2CE3A

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
177
structure length
167
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
total genus 63
structure length 167
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2ce3A00
4OLQA 4ZU2A 3PGQA 5E0NX 4ELSA 1DUBA 3ZWAA 5KDRA 4MXIA 3QXIA 4GHNA 4K3WA 3M6MA 1JXZA 1ON9A 3V5IA 3KTKA 3RSTA 1TG6A 3HLN1 2ZQQA 4LK5A 1UYSA 3M6NA 3KTJA 4ZDEA 1OD2A 2NP9A 4Z0MA 4GM2A 4I52A 2DEOA 3GF3A 3K50A 5G1RA 3TDCA 1K32A 2A7SA 3H81A 4MI2A 3KTHA 1UYVA 1WDMA 2D3TA 3LAOA 4FNBA 1EF9A 3TVUA 3IBBA 3PZKA 3T8AA 4EMPA 4ZDDA 4WCZA 3QWDA 4RYFH 1SZOA 4MOUA 3ST9A 4JCRA 1UYTA 4WZ8B 1HNOA 2FZSA 4QIIA 3H02A 1HZDA 3P5MA 3R6HA 4JCQA 2A7KA 5DZKA 3DORA 1XNYA 3I47A 2F9IA 1FCFA 3KQFA 4FZWA 5FIFA 4K2NA 1VRGA 2QQ3A 3T88A 2J5SA 5DU8A 2ZL2A 4U0HA 3H0SA 2WTBA 4OMRA 4ZDFA 2J5IB 4NEKA 4JOTA 1WZ8A 3G64A 1YG8A 2ZQRA 3JU1A 3R9TA 3ISAA 3U9SB 1N6FA 1W2XA 3OT6A 3ZW9A 3SWXA 5E0SA 1OD4A 2C8TA 5DU6A 4B3HA 3Q1TA 5DL1A 3R9QA 1K39A 3GKBA 4FN8A 4NNQA 5DU4A 2A81A 1EY3A 2F6QA 3Q7HA 5JBXA 3STAA 4RYFA 4HNKA 3HINA 2VSUC 2VSUF 1YG6A 5INFA 3QK8A 5DUCA 3T8BA 4IZCA 1RJNA 3TVWA 2J5IA 3BPPA 4QFEA 5DUFA 1N6DA 2W3PA 3TRRA 2X24A 3TLFA 3R0OA 4G2RA 4JJTA 1FC9A 5G1QA 1XO6A 4K29A 5CTBA 4F47A 3QREA 4U0GH 5C90A 2F9YB 2VSSA 4U1AA 5FUSA 3PEAA 4JVTA 2PPYA 1PJHA 1MJ3A 4B3JA 1Q51A 4L6WA 1TYFA 3TZ3A 2J5GD 2Q35A 2J5II 2GTRA 5CTCA 3OC7A 2VSUA 3FDUA 5KJPA 2PBPA 3LKEA 3HP0A 1RJMA 1N6EA 3U9RB 4FNDA 4JCTA 3Q0JA 3H0JA 4KD6A 5C9GA 2F9YA 3DJAA 3GMAA 1Y7OA 3MT6A 3QXZA 4JCSA 3ZW8A 5E0SH 4RCNA 4FB8A 2ZL3A 4KWBA 1SG4A 4ZDCA 5MGBA 3MYBA 1Q52A 2CBYA 4IZBA 4ELXA 3L3SA 5KDRB 4KNPA 4JYLA 4EMLA 3T89A 3HE2A 2FBMA 5G1SA 4Q0GA 2ZL4A 4FJWD 4L8KA 3GF7A 3V5EA 3QYRA 3H0QA 2F6IA 2FW2A 4ELWA 3P85A 4I42A 3VIVA 1UYRA 1NZYA 2VSSE 3WG5A 2J5GA 3OMEA 2Q2XA 1O8UA 5DTWA 1ON3A 2X58A 3PE8A 3HRXA 2CE3A 3P2LA 1FC6A 5JBWA 4OG1A 3BF0A 3FF6A 2DUBA 2VREA 4DI1A 5INGA 5INIA 1HNUA 3QKAA 3R9SA 1PIXA 3BEZA 4QIJA 4IZDA 1X0UA 3MFMA 4ZDBA 1UIYA 3ZWCA 3U9TB 2F9IB 2IEXA 4U19A 3TT7A 2Q34A 4Q1IA 3H0UA 4I4ZA 4B3IA 3NJDA 4FZWC 1XX4A 3IAVA 3TT6A 2VX2A 2ZL0A 2PG8A 3TV5A 3QMJA 4FN7A 4JYJA 3T3WA 5IKLB 4JSBA 4EMMA 2VSUE 3RSIA 3RRVA 3NJBA 4U18A 1XNVA 1J7XA 3SLLA 3N6RB 3Q0GA 4JWVA 5DZKH 3IB9A 5DKPA 4JFCA 4WYOB 4U0GA 2HW5A 3K8XA 1WDKA 1XNWA 1DCIA 1NZYB 4YLHA 4ASIA 2VSSF 3KTGA 3MOYA 2BZRA 3KTIA 4KPKA 3GLMA 2UZFA 4HC8A 1FC7A 1EF8A 2EJ5A 3ZWBA 1WDLA 5DTPA
chains in the Genus database with same CATH superfamily
4OLQA 4ZU2A 3PGQA 5E0NX 4ELSA 1DUBA 3ZWAA 5KDRA 4MXIA 3QXIA 4GHNA 4K3WA 3M6MA 1JXZA 1ON9A 3V5IA 3KTKA 3RSTA 1TG6A 3HLN1 2ZQQA 4LK5A 1UYSA 3M6NA 3KTJA 4ZDEA 1OD2A 2NP9A 4Z0MA 4GM2A 4I52A 2DEOA 3GF3A 3K50A 5G1RA 3TDCA 1K32A 2A7SA 3H81A 4MI2A 3KTHA 1UYVA 1WDMA 2D3TA 3LAOA 4FNBA 1EF9A 3TVUA 3IBBA 3PZKA 3T8AA 4EMPA 4ZDDA 4WCZA 3QWDA 4RYFH 1SZOA 4MOUA 3ST9A 4JCRA 1UYTA 4WZ8B 2YJGA 1HNOA 2FZSA 4QIIA 3H02A 1HZDA 3P5MA 3R6HA 4JCQA 2A7KA 5DZKA 3DORA 1XNYA 3I47A 2F9IA 1FCFA 3KQFA 4FZWA 5FIFA 4K2NA 1VRGA 2QQ3A 3T88A 2J5SA 5DU8A 2ZL2A 4U0HA 3H0SA 4HDTA 2WTBA 4OMRA 4ZDFA 2J5IB 4NEKA 4JOTA 1WZ8A 3G64A 1YG8A 2ZQRA 3JU1A 3R9TA 3ISAA 3U9SB 1N6FA 1W2XA 3OT6A 3ZW9A 3SWXA 5E0SA 1OD4A 2C8TA 5DU6A 4B3HA 3Q1TA 5DL1A 3R9QA 1K39A 3GKBA 4FN8A 4NNQA 5DU4A 2A81A 1EY3A 2F6QA 3Q7HA 5JBXA 3STAA 4RYFA 4HNKA 3HINA 2VSUC 2VSUF 1YG6A 5INFA 3QK8A 5DUCA 3T8BA 4IZCA 1RJNA 3TVWA 2J5IA 3BPPA 4QFEA 5DUFA 1N6DA 2W3PA 3TRRA 2X24A 3TLFA 3R0OA 4G2RA 4JJTA 1FC9A 5G1QA 1XO6A 4K29A 5CTBA 4F47A 3QREA 4U0GH 5C90A 2F9YB 2VSSA 4U1AA 5FUSA 3PEAA 4JVTA 2PPYA 1PJHA 1MJ3A 4B3JA 1Q51A 4L6WA 1TYFA 3TZ3A 2J5GD 2Q35A 2J5II 2GTRA 5CTCA 3OC7A 2VSUA 3FDUA 5KJPA 2PBPA 3LKEA 3HP0A 1RJMA 1N6EA 3U9RB 4FNDA 4JCTA 3Q0JA 3H0JA 4KD6A 5C9GA 2F9YA 3DJAA 3GMAA 1Y7OA 3MT6A 3QXZA 4JCSA 3ZW8A 5E0SH 4RCNA 4FB8A 2ZL3A 4KWBA 1SG4A 4ZDCA 5MGBA 3MYBA 1Q52A 2CBYA 4IZBA 4ELXA 3L3SA 5KDRB 4KNPA 4JYLA 4EMLA 3T89A 3HE2A 2FBMA 5G1SA 4Q0GA 2ZL4A 4FJWD 4L8KA 3GF7A 3V5EA 3QYRA 3H0QA 2F6IA 2FW2A 4ELWA 3P85A 4I42A 3VIVA 1UYRA 1NZYA 3BPTA 2VSSE 3WG5A 2J5GA 3OMEA 2Q2XA 1O8UA 5DTWA 1ON3A 2X58A 3PE8A 3HRXA 2CE3A 3P2LA 1FC6A 4NARA 5JBWA 4OG1A 3BF0A 3FF6A 2DUBA 2VREA 4DI1A 5INGA 5INIA 1HNUA 3QKAA 3R9SA 1PIXA 3BEZA 4QIJA 4IZDA 1X0UA 3MFMA 4ZDBA 1UIYA 3ZWCA 3U9TB 2F9IB 2IEXA 4U19A 3TT7A 2Q34A 4Q1IA 3H0UA 4I4ZA 4B3IA 3NJDA 4FZWC 1XX4A 3IAVA 3TT6A 2VX2A 2ZL0A 2PG8A 4J2UA 3TV5A 3QMJA 4FN7A 4JYJA 3T3WA 5IKLB 4JSBA 4EMMA 2VSUE 3RSIA 3RRVA 3NJBA 4U18A 1XNVA 1J7XA 5HUQA 3SLLA 3N6RB 3Q0GA 4JWVA 5DZKH 3IB9A 5DKPA 4JFCA 4WYOB 4U0GA 2HW5A 3K8XA 1WDKA 1XNWA 1DCIA 1NZYB 4YLHA 4ASIA 2VSSF 3KTGA 3MOYA 2BZRA 3KTIA 4KPKA 3GLMA 2UZFA 4HC8A 1FC7A 1EF8A 2EJ5A 3ZWBA 1WDLA 5DTPA
chains in the Genus database with same CATH topology
4OLQA 4ZU2A 3PGQA 5E0NX 4ELSA 1DUBA 3ZWAA 5KDRA 4MXIA 3QXIA 4GHNA 4K3WA 3M6MA 1JXZA 1ON9A 3V5IA 3KTKA 3RSTA 1TG6A 3HLN1 2ZQQA 4LK5A 1UYSA 3M6NA 3KTJA 4ZDEA 1OD2A 2NP9A 4Z0MA 4GM2A 4I52A 2DEOA 3GF3A 3K50A 5G1RA 3TDCA 1K32A 2A7SA 3H81A 4MI2A 3KTHA 1UYVA 1WDMA 2D3TA 3LAOA 4FNBA 1EF9A 3TVUA 3IBBA 3PZKA 3T8AA 4EMPA 4ZDDA 4WCZA 3QWDA 4RYFH 1SZOA 4MOUA 3ST9A 4JCRA 1UYTA 4WZ8B 2YJGA 1HNOA 2FZSA 4QIIA 3H02A 1HZDA 3P5MA 3R6HA 4JCQA 2A7KA 5DZKA 3DORA 1XNYA 3I47A 2F9IA 1FCFA 3KQFA 4FZWA 5FIFA 4K2NA 1VRGA 2QQ3A 3T88A 2J5SA 5DU8A 2ZL2A 4U0HA 3H0SA 4HDTA 2WTBA 4OMRA 4ZDFA 2J5IB 4NEKA 4JOTA 1WZ8A 3G64A 1YG8A 2ZQRA 3JU1A 3R9TA 3ISAA 3U9SB 1N6FA 1W2XA 3OT6A 3ZW9A 3SWXA 5E0SA 1OD4A 2C8TA 5DU6A 4B3HA 3Q1TA 5DL1A 3R9QA 1K39A 3GKBA 4FN8A 4NNQA 5DU4A 2A81A 1EY3A 2F6QA 3Q7HA 5JBXA 3STAA 4RYFA 4HNKA 3HINA 2VSUC 2VSUF 1YG6A 5INFA 3QK8A 5DUCA 3T8BA 4IZCA 1RJNA 3TVWA 2J5IA 3BPPA 4QFEA 5DUFA 1N6DA 2W3PA 3TRRA 2X24A 3TLFA 3R0OA 4G2RA 4JJTA 1FC9A 5G1QA 1XO6A 4K29A 5CTBA 4F47A 3QREA 4U0GH 5C90A 2F9YB 2VSSA 4U1AA 5FUSA 3PEAA 4JVTA 2PPYA 1PJHA 1MJ3A 4B3JA 1Q51A 4L6WA 1TYFA 3TZ3A 2J5GD 2Q35A 2J5II 2GTRA 5CTCA 3OC7A 2VSUA 3FDUA 5KJPA 2PBPA 3LKEA 3HP0A 1RJMA 1N6EA 3U9RB 4FNDA 4JCTA 3Q0JA 3H0JA 4KD6A 5C9GA 2F9YA 3DJAA 3GMAA 1Y7OA 3MT6A 3QXZA 4JCSA 3ZW8A 5E0SH 4RCNA 4FB8A 2ZL3A 4KWBA 1SG4A 4ZDCA 5MGBA 3MYBA 1Q52A 2CBYA 4IZBA 4ELXA 3L3SA 5KDRB 4KNPA 4JYLA 4EMLA 3T89A 3HE2A 2FBMA 5G1SA 4Q0GA 2ZL4A 4FJWD 4L8KA 3GF7A 3V5EA 3QYRA 3H0QA 2F6IA 2FW2A 4ELWA 3P85A 4I42A 3VIVA 1UYRA 1NZYA 3BPTA 2VSSE 3WG5A 2J5GA 3OMEA 2Q2XA 1O8UA 5DTWA 1ON3A 2X58A 3PE8A 3HRXA 2CE3A 3P2LA 1FC6A 4NARA 5JBWA 4OG1A 3BF0A 3FF6A 2DUBA 2VREA 4DI1A 5INGA 5INIA 1HNUA 3QKAA 3R9SA 1PIXA 3BEZA 4QIJA 4IZDA 1X0UA 3MFMA 4ZDBA 1UIYA 3ZWCA 3U9TB 2F9IB 2IEXA 4U19A 3TT7A 2Q34A 4Q1IA 3H0UA 4I4ZA 4B3IA 3NJDA 4FZWC 1XX4A 3IAVA 3TT6A 2VX2A 2ZL0A 2PG8A 4J2UA 3TV5A 3QMJA 4FN7A 4JYJA 3T3WA 5IKLB 4JSBA 4EMMA 2VSUE 3RSIA 3RRVA 3NJBA 4U18A 1XNVA 1J7XA 5HUQA 3SLLA 3N6RB 3Q0GA 4JWVA 5DZKH 3IB9A 5DKPA 4JFCA 4WYOB 4U0GA 2HW5A 3K8XA 1WDKA 1XNWA 1DCIA 1NZYB 4YLHA 4ASIA 2VSSF 3KTGA 3MOYA 2BZRA 3KTIA 4KPKA 3GLMA 2UZFA 4HC8A 1FC7A 1EF8A 2EJ5A 3ZWBA 1WDLA 5DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLQ A;  4ZU2 A;  3PGQ A;  5E0N X;  4ELS A;  1DUB A;  3ZWA A;  5KDR A;  4MXI A;  3QXI A;  4GHN A;  4K3W A;  3M6M A;  1JXZ A;  1ON9 A;  3V5I A;  3KTK A;  3RST A;  1TG6 A;  3HLN 1;  2ZQQ A;  4LK5 A;  1UYS A;  3M6N A;  3KTJ A;  4ZDE A;  1OD2 A;  2NP9 A;  4Z0M A;  4GM2 A;  4I52 A;  2DEO A;  3GF3 A;  3K50 A;  5G1R A;  3TDC A;  1K32 A;  2A7S A;  3H81 A;  4MI2 A;  3KTH A;  1UYV A;  1WDM A;  2D3T A;  3LAO A;  4FNB A;  1EF9 A;  3TVU A;  3IBB A;  3PZK A;  3T8A A;  4EMP A;  4ZDD A;  4WCZ A;  3QWD A;  4RYF H;  1SZO A;  4MOU A;  3ST9 A;  4JCR A;  1UYT A;  4WZ8 B;  1HNO A;  2FZS A;  4QII A;  3H02 A;  1HZD A;  3P5M A;  3R6H A;  4JCQ A;  2A7K A;  5DZK A;  3DOR A;  1XNY A;  3I47 A;  2F9I A;  1FCF A;  3KQF A;  4FZW A;  5FIF A;  4K2N A;  1VRG A;  2QQ3 A;  3T88 A;  2J5S A;  5DU8 A;  2ZL2 A;  4U0H A;  3H0S A;  2WTB A;  4OMR A;  4ZDF A;  2J5I B;  4NEK A;  4JOT A;  1WZ8 A;  3G64 A;  1YG8 A;  2ZQR A;  3JU1 A;  3R9T A;  3ISA A;  3U9S B;  1N6F A;  1W2X A;  3OT6 A;  3ZW9 A;  3SWX A;  5E0S A;  1OD4 A;  2C8T A;  5DU6 A;  4B3H A;  3Q1T A;  5DL1 A;  3R9Q A;  1K39 A;  3GKB A;  4FN8 A;  4NNQ A;  5DU4 A;  2A81 A;  1EY3 A;  2F6Q A;  3Q7H A;  5JBX A;  3STA A;  4RYF A;  4HNK A;  3HIN A;  2VSU C;  2VSU F;  1YG6 A;  5INF A;  3QK8 A;  5DUC A;  3T8B A;  4IZC A;  1RJN A;  3TVW A;  2J5I A;  3BPP A;  4QFE A;  5DUF A;  1N6D A;  2W3P A;  3TRR A;  2X24 A;  3TLF A;  3R0O A;  4G2R A;  4JJT A;  1FC9 A;  5G1Q A;  1XO6 A;  4K29 A;  5CTB A;  4F47 A;  3QRE A;  4U0G H;  5C90 A;  2F9Y B;  2VSS A;  4U1A A;  5FUS A;  3PEA A;  4JVT A;  2PPY A;  1PJH A;  1MJ3 A;  4B3J A;  1Q51 A;  4L6W A;  1TYF A;  3TZ3 A;  2J5G D;  2Q35 A;  2J5I I;  2GTR A;  5CTC A;  3OC7 A;  2VSU A;  3FDU A;  5KJP A;  2PBP A;  3LKE A;  3HP0 A;  1RJM A;  1N6E A;  3U9R B;  4FND A;  4JCT A;  3Q0J A;  3H0J A;  4KD6 A;  5C9G A;  2F9Y A;  3DJA A;  3GMA A;  1Y7O A;  3MT6 A;  3QXZ A;  4JCS A;  3ZW8 A;  5E0S H;  4RCN A;  4FB8 A;  2ZL3 A;  4KWB A;  1SG4 A;  4ZDC A;  5MGB A;  3MYB A;  1Q52 A;  2CBY A;  4IZB A;  4ELX A;  3L3S A;  5KDR B;  4KNP A;  4JYL A;  4EML A;  3T89 A;  3HE2 A;  2FBM A;  5G1S A;  4Q0G A;  2ZL4 A;  4FJW D;  4L8K A;  3GF7 A;  3V5E A;  3QYR A;  3H0Q A;  2F6I A;  2FW2 A;  4ELW A;  3P85 A;  4I42 A;  3VIV A;  1UYR A;  1NZY A;  2VSS E;  3WG5 A;  2J5G A;  3OME A;  2Q2X A;  1O8U A;  5DTW A;  1ON3 A;  2X58 A;  3PE8 A;  3HRX A;  2CE3 A;  3P2L A;  1FC6 A;  5JBW A;  4OG1 A;  3BF0 A;  3FF6 A;  2DUB A;  2VRE A;  4DI1 A;  5ING A;  5INI A;  1HNU A;  3QKA A;  3R9S A;  1PIX A;  3BEZ A;  4QIJ A;  4IZD A;  1X0U A;  3MFM A;  4ZDB A;  1UIY A;  3ZWC A;  3U9T B;  2F9I B;  2IEX A;  4U19 A;  3TT7 A;  2Q34 A;  4Q1I A;  3H0U A;  4I4Z A;  4B3I A;  3NJD A;  4FZW C;  1XX4 A;  3IAV A;  3TT6 A;  2VX2 A;  2ZL0 A;  2PG8 A;  3TV5 A;  3QMJ A;  4FN7 A;  4JYJ A;  3T3W A;  5IKL B;  4JSB A;  4EMM A;  2VSU E;  3RSI A;  3RRV A;  3NJB A;  4U18 A;  1XNV A;  1J7X A;  3SLL A;  3N6R B;  3Q0G A;  4JWV A;  5DZK H;  3IB9 A;  5DKP A;  4JFC A;  4WYO B;  4U0G A;  2HW5 A;  3K8X A;  1WDK A;  1XNW A;  1DCI A;  1NZY B;  4YLH A;  4ASI A;  2VSS F;  3KTG A;  3MOY A;  2BZR A;  3KTI A;  4KPK A;  3GLM A;  2UZF A;  4HC8 A;  1FC7 A;  1EF8 A;  2EJ5 A;  3ZWB A;  1WDL A;  5DTP A; 
#chains in the Genus database with same CATH topology
 4OLQ A;  4ZU2 A;  3PGQ A;  5E0N X;  4ELS A;  1DUB A;  3ZWA A;  5KDR A;  4MXI A;  3QXI A;  4GHN A;  4K3W A;  3M6M A;  1JXZ A;  1ON9 A;  3V5I A;  3KTK A;  3RST A;  1TG6 A;  3HLN 1;  2ZQQ A;  4LK5 A;  1UYS A;  3M6N A;  3KTJ A;  4ZDE A;  1OD2 A;  2NP9 A;  4Z0M A;  4GM2 A;  4I52 A;  2DEO A;  3GF3 A;  3K50 A;  5G1R A;  3TDC A;  1K32 A;  2A7S A;  3H81 A;  4MI2 A;  3KTH A;  1UYV A;  1WDM A;  2D3T A;  3LAO A;  4FNB A;  1EF9 A;  3TVU A;  3IBB A;  3PZK A;  3T8A A;  4EMP A;  4ZDD A;  4WCZ A;  3QWD A;  4RYF H;  1SZO A;  4MOU A;  3ST9 A;  4JCR A;  1UYT A;  4WZ8 B;  2YJG A;  1HNO A;  2FZS A;  4QII A;  3H02 A;  1HZD A;  3P5M A;  3R6H A;  4JCQ A;  2A7K A;  5DZK A;  3DOR A;  1XNY A;  3I47 A;  2F9I A;  1FCF A;  3KQF A;  4FZW A;  5FIF A;  4K2N A;  1VRG A;  2QQ3 A;  3T88 A;  2J5S A;  5DU8 A;  2ZL2 A;  4U0H A;  3H0S A;  4HDT A;  2WTB A;  4OMR A;  4ZDF A;  2J5I B;  4NEK A;  4JOT A;  1WZ8 A;  3G64 A;  1YG8 A;  2ZQR A;  3JU1 A;  3R9T A;  3ISA A;  3U9S B;  1N6F A;  1W2X A;  3OT6 A;  3ZW9 A;  3SWX A;  5E0S A;  1OD4 A;  2C8T A;  5DU6 A;  4B3H A;  3Q1T A;  5DL1 A;  3R9Q A;  1K39 A;  3GKB A;  4FN8 A;  4NNQ A;  5DU4 A;  2A81 A;  1EY3 A;  2F6Q A;  3Q7H A;  5JBX A;  3STA A;  4RYF A;  4HNK A;  3HIN A;  2VSU C;  2VSU F;  1YG6 A;  5INF A;  3QK8 A;  5DUC A;  3T8B A;  4IZC A;  1RJN A;  3TVW A;  2J5I A;  3BPP A;  4QFE A;  5DUF A;  1N6D A;  2W3P A;  3TRR A;  2X24 A;  3TLF A;  3R0O A;  4G2R A;  4JJT A;  1FC9 A;  5G1Q A;  1XO6 A;  4K29 A;  5CTB A;  4F47 A;  3QRE A;  4U0G H;  5C90 A;  2F9Y B;  2VSS A;  4U1A A;  5FUS A;  3PEA A;  4JVT A;  2PPY A;  1PJH A;  1MJ3 A;  4B3J A;  1Q51 A;  4L6W A;  1TYF A;  3TZ3 A;  2J5G D;  2Q35 A;  2J5I I;  2GTR A;  5CTC A;  3OC7 A;  2VSU A;  3FDU A;  5KJP A;  2PBP A;  3LKE A;  3HP0 A;  1RJM A;  1N6E A;  3U9R B;  4FND A;  4JCT A;  3Q0J A;  3H0J A;  4KD6 A;  5C9G A;  2F9Y A;  3DJA A;  3GMA A;  1Y7O A;  3MT6 A;  3QXZ A;  4JCS A;  3ZW8 A;  5E0S H;  4RCN A;  4FB8 A;  2ZL3 A;  4KWB A;  1SG4 A;  4ZDC A;  5MGB A;  3MYB A;  1Q52 A;  2CBY A;  4IZB A;  4ELX A;  3L3S A;  5KDR B;  4KNP A;  4JYL A;  4EML A;  3T89 A;  3HE2 A;  2FBM A;  5G1S A;  4Q0G A;  2ZL4 A;  4FJW D;  4L8K A;  3GF7 A;  3V5E A;  3QYR A;  3H0Q A;  2F6I A;  2FW2 A;  4ELW A;  3P85 A;  4I42 A;  3VIV A;  1UYR A;  1NZY A;  3BPT A;  2VSS E;  3WG5 A;  2J5G A;  3OME A;  2Q2X A;  1O8U A;  5DTW A;  1ON3 A;  2X58 A;  3PE8 A;  3HRX A;  2CE3 A;  3P2L A;  1FC6 A;  4NAR A;  5JBW A;  4OG1 A;  3BF0 A;  3FF6 A;  2DUB A;  2VRE A;  4DI1 A;  5ING A;  5INI A;  1HNU A;  3QKA A;  3R9S A;  1PIX A;  3BEZ A;  4QIJ A;  4IZD A;  1X0U A;  3MFM A;  4ZDB A;  1UIY A;  3ZWC A;  3U9T B;  2F9I B;  2IEX A;  4U19 A;  3TT7 A;  2Q34 A;  4Q1I A;  3H0U A;  4I4Z A;  4B3I A;  3NJD A;  4FZW C;  1XX4 A;  3IAV A;  3TT6 A;  2VX2 A;  2ZL0 A;  2PG8 A;  4J2U A;  3TV5 A;  3QMJ A;  4FN7 A;  4JYJ A;  3T3W A;  5IKL B;  4JSB A;  4EMM A;  2VSU E;  3RSI A;  3RRV A;  3NJB A;  4U18 A;  1XNV A;  1J7X A;  5HUQ A;  3SLL A;  3N6R B;  3Q0G A;  4JWV A;  5DZK H;  3IB9 A;  5DKP A;  4JFC A;  4WYO B;  4U0G A;  2HW5 A;  3K8X A;  1WDK A;  1XNW A;  1DCI A;  1NZY B;  4YLH A;  4ASI A;  2VSS F;  3KTG A;  3MOY A;  2BZR A;  3KTI A;  4KPK A;  3GLM A;  2UZF A;  4HC8 A;  1FC7 A;  1EF8 A;  2EJ5 A;  3ZWB A;  1WDL A;  5DTP A; 
#chains in the Genus database with same CATH homology
 4OLQ A;  4ZU2 A;  3PGQ A;  5E0N X;  4ELS A;  1DUB A;  3ZWA A;  5KDR A;  4MXI A;  3QXI A;  4GHN A;  4K3W A;  3M6M A;  1JXZ A;  1ON9 A;  3V5I A;  3KTK A;  3RST A;  1TG6 A;  3HLN 1;  2ZQQ A;  4LK5 A;  1UYS A;  3M6N A;  3KTJ A;  4ZDE A;  1OD2 A;  2NP9 A;  4Z0M A;  4GM2 A;  4I52 A;  2DEO A;  3GF3 A;  3K50 A;  5G1R A;  3TDC A;  1K32 A;  2A7S A;  3H81 A;  4MI2 A;  3KTH A;  1UYV A;  1WDM A;  2D3T A;  3LAO A;  4FNB A;  1EF9 A;  3TVU A;  3IBB A;  3PZK A;  3T8A A;  4EMP A;  4ZDD A;  4WCZ A;  3QWD A;  4RYF H;  1SZO A;  4MOU A;  3ST9 A;  4JCR A;  1UYT A;  4WZ8 B;  2YJG A;  1HNO A;  2FZS A;  4QII A;  3H02 A;  1HZD A;  3P5M A;  3R6H A;  4JCQ A;  2A7K A;  5DZK A;  3DOR A;  1XNY A;  3I47 A;  2F9I A;  1FCF A;  3KQF A;  4FZW A;  5FIF A;  4K2N A;  1VRG A;  2QQ3 A;  3T88 A;  2J5S A;  5DU8 A;  2ZL2 A;  4U0H A;  3H0S A;  4HDT A;  2WTB A;  4OMR A;  4ZDF A;  2J5I B;  4NEK A;  4JOT A;  1WZ8 A;  3G64 A;  1YG8 A;  2ZQR A;  3JU1 A;  3R9T A;  3ISA A;  3U9S B;  1N6F A;  1W2X A;  3OT6 A;  3ZW9 A;  3SWX A;  5E0S A;  1OD4 A;  2C8T A;  5DU6 A;  4B3H A;  3Q1T A;  5DL1 A;  3R9Q A;  1K39 A;  3GKB A;  4FN8 A;  4NNQ A;  5DU4 A;  2A81 A;  1EY3 A;  2F6Q A;  3Q7H A;  5JBX A;  3STA A;  4RYF A;  4HNK A;  3HIN A;  2VSU C;  2VSU F;  1YG6 A;  5INF A;  3QK8 A;  5DUC A;  3T8B A;  4IZC A;  1RJN A;  3TVW A;  2J5I A;  3BPP A;  4QFE A;  5DUF A;  1N6D A;  2W3P A;  3TRR A;  2X24 A;  3TLF A;  3R0O A;  4G2R A;  4JJT A;  1FC9 A;  5G1Q A;  1XO6 A;  4K29 A;  5CTB A;  4F47 A;  3QRE A;  4U0G H;  5C90 A;  2F9Y B;  2VSS A;  4U1A A;  5FUS A;  3PEA A;  4JVT A;  2PPY A;  1PJH A;  1MJ3 A;  4B3J A;  1Q51 A;  4L6W A;  1TYF A;  3TZ3 A;  2J5G D;  2Q35 A;  2J5I I;  2GTR A;  5CTC A;  3OC7 A;  2VSU A;  3FDU A;  5KJP A;  2PBP A;  3LKE A;  3HP0 A;  1RJM A;  1N6E A;  3U9R B;  4FND A;  4JCT A;  3Q0J A;  3H0J A;  4KD6 A;  5C9G A;  2F9Y A;  3DJA A;  3GMA A;  1Y7O A;  3MT6 A;  3QXZ A;  4JCS A;  3ZW8 A;  5E0S H;  4RCN A;  4FB8 A;  2ZL3 A;  4KWB A;  1SG4 A;  4ZDC A;  5MGB A;  3MYB A;  1Q52 A;  2CBY A;  4IZB A;  4ELX A;  3L3S A;  5KDR B;  4KNP A;  4JYL A;  4EML A;  3T89 A;  3HE2 A;  2FBM A;  5G1S A;  4Q0G A;  2ZL4 A;  4FJW D;  4L8K A;  3GF7 A;  3V5E A;  3QYR A;  3H0Q A;  2F6I A;  2FW2 A;  4ELW A;  3P85 A;  4I42 A;  3VIV A;  1UYR A;  1NZY A;  3BPT A;  2VSS E;  3WG5 A;  2J5G A;  3OME A;  2Q2X A;  1O8U A;  5DTW A;  1ON3 A;  2X58 A;  3PE8 A;  3HRX A;  2CE3 A;  3P2L A;  1FC6 A;  4NAR A;  5JBW A;  4OG1 A;  3BF0 A;  3FF6 A;  2DUB A;  2VRE A;  4DI1 A;  5ING A;  5INI A;  1HNU A;  3QKA A;  3R9S A;  1PIX A;  3BEZ A;  4QIJ A;  4IZD A;  1X0U A;  3MFM A;  4ZDB A;  1UIY A;  3ZWC A;  3U9T B;  2F9I B;  2IEX A;  4U19 A;  3TT7 A;  2Q34 A;  4Q1I A;  3H0U A;  4I4Z A;  4B3I A;  3NJD A;  4FZW C;  1XX4 A;  3IAV A;  3TT6 A;  2VX2 A;  2ZL0 A;  2PG8 A;  4J2U A;  3TV5 A;  3QMJ A;  4FN7 A;  4JYJ A;  3T3W A;  5IKL B;  4JSB A;  4EMM A;  2VSU E;  3RSI A;  3RRV A;  3NJB A;  4U18 A;  1XNV A;  1J7X A;  5HUQ A;  3SLL A;  3N6R B;  3Q0G A;  4JWV A;  5DZK H;  3IB9 A;  5DKP A;  4JFC A;  4WYO B;  4U0G A;  2HW5 A;  3K8X A;  1WDK A;  1XNW A;  1DCI A;  1NZY B;  4YLH A;  4ASI A;  2VSS F;  3KTG A;  3MOY A;  2BZR A;  3KTI A;  4KPK A;  3GLM A;  2UZF A;  4HC8 A;  1FC7 A;  1EF8 A;  2EJ5 A;  3ZWB A;  1WDL A;  5DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...