2CE9A

A wrpw peptide bound to the groucho-tle wd40 domain.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
337
structure length
337
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 84
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce9A00
2IURA 1GOTB 3PVWB 3UVKA 2P9PC 2IWKA 2CE9A 2BCJB 1OMWB 5I5IA 2H14A 4XYIA 1L0QA 3PXSD 1S4UX 4X60B 2H9PA 5FXYA 5HQGA 4FAND 3PSLA 2I0RA 4HDJA 3N0EA 4CY5A 4LG8A 3SXTD 4QQEA 5JWZA 3P4FA 4J84A 4Z8LA 4R7AB 3UR4A 3DSMA 2J55H 2H6KA 3JAMg 1PEVA 4CI8A 3JZGA 3MMYA 2HXCA 2EBSA 4QL1A 1XIPA 1B9XA 4JSXC 3HFQA 1XHMA 2B5MA 3KRXB 4GQ2P 4Y7RA 1PBYB 4IA9A 4J0XA 3FM0A 3I7LA 5EM2A 1SQJA 4K3ID 4ZOXA 3RSEC 2B4EA 2P9NC 5THAA 4JT6C 2QXVA 2AGLA 3AL8A 3GFCA 3EI1A 4PNKB 3W15A 4A09B 2UZXB 5IT9g 2OVQB 5FQDA 2H13A 3C9CA 4A11B 5CXBB 3J81g 2CNXA 2Z2NA 4J82A 3UVNA 4JD2C 3K26A 5SXMA 2AGZA 2GC4A 4CY2A 3EU7A 1U4CA 4LGNA 1K32A 2GNQA 3UKUC 4A7JA 2CN3A 5FKTA 5IJ8E 1U2VC 4QRJA 3AL9A 5CXBA 2I0TA 4CZVA 3I8EA 5EMKB 3RRMC 3VH0A 2YNPA 3I7NA 5FLXg 2YMUA 4X61B 3U4YA 3DXKC 2HYEA 4CI2A 2Q7QA 4KFMB 1GP2B 3C75H 3I89A 4XEIC 2J56H 4E54A 5HE2B 5EALA 2I3SA 2P9SC 4QT8A 3UKRC 5K19A 5TF2A 3JB9L 4G56B 1GG2B 3N0DA 1GXRA 2IUPA 3F3GA 4Y5RD 4EWRA 4CI3A 4GQBB 2OJYA 1XKSA 4PSWB 1JMZB 2B5NA 3IIWA 3BG0A 1OLZA 4L3HD 4AEZA 4YVDA 1JOFA 2AH0A 3PE7A 2OK4A 2I3TA 3OKYB 2AGYA 3EI4A 1YFQA 3DWLC 3F3FA 3AH8B 3JPXA 3VGZA 1N6EA 1RI6A 2PM9B 3OKYA 2HJ4A 3NVXA 2O9KA 2PM6B 4ZOYA 4A0BB 2P9KC 4PC0A 3PVUB 2IAAA 3I7KA 4GZ8A 3GREA 4J8BA 3A0FA 2PM9A 1JJUB 3KRWB 4FAVD 4PXWA 3EI2B 4GMBA 3ULEC 4D6VA 5IJ7E 3SMRA 4AOWA 3FGBA 2CO0A 4UI9R 4GGCA 3SBPA 4BH6A 4FB1D 4BL0A 4N14A 4O9DA 5HE1B 1JMXB 2QC5A 5GSAA 4X3EA 1P22A 3CIKB 5EAPA 1R5MA 3E0CA 1TBGA 5C9ZB 3CFSB 2H9NA 3I7OA 2AQ5A 3EG6A 2Z2PA 3EI3B 2G99A 3L4MD 3I2NA 4A09A 4A08B 5GXHA 1A0RB 5EAMA 3DM0A 5KDOB 3SBQA 4A11A 5TEEA 4FHLA 3RMZD 4ZOZA 2J57G 3ZWLB 3J80g 2OK6A 5H1MA 2CE8A 3EMHA 2CN2A 5I5MA 3L4OD 3SLED 2H3XA 3K27A 1TYQC 2HKRA 5FKQA 1N6FA 4ES0A 4E5ZB 3OTTA 1N6DA 5A2Qg 2PBIB 4L3GD 5HE0B 4GGAA 5AFU3 2H6QA 2YB8B 4O3TB 4O3UB 3IJ1A 1FWXA 5AJAA 4OWRA 2IUVA 4BUJC 4E5ZA 3AFCA 3UVMA 3OL2B 4LG9A 4PBZA 1MG3A 2H47A 4XYHA 3NVNA 2YNNA 3RFGA 4U7AA 4NSXA 4ZN4A 3OW8A 3EWEA 3PXWD 4J0WA 3MKQA 2I0SA 3UVLA 3BWSA 4CY1A 4JSVC 3SJLD 4OZUA 4ESGA 3VA6A 2YNOA 3V5WB 5FA5B 4FA5D 3ORVD 3SN6B 2YBAA 2HESX 2MTAH 3RLMD 4JSPC 2PM7B 4L1QD 4GM8A 4U1EI 2XL3A 3CFVA 2G9AA 3IIYA 1NR0A 3NVQA 3DXMC 3SCYA 1ERJA 4J81A 1MDAH 4J78A 3V7DB 5HE3B 3IJCA 2P9UC 5AMSA 5H17A 4D0KA 4CZYA 1Q47A 1MG2A 5IGOA 4O45A 5TDHB 2AGWA 4ERQA 2XL2A 2BBKH 3V9FA 4J73A 4GGDA 4J8GA 5K1CC 5C2VB 3SFZA 2GC7A 3MZLA 4MK0B 4A0BA 4CY3A 1PGUA 2AGXA 3SBRA 4PBYA 4J87A 4H5JA 4K3JB 3EI2A 5B4WA 5EM2B 4J77A 5EMMB 4GQ1A 1NEXB 1PI6A 3AL8B 2OVRB 5HYNB 3IKOA 3EI1B 1SHYB 5EARA 2H9LA 4A2MA 3BG1A 4CZXA 3I7HA 4FA4D 4TZ4A 2Z2OA 3PXTD 5H14A 5I5JA 3JRPA 3C5MA 3RN0D 1QNIA 3C99A 2AH1A 3MXXA 4ERZA 5CYKB 5TEFA 3EI3A 1B9YA 2TRCB 4J86A 4CC9A 4A08A 3I8CA 3JZHA 5IGQA 4FWWA 2W18A 2H9MA 3PSCB 5EMLB 3FRXA 4FA1D 3JROA 3OKWA 4A0AB 3RFHA 3B7FA 3OKTA 5CXCB 5CYKA 2IUQA 5IC7A 5GXIA 3MZKA 4JXMA 5C2WB 5EMJB 4E54B 4JSNC 3MKSB 2P9LC 2HJBA 5GMKn 4GM3A 3ODTA 2P9IC 4A0AA 1K8KC 5CXCA 2OVPB 4ZOVA 4A2LA 4IMMA 2UZYB 1VYHC 3SWSD 2IWFA 4ERYA 4JT5C 3SVWD 4O1QD 3UVOA 3SHFA 2HKMA 2H6NA 3JZNA 4X63B 5FKSA 2B5LA 3OL2A 1SQ9A 2XU7A 5FKRA 3I7PA 2H68A 3RN1D 4GM9A 3IJ0A 4L9OA 4I79A 4CI1A 3EI4B 2CO0C 4J79A 2XYIA 3F3PA 4H5IA 4PSXB 2OIZA 4FA9D
chains in the Genus database with same CATH superfamily
2IURA 1GOTB 3PVWB 3UVKA 2P9PC 4UM9A 2IWKA 2CE9A 2BCJB 1OMWB 5I5IA 2QZPA 2H14A 4XYIA 1L0QA 3PXSD 5E6RA 5C92A 1S4UX 4X60B 2H9PA 2EIDA 5FXYA 5HQGA 4FAND 3PSLA 2I0RA 4HDJA 3N0EA 4CY5A 3FCSA 4LG8A 3SXTD 4QQEA 4JHPC 4BCBA 1QFMA 5JWZA 3P4FA 4J84A 3IUJA 4Z8LA 4R7AB 5M61A 3DSMA 3UR4A 2J55H 2H6KA 3JAMg 1PEVA 4CI8A 3JZGA 3MMYA 3O4GA 2HXCA 2EBSA 4QL1A 1XIPA 5M5TA 1B9XA 1L5GA 4MMZA 4JSXC 3HFQA 4WK2A 1E5TA 1XHMA 2B5MA 3KRXB 2VDPA 4GQ2P 4Y7RA 1PBYB 4IA9A 4J0XA 3MUNA 3FM0A 3I7LA 5EM2A 1SQJA 1VZ3A 4K3ID 4ZOXA 3RSEC 2B4EA 2P9NC 5THAA 4JT6C 2QXVA 2AGLA 3AL8A 3GFCA 3EI1A 4PNKB 3W15A 4A09B 2UZXB 2VZ3A 4D9SA 5IT9g 2OVQB 1BPOA 5FQDA 2H13A 3C9CA 4A11B 5CXBB 3J81g 2CNXA 2Z2NA 4J82A 3NIFA 2VDRA 3UVNA 4AN0A 1K3IA 3K26A 4JD2C 5SXMA 2AGZA 2GC4A 3ZE2A 3EU7A 4CY2A 1U4CA 1K32A 4LGNA 5M5RA 2GNQA 3UKUC 4A7JA 2CN3A 3K71A 5FKTA 5IJ8E 1U2VC 4QRJA 3AL9A 5CXBA 4WJKA 2I0TA 4L1MA 3IUQA 4CZVA 3I8EA 3GD1I 5EMKB 3RRMC 3VH0A 2YNPA 3I7NA 4G1MA 1GOFA 5FLXg 2XE4A 2YMUA 1C9IA 4X61B 3U4YA 3DXKC 2HYEA 4CI2A 2VDMA 2Q7QA 4KFMB 1GP2B 3C75H 3GC3B 3I89A 4XEIC 2J56H 4E54A 5HE2B 2HU7A 4UM8A 5EALA 2I3SA 5M5UA 2P9SC 4QT8A 3UKRC 5K19A 4NAAA 5TF2A 3JB9L 4G56B 1GG2B 3N0DA 1GXRA 2IUPA 3F3GA 4Y5RD 4EWRA 4CI3A 4GQBB 2OJYA 1XKSA 4PSWB 1JMZB 2B5NA 3IIWA 3BG0A 1OLZA 2VC2A 4DNVA 4L3HD 4AEZA 1QFSA 4YVDA 4Z7OA 1JOFA 2AH0A 2JKXA 3PE7A 2HU5A 2OK4A 2I3TA 4QAMA 3OKYB 2VDOA 2AGYA 3EI4A 1YFQA 3DWLC 3F3FA 4AMZA 3AH8B 3JPXA 1T2XA 4RE5A 3VGZA 1N6EA 3O4HA 3ZE0A 1RI6A 1TYEA 1YR2A 2PM9B 3OKYA 2HJ4A 3NVXA 3QHYB 1GOHA 2O9KA 2PM6B 4ZOYA 3T3PA 4A0BB 2P9KC 4PC0A 3PVUB 3V4PA 2IAAA 3I7KA 4GZ8A 3GREA 4J8BA 3A0FA 2PM9A 1JJUB 4O02A 3KRWB 3KCIA 3ZDZA 4FAVD 4PXWA 3EI2B 4GMBA 1H2XA 3K72A 3ULEC 3V4VA 4D6VA 5IJ7E 3SMRA 4AOWA 3FGBA 4RE6A 2CO0A 4UI9R 4GGCA 3SBPA 4BH6A 4FB1D 4BL0A 4N14A 4O9DA 5HDBA 1UOQA 5HE1B 1JMXB 4IRZA 2QC5A 5GSAA 4X3EA 1P22A 5E6SA 3QI0A 5FFOA 5FFGA 3CIKB 5EAPA 1R5MA 4Z7QA 3O4JA 4BCDA 3E0CA 1TBGA 4BP8A 5C9ZB 4AMYA 3O4IA 3CFSB 2H9NA 3I7OA 2AQ5A 3EG6A 2Z2PA 4DNUA 3EI3B 2G99A 3L4MD 1C9LA 3EQ7A 3I2NA 3IURA 4O2WA 4A08B 4A09A 5GXHA 1A0RB 5EAMA 3DM0A 5KDOB 3K6SA 3SBQA 1UOPA 4JHNA 4A11A 1JV2A 5TEEA 3IULA 4FHLA 4ZOZA 2J57G 3IJEA 3RMZD 3ZWLB 3J80g 2OK6A 5H1MA 2CE8A 3EMHA 4G1EA 2CN2A 5I5MA 4WK0A 3L4OD 3SLED 3FCUA 2H3XA 2VDNA 3K27A 1TYQC 2HKRA 5FKQA 1VE6A 1N6FA 4ES0A 3ZDYA 4E5ZB 3OTTA 1U8CA 1N6DA 3MUOA 5A2Qg 2PBIB 4L3GD 1M1XA 5HE0B 4GGAA 5AFU3 2H6QA 2YB8B 4O3TB 4O3UB 1VZ2A 3IJ1A 3IUNA 1FWXA 5AJAA 4OWRA 2IUVA 4BUJC 2WQ8A 4E5ZA 3AFCA 3UVMA 3OL2B 4LG9A 4PBZA 1MG3A 2H47A 3VI3A 4XYHA 3NVNA 2YNNA 1A12A 3RFGA 1O6GA 4NSXA 4U7AA 1O6FA 4ZN4A 4AX4A 3OW8A 3EWEA 3PXWD 4J0WA 3MKQA 2I0SA 3UVLA 2XZGA 3BWSA 4CY1A 4JSVC 3SJLD 4OZUA 4ESGA 2HU8A 3VA6A 2YNOA 3OF7A 2VZ1A 3V5WB 5FA5B 4FA5D 3ORVD 3SN6B 2YBAA 2HESX 2MTAH 3RLMD 4AN1A 1GOGA 3NIGA 2PM7B 4JSPC 4L1QD 4NENA 4GM8A 4U1EI 2XL3A 3CFVA 2G9AA 3IIYA 1NR0A 3NVQA 3DXMC 3SCYA 1ERJA 4J81A 1MDAH 4J78A 3V7DB 5HE3B 3IJCA 2P9UC 5AMSA 5H17A 2VDQA 4D0KA 4CZYA 1Q47A 1MG2A 5IGOA 2XDWA 4O45A 5TDHB 1H2YA 1JTDB 2AGWA 2XL2A 4ERQA 2BBKH 3V9FA 3IVMA 2QR5A 4J73A 4GGDA 4J8GA 3EQ9A 5K1CC 5C2VB 3SFZA 2GC7A 3MZLA 4MK0B 4A0BA 4CY3A 1PGUA 3IUMA 2EICA 2AGXA 3SBRA 1E8MA 4PBYA 4J87A 2VDKA 4H5JA 4K3JB 3EI2A 3ZDXA 5B4WA 5EM2B 4WK4A 4J77A 5EMMB 4GQ1A 1NEXB 1PI6A 3AL8B 2OVRB 5HYNB 3IKOA 3EI1B 3MVDK 4DNWA 1I2MB 1SHYB 1H2WA 5EARA 2H9LA 3EQ8A 3T3MA 4A2MA 3BG1A 4NBMA 4CZXA 3I7HA 2BKLA 4FA4D 4TZ4A 2Z2OA 3PXTD 5H14A 2VDLA 5I5JA 3JRPA 3C5MA 3RN0D 1QNIA 3C99A 2AH1A 3MXXA 4NC4A 4ERZA 5CYKB 5TEFA 4Z7NA 3EI3A 1B9YA 2TRCB 4J86A 1UOOA 4CC9A 4A08A 3I8CA 3JZHA 5IGQA 4FWWA 2W18A 1VE7A 4G55A 2H9MA 3PSCB 5EMLB 3FRXA 3DDUA 4FA1D 3JROA 3OKWA 4A0AB 4MMYA 3RFHA 3B7FA 3OKTA 5CXCB 5CYKA 4BP9A 2IUQA 5IC7A 5GXIA 3MZKA 4JXMA 1UTCA 5EMJB 5C2WB 4JSNC 4E54B 3MKSB 3VI4A 2P9LC 2HJBA 2EIBA 4GM3A 5GMKn 4MMXA 4BCCA 3NIDA 3ODTA 1H2ZA 2P9IC 4A0AA 1K8KC 5CXCA 2OVPB 4ZOVA 4A2LA 4IMMA 2UZYB 1VYHC 5C86A 3SWSD 2IWFA 4ERYA 4JT5C 3SVWD 4O1QD 3UVOA 5M5VA 3SHFA 2HKMA 2H6NA 3JZNA 3ZE1A 5E6UA 4X63B 5FKSA 2B5LA 3OL2A 1SQ9A 1E8NA 2XU7A 5FKRA 3I7PA 2H68A 3RN1D 4GM9A 3IJ0A 4L9OA 5M5SA 4I79A 4CI1A 3EI4B 2CO0C 4J79A 2XYIA 3F3PA 2EIEA 4H5IA 4PSXB 2OIZA 4FA9D
chains in the Genus database with same CATH topology
2IURA 1GOTB 3PVWB 3UVKA 2P9PC 2IWKA 2CE9A 2BCJB 1OMWB 5I5IA 2H14A 4XYIA 1L0QA 3PXSD 1S4UX 4X60B 2H9PA 5FXYA 5HQGA 4FAND 3PSLA 2I0RA 4HDJA 3N0EA 4CY5A 4LG8A 3SXTD 4QQEA 5JWZA 3P4FA 4J84A 4Z8LA 4R7AB 3UR4A 3DSMA 2J55H 2H6KA 3JAMg 1PEVA 4CI8A 3JZGA 3MMYA 2HXCA 2EBSA 4QL1A 1XIPA 1B9XA 4JSXC 3HFQA 1XHMA 2B5MA 3KRXB 4GQ2P 4Y7RA 1PBYB 4IA9A 4J0XA 3FM0A 3I7LA 5EM2A 1SQJA 4K3ID 4ZOXA 3RSEC 2B4EA 2P9NC 5THAA 4JT6C 2QXVA 2AGLA 3AL8A 3GFCA 3EI1A 4PNKB 3W15A 4A09B 2UZXB 5IT9g 2OVQB 5FQDA 2H13A 3C9CA 4A11B 5CXBB 3J81g 2CNXA 2Z2NA 4J82A 3UVNA 4JD2C 3K26A 5SXMA 2AGZA 2GC4A 4CY2A 3EU7A 1U4CA 4LGNA 1K32A 2GNQA 3UKUC 4A7JA 2CN3A 5FKTA 5IJ8E 1U2VC 4QRJA 3AL9A 5CXBA 2I0TA 4CZVA 3I8EA 5EMKB 3RRMC 3VH0A 2YNPA 3I7NA 5FLXg 2YMUA 4X61B 3U4YA 3DXKC 2HYEA 4CI2A 2Q7QA 4KFMB 1GP2B 3C75H 3I89A 4XEIC 2J56H 4E54A 5HE2B 5EALA 2I3SA 2P9SC 4QT8A 3UKRC 5K19A 5TF2A 3JB9L 4G56B 1GG2B 3N0DA 1GXRA 2IUPA 3F3GA 4Y5RD 4EWRA 4CI3A 4GQBB 2OJYA 1XKSA 4PSWB 1JMZB 2B5NA 3IIWA 3BG0A 1OLZA 4L3HD 4AEZA 4YVDA 1JOFA 2AH0A 3PE7A 2OK4A 2I3TA 3OKYB 2AGYA 3EI4A 1YFQA 3DWLC 3F3FA 3AH8B 3JPXA 3VGZA 1N6EA 1RI6A 2PM9B 3OKYA 2HJ4A 3NVXA 2O9KA 2PM6B 4ZOYA 4A0BB 2P9KC 4PC0A 3PVUB 2IAAA 3I7KA 4GZ8A 3GREA 4J8BA 3A0FA 2PM9A 1JJUB 3KRWB 4FAVD 4PXWA 3EI2B 4GMBA 3ULEC 4D6VA 5IJ7E 3SMRA 4AOWA 3FGBA 2CO0A 4UI9R 4GGCA 3SBPA 4BH6A 4FB1D 4BL0A 4N14A 4O9DA 5HE1B 1JMXB 2QC5A 5GSAA 4X3EA 1P22A 3CIKB 5EAPA 1R5MA 3E0CA 1TBGA 5C9ZB 3CFSB 2H9NA 3I7OA 2AQ5A 3EG6A 2Z2PA 3EI3B 2G99A 3L4MD 3I2NA 4A09A 4A08B 5GXHA 1A0RB 5EAMA 3DM0A 5KDOB 3SBQA 4A11A 5TEEA 4FHLA 3RMZD 4ZOZA 2J57G 3ZWLB 3J80g 2OK6A 5H1MA 2CE8A 3EMHA 2CN2A 5I5MA 3L4OD 3SLED 2H3XA 3K27A 1TYQC 2HKRA 5FKQA 1N6FA 4ES0A 4E5ZB 3OTTA 1N6DA 5A2Qg 2PBIB 4L3GD 5HE0B 4GGAA 5AFU3 2H6QA 2YB8B 4O3TB 4O3UB 3IJ1A 1FWXA 5AJAA 4OWRA 2IUVA 4BUJC 4E5ZA 3AFCA 3UVMA 3OL2B 4LG9A 4PBZA 1MG3A 2H47A 4XYHA 3NVNA 2YNNA 3RFGA 4U7AA 4NSXA 4ZN4A 3OW8A 3EWEA 3PXWD 4J0WA 3MKQA 2I0SA 3UVLA 3BWSA 4CY1A 4JSVC 3SJLD 4OZUA 4ESGA 3VA6A 2YNOA 3V5WB 5FA5B 4FA5D 3ORVD 3SN6B 2YBAA 2HESX 2MTAH 3RLMD 4JSPC 2PM7B 4L1QD 4GM8A 4U1EI 2XL3A 3CFVA 2G9AA 3IIYA 1NR0A 3NVQA 3DXMC 3SCYA 1ERJA 4J81A 1MDAH 4J78A 3V7DB 5HE3B 3IJCA 2P9UC 5AMSA 5H17A 4D0KA 4CZYA 1Q47A 1MG2A 5IGOA 4O45A 5TDHB 2AGWA 4ERQA 2XL2A 2BBKH 3V9FA 4J73A 4GGDA 4J8GA 5K1CC 5C2VB 3SFZA 2GC7A 3MZLA 4MK0B 4A0BA 4CY3A 1PGUA 2AGXA 3SBRA 4PBYA 4J87A 4H5JA 4K3JB 3EI2A 5B4WA 5EM2B 4J77A 5EMMB 4GQ1A 1NEXB 1PI6A 3AL8B 2OVRB 5HYNB 3IKOA 3EI1B 1SHYB 5EARA 2H9LA 4A2MA 3BG1A 4CZXA 3I7HA 4FA4D 4TZ4A 2Z2OA 3PXTD 5H14A 5I5JA 3JRPA 3C5MA 3RN0D 1QNIA 3C99A 2AH1A 3MXXA 4ERZA 5CYKB 5TEFA 3EI3A 1B9YA 2TRCB 4J86A 4CC9A 4A08A 3I8CA 3JZHA 5IGQA 4FWWA 2W18A 2H9MA 3PSCB 5EMLB 3FRXA 4FA1D 3JROA 3OKWA 4A0AB 3RFHA 3B7FA 3OKTA 5CXCB 5CYKA 2IUQA 5IC7A 5GXIA 3MZKA 4JXMA 5C2WB 5EMJB 4E54B 4JSNC 3MKSB 2P9LC 2HJBA 5GMKn 4GM3A 3ODTA 2P9IC 4A0AA 1K8KC 5CXCA 2OVPB 4ZOVA 4A2LA 4IMMA 2UZYB 1VYHC 3SWSD 2IWFA 4ERYA 4JT5C 3SVWD 4O1QD 3UVOA 3SHFA 2HKMA 2H6NA 3JZNA 4X63B 5FKSA 2B5LA 3OL2A 1SQ9A 2XU7A 5FKRA 3I7PA 2H68A 3RN1D 4GM9A 3IJ0A 4L9OA 4I79A 4CI1A 3EI4B 2CO0C 4J79A 2XYIA 3F3PA 4H5IA 4PSXB 2OIZA 4FA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUR A;  1GOT B;  3PVW B;  3UVK A;  2P9P C;  2IWK A;  2CE9 A;  2BCJ B;  1OMW B;  5I5I A;  2H14 A;  4XYI A;  1L0Q A;  3PXS D;  1S4U X;  4X60 B;  2H9P A;  5FXY A;  5HQG A;  4FAN D;  3PSL A;  2I0R A;  4HDJ A;  3N0E A;  4CY5 A;  4LG8 A;  3SXT D;  4QQE A;  5JWZ A;  3P4F A;  4J84 A;  4Z8L A;  4R7A B;  3UR4 A;  3DSM A;  2J55 H;  2H6K A;  3JAM g;  1PEV A;  4CI8 A;  3JZG A;  3MMY A;  2HXC A;  2EBS A;  4QL1 A;  1XIP A;  1B9X A;  4JSX C;  3HFQ A;  1XHM A;  2B5M A;  3KRX B;  4GQ2 P;  4Y7R A;  1PBY B;  4IA9 A;  4J0X A;  3FM0 A;  3I7L A;  5EM2 A;  1SQJ A;  4K3I D;  4ZOX A;  3RSE C;  2B4E A;  2P9N C;  5THA A;  4JT6 C;  2QXV A;  2AGL A;  3AL8 A;  3GFC A;  3EI1 A;  4PNK B;  3W15 A;  4A09 B;  2UZX B;  5IT9 g;  2OVQ B;  5FQD A;  2H13 A;  3C9C A;  4A11 B;  5CXB B;  3J81 g;  2CNX A;  2Z2N A;  4J82 A;  3UVN A;  4JD2 C;  3K26 A;  5SXM A;  2AGZ A;  2GC4 A;  4CY2 A;  3EU7 A;  1U4C A;  4LGN A;  1K32 A;  2GNQ A;  3UKU C;  4A7J A;  2CN3 A;  5FKT A;  5IJ8 E;  1U2V C;  4QRJ A;  3AL9 A;  5CXB A;  2I0T A;  4CZV A;  3I8E A;  5EMK B;  3RRM C;  3VH0 A;  2YNP A;  3I7N A;  5FLX g;  2YMU A;  4X61 B;  3U4Y A;  3DXK C;  2HYE A;  4CI2 A;  2Q7Q A;  4KFM B;  1GP2 B;  3C75 H;  3I89 A;  4XEI C;  2J56 H;  4E54 A;  5HE2 B;  5EAL A;  2I3S A;  2P9S C;  4QT8 A;  3UKR C;  5K19 A;  5TF2 A;  3JB9 L;  4G56 B;  1GG2 B;  3N0D A;  1GXR A;  2IUP A;  3F3G A;  4Y5R D;  4EWR A;  4CI3 A;  4GQB B;  2OJY A;  1XKS A;  4PSW B;  1JMZ B;  2B5N A;  3IIW A;  3BG0 A;  1OLZ A;  4L3H D;  4AEZ A;  4YVD A;  1JOF A;  2AH0 A;  3PE7 A;  2OK4 A;  2I3T A;  3OKY B;  2AGY A;  3EI4 A;  1YFQ A;  3DWL C;  3F3F A;  3AH8 B;  3JPX A;  3VGZ A;  1N6E A;  1RI6 A;  2PM9 B;  3OKY A;  2HJ4 A;  3NVX A;  2O9K A;  2PM6 B;  4ZOY A;  4A0B B;  2P9K C;  4PC0 A;  3PVU B;  2IAA A;  3I7K A;  4GZ8 A;  3GRE A;  4J8B A;  3A0F A;  2PM9 A;  1JJU B;  3KRW B;  4FAV D;  4PXW A;  3EI2 B;  4GMB A;  3ULE C;  4D6V A;  5IJ7 E;  3SMR A;  4AOW A;  3FGB A;  2CO0 A;  4UI9 R;  4GGC A;  3SBP A;  4BH6 A;  4FB1 D;  4BL0 A;  4N14 A;  4O9D A;  5HE1 B;  1JMX B;  2QC5 A;  5GSA A;  4X3E A;  1P22 A;  3CIK B;  5EAP A;  1R5M A;  3E0C A;  1TBG A;  5C9Z B;  3CFS B;  2H9N A;  3I7O A;  2AQ5 A;  3EG6 A;  2Z2P A;  3EI3 B;  2G99 A;  3L4M D;  3I2N A;  4A09 A;  4A08 B;  5GXH A;  1A0R B;  5EAM A;  3DM0 A;  5KDO B;  3SBQ A;  4A11 A;  5TEE A;  4FHL A;  3RMZ D;  4ZOZ A;  2J57 G;  3ZWL B;  3J80 g;  2OK6 A;  5H1M A;  2CE8 A;  3EMH A;  2CN2 A;  5I5M A;  3L4O D;  3SLE D;  2H3X A;  3K27 A;  1TYQ C;  2HKR A;  5FKQ A;  1N6F A;  4ES0 A;  4E5Z B;  3OTT A;  1N6D A;  5A2Q g;  2PBI B;  4L3G D;  5HE0 B;  4GGA A;  5AFU 3;  2H6Q A;  2YB8 B;  4O3T B;  4O3U B;  3IJ1 A;  1FWX A;  5AJA A;  4OWR A;  2IUV A;  4BUJ C;  4E5Z A;  3AFC A;  3UVM A;  3OL2 B;  4LG9 A;  4PBZ A;  1MG3 A;  2H47 A;  4XYH A;  3NVN A;  2YNN A;  3RFG A;  4U7A A;  4NSX A;  4ZN4 A;  3OW8 A;  3EWE A;  3PXW D;  4J0W A;  3MKQ A;  2I0S A;  3UVL A;  3BWS A;  4CY1 A;  4JSV C;  3SJL D;  4OZU A;  4ESG A;  3VA6 A;  2YNO A;  3V5W B;  5FA5 B;  4FA5 D;  3ORV D;  3SN6 B;  2YBA A;  2HES X;  2MTA H;  3RLM D;  4JSP C;  2PM7 B;  4L1Q D;  4GM8 A;  4U1E I;  2XL3 A;  3CFV A;  2G9A A;  3IIY A;  1NR0 A;  3NVQ A;  3DXM C;  3SCY A;  1ERJ A;  4J81 A;  1MDA H;  4J78 A;  3V7D B;  5HE3 B;  3IJC A;  2P9U C;  5AMS A;  5H17 A;  4D0K A;  4CZY A;  1Q47 A;  1MG2 A;  5IGO A;  4O45 A;  5TDH B;  2AGW A;  4ERQ A;  2XL2 A;  2BBK H;  3V9F A;  4J73 A;  4GGD A;  4J8G A;  5K1C C;  5C2V B;  3SFZ A;  2GC7 A;  3MZL A;  4MK0 B;  4A0B A;  4CY3 A;  1PGU A;  2AGX A;  3SBR A;  4PBY A;  4J87 A;  4H5J A;  4K3J B;  3EI2 A;  5B4W A;  5EM2 B;  4J77 A;  5EMM B;  4GQ1 A;  1NEX B;  1PI6 A;  3AL8 B;  2OVR B;  5HYN B;  3IKO A;  3EI1 B;  1SHY B;  5EAR A;  2H9L A;  4A2M A;  3BG1 A;  4CZX A;  3I7H A;  4FA4 D;  4TZ4 A;  2Z2O A;  3PXT D;  5H14 A;  5I5J A;  3JRP A;  3C5M A;  3RN0 D;  1QNI A;  3C99 A;  2AH1 A;  3MXX A;  4ERZ A;  5CYK B;  5TEF A;  3EI3 A;  1B9Y A;  2TRC B;  4J86 A;  4CC9 A;  4A08 A;  3I8C A;  3JZH A;  5IGQ A;  4FWW A;  2W18 A;  2H9M A;  3PSC B;  5EML B;  3FRX A;  4FA1 D;  3JRO A;  3OKW A;  4A0A B;  3RFH A;  3B7F A;  3OKT A;  5CXC B;  5CYK A;  2IUQ A;  5IC7 A;  5GXI A;  3MZK A;  4JXM A;  5C2W B;  5EMJ B;  4E54 B;  4JSN C;  3MKS B;  2P9L C;  2HJB A;  5GMK n;  4GM3 A;  3ODT A;  2P9I C;  4A0A A;  1K8K C;  5CXC A;  2OVP B;  4ZOV A;  4A2L A;  4IMM A;  2UZY B;  1VYH C;  3SWS D;  2IWF A;  4ERY A;  4JT5 C;  3SVW D;  4O1Q D;  3UVO A;  3SHF A;  2HKM A;  2H6N A;  3JZN A;  4X63 B;  5FKS A;  2B5L A;  3OL2 A;  1SQ9 A;  2XU7 A;  5FKR A;  3I7P A;  2H68 A;  3RN1 D;  4GM9 A;  3IJ0 A;  4L9O A;  4I79 A;  4CI1 A;  3EI4 B;  2CO0 C;  4J79 A;  2XYI A;  3F3P A;  4H5I A;  4PSX B;  2OIZ A;  4FA9 D; 
#chains in the Genus database with same CATH topology
 2IUR A;  1GOT B;  3PVW B;  3UVK A;  2P9P C;  4UM9 A;  2IWK A;  2CE9 A;  2BCJ B;  1OMW B;  5I5I A;  2QZP A;  2H14 A;  4XYI A;  1L0Q A;  3PXS D;  5E6R A;  5C92 A;  1S4U X;  4X60 B;  2H9P A;  2EID A;  5FXY A;  5HQG A;  4FAN D;  3PSL A;  2I0R A;  4HDJ A;  3N0E A;  4CY5 A;  3FCS A;  4LG8 A;  3SXT D;  4QQE A;  4JHP C;  4BCB A;  1QFM A;  5JWZ A;  3P4F A;  4J84 A;  3IUJ A;  4Z8L A;  4R7A B;  5M61 A;  3DSM A;  3UR4 A;  2J55 H;  2H6K A;  3JAM g;  1PEV A;  4CI8 A;  3JZG A;  3MMY A;  3O4G A;  2HXC A;  2EBS A;  4QL1 A;  1XIP A;  5M5T A;  1B9X A;  1L5G A;  4MMZ A;  4JSX C;  3HFQ A;  4WK2 A;  1E5T A;  1XHM A;  2B5M A;  3KRX B;  2VDP A;  4GQ2 P;  4Y7R A;  1PBY B;  4IA9 A;  4J0X A;  3MUN A;  3FM0 A;  3I7L A;  5EM2 A;  1SQJ A;  1VZ3 A;  4K3I D;  4ZOX A;  3RSE C;  2B4E A;  2P9N C;  5THA A;  4JT6 C;  2QXV A;  2AGL A;  3AL8 A;  3GFC A;  3EI1 A;  4PNK B;  3W15 A;  4A09 B;  2UZX B;  2VZ3 A;  4D9S A;  5IT9 g;  2OVQ B;  1BPO A;  5FQD A;  2H13 A;  3C9C A;  4A11 B;  5CXB B;  3J81 g;  2CNX A;  2Z2N A;  4J82 A;  3NIF A;  2VDR A;  3UVN A;  4AN0 A;  1K3I A;  3K26 A;  4JD2 C;  5SXM A;  2AGZ A;  2GC4 A;  3ZE2 A;  3EU7 A;  4CY2 A;  1U4C A;  1K32 A;  4LGN A;  5M5R A;  2GNQ A;  3UKU C;  4A7J A;  2CN3 A;  3K71 A;  5FKT A;  5IJ8 E;  1U2V C;  4QRJ A;  3AL9 A;  5CXB A;  4WJK A;  2I0T A;  4L1M A;  3IUQ A;  4CZV A;  3I8E A;  3GD1 I;  5EMK B;  3RRM C;  3VH0 A;  2YNP A;  3I7N A;  4G1M A;  1GOF A;  5FLX g;  2XE4 A;  2YMU A;  1C9I A;  4X61 B;  3U4Y A;  3DXK C;  2HYE A;  4CI2 A;  2VDM A;  2Q7Q A;  4KFM B;  1GP2 B;  3C75 H;  3GC3 B;  3I89 A;  4XEI C;  2J56 H;  4E54 A;  5HE2 B;  2HU7 A;  4UM8 A;  5EAL A;  2I3S A;  5M5U A;  2P9S C;  4QT8 A;  3UKR C;  5K19 A;  4NAA A;  5TF2 A;  3JB9 L;  4G56 B;  1GG2 B;  3N0D A;  1GXR A;  2IUP A;  3F3G A;  4Y5R D;  4EWR A;  4CI3 A;  4GQB B;  2OJY A;  1XKS A;  4PSW B;  1JMZ B;  2B5N A;  3IIW A;  3BG0 A;  1OLZ A;  2VC2 A;  4DNV A;  4L3H D;  4AEZ A;  1QFS A;  4YVD A;  4Z7O A;  1JOF A;  2AH0 A;  2JKX A;  3PE7 A;  2HU5 A;  2OK4 A;  2I3T A;  4QAM A;  3OKY B;  2VDO A;  2AGY A;  3EI4 A;  1YFQ A;  3DWL C;  3F3F A;  4AMZ A;  3AH8 B;  3JPX A;  1T2X A;  4RE5 A;  3VGZ A;  1N6E A;  3O4H A;  3ZE0 A;  1RI6 A;  1TYE A;  1YR2 A;  2PM9 B;  3OKY A;  2HJ4 A;  3NVX A;  3QHY B;  1GOH A;  2O9K A;  2PM6 B;  4ZOY A;  3T3P A;  4A0B B;  2P9K C;  4PC0 A;  3PVU B;  3V4P A;  2IAA A;  3I7K A;  4GZ8 A;  3GRE A;  4J8B A;  3A0F A;  2PM9 A;  1JJU B;  4O02 A;  3KRW B;  3KCI A;  3ZDZ A;  4FAV D;  4PXW A;  3EI2 B;  4GMB A;  1H2X A;  3K72 A;  3ULE C;  3V4V A;  4D6V A;  5IJ7 E;  3SMR A;  4AOW A;  3FGB A;  4RE6 A;  2CO0 A;  4UI9 R;  4GGC A;  3SBP A;  4BH6 A;  4FB1 D;  4BL0 A;  4N14 A;  4O9D A;  5HDB A;  1UOQ A;  5HE1 B;  1JMX B;  4IRZ A;  2QC5 A;  5GSA A;  4X3E A;  1P22 A;  5E6S A;  3QI0 A;  5FFO A;  5FFG A;  3CIK B;  5EAP A;  1R5M A;  4Z7Q A;  3O4J A;  4BCD A;  3E0C A;  1TBG A;  4BP8 A;  5C9Z B;  4AMY A;  3O4I A;  3CFS B;  2H9N A;  3I7O A;  2AQ5 A;  3EG6 A;  2Z2P A;  4DNU A;  3EI3 B;  2G99 A;  3L4M D;  1C9L A;  3EQ7 A;  3I2N A;  3IUR A;  4O2W A;  4A08 B;  4A09 A;  5GXH A;  1A0R B;  5EAM A;  3DM0 A;  5KDO B;  3K6S A;  3SBQ A;  1UOP A;  4JHN A;  4A11 A;  1JV2 A;  5TEE A;  3IUL A;  4FHL A;  4ZOZ A;  2J57 G;  3IJE A;  3RMZ D;  3ZWL B;  3J80 g;  2OK6 A;  5H1M A;  2CE8 A;  3EMH A;  4G1E A;  2CN2 A;  5I5M A;  4WK0 A;  3L4O D;  3SLE D;  3FCU A;  2H3X A;  2VDN A;  3K27 A;  1TYQ C;  2HKR A;  5FKQ A;  1VE6 A;  1N6F A;  4ES0 A;  3ZDY A;  4E5Z B;  3OTT A;  1U8C A;  1N6D A;  3MUO A;  5A2Q g;  2PBI B;  4L3G D;  1M1X A;  5HE0 B;  4GGA A;  5AFU 3;  2H6Q A;  2YB8 B;  4O3T B;  4O3U B;  1VZ2 A;  3IJ1 A;  3IUN A;  1FWX A;  5AJA A;  4OWR A;  2IUV A;  4BUJ C;  2WQ8 A;  4E5Z A;  3AFC A;  3UVM A;  3OL2 B;  4LG9 A;  4PBZ A;  1MG3 A;  2H47 A;  3VI3 A;  4XYH A;  3NVN A;  2YNN A;  1A12 A;  3RFG A;  1O6G A;  4NSX A;  4U7A A;  1O6F A;  4ZN4 A;  4AX4 A;  3OW8 A;  3EWE A;  3PXW D;  4J0W A;  3MKQ A;  2I0S A;  3UVL A;  2XZG A;  3BWS A;  4CY1 A;  4JSV C;  3SJL D;  4OZU A;  4ESG A;  2HU8 A;  3VA6 A;  2YNO A;  3OF7 A;  2VZ1 A;  3V5W B;  5FA5 B;  4FA5 D;  3ORV D;  3SN6 B;  2YBA A;  2HES X;  2MTA H;  3RLM D;  4AN1 A;  1GOG A;  3NIG A;  2PM7 B;  4JSP C;  4L1Q D;  4NEN A;  4GM8 A;  4U1E I;  2XL3 A;  3CFV A;  2G9A A;  3IIY A;  1NR0 A;  3NVQ A;  3DXM C;  3SCY A;  1ERJ A;  4J81 A;  1MDA H;  4J78 A;  3V7D B;  5HE3 B;  3IJC A;  2P9U C;  5AMS A;  5H17 A;  2VDQ A;  4D0K A;  4CZY A;  1Q47 A;  1MG2 A;  5IGO A;  2XDW A;  4O45 A;  5TDH B;  1H2Y A;  1JTD B;  2AGW A;  2XL2 A;  4ERQ A;  2BBK H;  3V9F A;  3IVM A;  2QR5 A;  4J73 A;  4GGD A;  4J8G A;  3EQ9 A;  5K1C C;  5C2V B;  3SFZ A;  2GC7 A;  3MZL A;  4MK0 B;  4A0B A;  4CY3 A;  1PGU A;  3IUM A;  2EIC A;  2AGX A;  3SBR A;  1E8M A;  4PBY A;  4J87 A;  2VDK A;  4H5J A;  4K3J B;  3EI2 A;  3ZDX A;  5B4W A;  5EM2 B;  4WK4 A;  4J77 A;  5EMM B;  4GQ1 A;  1NEX B;  1PI6 A;  3AL8 B;  2OVR B;  5HYN B;  3IKO A;  3EI1 B;  3MVD K;  4DNW A;  1I2M B;  1SHY B;  1H2W A;  5EAR A;  2H9L A;  3EQ8 A;  3T3M A;  4A2M A;  3BG1 A;  4NBM A;  4CZX A;  3I7H A;  2BKL A;  4FA4 D;  4TZ4 A;  2Z2O A;  3PXT D;  5H14 A;  2VDL A;  5I5J A;  3JRP A;  3C5M A;  3RN0 D;  1QNI A;  3C99 A;  2AH1 A;  3MXX A;  4NC4 A;  4ERZ A;  5CYK B;  5TEF A;  4Z7N A;  3EI3 A;  1B9Y A;  2TRC B;  4J86 A;  1UOO A;  4CC9 A;  4A08 A;  3I8C A;  3JZH A;  5IGQ A;  4FWW A;  2W18 A;  1VE7 A;  4G55 A;  2H9M A;  3PSC B;  5EML B;  3FRX A;  3DDU A;  4FA1 D;  3JRO A;  3OKW A;  4A0A B;  4MMY A;  3RFH A;  3B7F A;  3OKT A;  5CXC B;  5CYK A;  4BP9 A;  2IUQ A;  5IC7 A;  5GXI A;  3MZK A;  4JXM A;  1UTC A;  5EMJ B;  5C2W B;  4JSN C;  4E54 B;  3MKS B;  3VI4 A;  2P9L C;  2HJB A;  2EIB A;  4GM3 A;  5GMK n;  4MMX A;  4BCC A;  3NID A;  3ODT A;  1H2Z A;  2P9I C;  4A0A A;  1K8K C;  5CXC A;  2OVP B;  4ZOV A;  4A2L A;  4IMM A;  2UZY B;  1VYH C;  5C86 A;  3SWS D;  2IWF A;  4ERY A;  4JT5 C;  3SVW D;  4O1Q D;  3UVO A;  5M5V A;  3SHF A;  2HKM A;  2H6N A;  3JZN A;  3ZE1 A;  5E6U A;  4X63 B;  5FKS A;  2B5L A;  3OL2 A;  1SQ9 A;  1E8N A;  2XU7 A;  5FKR A;  3I7P A;  2H68 A;  3RN1 D;  4GM9 A;  3IJ0 A;  4L9O A;  5M5S A;  4I79 A;  4CI1 A;  3EI4 B;  2CO0 C;  4J79 A;  2XYI A;  3F3P A;  2EIE A;  4H5I A;  4PSX B;  2OIZ A;  4FA9 D; 
#chains in the Genus database with same CATH homology
 2IUR A;  1GOT B;  3PVW B;  3UVK A;  2P9P C;  2IWK A;  2CE9 A;  2BCJ B;  1OMW B;  5I5I A;  2H14 A;  4XYI A;  1L0Q A;  3PXS D;  1S4U X;  4X60 B;  2H9P A;  5FXY A;  5HQG A;  4FAN D;  3PSL A;  2I0R A;  4HDJ A;  3N0E A;  4CY5 A;  4LG8 A;  3SXT D;  4QQE A;  5JWZ A;  3P4F A;  4J84 A;  4Z8L A;  4R7A B;  3UR4 A;  3DSM A;  2J55 H;  2H6K A;  3JAM g;  1PEV A;  4CI8 A;  3JZG A;  3MMY A;  2HXC A;  2EBS A;  4QL1 A;  1XIP A;  1B9X A;  4JSX C;  3HFQ A;  1XHM A;  2B5M A;  3KRX B;  4GQ2 P;  4Y7R A;  1PBY B;  4IA9 A;  4J0X A;  3FM0 A;  3I7L A;  5EM2 A;  1SQJ A;  4K3I D;  4ZOX A;  3RSE C;  2B4E A;  2P9N C;  5THA A;  4JT6 C;  2QXV A;  2AGL A;  3AL8 A;  3GFC A;  3EI1 A;  4PNK B;  3W15 A;  4A09 B;  2UZX B;  5IT9 g;  2OVQ B;  5FQD A;  2H13 A;  3C9C A;  4A11 B;  5CXB B;  3J81 g;  2CNX A;  2Z2N A;  4J82 A;  3UVN A;  4JD2 C;  3K26 A;  5SXM A;  2AGZ A;  2GC4 A;  4CY2 A;  3EU7 A;  1U4C A;  4LGN A;  1K32 A;  2GNQ A;  3UKU C;  4A7J A;  2CN3 A;  5FKT A;  5IJ8 E;  1U2V C;  4QRJ A;  3AL9 A;  5CXB A;  2I0T A;  4CZV A;  3I8E A;  5EMK B;  3RRM C;  3VH0 A;  2YNP A;  3I7N A;  5FLX g;  2YMU A;  4X61 B;  3U4Y A;  3DXK C;  2HYE A;  4CI2 A;  2Q7Q A;  4KFM B;  1GP2 B;  3C75 H;  3I89 A;  4XEI C;  2J56 H;  4E54 A;  5HE2 B;  5EAL A;  2I3S A;  2P9S C;  4QT8 A;  3UKR C;  5K19 A;  5TF2 A;  3JB9 L;  4G56 B;  1GG2 B;  3N0D A;  1GXR A;  2IUP A;  3F3G A;  4Y5R D;  4EWR A;  4CI3 A;  4GQB B;  2OJY A;  1XKS A;  4PSW B;  1JMZ B;  2B5N A;  3IIW A;  3BG0 A;  1OLZ A;  4L3H D;  4AEZ A;  4YVD A;  1JOF A;  2AH0 A;  3PE7 A;  2OK4 A;  2I3T A;  3OKY B;  2AGY A;  3EI4 A;  1YFQ A;  3DWL C;  3F3F A;  3AH8 B;  3JPX A;  3VGZ A;  1N6E A;  1RI6 A;  2PM9 B;  3OKY A;  2HJ4 A;  3NVX A;  2O9K A;  2PM6 B;  4ZOY A;  4A0B B;  2P9K C;  4PC0 A;  3PVU B;  2IAA A;  3I7K A;  4GZ8 A;  3GRE A;  4J8B A;  3A0F A;  2PM9 A;  1JJU B;  3KRW B;  4FAV D;  4PXW A;  3EI2 B;  4GMB A;  3ULE C;  4D6V A;  5IJ7 E;  3SMR A;  4AOW A;  3FGB A;  2CO0 A;  4UI9 R;  4GGC A;  3SBP A;  4BH6 A;  4FB1 D;  4BL0 A;  4N14 A;  4O9D A;  5HE1 B;  1JMX B;  2QC5 A;  5GSA A;  4X3E A;  1P22 A;  3CIK B;  5EAP A;  1R5M A;  3E0C A;  1TBG A;  5C9Z B;  3CFS B;  2H9N A;  3I7O A;  2AQ5 A;  3EG6 A;  2Z2P A;  3EI3 B;  2G99 A;  3L4M D;  3I2N A;  4A09 A;  4A08 B;  5GXH A;  1A0R B;  5EAM A;  3DM0 A;  5KDO B;  3SBQ A;  4A11 A;  5TEE A;  4FHL A;  3RMZ D;  4ZOZ A;  2J57 G;  3ZWL B;  3J80 g;  2OK6 A;  5H1M A;  2CE8 A;  3EMH A;  2CN2 A;  5I5M A;  3L4O D;  3SLE D;  2H3X A;  3K27 A;  1TYQ C;  2HKR A;  5FKQ A;  1N6F A;  4ES0 A;  4E5Z B;  3OTT A;  1N6D A;  5A2Q g;  2PBI B;  4L3G D;  5HE0 B;  4GGA A;  5AFU 3;  2H6Q A;  2YB8 B;  4O3T B;  4O3U B;  3IJ1 A;  1FWX A;  5AJA A;  4OWR A;  2IUV A;  4BUJ C;  4E5Z A;  3AFC A;  3UVM A;  3OL2 B;  4LG9 A;  4PBZ A;  1MG3 A;  2H47 A;  4XYH A;  3NVN A;  2YNN A;  3RFG A;  4U7A A;  4NSX A;  4ZN4 A;  3OW8 A;  3EWE A;  3PXW D;  4J0W A;  3MKQ A;  2I0S A;  3UVL A;  3BWS A;  4CY1 A;  4JSV C;  3SJL D;  4OZU A;  4ESG A;  3VA6 A;  2YNO A;  3V5W B;  5FA5 B;  4FA5 D;  3ORV D;  3SN6 B;  2YBA A;  2HES X;  2MTA H;  3RLM D;  4JSP C;  2PM7 B;  4L1Q D;  4GM8 A;  4U1E I;  2XL3 A;  3CFV A;  2G9A A;  3IIY A;  1NR0 A;  3NVQ A;  3DXM C;  3SCY A;  1ERJ A;  4J81 A;  1MDA H;  4J78 A;  3V7D B;  5HE3 B;  3IJC A;  2P9U C;  5AMS A;  5H17 A;  4D0K A;  4CZY A;  1Q47 A;  1MG2 A;  5IGO A;  4O45 A;  5TDH B;  2AGW A;  4ERQ A;  2XL2 A;  2BBK H;  3V9F A;  4J73 A;  4GGD A;  4J8G A;  5K1C C;  5C2V B;  3SFZ A;  2GC7 A;  3MZL A;  4MK0 B;  4A0B A;  4CY3 A;  1PGU A;  2AGX A;  3SBR A;  4PBY A;  4J87 A;  4H5J A;  4K3J B;  3EI2 A;  5B4W A;  5EM2 B;  4J77 A;  5EMM B;  4GQ1 A;  1NEX B;  1PI6 A;  3AL8 B;  2OVR B;  5HYN B;  3IKO A;  3EI1 B;  1SHY B;  5EAR A;  2H9L A;  4A2M A;  3BG1 A;  4CZX A;  3I7H A;  4FA4 D;  4TZ4 A;  2Z2O A;  3PXT D;  5H14 A;  5I5J A;  3JRP A;  3C5M A;  3RN0 D;  1QNI A;  3C99 A;  2AH1 A;  3MXX A;  4ERZ A;  5CYK B;  5TEF A;  3EI3 A;  1B9Y A;  2TRC B;  4J86 A;  4CC9 A;  4A08 A;  3I8C A;  3JZH A;  5IGQ A;  4FWW A;  2W18 A;  2H9M A;  3PSC B;  5EML B;  3FRX A;  4FA1 D;  3JRO A;  3OKW A;  4A0A B;  3RFH A;  3B7F A;  3OKT A;  5CXC B;  5CYK A;  2IUQ A;  5IC7 A;  5GXI A;  3MZK A;  4JXM A;  5C2W B;  5EMJ B;  4E54 B;  4JSN C;  3MKS B;  2P9L C;  2HJB A;  5GMK n;  4GM3 A;  3ODT A;  2P9I C;  4A0A A;  1K8K C;  5CXC A;  2OVP B;  4ZOV A;  4A2L A;  4IMM A;  2UZY B;  1VYH C;  3SWS D;  2IWF A;  4ERY A;  4JT5 C;  3SVW D;  4O1Q D;  3UVO A;  3SHF A;  2HKM A;  2H6N A;  3JZN A;  4X63 B;  5FKS A;  2B5L A;  3OL2 A;  1SQ9 A;  2XU7 A;  5FKR A;  3I7P A;  2H68 A;  3RN1 D;  4GM9 A;  3IJ0 A;  4L9O A;  4I79 A;  4CI1 A;  3EI4 B;  2CO0 C;  4J79 A;  2XYI A;  3F3P A;  4H5I A;  4PSX B;  2OIZ A;  4FA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...