2CE9A

A wrpw peptide bound to the groucho-tle wd40 domain.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
337
structure length
337
Chain Sequence
b'DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 84
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce9A00
3C5MA 4GZ8A 3UVOA 5HE1B 2OK6A 4J79A 3EU7A 3PXSD 2I0SA 2AQ5A 4O9DA 4J8GA 3IJCA 5EMJB 4JSNC 2P9KC 4AEZA 2CO0C 2OVQB 4PBZA 3UVNA 2YBAA 2B5MA 5H14A 2PM9A 2H13A 3IIWA 2PM6B 2PBIB 4A2LA 4A09A 4L3GD 3PSLA 4JXMA 4E54A 5H1MA 1Q47A 2O9KA 4PSWB 2I3SA 1PEVA 1TYQC 5IGQA 5TEEA 1P22A 4AOWA 2GC4A 3OKYA 3J80g 3A0FA 4O3TB 5EMLB 4BH6A 5FXYA 4MK0B 4NSXA 4X3EA 3SVWD 4FA9D 3SWSD 2HESX 4J86A 1JMXB 3SFZA 5KDOB 1SQJA 3I8CA 3IIYA 3DXMC 5GSAA 3P4FA 5FKQA 1YFQA 2H9NA 2Z2OA 4ZOXA 5EM2A 5THAA 2H9LA 5B4WA 2XYIA 3EG6A 4CI1A 2AH1A 3I7NA 2H6NA 3RFGA 1TBGA 3CFSB 5GXHA 1PGUA 4QL1A 2CE8A 4JSXC 4L3HD 5EALA 4K3ID 5TDHB 4ZOYA 3UVLA 4E5ZA 3RSEC 4J84A 3BWSA 3V5WB 3E0CA 2YNNA 4CY1A 3I7PA 3AL8B 3MZKA 4O45A 4J8BA 5CXCA 3EI3B 2J57G 2QC5A 2AGYA 1JOFA 2HJ4A 2QXVA 3AH8B 3VA6A 2AGZA 3N0DA 3ZWLB 4A0BB 2XU7A 2H9MA 3JB9L 1SHYB 3MKSB 2MTAH 2CE9A 4GM8A 3OW8A 4JT5C 3OL2A 2I3TA 4QT8A 3I2NA 4QRJA 4ERYA 4FAVD 2I0RA 1NEXB 3C99A 3EI4A 4X63B 5FKRA 4FA4D 4R7AB 4A08B 3HFQA 2OVPB 5C2VB 2P9SC 3ORVD 3FGBA 2H6KA 3F3FA 3SJLD 4Z8LA 4I79A 5AFU3 4N14A 3AFCA 3K26A 4GGAA 4CY2A 4FWWA 5EAMA 3VGZA 3RN1D 3DSMA 4HDJA 5EMMB 4XYHA 4J73A 2AGXA 3OKWA 1ERJA 2I0TA 2PM7B 1MG3A 1N6EA 4ERQA 4LGNA 2OIZA 5A2Qg 3VH0A 5JWZA 2B5NA 5SXMA 5AJAA 2Q7QA 3NVQA 3OKTA 4ZOZA 3J81g 3V9FA 4CY3A 2HYEA 2P9NC 5H17A 3BG0A 4JT6C 4QQEA 3I7KA 4FAND 2J56H 4L1QD 2CN3A 3UVMA 4GQBB 3EI2B 5CXBA 4O3UB 2H9PA 4UI9R 1S4UX 1XHMA 5K19A 3F3GA 2AGLA 1L0QA 3NVNA 2OJYA 3SLED 5C9ZB 1FWXA 3MKQA 5GMKn 5IT9g 3OTTA 2H47A 2Z2NA 4K3JB 4J82A 2GC7A 4PXWA 2IWKA 3SBQA 4Y5RD 5EM2B 2BCJB 3SBRA 2IUQA 2TRCB 2H68A 4CI8A 3MZLA 3B7FA 3JZGA 3JZNA 5IGOA 3PVWB 2AGWA 3IKOA 4CI3A 4A11B 3GFCA 5FKSA 3EI1B 1XKSA 2Z2PA 4GGCA 2CNXA 4GQ2P 2W18A 3AL8A 4H5IA 3EI3A 4A0AB 4X61B 2IAAA 4GM9A 4BUJC 4LG8A 2P9LC 5HE3B 3RN0D 3SCYA 2J55H 1GOTB 2BBKH 2YNOA 4J81A 1XIPA 5EMKB 3L4MD 4J0WA 2HKMA 3RMZD 5I5JA 3K27A 2IURA 4U1EI 4J78A 1N6FA 4OWRA 2H6QA 4IA9A 1PBYB 1MDAH 2B5LA 3I7HA 5CYKB 2OK4A 3SXTD 5AMSA 3UKRC 5IJ7E 5I5IA 5TEFA 3I89A 4X60B 3ODTA 4A08A 1N6DA 5I5MA 5C2WB 2YB8B 3JRPA 1VYHC 3MMYA 3RRMC 1U4CA 3UKUC 3AL9A 3RLMD 1RI6A 1GG2B 2IUPA 1QNIA 3GREA 2XL2A 2G99A 4D6VA 3EWEA 4JD2C 3I8EA 2AH0A 5K1CC 2YNPA 5EARA 3CFVA 5IC7A 1JMZB 5TF2A 3MXXA 2HKRA 1K8KC 4ESGA 4H5JA 2PM9B 1GXRA 2CO0A 4ZOVA 3KRWB 4A09B 3CIKB 1B9YA 2H14A 4IMMA 4J87A 4E54B 1A0RB 4PNKB 3PE7A 4YVDA 2P9UC 1B9XA 4FA1D 3KRXB 1OLZA 2YMUA 3RFHA 3EI2A 4O1QD 4XYIA 3EMHA 3OKYB 4XEIC 5FA5B 4CZYA 3V7DB 3I7OA 5CXBB 3SMRA 4CZXA 3BG1A 2UZYB 4CZVA 3SHFA 3SBPA 4GQ1A 2UZXB 1JJUB 3IJ0A 1OMWB 3ULEC 4OZUA 3PVUB 4J77A 3C75H 1NR0A 2GNQA 4J0XA 4CI2A 4ES0A 3DXKC 3UR4A 3JROA 4A7JA 2G9AA 5FLXg 4PC0A 4E5ZB 4A11A 3N0EA 3EI1A 4PSXB 5GXIA 4TZ4A 4ERZA 4U7AA 4JSPC 3IJ1A 5CXCB 3PXTD 2HJBA 3SN6B 3UVKA 4A0AA 3DWLC 5HQGA 2P9PC 4KFMB 4A0BA 4LG9A 3C9CA 4FHLA 3W15A 2H3XA 3FM0A 3I7LA 4FB1D 4CY5A 3FRXA 3U4YA 4CC9A 4ZN4A 4Y7RA 5HE0B 5FQDA 3F3PA 4G56B 4GMBA 2P9IC 1MG2A 3DM0A 4GGDA 2IWFA 4FA5D 3OL2B 3NVXA 4PBYA 3JPXA 3PSCB 4D0KA 3L4OD 1SQ9A 3JZHA 5HYNB 3JAMg 3EI4B 2XL3A 4L9OA 5CYKA 2CN2A 2OVRB 4BL0A 4A2MA 2EBSA 4GM3A 1R5MA 1K32A 3PXWD 5IJ8E 5HE2B 4EWRA 1PI6A 1U2VC 1GP2B 2HXCA 2B4EA 2IUVA 5FKTA 4JSVC 5EAPA
chains in the Genus database with same CATH superfamily
3C5MA 1U8CA 3O4GA 4GZ8A 5E6UA 3UVOA 1JTDB 1GOGA 1VE7A 5HE1B 2OK6A 4J79A 3EU7A 1UOPA 2XZGA 3PXSD 2I0SA 2AQ5A 3O4IA 4O9DA 5FFOA 4J8GA 4Z7NA 3IJCA 5EMJB 4JSNC 2P9KC 4AEZA 3O4JA 2CO0C 2OVQB 4PBZA 3UVNA 2YBAA 2B5MA 3GC3B 5FFGA 5H14A 2PM9A 2H13A 3IIWA 2PM6B 2PBIB 4A2LA 3QI0A 4A09A 1E8NA 4L3GD 2JKXA 1GOFA 3PSLA 4JXMA 4AN0A 4E54A 5H1MA 1E8MA 1Q47A 2O9KA 4PSWB 2I3SA 1T2XA 1PEVA 1TYQC 5IGQA 5TEEA 1P22A 4AOWA 2GC4A 1QFMA 2VDQA 3GD1I 3OKYA 4WJKA 3J80g 1UTCA 3A0FA 4O3TB 5EMLB 3T3MA 4BH6A 5FXYA 4MK0B 3ZE0A 4IRZA 2VC2A 4NSXA 4X3EA 3SVWD 4FA9D 3SWSD 2HESX 4J86A 1JMXB 3SFZA 2VDPA 5KDOB 1H2YA 1SQJA 2VDLA 3I8CA 3IIYA 3DXMC 5GSAA 3P4FA 5FKQA 1YFQA 2H9NA 2Z2OA 2VDRA 4ZOXA 5EM2A 5THAA 2H9LA 5B4WA 2XYIA 3EG6A 2VZ3A 1TYEA 4CI1A 2AH1A 3I7NA 4AMZA 2H6NA 3RFGA 1TBGA 3CFSB 5GXHA 1PGUA 4QL1A 2CE8A 4JSXC 4L3HD 5EALA 4K3ID 3VI4A 5TDHB 4ZOYA 3UVLA 2XDWA 4E5ZA 4NC4A 3RSEC 4J84A 3BWSA 3V5WB 3E0CA 3NIGA 2YNNA 4CY1A 3I7PA 3AL8B 4RE6A 3MZKA 3ZDZA 4DNVA 4O45A 4J8BA 5CXCA 4RE5A 1O6FA 3IULA 3EI3B 4NENA 2J57G 4G1MA 4G55A 2QC5A 5E6RA 2AGYA 1JOFA 2HJ4A 2QXVA 4G1EA 3AH8B 3VA6A 4O02A 3T3PA 2AGZA 3N0DA 3ZWLB 4A0BB 2WQ8A 2XU7A 3NIDA 2H9MA 3JB9L 2EIEA 1SHYB 3MKSB 2MTAH 2CE9A 4GM8A 4MMZA 3OW8A 3K72A 4JT5C 3OL2A 2I3TA 4QT8A 3I2NA 4QRJA 4ERYA 4FAVD 2I0RA 1NEXB 2VZ1A 3C99A 3EI4A 4X63B 5FKRA 4FA4D 4R7AB 4A08B 3HFQA 2OVPB 3DDUA 5C2VB 2P9SC 3ORVD 3FGBA 2H6KA 3F3FA 2BKLA 3SJLD 4Z8LA 4I79A 5HDBA 5AFU3 4N14A 3AFCA 3K26A 4GGAA 4CY2A 4FWWA 5EAMA 3VGZA 3RN1D 3DSMA 3IUJA 2HU8A 4HDJA 1BPOA 5EMMB 4XYHA 4J73A 2AGXA 3OKWA 3MUOA 1C9LA 4O2WA 1ERJA 2I0TA 2PM7B 1MG3A 1N6EA 4ERQA 4LGNA 2OIZA 5A2Qg 3VH0A 5JWZA 3EQ8A 2B5NA 5SXMA 5AJAA 2Q7QA 3NVQA 1VZ2A 3ZE2A 3OKTA 4ZOZA 4L1MA 3J81g 3V9FA 5M61A 4BCBA 4CY3A 1L5GA 2P9NC 1M1XA 5H17A 2HYEA 3BG0A 4JT6C 4QQEA 3I7KA 4FAND 2J56H 4BP9A 4L1QD 2CN3A 3UVMA 3IUNA 4GQBB 3EI2B 5CXBA 4O3UB 1I2MB 2H9PA 4UI9R 1S4UX 1XHMA 5K19A 3VI3A 3F3GA 2AGLA 1L0QA 3NVNA 2OJYA 3SLED 5C9ZB 1FWXA 3MKQA 5GMKn 5IT9g 3OTTA 2H47A 2Z2NA 4K3JB 3IUMA 4J82A 2HU5A 2GC7A 4PXWA 2IWKA 3SBQA 4Y5RD 5EM2B 2BCJB 3SBRA 5C86A 2IUQA 2TRCB 3OF7A 2EIBA 2H68A 3IUQA 4CI8A 3MZLA 3B7FA 3JZGA 3JZNA 1H2XA 5IGOA 3MVDK 3PVWB 2AGWA 3IKOA 4CI3A 4A11B 3GFCA 3ZDYA 5FKSA 4MMXA 3EI1B 1XKSA 2Z2PA 1YR2A 3EQ9A 4GGCA 4Z7OA 2CNXA 4GQ2P 2W18A 3AL8A 4UM9A 1QFSA 4H5IA 3EI3A 4A0AB 4X61B 2IAAA 4GM9A 4BUJC 4LG8A 2P9LC 5HE3B 3RN0D 3SCYA 2J55H 1H2WA 1GOTB 1UOOA 2BBKH 2YNOA 4J81A 1XIPA 5EMKB 4DNUA 1JV2A 3FCSA 3L4MD 1VZ3A 4J0WA 5E6SA 5M5VA 2HKMA 3RMZD 5I5JA 3K27A 2IURA 4U1EI 4J78A 3NIFA 1N6FA 4OWRA 2H6QA 4IA9A 1PBYB 1MDAH 2B5LA 3I7HA 5CYKB 2OK4A 3SXTD 5AMSA 3UKRC 5IJ7E 5I5IA 4WK4A 5TEFA 3I89A 4X60B 3ODTA 3V4PA 5M5TA 4A08A 1N6DA 5I5MA 5C2WB 2YB8B 3JRPA 1VYHC 3K71A 3MMYA 3RRMC 1U4CA 4DNWA 3UKUC 3AL9A 3RLMD 1RI6A 2QZPA 1GG2B 2IUPA 1QNIA 3GREA 2XL2A 2G99A 2EICA 4D6VA 3EWEA 4JD2C 1A12A 3I8EA 1GOHA 2AH0A 5K1CC 2YNPA 5EARA 3CFVA 5IC7A 3ZE1A 1JMZB 1UOQA 5TF2A 4MMYA 3MXXA 2HKRA 1K3IA 1K8KC 4ESGA 4H5JA 2PM9B 4BP8A 1GXRA 1E5TA 2CO0A 4ZOVA 3KRWB 4A09B 2HU7A 3CIKB 1B9YA 2H14A 3MUNA 4IMMA 4J87A 4E54B 1A0RB 4PNKB 3PE7A 4YVDA 2P9UC 1B9XA 4FA1D 3KRXB 1OLZA 2YMUA 3RFHA 4BCDA 2VDOA 3EI2A 4O1QD 4XYIA 4NBMA 3EMHA 3OKYB 4XEIC 4D9SA 5FA5B 4CZYA 3V7DB 3I7OA 5CXBB 3SMRA 4CZXA 3KCIA 3BG1A 4WK2A 5M5UA 2UZYB 4CZVA 3SHFA 3IJEA 3SBPA 4GQ1A 2UZXB 1JJUB 1C9IA 3IJ0A 3QHYB 2QR5A 3FCUA 1OMWB 3ULEC 4OZUA 3O4HA 1H2ZA 3V4VA 3PVUB 4J77A 1O6GA 3C75H 1NR0A 2GNQA 4J0XA 4CI2A 2VDNA 4ES0A 3DXKC 3UR4A 3JROA 4A7JA 2G9AA 5FLXg 4PC0A 4NAAA 2EIDA 4JHNA 4E5ZB 4A11A 3N0EA 3EI1A 3K6SA 4PSXB 5GXIA 4TZ4A 2VDKA 4ERZA 4U7AA 4JSPC 4WK0A 3IJ1A 5CXCB 3PXTD 2HJBA 3SN6B 3UVKA 4A0AA 5M5RA 3DWLC 5HQGA 2P9PC 4KFMB 4A0BA 4LG9A 3C9CA 4FHLA 3W15A 2H3XA 2XE4A 3FM0A 3I7LA 4FB1D 5M5SA 4Z7QA 5C92A 4AMYA 4CY5A 3FRXA 3U4YA 3EQ7A 4CC9A 4ZN4A 4Y7RA 3IVMA 5HE0B 5FQDA 3F3PA 4G56B 4GMBA 2P9IC 1MG2A 3DM0A 4GGDA 2IWFA 4FA5D 3OL2B 3NVXA 2VDMA 4PBYA 3JPXA 3PSCB 3ZDXA 4BCCA 4D0KA 1VE6A 3L4OD 1SQ9A 3JZHA 4AX4A 5HYNB 3EI4B 2XL3A 4L9OA 5CYKA 3JAMg 2CN2A 2OVRB 4AN1A 4BL0A 4A2MA 2EBSA 4GM3A 3IURA 4QAMA 1R5MA 4UM8A 1K32A 4JHPC 3PXWD 5IJ8E 5HE2B 4EWRA 1PI6A 1U2VC 1GP2B 2HXCA 2B4EA 2IUVA 5FKTA 4JSVC 5EAPA
chains in the Genus database with same CATH topology
3C5MA 4GZ8A 3UVOA 5HE1B 2OK6A 4J79A 3EU7A 3PXSD 2I0SA 2AQ5A 4O9DA 4J8GA 3IJCA 5EMJB 4JSNC 2P9KC 4AEZA 2CO0C 2OVQB 4PBZA 3UVNA 2YBAA 2B5MA 5H14A 2PM9A 2H13A 3IIWA 2PM6B 2PBIB 4A2LA 4A09A 4L3GD 3PSLA 4JXMA 4E54A 5H1MA 1Q47A 2O9KA 4PSWB 2I3SA 1PEVA 1TYQC 5IGQA 5TEEA 1P22A 4AOWA 2GC4A 3OKYA 3J80g 3A0FA 4O3TB 5EMLB 4BH6A 5FXYA 4MK0B 4NSXA 4X3EA 3SVWD 4FA9D 3SWSD 2HESX 4J86A 1JMXB 3SFZA 5KDOB 1SQJA 3I8CA 3IIYA 3DXMC 5GSAA 3P4FA 5FKQA 1YFQA 2H9NA 2Z2OA 4ZOXA 5EM2A 5THAA 2H9LA 5B4WA 2XYIA 3EG6A 4CI1A 2AH1A 3I7NA 2H6NA 3RFGA 1TBGA 3CFSB 5GXHA 1PGUA 4QL1A 2CE8A 4JSXC 4L3HD 5EALA 4K3ID 5TDHB 4ZOYA 3UVLA 4E5ZA 3RSEC 4J84A 3BWSA 3V5WB 3E0CA 2YNNA 4CY1A 3I7PA 3AL8B 3MZKA 4O45A 4J8BA 5CXCA 3EI3B 2J57G 2QC5A 2AGYA 1JOFA 2HJ4A 2QXVA 3AH8B 3VA6A 2AGZA 3N0DA 3ZWLB 4A0BB 2XU7A 2H9MA 3JB9L 1SHYB 3MKSB 2MTAH 2CE9A 4GM8A 3OW8A 4JT5C 3OL2A 2I3TA 4QT8A 3I2NA 4QRJA 4ERYA 4FAVD 2I0RA 1NEXB 3C99A 3EI4A 4X63B 5FKRA 4FA4D 4R7AB 4A08B 3HFQA 2OVPB 5C2VB 2P9SC 3ORVD 3FGBA 2H6KA 3F3FA 3SJLD 4Z8LA 4I79A 5AFU3 4N14A 3AFCA 3K26A 4GGAA 4CY2A 4FWWA 5EAMA 3VGZA 3RN1D 3DSMA 4HDJA 5EMMB 4XYHA 4J73A 2AGXA 3OKWA 1ERJA 2I0TA 2PM7B 1MG3A 1N6EA 4ERQA 4LGNA 2OIZA 5A2Qg 3VH0A 5JWZA 2B5NA 5SXMA 5AJAA 2Q7QA 3NVQA 3OKTA 4ZOZA 3J81g 3V9FA 4CY3A 2HYEA 2P9NC 5H17A 3BG0A 4JT6C 4QQEA 3I7KA 4FAND 2J56H 4L1QD 2CN3A 3UVMA 4GQBB 3EI2B 5CXBA 4O3UB 2H9PA 4UI9R 1S4UX 1XHMA 5K19A 3F3GA 2AGLA 1L0QA 3NVNA 2OJYA 3SLED 5C9ZB 1FWXA 3MKQA 5GMKn 5IT9g 3OTTA 2H47A 2Z2NA 4K3JB 4J82A 2GC7A 4PXWA 2IWKA 3SBQA 4Y5RD 5EM2B 2BCJB 3SBRA 2IUQA 2TRCB 2H68A 4CI8A 3MZLA 3B7FA 3JZGA 3JZNA 5IGOA 3PVWB 2AGWA 3IKOA 4CI3A 4A11B 3GFCA 5FKSA 3EI1B 1XKSA 2Z2PA 4GGCA 2CNXA 4GQ2P 2W18A 3AL8A 4H5IA 3EI3A 4A0AB 4X61B 2IAAA 4GM9A 4BUJC 4LG8A 2P9LC 5HE3B 3RN0D 3SCYA 2J55H 1GOTB 2BBKH 2YNOA 4J81A 1XIPA 5EMKB 3L4MD 4J0WA 2HKMA 3RMZD 5I5JA 3K27A 2IURA 4U1EI 4J78A 1N6FA 4OWRA 2H6QA 4IA9A 1PBYB 1MDAH 2B5LA 3I7HA 5CYKB 2OK4A 3SXTD 5AMSA 3UKRC 5IJ7E 5I5IA 5TEFA 3I89A 4X60B 3ODTA 4A08A 1N6DA 5I5MA 5C2WB 2YB8B 3JRPA 1VYHC 3MMYA 3RRMC 1U4CA 3UKUC 3AL9A 3RLMD 1RI6A 1GG2B 2IUPA 1QNIA 3GREA 2XL2A 2G99A 4D6VA 3EWEA 4JD2C 3I8EA 2AH0A 5K1CC 2YNPA 5EARA 3CFVA 5IC7A 1JMZB 5TF2A 3MXXA 2HKRA 1K8KC 4ESGA 4H5JA 2PM9B 1GXRA 2CO0A 4ZOVA 3KRWB 4A09B 3CIKB 1B9YA 2H14A 4IMMA 4J87A 4E54B 1A0RB 4PNKB 3PE7A 4YVDA 2P9UC 1B9XA 4FA1D 3KRXB 1OLZA 2YMUA 3RFHA 3EI2A 4O1QD 4XYIA 3EMHA 3OKYB 4XEIC 5FA5B 4CZYA 3V7DB 3I7OA 5CXBB 3SMRA 4CZXA 3BG1A 2UZYB 4CZVA 3SHFA 3SBPA 4GQ1A 2UZXB 1JJUB 3IJ0A 1OMWB 3ULEC 4OZUA 3PVUB 4J77A 3C75H 1NR0A 2GNQA 4J0XA 4CI2A 4ES0A 3DXKC 3UR4A 3JROA 4A7JA 2G9AA 5FLXg 4PC0A 4E5ZB 4A11A 3N0EA 3EI1A 4PSXB 5GXIA 4TZ4A 4ERZA 4U7AA 4JSPC 3IJ1A 5CXCB 3PXTD 2HJBA 3SN6B 3UVKA 4A0AA 3DWLC 5HQGA 2P9PC 4KFMB 4A0BA 4LG9A 3C9CA 4FHLA 3W15A 2H3XA 3FM0A 3I7LA 4FB1D 4CY5A 3FRXA 3U4YA 4CC9A 4ZN4A 4Y7RA 5HE0B 5FQDA 3F3PA 4G56B 4GMBA 2P9IC 1MG2A 3DM0A 4GGDA 2IWFA 4FA5D 3OL2B 3NVXA 4PBYA 3JPXA 3PSCB 4D0KA 3L4OD 1SQ9A 3JZHA 5HYNB 3JAMg 3EI4B 2XL3A 4L9OA 5CYKA 2CN2A 2OVRB 4BL0A 4A2MA 2EBSA 4GM3A 1R5MA 1K32A 3PXWD 5IJ8E 5HE2B 4EWRA 1PI6A 1U2VC 1GP2B 2HXCA 2B4EA 2IUVA 5FKTA 4JSVC 5EAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5M A;  4GZ8 A;  3UVO A;  5HE1 B;  2OK6 A;  4J79 A;  3EU7 A;  3PXS D;  2I0S A;  2AQ5 A;  4O9D A;  4J8G A;  3IJC A;  5EMJ B;  4JSN C;  2P9K C;  4AEZ A;  2CO0 C;  2OVQ B;  4PBZ A;  3UVN A;  2YBA A;  2B5M A;  5H14 A;  2PM9 A;  2H13 A;  3IIW A;  2PM6 B;  2PBI B;  4A2L A;  4A09 A;  4L3G D;  3PSL A;  4JXM A;  4E54 A;  5H1M A;  1Q47 A;  2O9K A;  4PSW B;  2I3S A;  1PEV A;  1TYQ C;  5IGQ A;  5TEE A;  1P22 A;  4AOW A;  2GC4 A;  3OKY A;  3J80 g;  3A0F A;  4O3T B;  5EML B;  4BH6 A;  5FXY A;  4MK0 B;  4NSX A;  4X3E A;  3SVW D;  4FA9 D;  3SWS D;  2HES X;  4J86 A;  1JMX B;  3SFZ A;  5KDO B;  1SQJ A;  3I8C A;  3IIY A;  3DXM C;  5GSA A;  3P4F A;  5FKQ A;  1YFQ A;  2H9N A;  2Z2O A;  4ZOX A;  5EM2 A;  5THA A;  2H9L A;  5B4W A;  2XYI A;  3EG6 A;  4CI1 A;  2AH1 A;  3I7N A;  2H6N A;  3RFG A;  1TBG A;  3CFS B;  5GXH A;  1PGU A;  4QL1 A;  2CE8 A;  4JSX C;  4L3H D;  5EAL A;  4K3I D;  5TDH B;  4ZOY A;  3UVL A;  4E5Z A;  3RSE C;  4J84 A;  3BWS A;  3V5W B;  3E0C A;  2YNN A;  4CY1 A;  3I7P A;  3AL8 B;  3MZK A;  4O45 A;  4J8B A;  5CXC A;  3EI3 B;  2J57 G;  2QC5 A;  2AGY A;  1JOF A;  2HJ4 A;  2QXV A;  3AH8 B;  3VA6 A;  2AGZ A;  3N0D A;  3ZWL B;  4A0B B;  2XU7 A;  2H9M A;  3JB9 L;  1SHY B;  3MKS B;  2MTA H;  2CE9 A;  4GM8 A;  3OW8 A;  4JT5 C;  3OL2 A;  2I3T A;  4QT8 A;  3I2N A;  4QRJ A;  4ERY A;  4FAV D;  2I0R A;  1NEX B;  3C99 A;  3EI4 A;  4X63 B;  5FKR A;  4FA4 D;  4R7A B;  4A08 B;  3HFQ A;  2OVP B;  5C2V B;  2P9S C;  3ORV D;  3FGB A;  2H6K A;  3F3F A;  3SJL D;  4Z8L A;  4I79 A;  5AFU 3;  4N14 A;  3AFC A;  3K26 A;  4GGA A;  4CY2 A;  4FWW A;  5EAM A;  3VGZ A;  3RN1 D;  3DSM A;  4HDJ A;  5EMM B;  4XYH A;  4J73 A;  2AGX A;  3OKW A;  1ERJ A;  2I0T A;  2PM7 B;  1MG3 A;  1N6E A;  4ERQ A;  4LGN A;  2OIZ A;  5A2Q g;  3VH0 A;  5JWZ A;  2B5N A;  5SXM A;  5AJA A;  2Q7Q A;  3NVQ A;  3OKT A;  4ZOZ A;  3J81 g;  3V9F A;  4CY3 A;  2HYE A;  2P9N C;  5H17 A;  3BG0 A;  4JT6 C;  4QQE A;  3I7K A;  4FAN D;  2J56 H;  4L1Q D;  2CN3 A;  3UVM A;  4GQB B;  3EI2 B;  5CXB A;  4O3U B;  2H9P A;  4UI9 R;  1S4U X;  1XHM A;  5K19 A;  3F3G A;  2AGL A;  1L0Q A;  3NVN A;  2OJY A;  3SLE D;  5C9Z B;  1FWX A;  3MKQ A;  5GMK n;  5IT9 g;  3OTT A;  2H47 A;  2Z2N A;  4K3J B;  4J82 A;  2GC7 A;  4PXW A;  2IWK A;  3SBQ A;  4Y5R D;  5EM2 B;  2BCJ B;  3SBR A;  2IUQ A;  2TRC B;  2H68 A;  4CI8 A;  3MZL A;  3B7F A;  3JZG A;  3JZN A;  5IGO A;  3PVW B;  2AGW A;  3IKO A;  4CI3 A;  4A11 B;  3GFC A;  5FKS A;  3EI1 B;  1XKS A;  2Z2P A;  4GGC A;  2CNX A;  4GQ2 P;  2W18 A;  3AL8 A;  4H5I A;  3EI3 A;  4A0A B;  4X61 B;  2IAA A;  4GM9 A;  4BUJ C;  4LG8 A;  2P9L C;  5HE3 B;  3RN0 D;  3SCY A;  2J55 H;  1GOT B;  2BBK H;  2YNO A;  4J81 A;  1XIP A;  5EMK B;  3L4M D;  4J0W A;  2HKM A;  3RMZ D;  5I5J A;  3K27 A;  2IUR A;  4U1E I;  4J78 A;  1N6F A;  4OWR A;  2H6Q A;  4IA9 A;  1PBY B;  1MDA H;  2B5L A;  3I7H A;  5CYK B;  2OK4 A;  3SXT D;  5AMS A;  3UKR C;  5IJ7 E;  5I5I A;  5TEF A;  3I89 A;  4X60 B;  3ODT A;  4A08 A;  1N6D A;  5I5M A;  5C2W B;  2YB8 B;  3JRP A;  1VYH C;  3MMY A;  3RRM C;  1U4C A;  3UKU C;  3AL9 A;  3RLM D;  1RI6 A;  1GG2 B;  2IUP A;  1QNI A;  3GRE A;  2XL2 A;  2G99 A;  4D6V A;  3EWE A;  4JD2 C;  3I8E A;  2AH0 A;  5K1C C;  2YNP A;  5EAR A;  3CFV A;  5IC7 A;  1JMZ B;  5TF2 A;  3MXX A;  2HKR A;  1K8K C;  4ESG A;  4H5J A;  2PM9 B;  1GXR A;  2CO0 A;  4ZOV A;  3KRW B;  4A09 B;  3CIK B;  1B9Y A;  2H14 A;  4IMM A;  4J87 A;  4E54 B;  1A0R B;  4PNK B;  3PE7 A;  4YVD A;  2P9U C;  1B9X A;  4FA1 D;  3KRX B;  1OLZ A;  2YMU A;  3RFH A;  3EI2 A;  4O1Q D;  4XYI A;  3EMH A;  3OKY B;  4XEI C;  5FA5 B;  4CZY A;  3V7D B;  3I7O A;  5CXB B;  3SMR A;  4CZX A;  3BG1 A;  2UZY B;  4CZV A;  3SHF A;  3SBP A;  4GQ1 A;  2UZX B;  1JJU B;  3IJ0 A;  1OMW B;  3ULE C;  4OZU A;  3PVU B;  4J77 A;  3C75 H;  1NR0 A;  2GNQ A;  4J0X A;  4CI2 A;  4ES0 A;  3DXK C;  3UR4 A;  3JRO A;  4A7J A;  2G9A A;  5FLX g;  4PC0 A;  4E5Z B;  4A11 A;  3N0E A;  3EI1 A;  4PSX B;  5GXI A;  4TZ4 A;  4ERZ A;  4U7A A;  4JSP C;  3IJ1 A;  5CXC B;  3PXT D;  2HJB A;  3SN6 B;  3UVK A;  4A0A A;  3DWL C;  5HQG A;  2P9P C;  4KFM B;  4A0B A;  4LG9 A;  3C9C A;  4FHL A;  3W15 A;  2H3X A;  3FM0 A;  3I7L A;  4FB1 D;  4CY5 A;  3FRX A;  3U4Y A;  4CC9 A;  4ZN4 A;  4Y7R A;  5HE0 B;  5FQD A;  3F3P A;  4G56 B;  4GMB A;  2P9I C;  1MG2 A;  3DM0 A;  4GGD A;  2IWF A;  4FA5 D;  3OL2 B;  3NVX A;  4PBY A;  3JPX A;  3PSC B;  4D0K A;  3L4O D;  1SQ9 A;  3JZH A;  5HYN B;  3JAM g;  3EI4 B;  2XL3 A;  4L9O A;  5CYK A;  2CN2 A;  2OVR B;  4BL0 A;  4A2M A;  2EBS A;  4GM3 A;  1R5M A;  1K32 A;  3PXW D;  5IJ8 E;  5HE2 B;  4EWR A;  1PI6 A;  1U2V C;  1GP2 B;  2HXC A;  2B4E A;  2IUV A;  5FKT A;  4JSV C;  5EAP A; 
#chains in the Genus database with same CATH topology
 3C5M A;  1U8C A;  3O4G A;  4GZ8 A;  5E6U A;  3UVO A;  1JTD B;  1GOG A;  1VE7 A;  5HE1 B;  2OK6 A;  4J79 A;  3EU7 A;  1UOP A;  2XZG A;  3PXS D;  2I0S A;  2AQ5 A;  3O4I A;  4O9D A;  5FFO A;  4J8G A;  4Z7N A;  3IJC A;  5EMJ B;  4JSN C;  2P9K C;  4AEZ A;  3O4J A;  2CO0 C;  2OVQ B;  4PBZ A;  3UVN A;  2YBA A;  2B5M A;  3GC3 B;  5FFG A;  5H14 A;  2PM9 A;  2H13 A;  3IIW A;  2PM6 B;  2PBI B;  4A2L A;  3QI0 A;  4A09 A;  1E8N A;  4L3G D;  2JKX A;  1GOF A;  3PSL A;  4JXM A;  4AN0 A;  4E54 A;  5H1M A;  1E8M A;  1Q47 A;  2O9K A;  4PSW B;  2I3S A;  1T2X A;  1PEV A;  1TYQ C;  5IGQ A;  5TEE A;  1P22 A;  4AOW A;  2GC4 A;  1QFM A;  2VDQ A;  3GD1 I;  3OKY A;  4WJK A;  3J80 g;  1UTC A;  3A0F A;  4O3T B;  5EML B;  3T3M A;  4BH6 A;  5FXY A;  4MK0 B;  3ZE0 A;  4IRZ A;  2VC2 A;  4NSX A;  4X3E A;  3SVW D;  4FA9 D;  3SWS D;  2HES X;  4J86 A;  1JMX B;  3SFZ A;  2VDP A;  5KDO B;  1H2Y A;  1SQJ A;  2VDL A;  3I8C A;  3IIY A;  3DXM C;  5GSA A;  3P4F A;  5FKQ A;  1YFQ A;  2H9N A;  2Z2O A;  2VDR A;  4ZOX A;  5EM2 A;  5THA A;  2H9L A;  5B4W A;  2XYI A;  3EG6 A;  2VZ3 A;  1TYE A;  4CI1 A;  2AH1 A;  3I7N A;  4AMZ A;  2H6N A;  3RFG A;  1TBG A;  3CFS B;  5GXH A;  1PGU A;  4QL1 A;  2CE8 A;  4JSX C;  4L3H D;  5EAL A;  4K3I D;  3VI4 A;  5TDH B;  4ZOY A;  3UVL A;  2XDW A;  4E5Z A;  4NC4 A;  3RSE C;  4J84 A;  3BWS A;  3V5W B;  3E0C A;  3NIG A;  2YNN A;  4CY1 A;  3I7P A;  3AL8 B;  4RE6 A;  3MZK A;  3ZDZ A;  4DNV A;  4O45 A;  4J8B A;  5CXC A;  4RE5 A;  1O6F A;  3IUL A;  3EI3 B;  4NEN A;  2J57 G;  4G1M A;  4G55 A;  2QC5 A;  5E6R A;  2AGY A;  1JOF A;  2HJ4 A;  2QXV A;  4G1E A;  3AH8 B;  3VA6 A;  4O02 A;  3T3P A;  2AGZ A;  3N0D A;  3ZWL B;  4A0B B;  2WQ8 A;  2XU7 A;  3NID A;  2H9M A;  3JB9 L;  2EIE A;  1SHY B;  3MKS B;  2MTA H;  2CE9 A;  4GM8 A;  4MMZ A;  3OW8 A;  3K72 A;  4JT5 C;  3OL2 A;  2I3T A;  4QT8 A;  3I2N A;  4QRJ A;  4ERY A;  4FAV D;  2I0R A;  1NEX B;  2VZ1 A;  3C99 A;  3EI4 A;  4X63 B;  5FKR A;  4FA4 D;  4R7A B;  4A08 B;  3HFQ A;  2OVP B;  3DDU A;  5C2V B;  2P9S C;  3ORV D;  3FGB A;  2H6K A;  3F3F A;  2BKL A;  3SJL D;  4Z8L A;  4I79 A;  5HDB A;  5AFU 3;  4N14 A;  3AFC A;  3K26 A;  4GGA A;  4CY2 A;  4FWW A;  5EAM A;  3VGZ A;  3RN1 D;  3DSM A;  3IUJ A;  2HU8 A;  4HDJ A;  1BPO A;  5EMM B;  4XYH A;  4J73 A;  2AGX A;  3OKW A;  3MUO A;  1C9L A;  4O2W A;  1ERJ A;  2I0T A;  2PM7 B;  1MG3 A;  1N6E A;  4ERQ A;  4LGN A;  2OIZ A;  5A2Q g;  3VH0 A;  5JWZ A;  3EQ8 A;  2B5N A;  5SXM A;  5AJA A;  2Q7Q A;  3NVQ A;  1VZ2 A;  3ZE2 A;  3OKT A;  4ZOZ A;  4L1M A;  3J81 g;  3V9F A;  5M61 A;  4BCB A;  4CY3 A;  1L5G A;  2P9N C;  1M1X A;  5H17 A;  2HYE A;  3BG0 A;  4JT6 C;  4QQE A;  3I7K A;  4FAN D;  2J56 H;  4BP9 A;  4L1Q D;  2CN3 A;  3UVM A;  3IUN A;  4GQB B;  3EI2 B;  5CXB A;  4O3U B;  1I2M B;  2H9P A;  4UI9 R;  1S4U X;  1XHM A;  5K19 A;  3VI3 A;  3F3G A;  2AGL A;  1L0Q A;  3NVN A;  2OJY A;  3SLE D;  5C9Z B;  1FWX A;  3MKQ A;  5GMK n;  5IT9 g;  3OTT A;  2H47 A;  2Z2N A;  4K3J B;  3IUM A;  4J82 A;  2HU5 A;  2GC7 A;  4PXW A;  2IWK A;  3SBQ A;  4Y5R D;  5EM2 B;  2BCJ B;  3SBR A;  5C86 A;  2IUQ A;  2TRC B;  3OF7 A;  2EIB A;  2H68 A;  3IUQ A;  4CI8 A;  3MZL A;  3B7F A;  3JZG A;  3JZN A;  1H2X A;  5IGO A;  3MVD K;  3PVW B;  2AGW A;  3IKO A;  4CI3 A;  4A11 B;  3GFC A;  3ZDY A;  5FKS A;  4MMX A;  3EI1 B;  1XKS A;  2Z2P A;  1YR2 A;  3EQ9 A;  4GGC A;  4Z7O A;  2CNX A;  4GQ2 P;  2W18 A;  3AL8 A;  4UM9 A;  1QFS A;  4H5I A;  3EI3 A;  4A0A B;  4X61 B;  2IAA A;  4GM9 A;  4BUJ C;  4LG8 A;  2P9L C;  5HE3 B;  3RN0 D;  3SCY A;  2J55 H;  1H2W A;  1GOT B;  1UOO A;  2BBK H;  2YNO A;  4J81 A;  1XIP A;  5EMK B;  4DNU A;  1JV2 A;  3FCS A;  3L4M D;  1VZ3 A;  4J0W A;  5E6S A;  5M5V A;  2HKM A;  3RMZ D;  5I5J A;  3K27 A;  2IUR A;  4U1E I;  4J78 A;  3NIF A;  1N6F A;  4OWR A;  2H6Q A;  4IA9 A;  1PBY B;  1MDA H;  2B5L A;  3I7H A;  5CYK B;  2OK4 A;  3SXT D;  5AMS A;  3UKR C;  5IJ7 E;  5I5I A;  4WK4 A;  5TEF A;  3I89 A;  4X60 B;  3ODT A;  3V4P A;  5M5T A;  4A08 A;  1N6D A;  5I5M A;  5C2W B;  2YB8 B;  3JRP A;  1VYH C;  3K71 A;  3MMY A;  3RRM C;  1U4C A;  4DNW A;  3UKU C;  3AL9 A;  3RLM D;  1RI6 A;  2QZP A;  1GG2 B;  2IUP A;  1QNI A;  3GRE A;  2XL2 A;  2G99 A;  2EIC A;  4D6V A;  3EWE A;  4JD2 C;  1A12 A;  3I8E A;  1GOH A;  2AH0 A;  5K1C C;  2YNP A;  5EAR A;  3CFV A;  5IC7 A;  3ZE1 A;  1JMZ B;  1UOQ A;  5TF2 A;  4MMY A;  3MXX A;  2HKR A;  1K3I A;  1K8K C;  4ESG A;  4H5J A;  2PM9 B;  4BP8 A;  1GXR A;  1E5T A;  2CO0 A;  4ZOV A;  3KRW B;  4A09 B;  2HU7 A;  3CIK B;  1B9Y A;  2H14 A;  3MUN A;  4IMM A;  4J87 A;  4E54 B;  1A0R B;  4PNK B;  3PE7 A;  4YVD A;  2P9U C;  1B9X A;  4FA1 D;  3KRX B;  1OLZ A;  2YMU A;  3RFH A;  4BCD A;  2VDO A;  3EI2 A;  4O1Q D;  4XYI A;  4NBM A;  3EMH A;  3OKY B;  4XEI C;  4D9S A;  5FA5 B;  4CZY A;  3V7D B;  3I7O A;  5CXB B;  3SMR A;  4CZX A;  3KCI A;  3BG1 A;  4WK2 A;  5M5U A;  2UZY B;  4CZV A;  3SHF A;  3IJE A;  3SBP A;  4GQ1 A;  2UZX B;  1JJU B;  1C9I A;  3IJ0 A;  3QHY B;  2QR5 A;  3FCU A;  1OMW B;  3ULE C;  4OZU A;  3O4H A;  1H2Z A;  3V4V A;  3PVU B;  4J77 A;  1O6G A;  3C75 H;  1NR0 A;  2GNQ A;  4J0X A;  4CI2 A;  2VDN A;  4ES0 A;  3DXK C;  3UR4 A;  3JRO A;  4A7J A;  2G9A A;  5FLX g;  4PC0 A;  4NAA A;  2EID A;  4JHN A;  4E5Z B;  4A11 A;  3N0E A;  3EI1 A;  3K6S A;  4PSX B;  5GXI A;  4TZ4 A;  2VDK A;  4ERZ A;  4U7A A;  4JSP C;  4WK0 A;  3IJ1 A;  5CXC B;  3PXT D;  2HJB A;  3SN6 B;  3UVK A;  4A0A A;  5M5R A;  3DWL C;  5HQG A;  2P9P C;  4KFM B;  4A0B A;  4LG9 A;  3C9C A;  4FHL A;  3W15 A;  2H3X A;  2XE4 A;  3FM0 A;  3I7L A;  4FB1 D;  5M5S A;  4Z7Q A;  5C92 A;  4AMY A;  4CY5 A;  3FRX A;  3U4Y A;  3EQ7 A;  4CC9 A;  4ZN4 A;  4Y7R A;  3IVM A;  5HE0 B;  5FQD A;  3F3P A;  4G56 B;  4GMB A;  2P9I C;  1MG2 A;  3DM0 A;  4GGD A;  2IWF A;  4FA5 D;  3OL2 B;  3NVX A;  2VDM A;  4PBY A;  3JPX A;  3PSC B;  3ZDX A;  4BCC A;  4D0K A;  1VE6 A;  3L4O D;  1SQ9 A;  3JZH A;  4AX4 A;  5HYN B;  3EI4 B;  2XL3 A;  4L9O A;  5CYK A;  3JAM g;  2CN2 A;  2OVR B;  4AN1 A;  4BL0 A;  4A2M A;  2EBS A;  4GM3 A;  3IUR A;  4QAM A;  1R5M A;  4UM8 A;  1K32 A;  4JHP C;  3PXW D;  5IJ8 E;  5HE2 B;  4EWR A;  1PI6 A;  1U2V C;  1GP2 B;  2HXC A;  2B4E A;  2IUV A;  5FKT A;  4JSV C;  5EAP A; 
#chains in the Genus database with same CATH homology
 3C5M A;  4GZ8 A;  3UVO A;  5HE1 B;  2OK6 A;  4J79 A;  3EU7 A;  3PXS D;  2I0S A;  2AQ5 A;  4O9D A;  4J8G A;  3IJC A;  5EMJ B;  4JSN C;  2P9K C;  4AEZ A;  2CO0 C;  2OVQ B;  4PBZ A;  3UVN A;  2YBA A;  2B5M A;  5H14 A;  2PM9 A;  2H13 A;  3IIW A;  2PM6 B;  2PBI B;  4A2L A;  4A09 A;  4L3G D;  3PSL A;  4JXM A;  4E54 A;  5H1M A;  1Q47 A;  2O9K A;  4PSW B;  2I3S A;  1PEV A;  1TYQ C;  5IGQ A;  5TEE A;  1P22 A;  4AOW A;  2GC4 A;  3OKY A;  3J80 g;  3A0F A;  4O3T B;  5EML B;  4BH6 A;  5FXY A;  4MK0 B;  4NSX A;  4X3E A;  3SVW D;  4FA9 D;  3SWS D;  2HES X;  4J86 A;  1JMX B;  3SFZ A;  5KDO B;  1SQJ A;  3I8C A;  3IIY A;  3DXM C;  5GSA A;  3P4F A;  5FKQ A;  1YFQ A;  2H9N A;  2Z2O A;  4ZOX A;  5EM2 A;  5THA A;  2H9L A;  5B4W A;  2XYI A;  3EG6 A;  4CI1 A;  2AH1 A;  3I7N A;  2H6N A;  3RFG A;  1TBG A;  3CFS B;  5GXH A;  1PGU A;  4QL1 A;  2CE8 A;  4JSX C;  4L3H D;  5EAL A;  4K3I D;  5TDH B;  4ZOY A;  3UVL A;  4E5Z A;  3RSE C;  4J84 A;  3BWS A;  3V5W B;  3E0C A;  2YNN A;  4CY1 A;  3I7P A;  3AL8 B;  3MZK A;  4O45 A;  4J8B A;  5CXC A;  3EI3 B;  2J57 G;  2QC5 A;  2AGY A;  1JOF A;  2HJ4 A;  2QXV A;  3AH8 B;  3VA6 A;  2AGZ A;  3N0D A;  3ZWL B;  4A0B B;  2XU7 A;  2H9M A;  3JB9 L;  1SHY B;  3MKS B;  2MTA H;  2CE9 A;  4GM8 A;  3OW8 A;  4JT5 C;  3OL2 A;  2I3T A;  4QT8 A;  3I2N A;  4QRJ A;  4ERY A;  4FAV D;  2I0R A;  1NEX B;  3C99 A;  3EI4 A;  4X63 B;  5FKR A;  4FA4 D;  4R7A B;  4A08 B;  3HFQ A;  2OVP B;  5C2V B;  2P9S C;  3ORV D;  3FGB A;  2H6K A;  3F3F A;  3SJL D;  4Z8L A;  4I79 A;  5AFU 3;  4N14 A;  3AFC A;  3K26 A;  4GGA A;  4CY2 A;  4FWW A;  5EAM A;  3VGZ A;  3RN1 D;  3DSM A;  4HDJ A;  5EMM B;  4XYH A;  4J73 A;  2AGX A;  3OKW A;  1ERJ A;  2I0T A;  2PM7 B;  1MG3 A;  1N6E A;  4ERQ A;  4LGN A;  2OIZ A;  5A2Q g;  3VH0 A;  5JWZ A;  2B5N A;  5SXM A;  5AJA A;  2Q7Q A;  3NVQ A;  3OKT A;  4ZOZ A;  3J81 g;  3V9F A;  4CY3 A;  2HYE A;  2P9N C;  5H17 A;  3BG0 A;  4JT6 C;  4QQE A;  3I7K A;  4FAN D;  2J56 H;  4L1Q D;  2CN3 A;  3UVM A;  4GQB B;  3EI2 B;  5CXB A;  4O3U B;  2H9P A;  4UI9 R;  1S4U X;  1XHM A;  5K19 A;  3F3G A;  2AGL A;  1L0Q A;  3NVN A;  2OJY A;  3SLE D;  5C9Z B;  1FWX A;  3MKQ A;  5GMK n;  5IT9 g;  3OTT A;  2H47 A;  2Z2N A;  4K3J B;  4J82 A;  2GC7 A;  4PXW A;  2IWK A;  3SBQ A;  4Y5R D;  5EM2 B;  2BCJ B;  3SBR A;  2IUQ A;  2TRC B;  2H68 A;  4CI8 A;  3MZL A;  3B7F A;  3JZG A;  3JZN A;  5IGO A;  3PVW B;  2AGW A;  3IKO A;  4CI3 A;  4A11 B;  3GFC A;  5FKS A;  3EI1 B;  1XKS A;  2Z2P A;  4GGC A;  2CNX A;  4GQ2 P;  2W18 A;  3AL8 A;  4H5I A;  3EI3 A;  4A0A B;  4X61 B;  2IAA A;  4GM9 A;  4BUJ C;  4LG8 A;  2P9L C;  5HE3 B;  3RN0 D;  3SCY A;  2J55 H;  1GOT B;  2BBK H;  2YNO A;  4J81 A;  1XIP A;  5EMK B;  3L4M D;  4J0W A;  2HKM A;  3RMZ D;  5I5J A;  3K27 A;  2IUR A;  4U1E I;  4J78 A;  1N6F A;  4OWR A;  2H6Q A;  4IA9 A;  1PBY B;  1MDA H;  2B5L A;  3I7H A;  5CYK B;  2OK4 A;  3SXT D;  5AMS A;  3UKR C;  5IJ7 E;  5I5I A;  5TEF A;  3I89 A;  4X60 B;  3ODT A;  4A08 A;  1N6D A;  5I5M A;  5C2W B;  2YB8 B;  3JRP A;  1VYH C;  3MMY A;  3RRM C;  1U4C A;  3UKU C;  3AL9 A;  3RLM D;  1RI6 A;  1GG2 B;  2IUP A;  1QNI A;  3GRE A;  2XL2 A;  2G99 A;  4D6V A;  3EWE A;  4JD2 C;  3I8E A;  2AH0 A;  5K1C C;  2YNP A;  5EAR A;  3CFV A;  5IC7 A;  1JMZ B;  5TF2 A;  3MXX A;  2HKR A;  1K8K C;  4ESG A;  4H5J A;  2PM9 B;  1GXR A;  2CO0 A;  4ZOV A;  3KRW B;  4A09 B;  3CIK B;  1B9Y A;  2H14 A;  4IMM A;  4J87 A;  4E54 B;  1A0R B;  4PNK B;  3PE7 A;  4YVD A;  2P9U C;  1B9X A;  4FA1 D;  3KRX B;  1OLZ A;  2YMU A;  3RFH A;  3EI2 A;  4O1Q D;  4XYI A;  3EMH A;  3OKY B;  4XEI C;  5FA5 B;  4CZY A;  3V7D B;  3I7O A;  5CXB B;  3SMR A;  4CZX A;  3BG1 A;  2UZY B;  4CZV A;  3SHF A;  3SBP A;  4GQ1 A;  2UZX B;  1JJU B;  3IJ0 A;  1OMW B;  3ULE C;  4OZU A;  3PVU B;  4J77 A;  3C75 H;  1NR0 A;  2GNQ A;  4J0X A;  4CI2 A;  4ES0 A;  3DXK C;  3UR4 A;  3JRO A;  4A7J A;  2G9A A;  5FLX g;  4PC0 A;  4E5Z B;  4A11 A;  3N0E A;  3EI1 A;  4PSX B;  5GXI A;  4TZ4 A;  4ERZ A;  4U7A A;  4JSP C;  3IJ1 A;  5CXC B;  3PXT D;  2HJB A;  3SN6 B;  3UVK A;  4A0A A;  3DWL C;  5HQG A;  2P9P C;  4KFM B;  4A0B A;  4LG9 A;  3C9C A;  4FHL A;  3W15 A;  2H3X A;  3FM0 A;  3I7L A;  4FB1 D;  4CY5 A;  3FRX A;  3U4Y A;  4CC9 A;  4ZN4 A;  4Y7R A;  5HE0 B;  5FQD A;  3F3P A;  4G56 B;  4GMB A;  2P9I C;  1MG2 A;  3DM0 A;  4GGD A;  2IWF A;  4FA5 D;  3OL2 B;  3NVX A;  4PBY A;  3JPX A;  3PSC B;  4D0K A;  3L4O D;  1SQ9 A;  3JZH A;  5HYN B;  3JAM g;  3EI4 B;  2XL3 A;  4L9O A;  5CYK A;  2CN2 A;  2OVR B;  4BL0 A;  4A2M A;  2EBS A;  4GM3 A;  1R5M A;  1K32 A;  3PXW D;  5IJ8 E;  5HE2 B;  4EWR A;  1PI6 A;  1U2V C;  1GP2 B;  2HXC A;  2B4E A;  2IUV A;  5FKT A;  4JSV C;  5EAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...