA 5FUSA 4GHNA 5DU6A 1SG4A 4FN7A 3HRXA 4FB8A 5JBXA 2ZQQA 3H0JA 2GTRA 5DZKH 3GKBA 4K3WA 4U0HA 2J5II 4IZCA 3JU1A 3T8BA 3GF7A 4NARA 1Y7OA 3KTGA 2F9IA 3ZWCA 3TLFA 3ZW8A 3QREA 3TDCA 3MT6A 2J5IB 2F6IA 2VSSA 4KNPA 4F47A 2VSUC 3V5IA 3TVUA 5DTPA 3KTHA 2VSSE 5MGBA 1DUBA 3LAOA 2J5GD 4U18A 3QK8A 4K29A 2Q35A 5JBWA 5G1QA 3TVWA 4JYJA 4JCTA 1MJ3A 2VX2A 3H02A 2A7SA 5G1SA 3T3WA 3BPPA 4ELWA 1WDKA 2CBYA 4ZDCA 4OLQA 5CTBA 3M6NA 1NZYA 3L3SA 3N6RB 1UYSA 2VSUE 3HLN1 3TRRA 3Q0JA 1Q52A 4L8KA 4WZ8B 1TG6A 2C8TA 3T89A 2YJGA 4QFEA 4JVTA 3PE8A 4RYFH 1RJMA 3Q1TA 1XO6A 1UYTA 5IKLB 1N6FA 2DUBA 3U9RB 2ZL4A 3K50A 4QIJA 2PBPA 4ZDFA 3QWDA 3BPTA 3HP0A 3P2LA 4ASIA 3TT7A 1PIXA 4IZBA 4OMRA 1FCFA 4KWBA 3G64A 3H0QA 3QMJA 3RRVA 2F9IB 4U1AA 4G2RA 1UIYA 1FC6A 5C9GA 2F9YB 4J2UA 1OD2A 3R9QA 5KJPA 3OMEA 3ZWAA 2ZL0A 3NJBA 3SLLA 4EMPA 3DORA 4FNBA 3MOYA 4EMMA 1TYFA 1EF8A 4JSBA 4JCRA 3TZ3A 4MI2A 4U0GA 2DEOA 4Q1IA 5HUQA 3NJDA 4FZWA 2VREA 1DCIA 3QKAA 3IB9A 5E0NX 3R9SA 3WG5A 1SZOA 4ZDBA 2Q2XA 5KDRB 3GMAA 5INFA 4MOUA 4NNQA 4OG1A 2WTBA 4Q0GA 1NZYB 5FIFA 5INGA 4I4ZA 3QXIA 4HNKA 3BF0A 4WYOB 4IZDA 3IBBA 3QXZA 3FDUA 1FC7A 4ZDDA 1N6EA 3GF3A 5CTCA 3LKEA 1ON3A 3HE2A 2A81A 1EF9A 4FJWD 4U19A 3H0SA 2F6QA 1XX4A 4B3IA 4DI1A 4WCZA 1YG6A 1HNOA 2X24A 5DUCA 2PG8A 4JCQA 4ELSA 1RJNA 1UYRA 4KPKA 3ZW9A 4B3HA 2IEXA 3U9SB 1O8UA 5DU4A 2ZL2A 4MXIA 2VSUF 3U9TB 3BEZA 3K8XA 5DTWA 2X58A 4Z0MA 3SWXA 5DUFA 4EMLA 3KTIA 4JJTA 5DKPA 2FW2A 1VRGA 3P5MA 3OT6A 3PEAA 1X0UA 2BZRA 1FC9A 1XNWA 3M6MA 2ZL3A 4FZWC 5E0SA 2A7KA 3STAA 1K39A 1XNYA 2FZSA 3R6HA 4GM2A 1K32A 4JOTA 1UYVA 4KD6A 3GLMA 1N6DA 2J5GA 3KTJA 2HW5A 4U0GH 4YLHA 4HC8A 1WDLA 3Q7HA 3I47A 3TV5A 2Q34A 3P85A 4JYLA 2D3TA 1J7XA 1XNVA 4L6WA 5DZKA 5C90A 3ISAA 1WDMA 2UZFA 4B3JA 3H0UA 4RCNA 3ST9A 2QQ3A 4I52A 5INIA 3VIVA 4K2NA 2F9YA 5DU8A 2CE3A 2EJ5A 2ZQRA 1WZ8A 3RSTA 3T8AA 1Q51A 3KQFA 4JFCA 2J5IA 3FF6A 3R9TA 3PGQA 1EY3A 3ZWBA 5DL1A 4QIIA 3T88A 1PJHA 3MYBA 2VSSF 3OC7A 4HDTA 2VSUA 5KDRA 2FBMA 4JWVA 3R0OA 1ON9A 3Q0GA 2J5SA 2NP9A 3KTKA 3IAVA 4I42A 2PPYA
chains in the Genus database with same CATH topology
3PZKA 3RSIA 3QYRA 3DJAA 4LK5A 4FN8A 1JXZA 1OD4A 3TT6A 3HINA 4ELXA 5E0SH 3H81A 3V5EA 1YG8A 1HNUA 4RYFA 1HZDA 4JCSA 4ZDEA 4ZU2A 5G1RA 2W3PA 4FNDA 1W2XA 3MFMA 4NEKA 5FUSA 4GHNA 5DU6A 1SG4A 4FN7A 3HRXA 4FB8A 5JBXA 2ZQQA 3H0JA 2GTRA 5DZKH 3GKBA 4K3WA 4U0HA 2J5II 4IZCA 3JU1A 3T8BA 3GF7A 4NARA 1Y7OA 3KTGA 2F9IA 3ZWCA 3TLFA 3ZW8A 3QREA 3TDCA 3MT6A 2J5IB 2F6IA 2VSSA 4KNPA 4F47A 2VSUC 3V5IA 3TVUA 5DTPA 3KTHA 2VSSE 5MGBA 1DUBA 3LAOA 2J5GD 4U18A 3QK8A 4K29A 2Q35A 5JBWA 5G1QA 3TVWA 4JYJA 4JCTA 1MJ3A 2VX2A 3H02A 2A7SA 5G1SA 3T3WA 3BPPA 4ELWA 1WDKA 2CBYA 4ZDCA 4OLQA 5CTBA 3M6NA 1NZYA 3L3SA 3N6RB 1UYSA 2VSUE 3HLN1 3TRRA 3Q0JA 1Q52A 4L8KA 4WZ8B 1TG6A 2C8TA 3T89A 2YJGA 4QFEA 4JVTA 3PE8A 4RYFH 1RJMA 3Q1TA 1XO6A 1UYTA 5IKLB 1N6FA 2DUBA 3U9RB 2ZL4A 3K50A 4QIJA 2PBPA 4ZDFA 3QWDA 3BPTA 3HP0A 3P2LA 4ASIA 3TT7A 1PIXA 4IZBA 4OMRA 1FCFA 4KWBA 3G64A 3H0QA 3QMJA 3RRVA 2F9IB 4U1AA 4G2RA 1UIYA 1FC6A 5C9GA 2F9YB 4J2UA 1OD2A 3R9QA 5KJPA 3OMEA 3ZWAA 2ZL0A 3NJBA 3SLLA 4EMPA 3DORA 4FNBA 3MOYA 4EMMA 1TYFA 1EF8A 4JSBA 4JCRA 3TZ3A 4MI2A 4U0GA 2DEOA 4Q1IA 5HUQA 3NJDA 4FZWA 2VREA 1DCIA 3QKAA 3IB9A 5E0NX 3R9SA 3WG5A 1SZOA 4ZDBA 2Q2XA 5KDRB 3GMAA 5INFA 4MOUA 4NNQA 4OG1A 2WTBA 4Q0GA 1NZYB 5FIFA 5INGA 4I4ZA 3QXIA 4HNKA 3BF0A 4WYOB 4IZDA 3IBBA 3QXZA 3FDUA 1FC7A 4ZDDA 1N6EA 3GF3A 5CTCA 3LKEA 1ON3A 3HE2A 2A81A 1EF9A 4FJWD 4U19A 3H0SA 2F6QA 1XX4A 4B3IA 4DI1A 4WCZA 1YG6A 1HNOA 2X24A 5DUCA 2PG8A 4JCQA 4ELSA 1RJNA 1UYRA 4KPKA 3ZW9A 4B3HA 2IEXA 3U9SB 1O8UA 5DU4A 2ZL2A 4MXIA 2VSUF 3U9TB 3BEZA 3K8XA 5DTWA 2X58A 4Z0MA 3SWXA 5DUFA 4EMLA 3KTIA 4JJTA 5DKPA 2FW2A 1VRGA 3P5MA 3OT6A 3PEAA 1X0UA 2BZRA 1FC9A 1XNWA 3M6MA 2ZL3A 4FZWC 5E0SA 2A7KA 3STAA 1K39A 1XNYA 2FZSA 3R6HA 4GM2A 1K32A 4JOTA 1UYVA 4KD6A 3GLMA 1N6DA 2J5GA 3KTJA 2HW5A 4U0GH 4YLHA 4HC8A 1WDLA 3Q7HA 3I47A 3TV5A 2Q34A 3P85A 4JYLA 2D3TA 1J7XA 1XNVA 4L6WA 5DZKA 5C90A 3ISAA 1WDMA 2UZFA 4B3JA 3H0UA 4RCNA 3ST9A 2QQ3A 4I52A 5INIA 3VIVA 4K2NA 2F9YA 5DU8A 2CE3A 2EJ5A 2ZQRA 1WZ8A 3RSTA 3T8AA 1Q51A 3KQFA 4JFCA 2J5IA 3FF6A 3R9TA 3PGQA 1EY3A 3ZWBA 5DL1A 4QIIA 3T88A 1PJHA 3MYBA 2VSSF 3OC7A 4HDTA 2VSUA 5KDRA 2FBMA 4JWVA 3R0OA 1ON9A 3Q0GA 2J5SA 2NP9A 3KTKA 3IAVA 4I42A 2PPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZK A;  3RSI A;  3QYR A;  3DJA A;  4LK5 A;  4FN8 A;  1JXZ A;  1OD4 A;  3TT6 A;  3HIN A;  4ELX A;  5E0S H;  3H81 A;  3V5E A;  1YG8 A;  1HNU A;  4RYF A;  1HZD A;  4JCS A;  4ZDE A;  4ZU2 A;  5G1R A;  2W3P A;  4FND A;  1W2X A;  3MFM A;  4NEK A;  5FUS A;  4GHN A;  5DU6 A;  1SG4 A;  4FN7 A;  3HRX A;  4FB8 A;  5JBX A;  2ZQQ A;  3H0J A;  2GTR A;  5DZK H;  3GKB A;  4K3W A;  4U0H A;  2J5I I;  4IZC A;  3JU1 A;  3T8B A;  3GF7 A;  1Y7O A;  3KTG A;  2F9I A;  3ZWC A;  3TLF A;  3ZW8 A;  3QRE A;  3TDC A;  3MT6 A;  2J5I B;  2F6I A;  2VSS A;  4KNP A;  4F47 A;  2VSU C;  3V5I A;  3TVU A;  5DTP A;  3KTH A;  2VSS E;  5MGB A;  1DUB A;  3LAO A;  2J5G D;  4U18 A;  3QK8 A;  4K29 A;  2Q35 A;  5JBW A;  5G1Q A;  3TVW A;  4JYJ A;  4JCT A;  1MJ3 A;  2VX2 A;  3H02 A;  2A7S A;  5G1S A;  3T3W A;  3BPP A;  4ELW A;  1WDK A;  2CBY A;  4ZDC A;  4OLQ A;  5CTB A;  3M6N A;  1NZY A;  3L3S A;  3N6R B;  1UYS A;  2VSU E;  3HLN 1;  3TRR A;  3Q0J A;  1Q52 A;  4L8K A;  4WZ8 B;  1TG6 A;  2C8T A;  3T89 A;  4QFE A;  4JVT A;  3PE8 A;  4RYF H;  1RJM A;  3Q1T A;  1XO6 A;  1UYT A;  5IKL B;  1N6F A;  2DUB A;  3U9R B;  2ZL4 A;  3K50 A;  4QIJ A;  2PBP A;  4ZDF A;  3QWD A;  3HP0 A;  3P2L A;  4ASI A;  3TT7 A;  1PIX A;  4IZB A;  4OMR A;  1FCF A;  4KWB A;  3G64 A;  3H0Q A;  3QMJ A;  3RRV A;  2F9I B;  4U1A A;  4G2R A;  1UIY A;  1FC6 A;  5C9G A;  2F9Y B;  1OD2 A;  3R9Q A;  5KJP A;  3OME A;  3ZWA A;  2ZL0 A;  3NJB A;  3SLL A;  4EMP A;  3DOR A;  4FNB A;  3MOY A;  4EMM A;  1TYF A;  1EF8 A;  4JSB A;  4JCR A;  3TZ3 A;  4MI2 A;  4U0G A;  2DEO A;  4Q1I A;  3NJD A;  4FZW A;  2VRE A;  1DCI A;  3QKA A;  3IB9 A;  5E0N X;  3R9S A;  3WG5 A;  1SZO A;  4ZDB A;  2Q2X A;  5KDR B;  3GMA A;  5INF A;  4MOU A;  4NNQ A;  4OG1 A;  2WTB A;  4Q0G A;  1NZY B;  5FIF A;  5ING A;  4I4Z A;  3QXI A;  4HNK A;  3BF0 A;  4WYO B;  4IZD A;  3IBB A;  3QXZ A;  3FDU A;  1FC7 A;  4ZDD A;  1N6E A;  3GF3 A;  5CTC A;  3LKE A;  1ON3 A;  3HE2 A;  2A81 A;  1EF9 A;  4FJW D;  4U19 A;  3H0S A;  2F6Q A;  1XX4 A;  4B3I A;  4DI1 A;  4WCZ A;  1YG6 A;  1HNO A;  2X24 A;  5DUC A;  2PG8 A;  4JCQ A;  4ELS A;  1RJN A;  1UYR A;  4KPK A;  3ZW9 A;  4B3H A;  2IEX A;  3U9S B;  1O8U A;  5DU4 A;  2ZL2 A;  4MXI A;  2VSU F;  3U9T B;  3BEZ A;  3K8X A;  5DTW A;  2X58 A;  4Z0M A;  3SWX A;  5DUF A;  4EML A;  3KTI A;  4JJT A;  5DKP A;  2FW2 A;  1VRG A;  3P5M A;  3OT6 A;  3PEA A;  1X0U A;  2BZR A;  1FC9 A;  1XNW A;  3M6M A;  2ZL3 A;  4FZW C;  5E0S A;  2A7K A;  3STA A;  1K39 A;  1XNY A;  2FZS A;  3R6H A;  4GM2 A;  1K32 A;  4JOT A;  1UYV A;  4KD6 A;  3GLM A;  1N6D A;  2J5G A;  3KTJ A;  2HW5 A;  4U0G H;  4YLH A;  4HC8 A;  1WDL A;  3Q7H A;  3I47 A;  3TV5 A;  2Q34 A;  3P85 A;  4JYL A;  2D3T A;  1J7X A;  1XNV A;  4L6W A;  5DZK A;  5C90 A;  3ISA A;  1WDM A;  2UZF A;  4B3J A;  3H0U A;  4RCN A;  3ST9 A;  2QQ3 A;  4I52 A;  5INI A;  3VIV A;  4K2N A;  2F9Y A;  5DU8 A;  2CE3 A;  2EJ5 A;  2ZQR A;  1WZ8 A;  3RST A;  3T8A A;  1Q51 A;  3KQF A;  4JFC A;  2J5I A;  3FF6 A;  3R9T A;  3PGQ A;  1EY3 A;  3ZWB A;  5DL1 A;  4QII A;  3T88 A;  1PJH A;  3MYB A;  2VSS F;  3OC7 A;  2VSU A;  5KDR A;  2FBM A;  4JWV A;  3R0O A;  1ON9 A;  3Q0G A;  2J5S A;  2NP9 A;  3KTK A;  3IAV A;  4I42 A;  2PPY A; 
#chains in the Genus database with same CATH topology
 3PZK A;  3RSI A;  3QYR A;  3DJA A;  4LK5 A;  4FN8 A;  1JXZ A;  1OD4 A;  3TT6 A;  3HIN A;  4ELX A;  5E0S H;  3H81 A;  3V5E A;  1YG8 A;  1HNU A;  4RYF A;  1HZD A;  4JCS A;  4ZDE A;  4ZU2 A;  5G1R A;  2W3P A;  4FND A;  1W2X A;  3MFM A;  4NEK A;  5FUS A;  4GHN A;  5DU6 A;  1SG4 A;  4FN7 A;  3HRX A;  4FB8 A;  5JBX A;  2ZQQ A;  3H0J A;  2GTR A;  5DZK H;  3GKB A;  4K3W A;  4U0H A;  2J5I I;  4IZC A;  3JU1 A;  3T8B A;  3GF7 A;  4NAR A;  1Y7O A;  3KTG A;  2F9I A;  3ZWC A;  3TLF A;  3ZW8 A;  3QRE A;  3TDC A;  3MT6 A;  2J5I B;  2F6I A;  2VSS A;  4KNP A;  4F47 A;  2VSU C;  3V5I A;  3TVU A;  5DTP A;  3KTH A;  2VSS E;  5MGB A;  1DUB A;  3LAO A;  2J5G D;  4U18 A;  3QK8 A;  4K29 A;  2Q35 A;  5JBW A;  5G1Q A;  3TVW A;  4JYJ A;  4JCT A;  1MJ3 A;  2VX2 A;  3H02 A;  2A7S A;  5G1S A;  3T3W A;  3BPP A;  4ELW A;  1WDK A;  2CBY A;  4ZDC A;  4OLQ A;  5CTB A;  3M6N A;  1NZY A;  3L3S A;  3N6R B;  1UYS A;  2VSU E;  3HLN 1;  3TRR A;  3Q0J A;  1Q52 A;  4L8K A;  4WZ8 B;  1TG6 A;  2C8T A;  3T89 A;  2YJG A;  4QFE A;  4JVT A;  3PE8 A;  4RYF H;  1RJM A;  3Q1T A;  1XO6 A;  1UYT A;  5IKL B;  1N6F A;  2DUB A;  3U9R B;  2ZL4 A;  3K50 A;  4QIJ A;  2PBP A;  4ZDF A;  3QWD A;  3BPT A;  3HP0 A;  3P2L A;  4ASI A;  3TT7 A;  1PIX A;  4IZB A;  4OMR A;  1FCF A;  4KWB A;  3G64 A;  3H0Q A;  3QMJ A;  3RRV A;  2F9I B;  4U1A A;  4G2R A;  1UIY A;  1FC6 A;  5C9G A;  2F9Y B;  4J2U A;  1OD2 A;  3R9Q A;  5KJP A;  3OME A;  3ZWA A;  2ZL0 A;  3NJB A;  3SLL A;  4EMP A;  3DOR A;  4FNB A;  3MOY A;  4EMM A;  1TYF A;  1EF8 A;  4JSB A;  4JCR A;  3TZ3 A;  4MI2 A;  4U0G A;  2DEO A;  4Q1I A;  5HUQ A;  3NJD A;  4FZW A;  2VRE A;  1DCI A;  3QKA A;  3IB9 A;  5E0N X;  3R9S A;  3WG5 A;  1SZO A;  4ZDB A;  2Q2X A;  5KDR B;  3GMA A;  5INF A;  4MOU A;  4NNQ A;  4OG1 A;  2WTB A;  4Q0G A;  1NZY B;  5FIF A;  5ING A;  4I4Z A;  3QXI A;  4HNK A;  3BF0 A;  4WYO B;  4IZD A;  3IBB A;  3QXZ A;  3FDU A;  1FC7 A;  4ZDD A;  1N6E A;  3GF3 A;  5CTC A;  3LKE A;  1ON3 A;  3HE2 A;  2A81 A;  1EF9 A;  4FJW D;  4U19 A;  3H0S A;  2F6Q A;  1XX4 A;  4B3I A;  4DI1 A;  4WCZ A;  1YG6 A;  1HNO A;  2X24 A;  5DUC A;  2PG8 A;  4JCQ A;  4ELS A;  1RJN A;  1UYR A;  4KPK A;  3ZW9 A;  4B3H A;  2IEX A;  3U9S B;  1O8U A;  5DU4 A;  2ZL2 A;  4MXI A;  2VSU F;  3U9T B;  3BEZ A;  3K8X A;  5DTW A;  2X58 A;  4Z0M A;  3SWX A;  5DUF A;  4EML A;  3KTI A;  4JJT A;  5DKP A;  2FW2 A;  1VRG A;  3P5M A;  3OT6 A;  3PEA A;  1X0U A;  2BZR A;  1FC9 A;  1XNW A;  3M6M A;  2ZL3 A;  4FZW C;  5E0S A;  2A7K A;  3STA A;  1K39 A;  1XNY A;  2FZS A;  3R6H A;  4GM2 A;  1K32 A;  4JOT A;  1UYV A;  4KD6 A;  3GLM A;  1N6D A;  2J5G A;  3KTJ A;  2HW5 A;  4U0G H;  4YLH A;  4HC8 A;  1WDL A;  3Q7H A;  3I47 A;  3TV5 A;  2Q34 A;  3P85 A;  4JYL A;  2D3T A;  1J7X A;  1XNV A;  4L6W A;  5DZK A;  5C90 A;  3ISA A;  1WDM A;  2UZF A;  4B3J A;  3H0U A;  4RCN A;  3ST9 A;  2QQ3 A;  4I52 A;  5INI A;  3VIV A;  4K2N A;  2F9Y A;  5DU8 A;  2CE3 A;  2EJ5 A;  2ZQR A;  1WZ8 A;  3RST A;  3T8A A;  1Q51 A;  3KQF A;  4JFC A;  2J5I A;  3FF6 A;  3R9T A;  3PGQ A;  1EY3 A;  3ZWB A;  5DL1 A;  4QII A;  3T88 A;  1PJH A;  3MYB A;  2VSS F;  3OC7 A;  4HDT A;  2VSU A;  5KDR A;  2FBM A;  4JWV A;  3R0O A;  1ON9 A;  3Q0G A;  2J5S A;  2NP9 A;  3KTK A;  3IAV A;  4I42 A;  2PPY A; 
#chains in the Genus database with same CATH homology
 3PZK A;  3RSI A;  3QYR A;  3DJA A;  4LK5 A;  4FN8 A;  1JXZ A;  1OD4 A;  3TT6 A;  3HIN A;  4ELX A;  5E0S H;  3H81 A;  3V5E A;  1YG8 A;  1HNU A;  4RYF A;  1HZD A;  4JCS A;  4ZDE A;  4ZU2 A;  5G1R A;  2W3P A;  4FND A;  1W2X A;  3MFM A;  4NEK A;  5FUS A;  4GHN A;  5DU6 A;  1SG4 A;  4FN7 A;  3HRX A;  4FB8 A;  5JBX A;  2ZQQ A;  3H0J A;  2GTR A;  5DZK H;  3GKB A;  4K3W A;  4U0H A;  2J5I I;  4IZC A;  3JU1 A;  3T8B A;  3GF7 A;  4NAR A;  1Y7O A;  3KTG A;  2F9I A;  3ZWC A;  3TLF A;  3ZW8 A;  3QRE A;  3TDC A;  3MT6 A;  2J5I B;  2F6I A;  2VSS A;  4KNP A;  4F47 A;  2VSU C;  3V5I A;  3TVU A;  5DTP A;  3KTH A;  2VSS E;  5MGB A;  1DUB A;  3LAO A;  2J5G D;  4U18 A;  3QK8 A;  4K29 A;  2Q35 A;  5JBW A;  5G1Q A;  3TVW A;  4JYJ A;  4JCT A;  1MJ3 A;  2VX2 A;  3H02 A;  2A7S A;  5G1S A;  3T3W A;  3BPP A;  4ELW A;  1WDK A;  2CBY A;  4ZDC A;  4OLQ A;  5CTB A;  3M6N A;  1NZY A;  3L3S A;  3N6R B;  1UYS A;  2VSU E;  3HLN 1;  3TRR A;  3Q0J A;  1Q52 A;  4L8K A;  4WZ8 B;  1TG6 A;  2C8T A;  3T89 A;  2YJG A;  4QFE A;  4JVT A;  3PE8 A;  4RYF H;  1RJM A;  3Q1T A;  1XO6 A;  1UYT A;  5IKL B;  1N6F A;  2DUB A;  3U9R B;  2ZL4 A;  3K50 A;  4QIJ A;  2PBP A;  4ZDF A;  3QWD A;  3BPT A;  3HP0 A;  3P2L A;  4ASI A;  3TT7 A;  1PIX A;  4IZB A;  4OMR A;  1FCF A;  4KWB A;  3G64 A;  3H0Q A;  3QMJ A;  3RRV A;  2F9I B;  4U1A A;  4G2R A;  1UIY A;  1FC6 A;  5C9G A;  2F9Y B;  4J2U A;  1OD2 A;  3R9Q A;  5KJP A;  3OME A;  3ZWA A;  2ZL0 A;  3NJB A;  3SLL A;  4EMP A;  3DOR A;  4FNB A;  3MOY A;  4EMM A;  1TYF A;  1EF8 A;  4JSB A;  4JCR A;  3TZ3 A;  4MI2 A;  4U0G A;  2DEO A;  4Q1I A;  5HUQ A;  3NJD A;  4FZW A;  2VRE A;  1DCI A;  3QKA A;  3IB9 A;  5E0N X;  3R9S A;  3WG5 A;  1SZO A;  4ZDB A;  2Q2X A;  5KDR B;  3GMA A;  5INF A;  4MOU A;  4NNQ A;  4OG1 A;  2WTB A;  4Q0G A;  1NZY B;  5FIF A;  5ING A;  4I4Z A;  3QXI A;  4HNK A;  3BF0 A;  4WYO B;  4IZD A;  3IBB A;  3QXZ A;  3FDU A;  1FC7 A;  4ZDD A;  1N6E A;  3GF3 A;  5CTC A;  3LKE A;  1ON3 A;  3HE2 A;  2A81 A;  1EF9 A;  4FJW D;  4U19 A;  3H0S A;  2F6Q A;  1XX4 A;  4B3I A;  4DI1 A;  4WCZ A;  1YG6 A;  1HNO A;  2X24 A;  5DUC A;  2PG8 A;  4JCQ A;  4ELS A;  1RJN A;  1UYR A;  4KPK A;  3ZW9 A;  4B3H A;  2IEX A;  3U9S B;  1O8U A;  5DU4 A;  2ZL2 A;  4MXI A;  2VSU F;  3U9T B;  3BEZ A;  3K8X A;  5DTW A;  2X58 A;  4Z0M A;  3SWX A;  5DUF A;  4EML A;  3KTI A;  4JJT A;  5DKP A;  2FW2 A;  1VRG A;  3P5M A;  3OT6 A;  3PEA A;  1X0U A;  2BZR A;  1FC9 A;  1XNW A;  3M6M A;  2ZL3 A;  4FZW C;  5E0S A;  2A7K A;  3STA A;  1K39 A;  1XNY A;  2FZS A;  3R6H A;  4GM2 A;  1K32 A;  4JOT A;  1UYV A;  4KD6 A;  3GLM A;  1N6D A;  2J5G A;  3KTJ A;  2HW5 A;  4U0G H;  4YLH A;  4HC8 A;  1WDL A;  3Q7H A;  3I47 A;  3TV5 A;  2Q34 A;  3P85 A;  4JYL A;  2D3T A;  1J7X A;  1XNV A;  4L6W A;  5DZK A;  5C90 A;  3ISA A;  1WDM A;  2UZF A;  4B3J A;  3H0U A;  4RCN A;  3ST9 A;  2QQ3 A;  4I52 A;  5INI A;  3VIV A;  4K2N A;  2F9Y A;  5DU8 A;  2CE3 A;  2EJ5 A;  2ZQR A;  1WZ8 A;  3RST A;  3T8A A;  1Q51 A;  3KQF A;  4JFC A;  2J5I A;  3FF6 A;  3R9T A;  3PGQ A;  1EY3 A;  3ZWB A;  5DL1 A;  4QII A;  3T88 A;  1PJH A;  3MYB A;  2VSS F;  3OC7 A;  4HDT A;  2VSU A;  5KDR A;  2FBM A;  4JWV A;  3R0O A;  1ON9 A;  3Q0G A;  2J5S A;  2NP9 A;  3KTK A;  3IAV A;  4I42 A;  2PPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...