2CE9A

A wrpw peptide bound to the groucho-tle wd40 domain.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
337
structure length
337
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
total genus 84
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce9A00
3PVUB 3I89A 4LG8A 4O9DA 2PM9B 3ODTA 3JRPA 4FA9D 1GXRA 3PXSD 2QXVA 2J56H 5KDOB 3UVKA 1PEVA 4ERYA 3NVXA 3NVNA 3ZWLB 2P9SC 3IIWA 5I5MA 2HESX 5C9ZB 3A0FA 1XHMA 5AFU3 3IJ1A 4JSXC 1R5MA 4PSXB 2YB8B 5JWZA 3JZGA 3L4OD 4GGAA 4YVDA 3PXWD 1N6EA 4LG9A 5TEFA 4GM8A 3W15A 2XL3A 3EI2B 2P9NC 3I7NA 2GNQA 4J79A 3UVLA 4FAND 3AL8A 4ZOYA 5HE1B 4A09A 3SLED 4QRJA 4BH6A 4FA4D 4FWWA 2HKRA 4E54B 1L0QA 3RRMC 2B5LA 4GQ1A 4A2LA 4ES0A 3I7KA 4PXWA 3BG1A 3L4MD 1OMWB 2YBAA 4TZ4A 4N14A 4R7AB 3SBRA 1PI6A 3OKYB 3V9FA 5AMSA 4I79A 2QC5A 3SMRA 5FLXg 3CFSB 2IURA 4BL0A 5EM2B 5THAA 5EMMB 4QL1A 4ERZA 2HJBA 3DXMC 2H6NA 4ZN4A 3MKQA 4A11A 5IJ7E 1SHYB 3AFCA 2B5NA 5B4WA 4A08B 3JB9L 5IC7A 3F3GA 1K8KC 3OKWA 4H5IA 3EI1B 3EI1A 2Z2OA 4AOWA 1YFQA 1FWXA 2CO0C 5I5IA 2H3XA 1PGUA 1JMZB 3MXXA 4CY5A 3EI3A 2OVQB 3EI3B 2IUQA 5CYKA 1P22A 5HYNB 3JAMg 1B9YA 3I7LA 2AH0A 2PBIB 3MZLA 4GQBB 3RMZD 4X63B 4Y7RA 3EI4A 2P9KC 3VH0A 2OK4A 3I7PA 5HE3B 5FKRA 2GC7A 3UR4A 4A0AA 5K19A 2Z2PA 4PBZA 3SN6B 3J81g 4X3EA 4U7AA 3UKUC 2H9MA 3F3FA 2H14A 4JXMA 5FA5B 4A0AB 4A2MA 2AGZA 4ESGA 3B7FA 3BG0A 2IUVA 4E54A 3I8EA 3RSEC 3E0CA 2H9LA 2IWFA 1SQJA 4JT6C 3AL8B 3OL2A 1A0RB 3C75H 2GC4A 5EMLB 2HXCA 5CXCA 3KRXB 3EU7A 4J0WA 5TEEA 4L1QD 4U1EI 3DXKC 2CN2A 5FXYA 4CI3A 5HE0B 1B9XA 2G9AA 5C2VB 3CFVA 3C5MA 4FA5D 5H17A 5CXBB 2H6KA 2B4EA 2AQ5A 2J57G 3ULEC 5GSAA 2AGWA 5IGQA 5IJ8E 2H68A 3AL9A 3SCYA 5IGOA 4FHLA 4GMBA 3EMHA 3SBQA 5EAPA 4PSWB 4CZVA 3SXTD 3SBPA 4O45A 2I3TA 3MMYA 5A2Qg 4J78A 1QNIA 5FKQA 4J87A 2J55H 2YNNA 4JT5C 5SXMA 2OJYA 4J86A 3ORVD 3UVNA 1TYQC 4O3UB 4XYHA 5EALA 3SFZA 4EWRA 4Z8LA 4X60B 2H6QA 4JSPC 1RI6A 3I7HA 3RFGA 3EG6A 4E5ZA 4CC9A 1TBGA 4JD2C 4J0XA 5H14A 4L9OA 4FA1D 2CO0A 3N0EA 4CY2A 2MTAH 3UKRC 1JMXB 3OW8A 1N6DA 3EI2A 2B5MA 3SJLD 5HQGA 4Y5RD 3K26A 1JOFA 2HJ4A 3VGZA 1GG2B 2EBSA 3SHFA 5EMJB 3VA6A 3FRXA 5I5JA 2HKMA 5HE2B 2AH1A 4A0BA 4J81A 4CI8A 4GM3A 4GQ2P 1GOTB 1VYHC 2P9IC 3RN0D 3GFCA 5EMKB 5FQDA 2CNXA 2I3SA 1XIPA 4PC0A 2XU7A 3HFQA 3NVQA 1S4UX 2AGYA 5CYKB 3V7DB 3PXTD 3EI4B 3FM0A 4QQEA 2XYIA 4AEZA 4XYIA 2H9NA 4FB1D 4K3ID 1U4CA 1PBYB 3DSMA 4J8BA 2IUPA 2O9KA 4CZXA 1XKSA 4PNKB 2P9LC 4L3GD 5EAMA 3DWLC 4ZOXA 4QT8A 4L3HD 4J82A 3SVWD 3EWEA 3CIKB 5FKSA 2I0TA 3F3PA 3IJ0A 4J73A 3PSCB 5EM2A 2UZYB 4GM9A 2HYEA 2H13A 4ZOZA 4XEIC 2PM6B 4MK0B 1K32A 4JSVC 3C99A 4H5JA 4J84A 4IA9A 3IKOA 4JSNC 3RFHA 1NEXB 3OKYA 5H1MA 4A11B 1Q47A 2P9UC 4OWRA 5GXHA 1MG2A 3UVMA 3FGBA 4IMMA 3I7OA 5FKTA 3K27A 3JROA 2CN3A 4G56B 4KFMB 4CI2A 3PVWB 5EARA 3U4YA 2PM7B 4O3TB 2P9PC 4CI1A 2IWKA 2OK6A 4GGCA 5AJAA 2BCJB 2OVRB 2OVPB 3GREA 3C9CA 1JJUB 2G99A 4D0KA 4A08A 3P4FA 4O1QD 5K1CC 4A7JA 3PSLA 3JPXA 4LGNA 4J8GA 3IIYA 5GXIA 2YNOA 4E5ZB 2YMUA 3DM0A 4FAVD 2YNPA 4A09B 3I2NA 4CY3A 3SWSD 2IAAA 5C2WB 2UZXB 1N6FA 3OKTA 3I8CA 3J80g 2H9PA 2PM9A 2TRCB 3OTTA 2CE9A 3IJCA 3PE7A 4GGDA 2OIZA 4X61B 4BUJC 3N0DA 3RLMD 4ZOVA 2I0RA 3BWSA 4GZ8A 3KRWB 5TDHB 3MKSB 3JZHA 4J77A 3OL2B 4NSXA 3V5WB 5GMKn 3RN1D 1MDAH 4CZYA 2Q7QA 3MZKA 2I0SA 5CXBA 2H47A 1U2VC 2XL2A 4OZUA 5CXCB 3UVOA 5TF2A 2AGXA 1ERJA 4CY1A 5IT9g 4D6VA 2AGLA 4PBYA 1MG3A 2BBKH 1SQ9A 4A0BB 3JZNA 4UI9R 2W18A 3AH8B 1OLZA 4HDJA 1GP2B 4ERQA 2Z2NA 1NR0A 2CE8A 4K3JB
chains in the Genus database with same CATH superfamily
3PVUB 3I89A 2VDMA 4LG8A 4O9DA 1JTDB 4AX4A 2PM9B 3ODTA 3JRPA 4NC4A 4FA9D 1GXRA 3PXSD 2QXVA 2J56H 5KDOB 3UVKA 1PEVA 4ERYA 2VZ3A 5HDBA 3NVXA 3NVNA 3ZWLB 2P9SC 5E6SA 3IIWA 5I5MA 2HESX 5C9ZB 3A0FA 1XHMA 5AFU3 4DNUA 4L1MA 3IJ1A 4JSXC 1R5MA 4PSXB 2YB8B 3IJEA 5JWZA 4G1EA 3JZGA 3L4OD 4GGAA 4YVDA 3PXWD 1N6EA 4LG9A 5TEFA 4GM8A 3W15A 2XL3A 4MMYA 3EI2B 2P9NC 3I7NA 2JKXA 2GNQA 4J79A 3UVLA 4FAND 4NENA 3AL8A 4ZOYA 5HE1B 4A09A 3SLED 4QRJA 4WK0A 4BH6A 4FA4D 4FWWA 2HKRA 4E54B 1U8CA 1L0QA 3V4PA 3RRMC 2B5LA 4GQ1A 4NBMA 4A2LA 4ES0A 3I7KA 4PXWA 4RE5A 3ZE2A 3BG1A 1H2YA 4WK4A 3L4MD 3IUMA 1OMWB 2EIBA 4AMYA 2YBAA 4TZ4A 4N14A 5M5RA 4R7AB 3SBRA 1PI6A 3OKYB 4Z7QA 3V9FA 5AMSA 4I79A 2QC5A 3SMRA 3O4IA 5FLXg 3CFSB 3IURA 2IURA 4BL0A 5EM2B 5THAA 2HU7A 3EQ7A 5EMMB 3ZE1A 4QL1A 1QFSA 3QHYB 4ERZA 2HJBA 3DXMC 4DNVA 2H6NA 4ZN4A 3MKQA 4A11A 5IJ7E 4RE6A 3V4VA 1SHYB 3AFCA 1E8MA 2B5NA 5B4WA 4A08B 3JB9L 5IC7A 3F3GA 1K8KC 3OKWA 4H5IA 2VDNA 3EI1B 3EI1A 2Z2OA 2XE4A 4AOWA 1YFQA 1FWXA 2CO0C 2QR5A 5I5IA 2H3XA 1PGUA 1JMZB 3MXXA 4CY5A 2VZ1A 3EI3A 2OVQB 3EI3B 3MVDK 2IUQA 1P22A 2XDWA 5CYKA 5HYNB 3JAMg 1B9YA 3I7LA 2AH0A 2PBIB 4QAMA 3MZLA 4GQBB 1T2XA 4X63B 3RMZD 4Y7RA 3EI4A 1M1XA 1I2MB 2P9KC 3VH0A 5C92A 2OK4A 3I7PA 4O02A 5HE3B 5FKRA 2GC7A 3UR4A 4A0AA 5K19A 2Z2PA 4PBZA 3SN6B 3J81g 4X3EA 4BCCA 4U7AA 3UKUC 4JHNA 2H9MA 3F3FA 2H14A 4JXMA 1GOHA 5FA5B 4BCBA 4A0AB 4JHPC 2AGZA 4A2MA 4ESGA 3B7FA 3BG0A 2IUVA 4E54A 3I8EA 3RSEC 3E0CA 5M61A 2H9LA 2IWFA 1SQJA 4JT6C 3AL8B 3OL2A 1A0RB 3C75H 2GC4A 5EMLB 2HXCA 1BPOA 5CXCA 3KRXB 2QZPA 3EU7A 4J0WA 5TEEA 4L1QD 4U1EI 3OF7A 3DXKC 1UTCA 2CN2A 3O4HA 5FXYA 4G1MA 4CI3A 5HE0B 1B9XA 2G9AA 5C2VB 3CFVA 3C5MA 4FA5D 5H17A 4IRZA 5CXBB 2H6KA 2B4EA 2AQ5A 2J57G 3ULEC 5GSAA 2AGWA 3K72A 5IGQA 5IJ8E 3NIGA 2H68A 3AL9A 3SCYA 5IGOA 4FHLA 4GMBA 3EMHA 3SBQA 5EAPA 4PSWB 1UOQA 4CZVA 3MUNA 5C86A 3SXTD 3GD1I 5M5SA 3SBPA 4O45A 2I3TA 3MMYA 5A2Qg 4J78A 1QNIA 3MUOA 5FKQA 4J87A 2J55H 2YNNA 4JT5C 5SXMA 2OJYA 4J86A 3ORVD 1E8NA 1O6FA 3UVNA 5FFOA 1TYQC 3T3PA 4O3UB 4XYHA 5EALA 3SFZA 4EWRA 4Z8LA 1TYEA 4X60B 5E6RA 2H6QA 4JSPC 3T3MA 1RI6A 3IUJA 3I7HA 3RFGA 3EG6A 4E5ZA 4CC9A 1TBGA 4JD2C 4J0XA 3ZDYA 3DDUA 5H14A 4L9OA 4FA1D 2CO0A 3N0EA 4CY2A 2MTAH 3UKRC 1JMXB 3OW8A 3IULA 1N6DA 3EI2A 1GOGA 2B5MA 3NIDA 3O4GA 3QI0A 2VDOA 5HQGA 3SJLD 4Y5RD 3K26A 1JOFA 2HJ4A 1VE6A 3VGZA 1GG2B 4WK2A 2EBSA 3SHFA 5EMJB 3VA6A 5FFGA 3O4JA 4Z7NA 3FRXA 5I5JA 2HKMA 1L5GA 5HE2B 2AH1A 4A0BA 4J81A 4CI8A 4GM3A 4GQ2P 1GOTB 1C9LA 1VYHC 2EIEA 2P9IC 3RN0D 3GFCA 5EMKB 1QFMA 4UM9A 2CNXA 2I3SA 3EQ8A 5FQDA 1XIPA 4PC0A 2HU5A 4D9SA 2XU7A 3HFQA 3NVQA 1S4UX 2AGYA 5CYKB 3V7DB 4AMZA 3PXTD 4AN0A 3EI4B 1JV2A 3FM0A 1H2XA 4QQEA 2XYIA 4AEZA 4XYIA 3ZE0A 2H9NA 1K3IA 4FB1D 3K71A 4K3ID 1U4CA 4BCDA 1VE7A 1PBYB 3VI4A 3DSMA 4J8BA 2IUPA 2O9KA 1C9IA 1XKSA 3FCSA 4PNKB 4CZXA 2P9LC 2VDQA 3ZDZA 4L3GD 4Z7OA 5EAMA 4MMXA 3DWLC 3NIFA 4ZOXA 4QT8A 4L3HD 4BP9A 4J82A 3SVWD 3EWEA 3IUQA 3CIKB 5FKSA 1UOOA 2I0TA 3F3PA 1VZ2A 3IJ0A 4J73A 3PSCB 5EM2A 2UZYB 4GM9A 2HYEA 2H13A 4ZOZA 4XEIC 2PM6B 4MK0B 4BP8A 1K32A 4JSVC 3C99A 2BKLA 4H5JA 4J84A 4IA9A 3IKOA 4JSNC 3RFHA 1NEXB 3OKYA 5H1MA 4A11B 1Q47A 2P9UC 1A12A 4OWRA 5GXHA 1YR2A 1MG2A 5M5VA 3UVMA 3FCUA 3FGBA 4IMMA 3I7OA 5FKTA 3K27A 4G55A 3JROA 2CN3A 4G56B 4KFMB 4CI2A 3PVWB 5EARA 3VI3A 3U4YA 4WJKA 2PM7B 4O3TB 2P9PC 3K6SA 2VDLA 4CI1A 2IWKA 2XZGA 2OK6A 4GGCA 5AJAA 2BCJB 2OVRB 4AN1A 2OVPB 3GREA 3C9CA 1JJUB 1VZ3A 4MMZA 3KCIA 2G99A 4D0KA 4A08A 3P4FA 2EICA 4O1QD 5K1CC 1E5TA 4A7JA 2WQ8A 3PSLA 3JPXA 4LGNA 4J8GA 4UM8A 3IIYA 3GC3B 5M5UA 5GXIA 2YNOA 4E5ZB 5M5TA 2YMUA 3DM0A 4FAVD 2VDRA 2YNPA 4A09B 3I2NA 4CY3A 3SWSD 2IAAA 5C2WB 2UZXB 1N6FA 2VC2A 3OKTA 3I8CA 3J80g 2H9PA 2PM9A 2TRCB 1O6GA 3OTTA 2CE9A 3IJCA 2HU8A 3PE7A 4GGDA 2OIZA 1UOPA 4X61B 3IVMA 2VDKA 4BUJC 3N0DA 3RLMD 4ZOVA 2I0RA 3BWSA 4GZ8A 3KRWB 5TDHB 3EQ9A 3MKSB 3JZHA 1GOFA 4J77A 4NAAA 3IUNA 3OL2B 4NSXA 3V5WB 5GMKn 3RN1D 1MDAH 5E6UA 4CZYA 2VDPA 2Q7QA 3MZKA 2I0SA 5CXBA 2H47A 1U2VC 2EIDA 2XL2A 4OZUA 5CXCB 3UVOA 5TF2A 2AGXA 1ERJA 1H2ZA 4CY1A 4O2WA 5IT9g 4D6VA 2AGLA 4PBYA 1MG3A 2BBKH 1SQ9A 4A0BB 1H2WA 3JZNA 4DNWA 4UI9R 2W18A 3AH8B 1OLZA 4HDJA 1GP2B 4ERQA 2Z2NA 3ZDXA 1NR0A 2CE8A 4K3JB
chains in the Genus database with same CATH topology
3PVUB 3I89A 4LG8A 4O9DA 2PM9B 3ODTA 3JRPA 4FA9D 1GXRA 3PXSD 2QXVA 2J56H 5KDOB 3UVKA 1PEVA 4ERYA 3NVXA 3NVNA 3ZWLB 2P9SC 3IIWA 5I5MA 2HESX 5C9ZB 3A0FA 1XHMA 5AFU3 3IJ1A 4JSXC 1R5MA 4PSXB 2YB8B 5JWZA 3JZGA 3L4OD 4GGAA 4YVDA 3PXWD 1N6EA 4LG9A 5TEFA 4GM8A 3W15A 2XL3A 3EI2B 2P9NC 3I7NA 2GNQA 4J79A 3UVLA 4FAND 3AL8A 4ZOYA 5HE1B 4A09A 3SLED 4QRJA 4BH6A 4FA4D 4FWWA 2HKRA 4E54B 1L0QA 3RRMC 2B5LA 4GQ1A 4A2LA 4ES0A 3I7KA 4PXWA 3BG1A 3L4MD 1OMWB 2YBAA 4TZ4A 4N14A 4R7AB 3SBRA 1PI6A 3OKYB 3V9FA 5AMSA 4I79A 2QC5A 3SMRA 5FLXg 3CFSB 2IURA 4BL0A 5EM2B 5THAA 5EMMB 4QL1A 4ERZA 2HJBA 3DXMC 2H6NA 4ZN4A 3MKQA 4A11A 5IJ7E 1SHYB 3AFCA 2B5NA 5B4WA 4A08B 3JB9L 5IC7A 3F3GA 1K8KC 3OKWA 4H5IA 3EI1B 3EI1A 2Z2OA 4AOWA 1YFQA 1FWXA 2CO0C 5I5IA 2H3XA 1PGUA 1JMZB 3MXXA 4CY5A 3EI3A 2OVQB 3EI3B 2IUQA 5CYKA 1P22A 5HYNB 3JAMg 1B9YA 3I7LA 2AH0A 2PBIB 3MZLA 4GQBB 3RMZD 4X63B 4Y7RA 3EI4A 2P9KC 3VH0A 2OK4A 3I7PA 5HE3B 5FKRA 2GC7A 3UR4A 4A0AA 5K19A 2Z2PA 4PBZA 3SN6B 3J81g 4X3EA 4U7AA 3UKUC 2H9MA 3F3FA 2H14A 4JXMA 5FA5B 4A0AB 4A2MA 2AGZA 4ESGA 3B7FA 3BG0A 2IUVA 4E54A 3I8EA 3RSEC 3E0CA 2H9LA 2IWFA 1SQJA 4JT6C 3AL8B 3OL2A 1A0RB 3C75H 2GC4A 5EMLB 2HXCA 5CXCA 3KRXB 3EU7A 4J0WA 5TEEA 4L1QD 4U1EI 3DXKC 2CN2A 5FXYA 4CI3A 5HE0B 1B9XA 2G9AA 5C2VB 3CFVA 3C5MA 4FA5D 5H17A 5CXBB 2H6KA 2B4EA 2AQ5A 2J57G 3ULEC 5GSAA 2AGWA 5IGQA 5IJ8E 2H68A 3AL9A 3SCYA 5IGOA 4FHLA 4GMBA 3EMHA 3SBQA 5EAPA 4PSWB 4CZVA 3SXTD 3SBPA 4O45A 2I3TA 3MMYA 5A2Qg 4J78A 1QNIA 5FKQA 4J87A 2J55H 2YNNA 4JT5C 5SXMA 2OJYA 4J86A 3ORVD 3UVNA 1TYQC 4O3UB 4XYHA 5EALA 3SFZA 4EWRA 4Z8LA 4X60B 2H6QA 4JSPC 1RI6A 3I7HA 3RFGA 3EG6A 4E5ZA 4CC9A 1TBGA 4JD2C 4J0XA 5H14A 4L9OA 4FA1D 2CO0A 3N0EA 4CY2A 2MTAH 3UKRC 1JMXB 3OW8A 1N6DA 3EI2A 2B5MA 3SJLD 5HQGA 4Y5RD 3K26A 1JOFA 2HJ4A 3VGZA 1GG2B 2EBSA 3SHFA 5EMJB 3VA6A 3FRXA 5I5JA 2HKMA 5HE2B 2AH1A 4A0BA 4J81A 4CI8A 4GM3A 4GQ2P 1GOTB 1VYHC 2P9IC 3RN0D 3GFCA 5EMKB 5FQDA 2CNXA 2I3SA 1XIPA 4PC0A 2XU7A 3HFQA 3NVQA 1S4UX 2AGYA 5CYKB 3V7DB 3PXTD 3EI4B 3FM0A 4QQEA 2XYIA 4AEZA 4XYIA 2H9NA 4FB1D 4K3ID 1U4CA 1PBYB 3DSMA 4J8BA 2IUPA 2O9KA 4CZXA 1XKSA 4PNKB 2P9LC 4L3GD 5EAMA 3DWLC 4ZOXA 4QT8A 4L3HD 4J82A 3SVWD 3EWEA 3CIKB 5FKSA 2I0TA 3F3PA 3IJ0A 4J73A 3PSCB 5EM2A 2UZYB 4GM9A 2HYEA 2H13A 4ZOZA 4XEIC 2PM6B 4MK0B 1K32A 4JSVC 3C99A 4H5JA 4J84A 4IA9A 3IKOA 4JSNC 3RFHA 1NEXB 3OKYA 5H1MA 4A11B 1Q47A 2P9UC 4OWRA 5GXHA 1MG2A 3UVMA 3FGBA 4IMMA 3I7OA 5FKTA 3K27A 3JROA 2CN3A 4G56B 4KFMB 4CI2A 3PVWB 5EARA 3U4YA 2PM7B 4O3TB 2P9PC 4CI1A 2IWKA 2OK6A 4GGCA 5AJAA 2BCJB 2OVRB 2OVPB 3GREA 3C9CA 1JJUB 2G99A 4D0KA 4A08A 3P4FA 4O1QD 5K1CC 4A7JA 3PSLA 3JPXA 4LGNA 4J8GA 3IIYA 5GXIA 2YNOA 4E5ZB 2YMUA 3DM0A 4FAVD 2YNPA 4A09B 3I2NA 4CY3A 3SWSD 2IAAA 5C2WB 2UZXB 1N6FA 3OKTA 3I8CA 3J80g 2H9PA 2PM9A 2TRCB 3OTTA 2CE9A 3IJCA 3PE7A 4GGDA 2OIZA 4X61B 4BUJC 3N0DA 3RLMD 4ZOVA 2I0RA 3BWSA 4GZ8A 3KRWB 5TDHB 3MKSB 3JZHA 4J77A 3OL2B 4NSXA 3V5WB 5GMKn 3RN1D 1MDAH 4CZYA 2Q7QA 3MZKA 2I0SA 5CXBA 2H47A 1U2VC 2XL2A 4OZUA 5CXCB 3UVOA 5TF2A 2AGXA 1ERJA 4CY1A 5IT9g 4D6VA 2AGLA 4PBYA 1MG3A 2BBKH 1SQ9A 4A0BB 3JZNA 4UI9R 2W18A 3AH8B 1OLZA 4HDJA 1GP2B 4ERQA 2Z2NA 1NR0A 2CE8A 4K3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU B;  3I89 A;  4LG8 A;  4O9D A;  2PM9 B;  3ODT A;  3JRP A;  4FA9 D;  1GXR A;  3PXS D;  2QXV A;  2J56 H;  5KDO B;  3UVK A;  1PEV A;  4ERY A;  3NVX A;  3NVN A;  3ZWL B;  2P9S C;  3IIW A;  5I5M A;  2HES X;  5C9Z B;  3A0F A;  1XHM A;  5AFU 3;  3IJ1 A;  4JSX C;  1R5M A;  4PSX B;  2YB8 B;  5JWZ A;  3JZG A;  3L4O D;  4GGA A;  4YVD A;  3PXW D;  1N6E A;  4LG9 A;  5TEF A;  4GM8 A;  3W15 A;  2XL3 A;  3EI2 B;  2P9N C;  3I7N A;  2GNQ A;  4J79 A;  3UVL A;  4FAN D;  3AL8 A;  4ZOY A;  5HE1 B;  4A09 A;  3SLE D;  4QRJ A;  4BH6 A;  4FA4 D;  4FWW A;  2HKR A;  4E54 B;  1L0Q A;  3RRM C;  2B5L A;  4GQ1 A;  4A2L A;  4ES0 A;  3I7K A;  4PXW A;  3BG1 A;  3L4M D;  1OMW B;  2YBA A;  4TZ4 A;  4N14 A;  4R7A B;  3SBR A;  1PI6 A;  3OKY B;  3V9F A;  5AMS A;  4I79 A;  2QC5 A;  3SMR A;  5FLX g;  3CFS B;  2IUR A;  4BL0 A;  5EM2 B;  5THA A;  5EMM B;  4QL1 A;  4ERZ A;  2HJB A;  3DXM C;  2H6N A;  4ZN4 A;  3MKQ A;  4A11 A;  5IJ7 E;  1SHY B;  3AFC A;  2B5N A;  5B4W A;  4A08 B;  3JB9 L;  5IC7 A;  3F3G A;  1K8K C;  3OKW A;  4H5I A;  3EI1 B;  3EI1 A;  2Z2O A;  4AOW A;  1YFQ A;  1FWX A;  2CO0 C;  5I5I A;  2H3X A;  1PGU A;  1JMZ B;  3MXX A;  4CY5 A;  3EI3 A;  2OVQ B;  3EI3 B;  2IUQ A;  5CYK A;  1P22 A;  5HYN B;  3JAM g;  1B9Y A;  3I7L A;  2AH0 A;  2PBI B;  3MZL A;  4GQB B;  3RMZ D;  4X63 B;  4Y7R A;  3EI4 A;  2P9K C;  3VH0 A;  2OK4 A;  3I7P A;  5HE3 B;  5FKR A;  2GC7 A;  3UR4 A;  4A0A A;  5K19 A;  2Z2P A;  4PBZ A;  3SN6 B;  3J81 g;  4X3E A;  4U7A A;  3UKU C;  2H9M A;  3F3F A;  2H14 A;  4JXM A;  5FA5 B;  4A0A B;  4A2M A;  2AGZ A;  4ESG A;  3B7F A;  3BG0 A;  2IUV A;  4E54 A;  3I8E A;  3RSE C;  3E0C A;  2H9L A;  2IWF A;  1SQJ A;  4JT6 C;  3AL8 B;  3OL2 A;  1A0R B;  3C75 H;  2GC4 A;  5EML B;  2HXC A;  5CXC A;  3KRX B;  3EU7 A;  4J0W A;  5TEE A;  4L1Q D;  4U1E I;  3DXK C;  2CN2 A;  5FXY A;  4CI3 A;  5HE0 B;  1B9X A;  2G9A A;  5C2V B;  3CFV A;  3C5M A;  4FA5 D;  5H17 A;  5CXB B;  2H6K A;  2B4E A;  2AQ5 A;  2J57 G;  3ULE C;  5GSA A;  2AGW A;  5IGQ A;  5IJ8 E;  2H68 A;  3AL9 A;  3SCY A;  5IGO A;  4FHL A;  4GMB A;  3EMH A;  3SBQ A;  5EAP A;  4PSW B;  4CZV A;  3SXT D;  3SBP A;  4O45 A;  2I3T A;  3MMY A;  5A2Q g;  4J78 A;  1QNI A;  5FKQ A;  4J87 A;  2J55 H;  2YNN A;  4JT5 C;  5SXM A;  2OJY A;  4J86 A;  3ORV D;  3UVN A;  1TYQ C;  4O3U B;  4XYH A;  5EAL A;  3SFZ A;  4EWR A;  4Z8L A;  4X60 B;  2H6Q A;  4JSP C;  1RI6 A;  3I7H A;  3RFG A;  3EG6 A;  4E5Z A;  4CC9 A;  1TBG A;  4JD2 C;  4J0X A;  5H14 A;  4L9O A;  4FA1 D;  2CO0 A;  3N0E A;  4CY2 A;  2MTA H;  3UKR C;  1JMX B;  3OW8 A;  1N6D A;  3EI2 A;  2B5M A;  3SJL D;  5HQG A;  4Y5R D;  3K26 A;  1JOF A;  2HJ4 A;  3VGZ A;  1GG2 B;  2EBS A;  3SHF A;  5EMJ B;  3VA6 A;  3FRX A;  5I5J A;  2HKM A;  5HE2 B;  2AH1 A;  4A0B A;  4J81 A;  4CI8 A;  4GM3 A;  4GQ2 P;  1GOT B;  1VYH C;  2P9I C;  3RN0 D;  3GFC A;  5EMK B;  5FQD A;  2CNX A;  2I3S A;  1XIP A;  4PC0 A;  2XU7 A;  3HFQ A;  3NVQ A;  1S4U X;  2AGY A;  5CYK B;  3V7D B;  3PXT D;  3EI4 B;  3FM0 A;  4QQE A;  2XYI A;  4AEZ A;  4XYI A;  2H9N A;  4FB1 D;  4K3I D;  1U4C A;  1PBY B;  3DSM A;  4J8B A;  2IUP A;  2O9K A;  4CZX A;  1XKS A;  4PNK B;  2P9L C;  4L3G D;  5EAM A;  3DWL C;  4ZOX A;  4QT8 A;  4L3H D;  4J82 A;  3SVW D;  3EWE A;  3CIK B;  5FKS A;  2I0T A;  3F3P A;  3IJ0 A;  4J73 A;  3PSC B;  5EM2 A;  2UZY B;  4GM9 A;  2HYE A;  2H13 A;  4ZOZ A;  4XEI C;  2PM6 B;  4MK0 B;  1K32 A;  4JSV C;  3C99 A;  4H5J A;  4J84 A;  4IA9 A;  3IKO A;  4JSN C;  3RFH A;  1NEX B;  3OKY A;  5H1M A;  4A11 B;  1Q47 A;  2P9U C;  4OWR A;  5GXH A;  1MG2 A;  3UVM A;  3FGB A;  4IMM A;  3I7O A;  5FKT A;  3K27 A;  3JRO A;  2CN3 A;  4G56 B;  4KFM B;  4CI2 A;  3PVW B;  5EAR A;  3U4Y A;  2PM7 B;  4O3T B;  2P9P C;  4CI1 A;  2IWK A;  2OK6 A;  4GGC A;  5AJA A;  2BCJ B;  2OVR B;  2OVP B;  3GRE A;  3C9C A;  1JJU B;  2G99 A;  4D0K A;  4A08 A;  3P4F A;  4O1Q D;  5K1C C;  4A7J A;  3PSL A;  3JPX A;  4LGN A;  4J8G A;  3IIY A;  5GXI A;  2YNO A;  4E5Z B;  2YMU A;  3DM0 A;  4FAV D;  2YNP A;  4A09 B;  3I2N A;  4CY3 A;  3SWS D;  2IAA A;  5C2W B;  2UZX B;  1N6F A;  3OKT A;  3I8C A;  3J80 g;  2H9P A;  2PM9 A;  2TRC B;  3OTT A;  2CE9 A;  3IJC A;  3PE7 A;  4GGD A;  2OIZ A;  4X61 B;  4BUJ C;  3N0D A;  3RLM D;  4ZOV A;  2I0R A;  3BWS A;  4GZ8 A;  3KRW B;  5TDH B;  3MKS B;  3JZH A;  4J77 A;  3OL2 B;  4NSX A;  3V5W B;  5GMK n;  3RN1 D;  1MDA H;  4CZY A;  2Q7Q A;  3MZK A;  2I0S A;  5CXB A;  2H47 A;  1U2V C;  2XL2 A;  4OZU A;  5CXC B;  3UVO A;  5TF2 A;  2AGX A;  1ERJ A;  4CY1 A;  5IT9 g;  4D6V A;  2AGL A;  4PBY A;  1MG3 A;  2BBK H;  1SQ9 A;  4A0B B;  3JZN A;  4UI9 R;  2W18 A;  3AH8 B;  1OLZ A;  4HDJ A;  1GP2 B;  4ERQ A;  2Z2N A;  1NR0 A;  2CE8 A;  4K3J B; 
#chains in the Genus database with same CATH topology
 3PVU B;  3I89 A;  2VDM A;  4LG8 A;  4O9D A;  1JTD B;  4AX4 A;  2PM9 B;  3ODT A;  3JRP A;  4NC4 A;  4FA9 D;  1GXR A;  3PXS D;  2QXV A;  2J56 H;  5KDO B;  3UVK A;  1PEV A;  4ERY A;  2VZ3 A;  5HDB A;  3NVX A;  3NVN A;  3ZWL B;  2P9S C;  5E6S A;  3IIW A;  5I5M A;  2HES X;  5C9Z B;  3A0F A;  1XHM A;  5AFU 3;  4DNU A;  4L1M A;  3IJ1 A;  4JSX C;  1R5M A;  4PSX B;  2YB8 B;  3IJE A;  5JWZ A;  4G1E A;  3JZG A;  3L4O D;  4GGA A;  4YVD A;  3PXW D;  1N6E A;  4LG9 A;  5TEF A;  4GM8 A;  3W15 A;  2XL3 A;  4MMY A;  3EI2 B;  2P9N C;  3I7N A;  2JKX A;  2GNQ A;  4J79 A;  3UVL A;  4FAN D;  4NEN A;  3AL8 A;  4ZOY A;  5HE1 B;  4A09 A;  3SLE D;  4QRJ A;  4WK0 A;  4BH6 A;  4FA4 D;  4FWW A;  2HKR A;  4E54 B;  1U8C A;  1L0Q A;  3V4P A;  3RRM C;  2B5L A;  4GQ1 A;  4NBM A;  4A2L A;  4ES0 A;  3I7K A;  4PXW A;  4RE5 A;  3ZE2 A;  3BG1 A;  1H2Y A;  4WK4 A;  3L4M D;  3IUM A;  1OMW B;  2EIB A;  4AMY A;  2YBA A;  4TZ4 A;  4N14 A;  5M5R A;  4R7A B;  3SBR A;  1PI6 A;  3OKY B;  4Z7Q A;  3V9F A;  5AMS A;  4I79 A;  2QC5 A;  3SMR A;  3O4I A;  5FLX g;  3CFS B;  3IUR A;  2IUR A;  4BL0 A;  5EM2 B;  5THA A;  2HU7 A;  3EQ7 A;  5EMM B;  3ZE1 A;  4QL1 A;  1QFS A;  3QHY B;  4ERZ A;  2HJB A;  3DXM C;  4DNV A;  2H6N A;  4ZN4 A;  3MKQ A;  4A11 A;  5IJ7 E;  4RE6 A;  3V4V A;  1SHY B;  3AFC A;  1E8M A;  2B5N A;  5B4W A;  4A08 B;  3JB9 L;  5IC7 A;  3F3G A;  1K8K C;  3OKW A;  4H5I A;  2VDN A;  3EI1 B;  3EI1 A;  2Z2O A;  2XE4 A;  4AOW A;  1YFQ A;  1FWX A;  2CO0 C;  2QR5 A;  5I5I A;  2H3X A;  1PGU A;  1JMZ B;  3MXX A;  4CY5 A;  2VZ1 A;  3EI3 A;  2OVQ B;  3EI3 B;  3MVD K;  2IUQ A;  1P22 A;  2XDW A;  5CYK A;  5HYN B;  3JAM g;  1B9Y A;  3I7L A;  2AH0 A;  2PBI B;  4QAM A;  3MZL A;  4GQB B;  1T2X A;  4X63 B;  3RMZ D;  4Y7R A;  3EI4 A;  1M1X A;  1I2M B;  2P9K C;  3VH0 A;  5C92 A;  2OK4 A;  3I7P A;  4O02 A;  5HE3 B;  5FKR A;  2GC7 A;  3UR4 A;  4A0A A;  5K19 A;  2Z2P A;  4PBZ A;  3SN6 B;  3J81 g;  4X3E A;  4BCC A;  4U7A A;  3UKU C;  4JHN A;  2H9M A;  3F3F A;  2H14 A;  4JXM A;  1GOH A;  5FA5 B;  4BCB A;  4A0A B;  4JHP C;  2AGZ A;  4A2M A;  4ESG A;  3B7F A;  3BG0 A;  2IUV A;  4E54 A;  3I8E A;  3RSE C;  3E0C A;  5M61 A;  2H9L A;  2IWF A;  1SQJ A;  4JT6 C;  3AL8 B;  3OL2 A;  1A0R B;  3C75 H;  2GC4 A;  5EML B;  2HXC A;  1BPO A;  5CXC A;  3KRX B;  2QZP A;  3EU7 A;  4J0W A;  5TEE A;  4L1Q D;  4U1E I;  3OF7 A;  3DXK C;  1UTC A;  2CN2 A;  3O4H A;  5FXY A;  4G1M A;  4CI3 A;  5HE0 B;  1B9X A;  2G9A A;  5C2V B;  3CFV A;  3C5M A;  4FA5 D;  5H17 A;  4IRZ A;  5CXB B;  2H6K A;  2B4E A;  2AQ5 A;  2J57 G;  3ULE C;  5GSA A;  2AGW A;  3K72 A;  5IGQ A;  5IJ8 E;  3NIG A;  2H68 A;  3AL9 A;  3SCY A;  5IGO A;  4FHL A;  4GMB A;  3EMH A;  3SBQ A;  5EAP A;  4PSW B;  1UOQ A;  4CZV A;  3MUN A;  5C86 A;  3SXT D;  3GD1 I;  5M5S A;  3SBP A;  4O45 A;  2I3T A;  3MMY A;  5A2Q g;  4J78 A;  1QNI A;  3MUO A;  5FKQ A;  4J87 A;  2J55 H;  2YNN A;  4JT5 C;  5SXM A;  2OJY A;  4J86 A;  3ORV D;  1E8N A;  1O6F A;  3UVN A;  5FFO A;  1TYQ C;  3T3P A;  4O3U B;  4XYH A;  5EAL A;  3SFZ A;  4EWR A;  4Z8L A;  1TYE A;  4X60 B;  5E6R A;  2H6Q A;  4JSP C;  3T3M A;  1RI6 A;  3IUJ A;  3I7H A;  3RFG A;  3EG6 A;  4E5Z A;  4CC9 A;  1TBG A;  4JD2 C;  4J0X A;  3ZDY A;  3DDU A;  5H14 A;  4L9O A;  4FA1 D;  2CO0 A;  3N0E A;  4CY2 A;  2MTA H;  3UKR C;  1JMX B;  3OW8 A;  3IUL A;  1N6D A;  3EI2 A;  1GOG A;  2B5M A;  3NID A;  3O4G A;  3QI0 A;  2VDO A;  5HQG A;  3SJL D;  4Y5R D;  3K26 A;  1JOF A;  2HJ4 A;  1VE6 A;  3VGZ A;  1GG2 B;  4WK2 A;  2EBS A;  3SHF A;  5EMJ B;  3VA6 A;  5FFG A;  3O4J A;  4Z7N A;  3FRX A;  5I5J A;  2HKM A;  1L5G A;  5HE2 B;  2AH1 A;  4A0B A;  4J81 A;  4CI8 A;  4GM3 A;  4GQ2 P;  1GOT B;  1C9L A;  1VYH C;  2EIE A;  2P9I C;  3RN0 D;  3GFC A;  5EMK B;  1QFM A;  4UM9 A;  2CNX A;  2I3S A;  3EQ8 A;  5FQD A;  1XIP A;  4PC0 A;  2HU5 A;  4D9S A;  2XU7 A;  3HFQ A;  3NVQ A;  1S4U X;  2AGY A;  5CYK B;  3V7D B;  4AMZ A;  3PXT D;  4AN0 A;  3EI4 B;  1JV2 A;  3FM0 A;  1H2X A;  4QQE A;  2XYI A;  4AEZ A;  4XYI A;  3ZE0 A;  2H9N A;  1K3I A;  4FB1 D;  3K71 A;  4K3I D;  1U4C A;  4BCD A;  1VE7 A;  1PBY B;  3VI4 A;  3DSM A;  4J8B A;  2IUP A;  2O9K A;  1C9I A;  1XKS A;  3FCS A;  4PNK B;  4CZX A;  2P9L C;  2VDQ A;  3ZDZ A;  4L3G D;  4Z7O A;  5EAM A;  4MMX A;  3DWL C;  3NIF A;  4ZOX A;  4QT8 A;  4L3H D;  4BP9 A;  4J82 A;  3SVW D;  3EWE A;  3IUQ A;  3CIK B;  5FKS A;  1UOO A;  2I0T A;  3F3P A;  1VZ2 A;  3IJ0 A;  4J73 A;  3PSC B;  5EM2 A;  2UZY B;  4GM9 A;  2HYE A;  2H13 A;  4ZOZ A;  4XEI C;  2PM6 B;  4MK0 B;  4BP8 A;  1K32 A;  4JSV C;  3C99 A;  2BKL A;  4H5J A;  4J84 A;  4IA9 A;  3IKO A;  4JSN C;  3RFH A;  1NEX B;  3OKY A;  5H1M A;  4A11 B;  1Q47 A;  2P9U C;  1A12 A;  4OWR A;  5GXH A;  1YR2 A;  1MG2 A;  5M5V A;  3UVM A;  3FCU A;  3FGB A;  4IMM A;  3I7O A;  5FKT A;  3K27 A;  4G55 A;  3JRO A;  2CN3 A;  4G56 B;  4KFM B;  4CI2 A;  3PVW B;  5EAR A;  3VI3 A;  3U4Y A;  4WJK A;  2PM7 B;  4O3T B;  2P9P C;  3K6S A;  2VDL A;  4CI1 A;  2IWK A;  2XZG A;  2OK6 A;  4GGC A;  5AJA A;  2BCJ B;  2OVR B;  4AN1 A;  2OVP B;  3GRE A;  3C9C A;  1JJU B;  1VZ3 A;  4MMZ A;  3KCI A;  2G99 A;  4D0K A;  4A08 A;  3P4F A;  2EIC A;  4O1Q D;  5K1C C;  1E5T A;  4A7J A;  2WQ8 A;  3PSL A;  3JPX A;  4LGN A;  4J8G A;  4UM8 A;  3IIY A;  3GC3 B;  5M5U A;  5GXI A;  2YNO A;  4E5Z B;  5M5T A;  2YMU A;  3DM0 A;  4FAV D;  2VDR A;  2YNP A;  4A09 B;  3I2N A;  4CY3 A;  3SWS D;  2IAA A;  5C2W B;  2UZX B;  1N6F A;  2VC2 A;  3OKT A;  3I8C A;  3J80 g;  2H9P A;  2PM9 A;  2TRC B;  1O6G A;  3OTT A;  2CE9 A;  3IJC A;  2HU8 A;  3PE7 A;  4GGD A;  2OIZ A;  1UOP A;  4X61 B;  3IVM A;  2VDK A;  4BUJ C;  3N0D A;  3RLM D;  4ZOV A;  2I0R A;  3BWS A;  4GZ8 A;  3KRW B;  5TDH B;  3EQ9 A;  3MKS B;  3JZH A;  1GOF A;  4J77 A;  4NAA A;  3IUN A;  3OL2 B;  4NSX A;  3V5W B;  5GMK n;  3RN1 D;  1MDA H;  5E6U A;  4CZY A;  2VDP A;  2Q7Q A;  3MZK A;  2I0S A;  5CXB A;  2H47 A;  1U2V C;  2EID A;  2XL2 A;  4OZU A;  5CXC B;  3UVO A;  5TF2 A;  2AGX A;  1ERJ A;  1H2Z A;  4CY1 A;  4O2W A;  5IT9 g;  4D6V A;  2AGL A;  4PBY A;  1MG3 A;  2BBK H;  1SQ9 A;  4A0B B;  1H2W A;  3JZN A;  4DNW A;  4UI9 R;  2W18 A;  3AH8 B;  1OLZ A;  4HDJ A;  1GP2 B;  4ERQ A;  2Z2N A;  3ZDX A;  1NR0 A;  2CE8 A;  4K3J B; 
#chains in the Genus database with same CATH homology
 3PVU B;  3I89 A;  4LG8 A;  4O9D A;  2PM9 B;  3ODT A;  3JRP A;  4FA9 D;  1GXR A;  3PXS D;  2QXV A;  2J56 H;  5KDO B;  3UVK A;  1PEV A;  4ERY A;  3NVX A;  3NVN A;  3ZWL B;  2P9S C;  3IIW A;  5I5M A;  2HES X;  5C9Z B;  3A0F A;  1XHM A;  5AFU 3;  3IJ1 A;  4JSX C;  1R5M A;  4PSX B;  2YB8 B;  5JWZ A;  3JZG A;  3L4O D;  4GGA A;  4YVD A;  3PXW D;  1N6E A;  4LG9 A;  5TEF A;  4GM8 A;  3W15 A;  2XL3 A;  3EI2 B;  2P9N C;  3I7N A;  2GNQ A;  4J79 A;  3UVL A;  4FAN D;  3AL8 A;  4ZOY A;  5HE1 B;  4A09 A;  3SLE D;  4QRJ A;  4BH6 A;  4FA4 D;  4FWW A;  2HKR A;  4E54 B;  1L0Q A;  3RRM C;  2B5L A;  4GQ1 A;  4A2L A;  4ES0 A;  3I7K A;  4PXW A;  3BG1 A;  3L4M D;  1OMW B;  2YBA A;  4TZ4 A;  4N14 A;  4R7A B;  3SBR A;  1PI6 A;  3OKY B;  3V9F A;  5AMS A;  4I79 A;  2QC5 A;  3SMR A;  5FLX g;  3CFS B;  2IUR A;  4BL0 A;  5EM2 B;  5THA A;  5EMM B;  4QL1 A;  4ERZ A;  2HJB A;  3DXM C;  2H6N A;  4ZN4 A;  3MKQ A;  4A11 A;  5IJ7 E;  1SHY B;  3AFC A;  2B5N A;  5B4W A;  4A08 B;  3JB9 L;  5IC7 A;  3F3G A;  1K8K C;  3OKW A;  4H5I A;  3EI1 B;  3EI1 A;  2Z2O A;  4AOW A;  1YFQ A;  1FWX A;  2CO0 C;  5I5I A;  2H3X A;  1PGU A;  1JMZ B;  3MXX A;  4CY5 A;  3EI3 A;  2OVQ B;  3EI3 B;  2IUQ A;  5CYK A;  1P22 A;  5HYN B;  3JAM g;  1B9Y A;  3I7L A;  2AH0 A;  2PBI B;  3MZL A;  4GQB B;  3RMZ D;  4X63 B;  4Y7R A;  3EI4 A;  2P9K C;  3VH0 A;  2OK4 A;  3I7P A;  5HE3 B;  5FKR A;  2GC7 A;  3UR4 A;  4A0A A;  5K19 A;  2Z2P A;  4PBZ A;  3SN6 B;  3J81 g;  4X3E A;  4U7A A;  3UKU C;  2H9M A;  3F3F A;  2H14 A;  4JXM A;  5FA5 B;  4A0A B;  4A2M A;  2AGZ A;  4ESG A;  3B7F A;  3BG0 A;  2IUV A;  4E54 A;  3I8E A;  3RSE C;  3E0C A;  2H9L A;  2IWF A;  1SQJ A;  4JT6 C;  3AL8 B;  3OL2 A;  1A0R B;  3C75 H;  2GC4 A;  5EML B;  2HXC A;  5CXC A;  3KRX B;  3EU7 A;  4J0W A;  5TEE A;  4L1Q D;  4U1E I;  3DXK C;  2CN2 A;  5FXY A;  4CI3 A;  5HE0 B;  1B9X A;  2G9A A;  5C2V B;  3CFV A;  3C5M A;  4FA5 D;  5H17 A;  5CXB B;  2H6K A;  2B4E A;  2AQ5 A;  2J57 G;  3ULE C;  5GSA A;  2AGW A;  5IGQ A;  5IJ8 E;  2H68 A;  3AL9 A;  3SCY A;  5IGO A;  4FHL A;  4GMB A;  3EMH A;  3SBQ A;  5EAP A;  4PSW B;  4CZV A;  3SXT D;  3SBP A;  4O45 A;  2I3T A;  3MMY A;  5A2Q g;  4J78 A;  1QNI A;  5FKQ A;  4J87 A;  2J55 H;  2YNN A;  4JT5 C;  5SXM A;  2OJY A;  4J86 A;  3ORV D;  3UVN A;  1TYQ C;  4O3U B;  4XYH A;  5EAL A;  3SFZ A;  4EWR A;  4Z8L A;  4X60 B;  2H6Q A;  4JSP C;  1RI6 A;  3I7H A;  3RFG A;  3EG6 A;  4E5Z A;  4CC9 A;  1TBG A;  4JD2 C;  4J0X A;  5H14 A;  4L9O A;  4FA1 D;  2CO0 A;  3N0E A;  4CY2 A;  2MTA H;  3UKR C;  1JMX B;  3OW8 A;  1N6D A;  3EI2 A;  2B5M A;  3SJL D;  5HQG A;  4Y5R D;  3K26 A;  1JOF A;  2HJ4 A;  3VGZ A;  1GG2 B;  2EBS A;  3SHF A;  5EMJ B;  3VA6 A;  3FRX A;  5I5J A;  2HKM A;  5HE2 B;  2AH1 A;  4A0B A;  4J81 A;  4CI8 A;  4GM3 A;  4GQ2 P;  1GOT B;  1VYH C;  2P9I C;  3RN0 D;  3GFC A;  5EMK B;  5FQD A;  2CNX A;  2I3S A;  1XIP A;  4PC0 A;  2XU7 A;  3HFQ A;  3NVQ A;  1S4U X;  2AGY A;  5CYK B;  3V7D B;  3PXT D;  3EI4 B;  3FM0 A;  4QQE A;  2XYI A;  4AEZ A;  4XYI A;  2H9N A;  4FB1 D;  4K3I D;  1U4C A;  1PBY B;  3DSM A;  4J8B A;  2IUP A;  2O9K A;  4CZX A;  1XKS A;  4PNK B;  2P9L C;  4L3G D;  5EAM A;  3DWL C;  4ZOX A;  4QT8 A;  4L3H D;  4J82 A;  3SVW D;  3EWE A;  3CIK B;  5FKS A;  2I0T A;  3F3P A;  3IJ0 A;  4J73 A;  3PSC B;  5EM2 A;  2UZY B;  4GM9 A;  2HYE A;  2H13 A;  4ZOZ A;  4XEI C;  2PM6 B;  4MK0 B;  1K32 A;  4JSV C;  3C99 A;  4H5J A;  4J84 A;  4IA9 A;  3IKO A;  4JSN C;  3RFH A;  1NEX B;  3OKY A;  5H1M A;  4A11 B;  1Q47 A;  2P9U C;  4OWR A;  5GXH A;  1MG2 A;  3UVM A;  3FGB A;  4IMM A;  3I7O A;  5FKT A;  3K27 A;  3JRO A;  2CN3 A;  4G56 B;  4KFM B;  4CI2 A;  3PVW B;  5EAR A;  3U4Y A;  2PM7 B;  4O3T B;  2P9P C;  4CI1 A;  2IWK A;  2OK6 A;  4GGC A;  5AJA A;  2BCJ B;  2OVR B;  2OVP B;  3GRE A;  3C9C A;  1JJU B;  2G99 A;  4D0K A;  4A08 A;  3P4F A;  4O1Q D;  5K1C C;  4A7J A;  3PSL A;  3JPX A;  4LGN A;  4J8G A;  3IIY A;  5GXI A;  2YNO A;  4E5Z B;  2YMU A;  3DM0 A;  4FAV D;  2YNP A;  4A09 B;  3I2N A;  4CY3 A;  3SWS D;  2IAA A;  5C2W B;  2UZX B;  1N6F A;  3OKT A;  3I8C A;  3J80 g;  2H9P A;  2PM9 A;  2TRC B;  3OTT A;  2CE9 A;  3IJC A;  3PE7 A;  4GGD A;  2OIZ A;  4X61 B;  4BUJ C;  3N0D A;  3RLM D;  4ZOV A;  2I0R A;  3BWS A;  4GZ8 A;  3KRW B;  5TDH B;  3MKS B;  3JZH A;  4J77 A;  3OL2 B;  4NSX A;  3V5W B;  5GMK n;  3RN1 D;  1MDA H;  4CZY A;  2Q7Q A;  3MZK A;  2I0S A;  5CXB A;  2H47 A;  1U2V C;  2XL2 A;  4OZU A;  5CXC B;  3UVO A;  5TF2 A;  2AGX A;  1ERJ A;  4CY1 A;  5IT9 g;  4D6V A;  2AGL A;  4PBY A;  1MG3 A;  2BBK H;  1SQ9 A;  4A0B B;  3JZN A;  4UI9 R;  2W18 A;  3AH8 B;  1OLZ A;  4HDJ A;  1GP2 B;  4ERQ A;  2Z2N A;  1NR0 A;  2CE8 A;  4K3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...