2CE3A

Crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
177
structure length
167
Chain Sequence
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Inter-Ring Plasticity of Caseinolytic Proteases from the X-Ray Structure of Mycobacterium Tuberculosis Clpp1.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
total genus 63
structure length 167
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2ce3A00
3WG5A 4FZWA 3LAOA 3ISAA 1YG6A 4IZDA 2F9YA 1J7XA 3R9SA 5G1SA 2J5SA 4GM2A 3BF0A 1O8UA 3R9QA 2W3PA 2PPYA 3Q1TA 5CTBA 5C9GA 3H0JA 4K3WA 2F9IA 4DI1A 1SG4A 5C90A 2VSUA 3Q0GA 5IKLB 2VSUE 3IB9A 3QXIA 3GF7A 3TZ3A 1XNWA 4B3IA 5DUFA 1EY3A 4JFCA 2Q2XA 3T3WA 1NZYB 3P85A 5DZKH 4ZDFA 3VIVA 4WCZA 2UZFA 3OC7A 1ON3A 3RSTA 1K39A 3N6RB 1RJMA 3KTKA 3MT6A 1XO6A 3SLLA 1TG6A 3TDCA 4JJTA 3T8BA 4FZWC 5FUSA 4ASIA 2A7SA 5DTPA 2X58A 3GKBA 2PG8A 4IZBA 5JBWA 1YG8A 2ZL4A 3V5IA 3OMEA 3M6MA 4RCNA 2VSSA 3H02A 4I52A 1UYTA 2CBYA 3QKAA 4Q1IA 3H81A 3HRXA 5DU4A 4Q0GA 4ZDBA 2VX2A 3IAVA 3ST9A 5MGBA 3M6NA 2F6IA 4ELSA 1XX4A 2DEOA 3HINA 3G64A 2ZQRA 5INFA 1SZOA 4KWBA 5E0NX 3TRRA 2EJ5A 1PJHA 1FC7A 4ZDDA 5DTWA 2HW5A 1WDKA 5E0SA 4MXIA 1RJNA 3NJBA 3JU1A 1N6EA 3MFMA 5FIFA 2NP9A 2FW2A 3QWDA 1UYVA 3QK8A 3ZW8A 5DKPA 3KQFA 3HLN1 2ZQQA 4G2RA 3PE8A 4WYOB 3OT6A 3RSIA 3KTHA 1WDLA 1JXZA 4HC8A 3SWXA 4KPKA 4WZ8B 2ZL2A 4ZDCA 4KD6A 4F47A 2Q34A 1NZYA 4U0GA 1Y7OA 5KJPA 1WZ8A 3PEAA 3STAA 3Q0JA 5INGA 4U1AA 3TVWA 5G1RA 5DUCA 4OG1A 4FN7A 3L3SA 4I4ZA 3PGQA 1EF8A 2X24A 2DUBA 3P5MA 3I47A 3P2LA 2J5GA 2Q35A 1HZDA 2VSUF 3HP0A 3U9SB 1FC9A 2ZL0A 4FN8A 4L8KA 4EMPA 4ELXA 3DORA 3TT6A 4B3HA 1MJ3A 3Q7HA 3QXZA 3NJDA 3U9RB 4ELWA 2VSSE 3ZWCA 3RRVA 3GMAA 5G1QA 3BEZA 3ZWBA 2J5II 1XNVA 2CE3A 3BPPA 5DZKA 4QIJA 2F6QA 4RYFH 2FBMA 4I42A 4YLHA 5DL1A 4JWVA 3FF6A 3HE2A 4U18A 4U19A 1K32A 1Q52A 4NNQA 4ZU2A 3IBBA 1N6FA 4EMLA 5DU8A 4JSBA 3H0QA 4JYLA 1X0UA 4OLQA 5DU6A 1W2XA 5KDRA 4FJWD 1UYRA 1VRGA 3TT7A 3ZWAA 2F9YB 4HNKA 1ON9A 4IZCA 2C8TA 2A81A 3R9TA 3TV5A 3K50A 3ZW9A 4MOUA 2J5IB 3TLFA 1XNYA 3KTJA 1OD4A 4QFEA 4LK5A 3KTIA 1N6DA 4EMMA 2A7KA 2VSSF 4L6WA 3T88A 4K2NA 2PBPA 3TVUA 2BZRA 2J5GD 5E0SH 4Z0MA 4U0GH 4JOTA 3QYRA 2VSUC 4JCTA 3V5EA 4FNDA 2IEXA 4FNBA 4B3JA 1WDMA 4MI2A 2D3TA 4GHNA 2J5IA 3GF3A 2WTBA 4ZDEA 5INIA 1UYSA 3T89A 1FC6A 3R0OA 1PIXA 4JVTA 3H0UA 5JBXA 4OMRA 2QQ3A 2FZSA 3T8AA 3MYBA 4JCSA 3QREA 1DUBA 2ZL3A 1Q51A 1OD2A 3LKEA 3KTGA 1HNOA 3QMJA 4U0HA 3DJAA 3H0SA 3PZKA 5CTCA 3MOYA 3R6HA 4FB8A 1UIYA 4JYJA 4JCRA 3K8XA 1EF9A 1HNUA 3FDUA 2VREA 1TYFA 1FCFA 3U9TB 1DCIA 4K29A 4NEKA 2GTRA 3GLMA 4QIIA 4RYFA 4KNPA 2F9IB 5KDRB 4JCQA
chains in the Genus database with same CATH superfamily
3WG5A 4FZWA 3LAOA 3ISAA 1YG6A 4IZDA 2F9YA 1J7XA 3R9SA 5G1SA 2J5SA 4GM2A 3BF0A 1O8UA 3R9QA 2W3PA 2PPYA 3Q1TA 5CTBA 5C9GA 3H0JA 4K3WA 2F9IA 4DI1A 1SG4A 5C90A 2VSUA 3Q0GA 5IKLB 2VSUE 3IB9A 3QXIA 3GF7A 3TZ3A 1XNWA 4B3IA 5DUFA 4HDTA 1EY3A 4JFCA 2Q2XA 3T3WA 1NZYB 3P85A 5DZKH 4ZDFA 3VIVA 4WCZA 2UZFA 3OC7A 1ON3A 3RSTA 1K39A 3N6RB 1RJMA 3KTKA 3MT6A 1XO6A 3SLLA 1TG6A 3TDCA 4JJTA 3T8BA 4FZWC 5FUSA 4ASIA 2A7SA 5DTPA 2X58A 3GKBA 2PG8A 4IZBA 5JBWA 1YG8A 2ZL4A 3V5IA 3OMEA 3M6MA 4RCNA 2VSSA 4J2UA 3H02A 4I52A 1UYTA 2CBYA 3QKAA 4Q1IA 3H81A 3HRXA 5DU4A 4Q0GA 4ZDBA 2VX2A 3IAVA 3ST9A 5MGBA 3M6NA 2F6IA 4ELSA 1XX4A 2DEOA 3HINA 3G64A 2ZQRA 5INFA 1SZOA 4KWBA 5E0NX 3TRRA 2EJ5A 1PJHA 1FC7A 4ZDDA 5DTWA 2HW5A 1WDKA 5E0SA 4MXIA 1RJNA 3NJBA 3JU1A 1N6EA 3MFMA 5FIFA 2NP9A 2FW2A 3QWDA 1UYVA 3QK8A 3ZW8A 5DKPA 3KQFA 3HLN1 2ZQQA 4G2RA 3PE8A 4WYOB 3OT6A 3RSIA 3KTHA 1WDLA 1JXZA 4HC8A 3SWXA 4KPKA 4WZ8B 2ZL2A 4ZDCA 4KD6A 4F47A 2Q34A 1NZYA 4U0GA 1Y7OA 5KJPA 1WZ8A 3PEAA 3STAA 3Q0JA 5INGA 4U1AA 3TVWA 5G1RA 4NARA 5DUCA 4OG1A 4FN7A 3L3SA 4I4ZA 3PGQA 1EF8A 2X24A 2DUBA 3P5MA 3I47A 3P2LA 2J5GA 2Q35A 1HZDA 2VSUF 3HP0A 3U9SB 1FC9A 2ZL0A 4FN8A 4L8KA 4EMPA 4ELXA 3DORA 3TT6A 3BPTA 4B3HA 1MJ3A 3Q7HA 3QXZA 3NJDA 3U9RB 4ELWA 2VSSE 3ZWCA 3RRVA 3GMAA 5G1QA 3BEZA 3ZWBA 2J5II 1XNVA 2CE3A 3BPPA 5DZKA 4QIJA 2F6QA 4RYFH 2FBMA 4I42A 4YLHA 5DL1A 4JWVA 3FF6A 3HE2A 4U18A 4U19A 1K32A 1Q52A 4NNQA 4ZU2A 3IBBA 1N6FA 4EMLA 5DU8A 4JSBA 3H0QA 4JYLA 1X0UA 4OLQA 5DU6A 1W2XA 5KDRA 4FJWD 1UYRA 1VRGA 3TT7A 3ZWAA 2F9YB 4HNKA 1ON9A 4IZCA 2C8TA 2A81A 3R9TA 3TV5A 3K50A 3ZW9A 4MOUA 2J5IB 3TLFA 1XNYA 3KTJA 1OD4A 4QFEA 4LK5A 3KTIA 1N6DA 4EMMA 2A7KA 2VSSF 4L6WA 3T88A 4K2NA 2PBPA 3TVUA 2BZRA 2J5GD 5E0SH 4Z0MA 4U0GH 4JOTA 3QYRA 2VSUC 4JCTA 3V5EA 4FNDA 2IEXA 4FNBA 4B3JA 1WDMA 4MI2A 2D3TA 4GHNA 2J5IA 3GF3A 2WTBA 4ZDEA 5INIA 1UYSA 3T89A 1FC6A 3R0OA 1PIXA 4JVTA 3H0UA 5JBXA 4OMRA 2QQ3A 2FZSA 3T8AA 3MYBA 4JCSA 3QREA 1DUBA 2ZL3A 1Q51A 1OD2A 3LKEA 3KTGA 1HNOA 3QMJA 4U0HA 5HUQA 3DJAA 3H0SA 3PZKA 5CTCA 3MOYA 3R6HA 4FB8A 1UIYA 4JYJA 2YJGA 4JCRA 3K8XA 1EF9A 1HNUA 3FDUA 2VREA 1TYFA 1FCFA 3U9TB 1DCIA 4K29A 4NEKA 2GTRA 3GLMA 4QIIA 4RYFA 4KNPA 2F9IB 5KDRB 4JCQA
chains in the Genus database with same CATH topology
3WG5A 4FZWA 3LAOA 3ISAA 1YG6A 4IZDA 2F9YA 1J7XA 3R9SA 5G1SA 2J5SA 4GM2A 3BF0A 1O8UA 3R9QA 2W3PA 2PPYA 3Q1TA 5CTBA 5C9GA 3H0JA 4K3WA 2F9IA 4DI1A 1SG4A 5C90A 2VSUA 3Q0GA 5IKLB 2VSUE 3IB9A 3QXIA 3GF7A 3TZ3A 1XNWA 4B3IA 5DUFA 4HDTA 1EY3A 4JFCA 2Q2XA 3T3WA 1NZYB 3P85A 5DZKH 4ZDFA 3VIVA 4WCZA 2UZFA 3OC7A 1ON3A 3RSTA 1K39A 3N6RB 1RJMA 3KTKA 3MT6A 1XO6A 3SLLA 1TG6A 3TDCA 4JJTA 3T8BA 4FZWC 5FUSA 4ASIA 2A7SA 5DTPA 2X58A 3GKBA 2PG8A 4IZBA 5JBWA 1YG8A 2ZL4A 3V5IA 3OMEA 3M6MA 4RCNA 2VSSA 4J2UA 3H02A 4I52A 1UYTA 2CBYA 3QKAA 4Q1IA 3H81A 3HRXA 5DU4A 4Q0GA 4ZDBA 2VX2A 3IAVA 3ST9A 5MGBA 3M6NA 2F6IA 4ELSA 1XX4A 2DEOA 3HINA 3G64A 2ZQRA 5INFA 1SZOA 4KWBA 5E0NX 3TRRA 2EJ5A 1PJHA 1FC7A 4ZDDA 5DTWA 2HW5A 1WDKA 5E0SA 4MXIA 1RJNA 3NJBA 3JU1A 1N6EA 3MFMA 5FIFA 2NP9A 2FW2A 3QWDA 1UYVA 3QK8A 3ZW8A 5DKPA 3KQFA 3HLN1 2ZQQA 4G2RA 3PE8A 4WYOB 3OT6A 3RSIA 3KTHA 1WDLA 1JXZA 4HC8A 3SWXA 4KPKA 4WZ8B 2ZL2A 4ZDCA 4KD6A 4F47A 2Q34A 1NZYA 4U0GA 1Y7OA 5KJPA 1WZ8A 3PEAA 3STAA 3Q0JA 5INGA 4U1AA 3TVWA 5G1RA 4NARA 5DUCA 4OG1A 4FN7A 3L3SA 4I4ZA 3PGQA 1EF8A 2X24A 2DUBA 3P5MA 3I47A 3P2LA 2J5GA 2Q35A 1HZDA 2VSUF 3HP0A 3U9SB 1FC9A 2ZL0A 4FN8A 4L8KA 4EMPA 4ELXA 3DORA 3TT6A 3BPTA 4B3HA 1MJ3A 3Q7HA 3QXZA 3NJDA 3U9RB 4ELWA 2VSSE 3ZWCA 3RRVA 3GMAA 5G1QA 3BEZA 3ZWBA 2J5II 1XNVA 2CE3A 3BPPA 5DZKA 4QIJA 2F6QA 4RYFH 2FBMA 4I42A 4YLHA 5DL1A 4JWVA 3FF6A 3HE2A 4U18A 4U19A 1K32A 1Q52A 4NNQA 4ZU2A 3IBBA 1N6FA 4EMLA 5DU8A 4JSBA 3H0QA 4JYLA 1X0UA 4OLQA 5DU6A 1W2XA 5KDRA 4FJWD 1UYRA 1VRGA 3TT7A 3ZWAA 2F9YB 4HNKA 1ON9A 4IZCA 2C8TA 2A81A 3R9TA 3TV5A 3K50A 3ZW9A 4MOUA 2J5IB 3TLFA 1XNYA 3KTJA 1OD4A 4QFEA 4LK5A 3KTIA 1N6DA 4EMMA 2A7KA 2VSSF 4L6WA 3T88A 4K2NA 2PBPA 3TVUA 2BZRA 2J5GD 5E0SH 4Z0MA 4U0GH 4JOTA 3QYRA 2VSUC 4JCTA 3V5EA 4FNDA 2IEXA 4FNBA 4B3JA 1WDMA 4MI2A 2D3TA 4GHNA 2J5IA 3GF3A 2WTBA 4ZDEA 5INIA 1UYSA 3T89A 1FC6A 3R0OA 1PIXA 4JVTA 3H0UA 5JBXA 4OMRA 2QQ3A 2FZSA 3T8AA 3MYBA 4JCSA 3QREA 1DUBA 2ZL3A 1Q51A 1OD2A 3LKEA 3KTGA 1HNOA 3QMJA 4U0HA 5HUQA 3DJAA 3H0SA 3PZKA 5CTCA 3MOYA 3R6HA 4FB8A 1UIYA 4JYJA 2YJGA 4JCRA 3K8XA 1EF9A 1HNUA 3FDUA 2VREA 1TYFA 1FCFA 3U9TB 1DCIA 4K29A 4NEKA 2GTRA 3GLMA 4QIIA 4RYFA 4KNPA 2F9IB 5KDRB 4JCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG5 A;  4FZW A;  3LAO A;  3ISA A;  1YG6 A;  4IZD A;  2F9Y A;  1J7X A;  3R9S A;  5G1S A;  2J5S A;  4GM2 A;  3BF0 A;  1O8U A;  3R9Q A;  2W3P A;  2PPY A;  3Q1T A;  5CTB A;  5C9G A;  3H0J A;  4K3W A;  2F9I A;  4DI1 A;  1SG4 A;  5C90 A;  2VSU A;  3Q0G A;  5IKL B;  2VSU E;  3IB9 A;  3QXI A;  3GF7 A;  3TZ3 A;  1XNW A;  4B3I A;  5DUF A;  1EY3 A;  4JFC A;  2Q2X A;  3T3W A;  1NZY B;  3P85 A;  5DZK H;  4ZDF A;  3VIV A;  4WCZ A;  2UZF A;  3OC7 A;  1ON3 A;  3RST A;  1K39 A;  3N6R B;  1RJM A;  3KTK A;  3MT6 A;  1XO6 A;  3SLL A;  1TG6 A;  3TDC A;  4JJT A;  3T8B A;  4FZW C;  5FUS A;  4ASI A;  2A7S A;  5DTP A;  2X58 A;  3GKB A;  2PG8 A;  4IZB A;  5JBW A;  1YG8 A;  2ZL4 A;  3V5I A;  3OME A;  3M6M A;  4RCN A;  2VSS A;  3H02 A;  4I52 A;  1UYT A;  2CBY A;  3QKA A;  4Q1I A;  3H81 A;  3HRX A;  5DU4 A;  4Q0G A;  4ZDB A;  2VX2 A;  3IAV A;  3ST9 A;  5MGB A;  3M6N A;  2F6I A;  4ELS A;  1XX4 A;  2DEO A;  3HIN A;  3G64 A;  2ZQR A;  5INF A;  1SZO A;  4KWB A;  5E0N X;  3TRR A;  2EJ5 A;  1PJH A;  1FC7 A;  4ZDD A;  5DTW A;  2HW5 A;  1WDK A;  5E0S A;  4MXI A;  1RJN A;  3NJB A;  3JU1 A;  1N6E A;  3MFM A;  5FIF A;  2NP9 A;  2FW2 A;  3QWD A;  1UYV A;  3QK8 A;  3ZW8 A;  5DKP A;  3KQF A;  3HLN 1;  2ZQQ A;  4G2R A;  3PE8 A;  4WYO B;  3OT6 A;  3RSI A;  3KTH A;  1WDL A;  1JXZ A;  4HC8 A;  3SWX A;  4KPK A;  4WZ8 B;  2ZL2 A;  4ZDC A;  4KD6 A;  4F47 A;  2Q34 A;  1NZY A;  4U0G A;  1Y7O A;  5KJP A;  1WZ8 A;  3PEA A;  3STA A;  3Q0J A;  5ING A;  4U1A A;  3TVW A;  5G1R A;  5DUC A;  4OG1 A;  4FN7 A;  3L3S A;  4I4Z A;  3PGQ A;  1EF8 A;  2X24 A;  2DUB A;  3P5M A;  3I47 A;  3P2L A;  2J5G A;  2Q35 A;  1HZD A;  2VSU F;  3HP0 A;  3U9S B;  1FC9 A;  2ZL0 A;  4FN8 A;  4L8K A;  4EMP A;  4ELX A;  3DOR A;  3TT6 A;  4B3H A;  1MJ3 A;  3Q7H A;  3QXZ A;  3NJD A;  3U9R B;  4ELW A;  2VSS E;  3ZWC A;  3RRV A;  3GMA A;  5G1Q A;  3BEZ A;  3ZWB A;  2J5I I;  1XNV A;  2CE3 A;  3BPP A;  5DZK A;  4QIJ A;  2F6Q A;  4RYF H;  2FBM A;  4I42 A;  4YLH A;  5DL1 A;  4JWV A;  3FF6 A;  3HE2 A;  4U18 A;  4U19 A;  1K32 A;  1Q52 A;  4NNQ A;  4ZU2 A;  3IBB A;  1N6F A;  4EML A;  5DU8 A;  4JSB A;  3H0Q A;  4JYL A;  1X0U A;  4OLQ A;  5DU6 A;  1W2X A;  5KDR A;  4FJW D;  1UYR A;  1VRG A;  3TT7 A;  3ZWA A;  2F9Y B;  4HNK A;  1ON9 A;  4IZC A;  2C8T A;  2A81 A;  3R9T A;  3TV5 A;  3K50 A;  3ZW9 A;  4MOU A;  2J5I B;  3TLF A;  1XNY A;  3KTJ A;  1OD4 A;  4QFE A;  4LK5 A;  3KTI A;  1N6D A;  4EMM A;  2A7K A;  2VSS F;  4L6W A;  3T88 A;  4K2N A;  2PBP A;  3TVU A;  2BZR A;  2J5G D;  5E0S H;  4Z0M A;  4U0G H;  4JOT A;  3QYR A;  2VSU C;  4JCT A;  3V5E A;  4FND A;  2IEX A;  4FNB A;  4B3J A;  1WDM A;  4MI2 A;  2D3T A;  4GHN A;  2J5I A;  3GF3 A;  2WTB A;  4ZDE A;  5INI A;  1UYS A;  3T89 A;  1FC6 A;  3R0O A;  1PIX A;  4JVT A;  3H0U A;  5JBX A;  4OMR A;  2QQ3 A;  2FZS A;  3T8A A;  3MYB A;  4JCS A;  3QRE A;  1DUB A;  2ZL3 A;  1Q51 A;  1OD2 A;  3LKE A;  3KTG A;  1HNO A;  3QMJ A;  4U0H A;  3DJA A;  3H0S A;  3PZK A;  5CTC A;  3MOY A;  3R6H A;  4FB8 A;  1UIY A;  4JYJ A;  4JCR A;  3K8X A;  1EF9 A;  1HNU A;  3FDU A;  2VRE A;  1TYF A;  1FCF A;  3U9T B;  1DCI A;  4K29 A;  4NEK A;  2GTR A;  3GLM A;  4QII A;  4RYF A;  4KNP A;  2F9I B;  5KDR B;  4JCQ A; 
#chains in the Genus database with same CATH topology
 3WG5 A;  4FZW A;  3LAO A;  3ISA A;  1YG6 A;  4IZD A;  2F9Y A;  1J7X A;  3R9S A;  5G1S A;  2J5S A;  4GM2 A;  3BF0 A;  1O8U A;  3R9Q A;  2W3P A;  2PPY A;  3Q1T A;  5CTB A;  5C9G A;  3H0J A;  4K3W A;  2F9I A;  4DI1 A;  1SG4 A;  5C90 A;  2VSU A;  3Q0G A;  5IKL B;  2VSU E;  3IB9 A;  3QXI A;  3GF7 A;  3TZ3 A;  1XNW A;  4B3I A;  5DUF A;  4HDT A;  1EY3 A;  4JFC A;  2Q2X A;  3T3W A;  1NZY B;  3P85 A;  5DZK H;  4ZDF A;  3VIV A;  4WCZ A;  2UZF A;  3OC7 A;  1ON3 A;  3RST A;  1K39 A;  3N6R B;  1RJM A;  3KTK A;  3MT6 A;  1XO6 A;  3SLL A;  1TG6 A;  3TDC A;  4JJT A;  3T8B A;  4FZW C;  5FUS A;  4ASI A;  2A7S A;  5DTP A;  2X58 A;  3GKB A;  2PG8 A;  4IZB A;  5JBW A;  1YG8 A;  2ZL4 A;  3V5I A;  3OME A;  3M6M A;  4RCN A;  2VSS A;  4J2U A;  3H02 A;  4I52 A;  1UYT A;  2CBY A;  3QKA A;  4Q1I A;  3H81 A;  3HRX A;  5DU4 A;  4Q0G A;  4ZDB A;  2VX2 A;  3IAV A;  3ST9 A;  5MGB A;  3M6N A;  2F6I A;  4ELS A;  1XX4 A;  2DEO A;  3HIN A;  3G64 A;  2ZQR A;  5INF A;  1SZO A;  4KWB A;  5E0N X;  3TRR A;  2EJ5 A;  1PJH A;  1FC7 A;  4ZDD A;  5DTW A;  2HW5 A;  1WDK A;  5E0S A;  4MXI A;  1RJN A;  3NJB A;  3JU1 A;  1N6E A;  3MFM A;  5FIF A;  2NP9 A;  2FW2 A;  3QWD A;  1UYV A;  3QK8 A;  3ZW8 A;  5DKP A;  3KQF A;  3HLN 1;  2ZQQ A;  4G2R A;  3PE8 A;  4WYO B;  3OT6 A;  3RSI A;  3KTH A;  1WDL A;  1JXZ A;  4HC8 A;  3SWX A;  4KPK A;  4WZ8 B;  2ZL2 A;  4ZDC A;  4KD6 A;  4F47 A;  2Q34 A;  1NZY A;  4U0G A;  1Y7O A;  5KJP A;  1WZ8 A;  3PEA A;  3STA A;  3Q0J A;  5ING A;  4U1A A;  3TVW A;  5G1R A;  4NAR A;  5DUC A;  4OG1 A;  4FN7 A;  3L3S A;  4I4Z A;  3PGQ A;  1EF8 A;  2X24 A;  2DUB A;  3P5M A;  3I47 A;  3P2L A;  2J5G A;  2Q35 A;  1HZD A;  2VSU F;  3HP0 A;  3U9S B;  1FC9 A;  2ZL0 A;  4FN8 A;  4L8K A;  4EMP A;  4ELX A;  3DOR A;  3TT6 A;  3BPT A;  4B3H A;  1MJ3 A;  3Q7H A;  3QXZ A;  3NJD A;  3U9R B;  4ELW A;  2VSS E;  3ZWC A;  3RRV A;  3GMA A;  5G1Q A;  3BEZ A;  3ZWB A;  2J5I I;  1XNV A;  2CE3 A;  3BPP A;  5DZK A;  4QIJ A;  2F6Q A;  4RYF H;  2FBM A;  4I42 A;  4YLH A;  5DL1 A;  4JWV A;  3FF6 A;  3HE2 A;  4U18 A;  4U19 A;  1K32 A;  1Q52 A;  4NNQ A;  4ZU2 A;  3IBB A;  1N6F A;  4EML A;  5DU8 A;  4JSB A;  3H0Q A;  4JYL A;  1X0U A;  4OLQ A;  5DU6 A;  1W2X A;  5KDR A;  4FJW D;  1UYR A;  1VRG A;  3TT7 A;  3ZWA A;  2F9Y B;  4HNK A;  1ON9 A;  4IZC A;  2C8T A;  2A81 A;  3R9T A;  3TV5 A;  3K50 A;  3ZW9 A;  4MOU A;  2J5I B;  3TLF A;  1XNY A;  3KTJ A;  1OD4 A;  4QFE A;  4LK5 A;  3KTI A;  1N6D A;  4EMM A;  2A7K A;  2VSS F;  4L6W A;  3T88 A;  4K2N A;  2PBP A;  3TVU A;  2BZR A;  2J5G D;  5E0S H;  4Z0M A;  4U0G H;  4JOT A;  3QYR A;  2VSU C;  4JCT A;  3V5E A;  4FND A;  2IEX A;  4FNB A;  4B3J A;  1WDM A;  4MI2 A;  2D3T A;  4GHN A;  2J5I A;  3GF3 A;  2WTB A;  4ZDE A;  5INI A;  1UYS A;  3T89 A;  1FC6 A;  3R0O A;  1PIX A;  4JVT A;  3H0U A;  5JBX A;  4OMR A;  2QQ3 A;  2FZS A;  3T8A A;  3MYB A;  4JCS A;  3QRE A;  1DUB A;  2ZL3 A;  1Q51 A;  1OD2 A;  3LKE A;  3KTG A;  1HNO A;  3QMJ A;  4U0H A;  5HUQ A;  3DJA A;  3H0S A;  3PZK A;  5CTC A;  3MOY A;  3R6H A;  4FB8 A;  1UIY A;  4JYJ A;  2YJG A;  4JCR A;  3K8X A;  1EF9 A;  1HNU A;  3FDU A;  2VRE A;  1TYF A;  1FCF A;  3U9T B;  1DCI A;  4K29 A;  4NEK A;  2GTR A;  3GLM A;  4QII A;  4RYF A;  4KNP A;  2F9I B;  5KDR B;  4JCQ A; 
#chains in the Genus database with same CATH homology
 3WG5 A;  4FZW A;  3LAO A;  3ISA A;  1YG6 A;  4IZD A;  2F9Y A;  1J7X A;  3R9S A;  5G1S A;  2J5S A;  4GM2 A;  3BF0 A;  1O8U A;  3R9Q A;  2W3P A;  2PPY A;  3Q1T A;  5CTB A;  5C9G A;  3H0J A;  4K3W A;  2F9I A;  4DI1 A;  1SG4 A;  5C90 A;  2VSU A;  3Q0G A;  5IKL B;  2VSU E;  3IB9 A;  3QXI A;  3GF7 A;  3TZ3 A;  1XNW A;  4B3I A;  5DUF A;  4HDT A;  1EY3 A;  4JFC A;  2Q2X A;  3T3W A;  1NZY B;  3P85 A;  5DZK H;  4ZDF A;  3VIV A;  4WCZ A;  2UZF A;  3OC7 A;  1ON3 A;  3RST A;  1K39 A;  3N6R B;  1RJM A;  3KTK A;  3MT6 A;  1XO6 A;  3SLL A;  1TG6 A;  3TDC A;  4JJT A;  3T8B A;  4FZW C;  5FUS A;  4ASI A;  2A7S A;  5DTP A;  2X58 A;  3GKB A;  2PG8 A;  4IZB A;  5JBW A;  1YG8 A;  2ZL4 A;  3V5I A;  3OME A;  3M6M A;  4RCN A;  2VSS A;  4J2U A;  3H02 A;  4I52 A;  1UYT A;  2CBY A;  3QKA A;  4Q1I A;  3H81 A;  3HRX A;  5DU4 A;  4Q0G A;  4ZDB A;  2VX2 A;  3IAV A;  3ST9 A;  5MGB A;  3M6N A;  2F6I A;  4ELS A;  1XX4 A;  2DEO A;  3HIN A;  3G64 A;  2ZQR A;  5INF A;  1SZO A;  4KWB A;  5E0N X;  3TRR A;  2EJ5 A;  1PJH A;  1FC7 A;  4ZDD A;  5DTW A;  2HW5 A;  1WDK A;  5E0S A;  4MXI A;  1RJN A;  3NJB A;  3JU1 A;  1N6E A;  3MFM A;  5FIF A;  2NP9 A;  2FW2 A;  3QWD A;  1UYV A;  3QK8 A;  3ZW8 A;  5DKP A;  3KQF A;  3HLN 1;  2ZQQ A;  4G2R A;  3PE8 A;  4WYO B;  3OT6 A;  3RSI A;  3KTH A;  1WDL A;  1JXZ A;  4HC8 A;  3SWX A;  4KPK A;  4WZ8 B;  2ZL2 A;  4ZDC A;  4KD6 A;  4F47 A;  2Q34 A;  1NZY A;  4U0G A;  1Y7O A;  5KJP A;  1WZ8 A;  3PEA A;  3STA A;  3Q0J A;  5ING A;  4U1A A;  3TVW A;  5G1R A;  4NAR A;  5DUC A;  4OG1 A;  4FN7 A;  3L3S A;  4I4Z A;  3PGQ A;  1EF8 A;  2X24 A;  2DUB A;  3P5M A;  3I47 A;  3P2L A;  2J5G A;  2Q35 A;  1HZD A;  2VSU F;  3HP0 A;  3U9S B;  1FC9 A;  2ZL0 A;  4FN8 A;  4L8K A;  4EMP A;  4ELX A;  3DOR A;  3TT6 A;  3BPT A;  4B3H A;  1MJ3 A;  3Q7H A;  3QXZ A;  3NJD A;  3U9R B;  4ELW A;  2VSS E;  3ZWC A;  3RRV A;  3GMA A;  5G1Q A;  3BEZ A;  3ZWB A;  2J5I I;  1XNV A;  2CE3 A;  3BPP A;  5DZK A;  4QIJ A;  2F6Q A;  4RYF H;  2FBM A;  4I42 A;  4YLH A;  5DL1 A;  4JWV A;  3FF6 A;  3HE2 A;  4U18 A;  4U19 A;  1K32 A;  1Q52 A;  4NNQ A;  4ZU2 A;  3IBB A;  1N6F A;  4EML A;  5DU8 A;  4JSB A;  3H0Q A;  4JYL A;  1X0U A;  4OLQ A;  5DU6 A;  1W2X A;  5KDR A;  4FJW D;  1UYR A;  1VRG A;  3TT7 A;  3ZWA A;  2F9Y B;  4HNK A;  1ON9 A;  4IZC A;  2C8T A;  2A81 A;  3R9T A;  3TV5 A;  3K50 A;  3ZW9 A;  4MOU A;  2J5I B;  3TLF A;  1XNY A;  3KTJ A;  1OD4 A;  4QFE A;  4LK5 A;  3KTI A;  1N6D A;  4EMM A;  2A7K A;  2VSS F;  4L6W A;  3T88 A;  4K2N A;  2PBP A;  3TVU A;  2BZR A;  2J5G D;  5E0S H;  4Z0M A;  4U0G H;  4JOT A;  3QYR A;  2VSU C;  4JCT A;  3V5E A;  4FND A;  2IEX A;  4FNB A;  4B3J A;  1WDM A;  4MI2 A;  2D3T A;  4GHN A;  2J5I A;  3GF3 A;  2WTB A;  4ZDE A;  5INI A;  1UYS A;  3T89 A;  1FC6 A;  3R0O A;  1PIX A;  4JVT A;  3H0U A;  5JBX A;  4OMR A;  2QQ3 A;  2FZS A;  3T8A A;  3MYB A;  4JCS A;  3QRE A;  1DUB A;  2ZL3 A;  1Q51 A;  1OD2 A;  3LKE A;  3KTG A;  1HNO A;  3QMJ A;  4U0H A;  5HUQ A;  3DJA A;  3H0S A;  3PZK A;  5CTC A;  3MOY A;  3R6H A;  4FB8 A;  1UIY A;  4JYJ A;  2YJG A;  4JCR A;  3K8X A;  1EF9 A;  1HNU A;  3FDU A;  2VRE A;  1TYF A;  1FCF A;  3U9T B;  1DCI A;  4K29 A;  4NEK A;  2GTR A;  3GLM A;  4QII A;  4RYF A;  4KNP A;  2F9I B;  5KDR B;  4JCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...