2CE3A

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
177
structure length
167
Chain Sequence
b'SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 63
structure length 167
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2ce3A00
2FW2A 1Q52A 2A81A 4NNQA 2A7SA 3MT6A 3QK8A 3Q7HA 1XNVA 1XO6A 3RSIA 4OLQA 3PE8A 3T8AA 5CTBA 5KDRB 1X0UA 4EMLA 2FBMA 4LK5A 3PGQA 4ZU2A 3TVUA 1SG4A 1WZ8A 3BEZA 4FN7A 2J5GA 2IEXA 4ELWA 4RYFA 1XX4A 3HE2A 2ZL0A 5INFA 2WTBA 5INIA 4I4ZA 2C8TA 1OD4A 5CTCA 3IAVA 4L8KA 2VSUC 2VX2A 5JBWA 4U1AA 4YLHA 4ELSA 3OMEA 1FC7A 5C9GA 2X58A 5FUSA 1J7XA 3V5EA 3R9TA 5DU4A 4FB8A 3GMAA 5DKPA 3RSTA 1Y7OA 3PZKA 4I42A 5DTPA 4ELXA 4B3HA 1JXZA 1OD2A 4JJTA 2PPYA 3P2LA 1FC6A 3QMJA 2F9IB 3NJBA 3BPPA 4JSBA 4ZDBA 3OC7A 1UYVA 4FNDA 3HINA 4KWBA 1HNUA 5KJPA 4F47A 1NZYB 4RYFH 3Q0JA 4U0GA 1XNYA 4L6WA 5DZKA 3H0QA 2ZL3A 3T3WA 3DORA 3MYBA 2PBPA 3I47A 2VSUE 3WG5A 4KNPA 4Q0GA 3QXIA 3VIVA 3KQFA 4JCRA 2A7KA 1UIYA 3KTJA 3TV5A 3H02A 1FCFA 2GTRA 4JWVA 4KD6A 4QIIA 1PIXA 3NJDA 3H0SA 5E0SH 2F9IA 3T89A 3STAA 1TYFA 3U9TB 4FNBA 3JU1A 2J5II 3GKBA 3T88A 2VSUF 2Q2XA 4JFCA 4ZDDA 1FC9A 1NZYA 2DEOA 2ZL4A 1W2XA 3KTGA 4K3WA 4MI2A 3R9QA 4GM2A 1DCIA 4FZWA 4U0GH 3ZWBA 5DZKH 5G1QA 5DU6A 2HW5A 4IZBA 5JBXA 4ASIA 4Z0MA 3MOYA 1YG8A 2D3TA 3HP0A 2VSUA 1XNWA 2ZL2A 5IKLB 4JCSA 3LKEA 2FZSA 5C90A 4HC8A 2CE3A 5KDRA 2NP9A 4K2NA 4IZDA 1MJ3A 4GHNA 5DUFA 5E0SA 3GF3A 3H0UA 3P85A 3G64A 3ST9A 3ZWAA 3K8XA 3TDCA 3FDUA 1EF9A 1RJNA 4JYJA 5G1SA 3TLFA 1SZOA 3T8BA 3M6NA 4FN8A 3U9SB 2ZQRA 3R6HA 4MXIA 5G1RA 3U9RB 5DU8A 4JCQA 1ON3A 3M6MA 5DTWA 3ISAA 2UZFA 1PJHA 1HNOA 2F6IA 1EY3A 4JOTA 3TVWA 3Q1TA 1DUBA 3FF6A 3H0JA 5E0NX 3ZW8A 4EMMA 3R9SA 3IB9A 3BF0A 2BZRA 1WDMA 1K39A 2DUBA 3KTHA 3SLLA 2F9YB 1YG6A 2VSSE 1UYRA 4OMRA 1N6FA 4B3IA 3TT6A 3TRRA 3ZWCA 4JCTA 2PG8A 1O8UA 3TT7A 3P5MA 2VREA 3LAOA 2QQ3A 2Q34A 3QREA 4U0HA 4KPKA 1WDLA 4FZWC 2J5GD 3QXZA 4NEKA 3PEAA 5FIFA 2VSSF 3MFMA 4RCNA 1VRGA 3KTKA 2Q35A 2J5IB 2W3PA 3TZ3A 2X24A 4ZDCA 1TG6A 3KTIA 2ZQQA 4FJWD 1Q51A 4JYLA 2F9YA 3IBBA 4ZDFA 4MOUA 3Q0GA 1UYSA 3DJAA 1ON9A 4EMPA 4B3JA 2VSSA 3ZW9A 1HZDA 3N6RB 5INGA 4JVTA 4WYOB 5MGBA 2F6QA 4K29A 3QKAA 4WZ8B 4U19A 2EJ5A 4G2RA 3HLN1 1K32A 1N6DA 3R0OA 3HRXA 1N6EA 4QIJA 4Q1IA 4IZCA 3QYRA 5DL1A 5DUCA 4WCZA 4OG1A 2J5SA 3SWXA 2CBYA 4QFEA 1EF8A 4I52A 3H81A 3K50A 4ZDEA 3QWDA 1RJMA 2J5IA 3L3SA 4HNKA 3RRVA 4U18A 3V5IA 1UYTA 3OT6A 1WDKA 4DI1A 3GF7A 3GLMA
chains in the Genus database with same CATH superfamily
2FW2A 1Q52A 2A81A 4NNQA 2A7SA 3MT6A 3QK8A 3Q7HA 1XNVA 1XO6A 3RSIA 4OLQA 3PE8A 3T8AA 5CTBA 5KDRB 1X0UA 4EMLA 2FBMA 4LK5A 3PGQA 4ZU2A 3TVUA 1SG4A 1WZ8A 3BEZA 4FN7A 2J5GA 2IEXA 4ELWA 4RYFA 1XX4A 3HE2A 2ZL0A 5INFA 2WTBA 5INIA 4I4ZA 2C8TA 1OD4A 5CTCA 3IAVA 4L8KA 2VSUC 2VX2A 5JBWA 4U1AA 4YLHA 4ELSA 3OMEA 1FC7A 5C9GA 2X58A 5FUSA 1J7XA 3V5EA 3R9TA 5DU4A 4FB8A 3GMAA 5DKPA 3RSTA 1Y7OA 3PZKA 4I42A 5DTPA 4ELXA 4B3HA 1JXZA 1OD2A 4JJTA 2PPYA 3P2LA 1FC6A 3QMJA 2F9IB 3NJBA 3BPPA 4JSBA 4ZDBA 4HDTA 3OC7A 1UYVA 4FNDA 3HINA 4KWBA 1HNUA 5KJPA 4F47A 1NZYB 4RYFH 3Q0JA 4U0GA 1XNYA 4L6WA 5DZKA 3H0QA 2ZL3A 3T3WA 3DORA 3MYBA 2PBPA 3I47A 2VSUE 3WG5A 4KNPA 4Q0GA 3QXIA 3VIVA 3KQFA 4JCRA 2A7KA 1UIYA 3KTJA 3TV5A 3H02A 1FCFA 2GTRA 4JWVA 4KD6A 4QIIA 1PIXA 3NJDA 3H0SA 5E0SH 2F9IA 3T89A 3STAA 1TYFA 3U9TB 4FNBA 3JU1A 2J5II 3GKBA 3T88A 2VSUF 2Q2XA 4JFCA 4ZDDA 1FC9A 1NZYA 2DEOA 2ZL4A 1W2XA 3KTGA 4K3WA 4MI2A 3R9QA 4GM2A 1DCIA 4FZWA 4U0GH 3ZWBA 5DZKH 5G1QA 5DU6A 2HW5A 4IZBA 5JBXA 4ASIA 4Z0MA 3MOYA 1YG8A 2D3TA 3HP0A 2VSUA 1XNWA 2ZL2A 5IKLB 4JCSA 3LKEA 2FZSA 5C90A 4HC8A 2CE3A 5KDRA 2NP9A 4K2NA 4IZDA 1MJ3A 4GHNA 5DUFA 5E0SA 3GF3A 3H0UA 3P85A 3G64A 2YJGA 3ST9A 3BPTA 3ZWAA 3K8XA 3TDCA 3FDUA 1EF9A 1RJNA 4JYJA 5G1SA 3TLFA 1SZOA 5HUQA 3T8BA 3M6NA 4FN8A 3U9SB 2ZQRA 3R6HA 4MXIA 5G1RA 3U9RB 5DU8A 4JCQA 1ON3A 3M6MA 5DTWA 3ISAA 2UZFA 1PJHA 1HNOA 2F6IA 1EY3A 4JOTA 3TVWA 3Q1TA 1DUBA 3FF6A 3H0JA 5E0NX 3ZW8A 4EMMA 3R9SA 3IB9A 3BF0A 2BZRA 1WDMA 1K39A 2DUBA 3KTHA 3SLLA 2F9YB 1YG6A 2VSSE 1UYRA 4OMRA 1N6FA 4NARA 4B3IA 3TT6A 3TRRA 3ZWCA 4JCTA 2PG8A 1O8UA 3TT7A 3P5MA 2VREA 3LAOA 2QQ3A 2Q34A 3QREA 4U0HA 4KPKA 1WDLA 4FZWC 2J5GD 3QXZA 4NEKA 3PEAA 5FIFA 2VSSF 3MFMA 4RCNA 1VRGA 3KTKA 2Q35A 2J5IB 2W3PA 3TZ3A 2X24A 4ZDCA 1TG6A 3KTIA 2ZQQA 4FJWD 1Q51A 4JYLA 2F9YA 3IBBA 4ZDFA 4MOUA 3Q0GA 1UYSA 3DJAA 1ON9A 4EMPA 4B3JA 2VSSA 3ZW9A 1HZDA 3N6RB 5INGA 4JVTA 4WYOB 5MGBA 2F6QA 4K29A 3QKAA 4WZ8B 4U19A 2EJ5A 4G2RA 3HLN1 1K32A 1N6DA 3R0OA 3HRXA 1N6EA 4QIJA 4Q1IA 4IZCA 3QYRA 5DL1A 5DUCA 4WCZA 4OG1A 2J5SA 3SWXA 2CBYA 4QFEA 1EF8A 4I52A 3H81A 3K50A 4ZDEA 3QWDA 1RJMA 2J5IA 3L3SA 4HNKA 3RRVA 4U18A 4J2UA 3V5IA 1UYTA 3OT6A 1WDKA 4DI1A 3GF7A 3GLMA
chains in the Genus database with same CATH topology
2FW2A 1Q52A 2A81A 4NNQA 2A7SA 3MT6A 3QK8A 3Q7HA 1XNVA 1XO6A 3RSIA 4OLQA 3PE8A 3T8AA 5CTBA 5KDRB 1X0UA 4EMLA 2FBMA 4LK5A 3PGQA 4ZU2A 3TVUA 1SG4A 1WZ8A 3BEZA 4FN7A 2J5GA 2IEXA 4ELWA 4RYFA 1XX4A 3HE2A 2ZL0A 5INFA 2WTBA 5INIA 4I4ZA 2C8TA 1OD4A 5CTCA 3IAVA 4L8KA 2VSUC 2VX2A 5JBWA 4U1AA 4YLHA 4ELSA 3OMEA 1FC7A 5C9GA 2X58A 5FUSA 1J7XA 3V5EA 3R9TA 5DU4A 4FB8A 3GMAA 5DKPA 3RSTA 1Y7OA 3PZKA 4I42A 5DTPA 4ELXA 4B3HA 1JXZA 1OD2A 4JJTA 2PPYA 3P2LA 1FC6A 3QMJA 2F9IB 3NJBA 3BPPA 4JSBA 4ZDBA 4HDTA 3OC7A 1UYVA 4FNDA 3HINA 4KWBA 1HNUA 5KJPA 4F47A 1NZYB 4RYFH 3Q0JA 4U0GA 1XNYA 4L6WA 5DZKA 3H0QA 2ZL3A 3T3WA 3DORA 3MYBA 2PBPA 3I47A 2VSUE 3WG5A 4KNPA 4Q0GA 3QXIA 3VIVA 3KQFA 4JCRA 2A7KA 1UIYA 3KTJA 3TV5A 3H02A 1FCFA 2GTRA 4JWVA 4KD6A 4QIIA 1PIXA 3NJDA 3H0SA 5E0SH 2F9IA 3T89A 3STAA 1TYFA 3U9TB 4FNBA 3JU1A 2J5II 3GKBA 3T88A 2VSUF 2Q2XA 4JFCA 4ZDDA 1FC9A 1NZYA 2DEOA 2ZL4A 1W2XA 3KTGA 4K3WA 4MI2A 3R9QA 4GM2A 1DCIA 4FZWA 4U0GH 3ZWBA 5DZKH 5G1QA 5DU6A 2HW5A 4IZBA 5JBXA 4ASIA 4Z0MA 3MOYA 1YG8A 2D3TA 3HP0A 2VSUA 1XNWA 2ZL2A 5IKLB 4JCSA 3LKEA 2FZSA 5C90A 4HC8A 2CE3A 5KDRA 2NP9A 4K2NA 4IZDA 1MJ3A 4GHNA 5DUFA 5E0SA 3GF3A 3H0UA 3P85A 3G64A 2YJGA 3ST9A 3BPTA 3ZWAA 3K8XA 3TDCA 3FDUA 1EF9A 1RJNA 4JYJA 5G1SA 3TLFA 1SZOA 5HUQA 3T8BA 3M6NA 4FN8A 3U9SB 2ZQRA 3R6HA 4MXIA 5G1RA 3U9RB 5DU8A 4JCQA 1ON3A 3M6MA 5DTWA 3ISAA 2UZFA 1PJHA 1HNOA 2F6IA 1EY3A 4JOTA 3TVWA 3Q1TA 1DUBA 3FF6A 3H0JA 5E0NX 3ZW8A 4EMMA 3R9SA 3IB9A 3BF0A 2BZRA 1WDMA 1K39A 2DUBA 3KTHA 3SLLA 2F9YB 1YG6A 2VSSE 1UYRA 4OMRA 1N6FA 4NARA 4B3IA 3TT6A 3TRRA 3ZWCA 4JCTA 2PG8A 1O8UA 3TT7A 3P5MA 2VREA 3LAOA 2QQ3A 2Q34A 3QREA 4U0HA 4KPKA 1WDLA 4FZWC 2J5GD 3QXZA 4NEKA 3PEAA 5FIFA 2VSSF 3MFMA 4RCNA 1VRGA 3KTKA 2Q35A 2J5IB 2W3PA 3TZ3A 2X24A 4ZDCA 1TG6A 3KTIA 2ZQQA 4FJWD 1Q51A 4JYLA 2F9YA 3IBBA 4ZDFA 4MOUA 3Q0GA 1UYSA 3DJAA 1ON9A 4EMPA 4B3JA 2VSSA 3ZW9A 1HZDA 3N6RB 5INGA 4JVTA 4WYOB 5MGBA 2F6QA 4K29A 3QKAA 4WZ8B 4U19A 2EJ5A 4G2RA 3HLN1 1K32A 1N6DA 3R0OA 3HRXA 1N6EA 4QIJA 4Q1IA 4IZCA 3QYRA 5DL1A 5DUCA 4WCZA 4OG1A 2J5SA 3SWXA 2CBYA 4QFEA 1EF8A 4I52A 3H81A 3K50A 4ZDEA 3QWDA 1RJMA 2J5IA 3L3SA 4HNKA 3RRVA 4U18A 4J2UA 3V5IA 1UYTA 3OT6A 1WDKA 4DI1A 3GF7A 3GLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FW2 A;  1Q52 A;  2A81 A;  4NNQ A;  2A7S A;  3MT6 A;  3QK8 A;  3Q7H A;  1XNV A;  1XO6 A;  3RSI A;  4OLQ A;  3PE8 A;  3T8A A;  5CTB A;  5KDR B;  1X0U A;  4EML A;  2FBM A;  4LK5 A;  3PGQ A;  4ZU2 A;  3TVU A;  1SG4 A;  1WZ8 A;  3BEZ A;  4FN7 A;  2J5G A;  2IEX A;  4ELW A;  4RYF A;  1XX4 A;  3HE2 A;  2ZL0 A;  5INF A;  2WTB A;  5INI A;  4I4Z A;  2C8T A;  1OD4 A;  5CTC A;  3IAV A;  4L8K A;  2VSU C;  2VX2 A;  5JBW A;  4U1A A;  4YLH A;  4ELS A;  3OME A;  1FC7 A;  5C9G A;  2X58 A;  5FUS A;  1J7X A;  3V5E A;  3R9T A;  5DU4 A;  4FB8 A;  3GMA A;  5DKP A;  3RST A;  1Y7O A;  3PZK A;  4I42 A;  5DTP A;  4ELX A;  4B3H A;  1JXZ A;  1OD2 A;  4JJT A;  2PPY A;  3P2L A;  1FC6 A;  3QMJ A;  2F9I B;  3NJB A;  3BPP A;  4JSB A;  4ZDB A;  3OC7 A;  1UYV A;  4FND A;  3HIN A;  4KWB A;  1HNU A;  5KJP A;  4F47 A;  1NZY B;  4RYF H;  3Q0J A;  4U0G A;  1XNY A;  4L6W A;  5DZK A;  3H0Q A;  2ZL3 A;  3T3W A;  3DOR A;  3MYB A;  2PBP A;  3I47 A;  2VSU E;  3WG5 A;  4KNP A;  4Q0G A;  3QXI A;  3VIV A;  3KQF A;  4JCR A;  2A7K A;  1UIY A;  3KTJ A;  3TV5 A;  3H02 A;  1FCF A;  2GTR A;  4JWV A;  4KD6 A;  4QII A;  1PIX A;  3NJD A;  3H0S A;  5E0S H;  2F9I A;  3T89 A;  3STA A;  1TYF A;  3U9T B;  4FNB A;  3JU1 A;  2J5I I;  3GKB A;  3T88 A;  2VSU F;  2Q2X A;  4JFC A;  4ZDD A;  1FC9 A;  1NZY A;  2DEO A;  2ZL4 A;  1W2X A;  3KTG A;  4K3W A;  4MI2 A;  3R9Q A;  4GM2 A;  1DCI A;  4FZW A;  4U0G H;  3ZWB A;  5DZK H;  5G1Q A;  5DU6 A;  2HW5 A;  4IZB A;  5JBX A;  4ASI A;  4Z0M A;  3MOY A;  1YG8 A;  2D3T A;  3HP0 A;  2VSU A;  1XNW A;  2ZL2 A;  5IKL B;  4JCS A;  3LKE A;  2FZS A;  5C90 A;  4HC8 A;  2CE3 A;  5KDR A;  2NP9 A;  4K2N A;  4IZD A;  1MJ3 A;  4GHN A;  5DUF A;  5E0S A;  3GF3 A;  3H0U A;  3P85 A;  3G64 A;  3ST9 A;  3ZWA A;  3K8X A;  3TDC A;  3FDU A;  1EF9 A;  1RJN A;  4JYJ A;  5G1S A;  3TLF A;  1SZO A;  3T8B A;  3M6N A;  4FN8 A;  3U9S B;  2ZQR A;  3R6H A;  4MXI A;  5G1R A;  3U9R B;  5DU8 A;  4JCQ A;  1ON3 A;  3M6M A;  5DTW A;  3ISA A;  2UZF A;  1PJH A;  1HNO A;  2F6I A;  1EY3 A;  4JOT A;  3TVW A;  3Q1T A;  1DUB A;  3FF6 A;  3H0J A;  5E0N X;  3ZW8 A;  4EMM A;  3R9S A;  3IB9 A;  3BF0 A;  2BZR A;  1WDM A;  1K39 A;  2DUB A;  3KTH A;  3SLL A;  2F9Y B;  1YG6 A;  2VSS E;  1UYR A;  4OMR A;  1N6F A;  4B3I A;  3TT6 A;  3TRR A;  3ZWC A;  4JCT A;  2PG8 A;  1O8U A;  3TT7 A;  3P5M A;  2VRE A;  3LAO A;  2QQ3 A;  2Q34 A;  3QRE A;  4U0H A;  4KPK A;  1WDL A;  4FZW C;  2J5G D;  3QXZ A;  4NEK A;  3PEA A;  5FIF A;  2VSS F;  3MFM A;  4RCN A;  1VRG A;  3KTK A;  2Q35 A;  2J5I B;  2W3P A;  3TZ3 A;  2X24 A;  4ZDC A;  1TG6 A;  3KTI A;  2ZQQ A;  4FJW D;  1Q51 A;  4JYL A;  2F9Y A;  3IBB A;  4ZDF A;  4MOU A;  3Q0G A;  1UYS A;  3DJA A;  1ON9 A;  4EMP A;  4B3J A;  2VSS A;  3ZW9 A;  1HZD A;  3N6R B;  5ING A;  4JVT A;  4WYO B;  5MGB A;  2F6Q A;  4K29 A;  3QKA A;  4WZ8 B;  4U19 A;  2EJ5 A;  4G2R A;  3HLN 1;  1K32 A;  1N6D A;  3R0O A;  3HRX A;  1N6E A;  4QIJ A;  4Q1I A;  4IZC A;  3QYR A;  5DL1 A;  5DUC A;  4WCZ A;  4OG1 A;  2J5S A;  3SWX A;  2CBY A;  4QFE A;  1EF8 A;  4I52 A;  3H81 A;  3K50 A;  4ZDE A;  3QWD A;  1RJM A;  2J5I A;  3L3S A;  4HNK A;  3RRV A;  4U18 A;  3V5I A;  1UYT A;  3OT6 A;  1WDK A;  4DI1 A;  3GF7 A;  3GLM A; 
#chains in the Genus database with same CATH topology
 2FW2 A;  1Q52 A;  2A81 A;  4NNQ A;  2A7S A;  3MT6 A;  3QK8 A;  3Q7H A;  1XNV A;  1XO6 A;  3RSI A;  4OLQ A;  3PE8 A;  3T8A A;  5CTB A;  5KDR B;  1X0U A;  4EML A;  2FBM A;  4LK5 A;  3PGQ A;  4ZU2 A;  3TVU A;  1SG4 A;  1WZ8 A;  3BEZ A;  4FN7 A;  2J5G A;  2IEX A;  4ELW A;  4RYF A;  1XX4 A;  3HE2 A;  2ZL0 A;  5INF A;  2WTB A;  5INI A;  4I4Z A;  2C8T A;  1OD4 A;  5CTC A;  3IAV A;  4L8K A;  2VSU C;  2VX2 A;  5JBW A;  4U1A A;  4YLH A;  4ELS A;  3OME A;  1FC7 A;  5C9G A;  2X58 A;  5FUS A;  1J7X A;  3V5E A;  3R9T A;  5DU4 A;  4FB8 A;  3GMA A;  5DKP A;  3RST A;  1Y7O A;  3PZK A;  4I42 A;  5DTP A;  4ELX A;  4B3H A;  1JXZ A;  1OD2 A;  4JJT A;  2PPY A;  3P2L A;  1FC6 A;  3QMJ A;  2F9I B;  3NJB A;  3BPP A;  4JSB A;  4ZDB A;  4HDT A;  3OC7 A;  1UYV A;  4FND A;  3HIN A;  4KWB A;  1HNU A;  5KJP A;  4F47 A;  1NZY B;  4RYF H;  3Q0J A;  4U0G A;  1XNY A;  4L6W A;  5DZK A;  3H0Q A;  2ZL3 A;  3T3W A;  3DOR A;  3MYB A;  2PBP A;  3I47 A;  2VSU E;  3WG5 A;  4KNP A;  4Q0G A;  3QXI A;  3VIV A;  3KQF A;  4JCR A;  2A7K A;  1UIY A;  3KTJ A;  3TV5 A;  3H02 A;  1FCF A;  2GTR A;  4JWV A;  4KD6 A;  4QII A;  1PIX A;  3NJD A;  3H0S A;  5E0S H;  2F9I A;  3T89 A;  3STA A;  1TYF A;  3U9T B;  4FNB A;  3JU1 A;  2J5I I;  3GKB A;  3T88 A;  2VSU F;  2Q2X A;  4JFC A;  4ZDD A;  1FC9 A;  1NZY A;  2DEO A;  2ZL4 A;  1W2X A;  3KTG A;  4K3W A;  4MI2 A;  3R9Q A;  4GM2 A;  1DCI A;  4FZW A;  4U0G H;  3ZWB A;  5DZK H;  5G1Q A;  5DU6 A;  2HW5 A;  4IZB A;  5JBX A;  4ASI A;  4Z0M A;  3MOY A;  1YG8 A;  2D3T A;  3HP0 A;  2VSU A;  1XNW A;  2ZL2 A;  5IKL B;  4JCS A;  3LKE A;  2FZS A;  5C90 A;  4HC8 A;  2CE3 A;  5KDR A;  2NP9 A;  4K2N A;  4IZD A;  1MJ3 A;  4GHN A;  5DUF A;  5E0S A;  3GF3 A;  3H0U A;  3P85 A;  3G64 A;  2YJG A;  3ST9 A;  3BPT A;  3ZWA A;  3K8X A;  3TDC A;  3FDU A;  1EF9 A;  1RJN A;  4JYJ A;  5G1S A;  3TLF A;  1SZO A;  5HUQ A;  3T8B A;  3M6N A;  4FN8 A;  3U9S B;  2ZQR A;  3R6H A;  4MXI A;  5G1R A;  3U9R B;  5DU8 A;  4JCQ A;  1ON3 A;  3M6M A;  5DTW A;  3ISA A;  2UZF A;  1PJH A;  1HNO A;  2F6I A;  1EY3 A;  4JOT A;  3TVW A;  3Q1T A;  1DUB A;  3FF6 A;  3H0J A;  5E0N X;  3ZW8 A;  4EMM A;  3R9S A;  3IB9 A;  3BF0 A;  2BZR A;  1WDM A;  1K39 A;  2DUB A;  3KTH A;  3SLL A;  2F9Y B;  1YG6 A;  2VSS E;  1UYR A;  4OMR A;  1N6F A;  4NAR A;  4B3I A;  3TT6 A;  3TRR A;  3ZWC A;  4JCT A;  2PG8 A;  1O8U A;  3TT7 A;  3P5M A;  2VRE A;  3LAO A;  2QQ3 A;  2Q34 A;  3QRE A;  4U0H A;  4KPK A;  1WDL A;  4FZW C;  2J5G D;  3QXZ A;  4NEK A;  3PEA A;  5FIF A;  2VSS F;  3MFM A;  4RCN A;  1VRG A;  3KTK A;  2Q35 A;  2J5I B;  2W3P A;  3TZ3 A;  2X24 A;  4ZDC A;  1TG6 A;  3KTI A;  2ZQQ A;  4FJW D;  1Q51 A;  4JYL A;  2F9Y A;  3IBB A;  4ZDF A;  4MOU A;  3Q0G A;  1UYS A;  3DJA A;  1ON9 A;  4EMP A;  4B3J A;  2VSS A;  3ZW9 A;  1HZD A;  3N6R B;  5ING A;  4JVT A;  4WYO B;  5MGB A;  2F6Q A;  4K29 A;  3QKA A;  4WZ8 B;  4U19 A;  2EJ5 A;  4G2R A;  3HLN 1;  1K32 A;  1N6D A;  3R0O A;  3HRX A;  1N6E A;  4QIJ A;  4Q1I A;  4IZC A;  3QYR A;  5DL1 A;  5DUC A;  4WCZ A;  4OG1 A;  2J5S A;  3SWX A;  2CBY A;  4QFE A;  1EF8 A;  4I52 A;  3H81 A;  3K50 A;  4ZDE A;  3QWD A;  1RJM A;  2J5I A;  3L3S A;  4HNK A;  3RRV A;  4U18 A;  4J2U A;  3V5I A;  1UYT A;  3OT6 A;  1WDK A;  4DI1 A;  3GF7 A;  3GLM A; 
#chains in the Genus database with same CATH homology
 2FW2 A;  1Q52 A;  2A81 A;  4NNQ A;  2A7S A;  3MT6 A;  3QK8 A;  3Q7H A;  1XNV A;  1XO6 A;  3RSI A;  4OLQ A;  3PE8 A;  3T8A A;  5CTB A;  5KDR B;  1X0U A;  4EML A;  2FBM A;  4LK5 A;  3PGQ A;  4ZU2 A;  3TVU A;  1SG4 A;  1WZ8 A;  3BEZ A;  4FN7 A;  2J5G A;  2IEX A;  4ELW A;  4RYF A;  1XX4 A;  3HE2 A;  2ZL0 A;  5INF A;  2WTB A;  5INI A;  4I4Z A;  2C8T A;  1OD4 A;  5CTC A;  3IAV A;  4L8K A;  2VSU C;  2VX2 A;  5JBW A;  4U1A A;  4YLH A;  4ELS A;  3OME A;  1FC7 A;  5C9G A;  2X58 A;  5FUS A;  1J7X A;  3V5E A;  3R9T A;  5DU4 A;  4FB8 A;  3GMA A;  5DKP A;  3RST A;  1Y7O A;  3PZK A;  4I42 A;  5DTP A;  4ELX A;  4B3H A;  1JXZ A;  1OD2 A;  4JJT A;  2PPY A;  3P2L A;  1FC6 A;  3QMJ A;  2F9I B;  3NJB A;  3BPP A;  4JSB A;  4ZDB A;  4HDT A;  3OC7 A;  1UYV A;  4FND A;  3HIN A;  4KWB A;  1HNU A;  5KJP A;  4F47 A;  1NZY B;  4RYF H;  3Q0J A;  4U0G A;  1XNY A;  4L6W A;  5DZK A;  3H0Q A;  2ZL3 A;  3T3W A;  3DOR A;  3MYB A;  2PBP A;  3I47 A;  2VSU E;  3WG5 A;  4KNP A;  4Q0G A;  3QXI A;  3VIV A;  3KQF A;  4JCR A;  2A7K A;  1UIY A;  3KTJ A;  3TV5 A;  3H02 A;  1FCF A;  2GTR A;  4JWV A;  4KD6 A;  4QII A;  1PIX A;  3NJD A;  3H0S A;  5E0S H;  2F9I A;  3T89 A;  3STA A;  1TYF A;  3U9T B;  4FNB A;  3JU1 A;  2J5I I;  3GKB A;  3T88 A;  2VSU F;  2Q2X A;  4JFC A;  4ZDD A;  1FC9 A;  1NZY A;  2DEO A;  2ZL4 A;  1W2X A;  3KTG A;  4K3W A;  4MI2 A;  3R9Q A;  4GM2 A;  1DCI A;  4FZW A;  4U0G H;  3ZWB A;  5DZK H;  5G1Q A;  5DU6 A;  2HW5 A;  4IZB A;  5JBX A;  4ASI A;  4Z0M A;  3MOY A;  1YG8 A;  2D3T A;  3HP0 A;  2VSU A;  1XNW A;  2ZL2 A;  5IKL B;  4JCS A;  3LKE A;  2FZS A;  5C90 A;  4HC8 A;  2CE3 A;  5KDR A;  2NP9 A;  4K2N A;  4IZD A;  1MJ3 A;  4GHN A;  5DUF A;  5E0S A;  3GF3 A;  3H0U A;  3P85 A;  3G64 A;  2YJG A;  3ST9 A;  3BPT A;  3ZWA A;  3K8X A;  3TDC A;  3FDU A;  1EF9 A;  1RJN A;  4JYJ A;  5G1S A;  3TLF A;  1SZO A;  5HUQ A;  3T8B A;  3M6N A;  4FN8 A;  3U9S B;  2ZQR A;  3R6H A;  4MXI A;  5G1R A;  3U9R B;  5DU8 A;  4JCQ A;  1ON3 A;  3M6M A;  5DTW A;  3ISA A;  2UZF A;  1PJH A;  1HNO A;  2F6I A;  1EY3 A;  4JOT A;  3TVW A;  3Q1T A;  1DUB A;  3FF6 A;  3H0J A;  5E0N X;  3ZW8 A;  4EMM A;  3R9S A;  3IB9 A;  3BF0 A;  2BZR A;  1WDM A;  1K39 A;  2DUB A;  3KTH A;  3SLL A;  2F9Y B;  1YG6 A;  2VSS E;  1UYR A;  4OMR A;  1N6F A;  4NAR A;  4B3I A;  3TT6 A;  3TRR A;  3ZWC A;  4JCT A;  2PG8 A;  1O8U A;  3TT7 A;  3P5M A;  2VRE A;  3LAO A;  2QQ3 A;  2Q34 A;  3QRE A;  4U0H A;  4KPK A;  1WDL A;  4FZW C;  2J5G D;  3QXZ A;  4NEK A;  3PEA A;  5FIF A;  2VSS F;  3MFM A;  4RCN A;  1VRG A;  3KTK A;  2Q35 A;  2J5I B;  2W3P A;  3TZ3 A;  2X24 A;  4ZDC A;  1TG6 A;  3KTI A;  2ZQQ A;  4FJW D;  1Q51 A;  4JYL A;  2F9Y A;  3IBB A;  4ZDF A;  4MOU A;  3Q0G A;  1UYS A;  3DJA A;  1ON9 A;  4EMP A;  4B3J A;  2VSS A;  3ZW9 A;  1HZD A;  3N6R B;  5ING A;  4JVT A;  4WYO B;  5MGB A;  2F6Q A;  4K29 A;  3QKA A;  4WZ8 B;  4U19 A;  2EJ5 A;  4G2R A;  3HLN 1;  1K32 A;  1N6D A;  3R0O A;  3HRX A;  1N6E A;  4QIJ A;  4Q1I A;  4IZC A;  3QYR A;  5DL1 A;  5DUC A;  4WCZ A;  4OG1 A;  2J5S A;  3SWX A;  2CBY A;  4QFE A;  1EF8 A;  4I52 A;  3H81 A;  3K50 A;  4ZDE A;  3QWD A;  1RJM A;  2J5I A;  3L3S A;  4HNK A;  3RRV A;  4U18 A;  4J2U A;  3V5I A;  1UYT A;  3OT6 A;  1WDK A;  4DI1 A;  3GF7 A;  3GLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...