2CEXA

Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
DYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of Structure and Mechanism in Primary and Secondary Transporters Exemplified by Siap, a Sialic Acid Binding Virulence Factor from Haemophilus Influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport
molecule keywords PROTEIN HI0146
total genus 112
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2cexA00
4NF0A 2WX9A 4X04A 4P8BA 4LN5A 4N15A 2ZZWA 4PBQA 2ZZXA 4P9KA 4X8RA 4OANA 2XA5A 4PFRA 4OVPA 4PAIA 4OVQA 2XWKA 4PC9A 4YZZA 5IZZA 2CEYA 4O7MA 4PAFA 4PF8A 4MIJA 2VPOA 3B50A 4MNPA 4P1LA 2WYPA 4XEQA 2XWIA 4YICA 4MNIA 3U65A 5LTCA 4N6KA 4N8GA 4PFBA 4OVTA 2HPGA 4OVSA 4N91A 2XWVA 4P1EA 4PFIA 4MHFA 4DI3D 2PFZA 3GYYA 4NAPA 4XF5A 4PF6A 2XXKA 4NX1A 4MX6A 4N6DA 4P56A 4XFEA 4PETA 4PDDA 4OA4A 4UABA 5IM2A 4NG7A 2CEXA 2HZLA 5CM6A 4OVRA 4NN3A 4DI4B 2WYKA 2HZKA 4MCOA 4N4UA 4PGNA 4PBHA 2VPNA 5I7IA 2ZZVA 4N17A 4NGUA 4MAGA 4P3LA 4NQ8A 4O94A 4MEVA 4N8YA 4MNCA 2PFYA 4PGPA 4PCDA 4MMPA 5IGAA 4P47A 2XWOA 4O8MA 5I5PA 4PAKA 3FXBA 2V4CA 4NHBA 4PE3A 4PDHA
chains in the Genus database with same CATH superfamily
3GZGA 4NF5B 1LFGA 1MH3A 2CZLA 2F8DA 3VLUA 3TCFA 4IO7A 1M5DA 1QKAA 1MQDA 5J1DA 2PCRA 1FPLA 4YKKA 1FBPA 3LV0A 4PC9A 4YKIA 1PB7A 1RYOA 4XKNA 1B5IA 2ZNSA 4ZECA 1BLFA 4MNPA 1ANFA 4KPTA 4GFRA 1POY1 1N76A 2ALUA 4OQOA 4MLQA 3B6WA 5LTCA 1UTBA 3KN7A 1AOVA 1S50A 2ONKE 5K2YA 3IORA 3SESA 3H3GA 2XWVA 1AL3A 1DTZA 1NI9A 3CSGA 4OHNA 1A8EA 4GWOA 3TEPA 4GQOA 5I2KA 2ESNA 2X7QA 3CVGA 4F31B 2XXIA 4KYSA 4QSDA 3N26A 2I6EA 4PTKA 1DCUA 2UVHA 1LFHA 2HZKA 3EQ1A 3FV1A 2V3QA 3RPLB 3VLVA 2HAVA 4OENA 1A54A 4BDRA 3AXFA 4F3PA 4XIGQ 4ZEBA 4QSEA 4P0IA 2ZNUA 3N6UA 4ESXA 4R6KA 1OQHA 2XHDA 4GX6A 2PFYA 5IAIA 2F7AA 2IEEA 4I40A 5KZTA 2XWOA 2F5XA 4NF0A 4BDNA 1SW5A 1QULA 3U8QA 4U4XA 2Z23A 3KZGA 2DSFA 3OD7A 3C34A 2F7CA 5T3JA 1MPDA 2XXRA 4OETA 5A5LA 4RXLA 3SERA 2L5VA 4GL0A 4YZZA 5IZZA 4ESWA 3Q26A 1JNFA 2I3WA 3ILTB 2XD2A 3VXCA 3PD9A 2CZHA 4QHQA 2Q8MA 5JEIA 1SYIA 4BLAA 3E3KA 4ONYA 3FVGA 3PMXA 5L9SA 4N8GA 4GD5A 1LCTA 2KQZA 2XXVA 3RYDA 1BTJA 1MG1A 1DOTA 2UVJA 1GGGA 5LOMA 3F11A 1IMFA 1FPJA 3PGFA 5H8QB 4N6DA 1LAGE 4QFOA 3IB1A 1INPA 3EPEA 4F3GA 3K6UA 2F97A 4YB6A 1RYXA 3CRBA 4NN3A 1NV5A 4MF3A 3IO4A 1N3XA 3EHSA 4DZ1A 3HO7A 2V93A 3QYTA 1CNQA 3D1RA 3LUZA 1N04A 2O7IA 3PMVA 4LP2B 1IMBA 3FJMA 5I59A 2DWAA 1FRPA 5ET5A 1IEJA 1PDAA 2D3IA 5EQ7A 3MW0A 1JW4A 4R9GA 3G3GA 1R9QA 2WBBA 1DSNA 3K1MA 1NV1A 1XVYA 2PX1A 4QFNA 3TFLA 4ZZEA 5L9MA 2PBWA 4N13A 1FPGA 3ILUB 1PBPA 1MY0A 1Y1MA 3LSXA 5CBSA 3RT6B 4OXVA 1IXIA 3O6IA 2H4IA 3QAXA 3VVFA 1FQEA 1FBDA 4OERA 3TQWA 3RUMA 2XWIA 1YAEA 2JJKA 4GWYA 2NVUB 2V3TA 4KQPA 3UP9A 3O6HA 2Z22A 3V83A 4N6KA 1MQIA 4R9FA 3VDFA 5A5XB 4OFLA 1Y4TA 2ONRA 3RTFB 4JSOA 3THIA 4F3SA 1MY3A 1NKXA 2GQ1A 1F9BA 2XXKA 5AA2A 4EXKA 1TT1A 2DXRA 4ZDMA 5CMBA 2YLNA 5KCJA 3LSWA 2W7YA 1LBVA 4UABA 4GX3A 3TODA 5HBCA 3S9EA 1R1NA 3MVYA 4YKPA 3T9UA 1ZLQA 1S9TA 2HXRA 2XXWA 4G8MA 1FBHA 2PT2A 3FJ7A 1LGBC 4NTLA 2DVCA 5TP9B 3H06B 4QBAA 3OENA 4P47A 5EQ9A 3EHUA 2F36A 3OO9A 1KA1A 3RQTA 3RLFE 3TMGA 2Z8EA 4LN5A 5JTYB 1ZMGA 5DVFA 4WEDA 2GFEA 4F1UA 1POTA 1Z7NE 3KJTA 4AS4A 1NH7A 2DP8A 4X1BA 5A5XA 3U72A 1NV7A 1FCKA 3MSTA 2XXQA 1UTBB 1OLAA 3R26A 4ZEDA 2WEFA 2HCAA 5AA4A 2XX8A 1JQFA 3TCHA 2DOJA 2DE3A 3C9HA 3UN6A 3JV9A 2UYEA 2A5SA 1B32A 1FPDA 1OVBA 1SI1A 1MQHA 1H3DA 3G3JA 1FQCA 1JETA 3KC0A 4PFYA 1Z7ME 4JVDA 4R2BA 1B5JA 4LVQA 4PE5B 1IXHA 3MP1A 3T96B 3TUSA 1GR2A 2PVUA 1P1OA 5DVJA 3MPLA 1NMUA 2XXXA 5ESYA 5EQ8A 4EXLA 5EYGA 3C33A 3IJOB 4NF6B 5CC2A 1VFEA 1QVSA 1H45A 4LZ5A 2VPNA 1LBZA 4JDFA 3ZKKA 4I3EA 1USYE 2PYYA 3TPAA 1LAHE 1I6AA 2QS4A 5DYHA 3N6TA 3PD8A 3SZPA 3FXBA 2VD3A 3V89B 3O6GA 3OO6A 3ZS6A 1P1NA 1B1XA 1YXIA 4H8IA 5AA4B 3QUFA 3I3VA 4PAIA 4TLMB 4R6YA 3ECRA 3T93B 1XC1A 1JW5A 2XD3A 4MLVA 4GXSB 4I3YA 4M1VA 3ONMA 2GHBA 3KSJA 3O28A 1D3KA 4YB7A 4K3FA 1Y9UA 1B3FA 4G68A 1Q35A 5I56B 3KGCA 3SDFA 1FPEA 3K1NA 4NF6A 4DI3D 4HCWA 4DLDA 3K6VA 4R75A 3IL1B 1GV8A 4JXIA 3QSLA 4XKPA 4G4PA 5H8HA 1RDXA 3O66A 4FIMA 4MBPA 1B40A 2A5TB 1LB9A 4R73A 3FVNA 2FIXA 4DIGA 4PBHA 2DS9A 3FJGA 5I7IA 4N17A 4I8CA 1YZ0A 1ZBMA 4EF2A 3MZ9A 1WVJA 2OWZA 3U93A 4JVCA 3N5LA 2QSXA 1L5TA 1J1NA 1XI6A 4ISUA 3DM0A 4ZS9A 1TFAA 1DPEA 4PCDA 4U21A 1NNKA 3E4RA 3TYHA 4ELPA 3OOAA 3OEKA 4POWA 4WKMA 4OTEA 3MPKA 1NL5A 3TDJA 3BKIB 3V8XB 2XX9A 4TQUQ 3CSBA 1PC3A 3FXUA 4FJPA 5B70A 5CBRA 2XWKA 2ZMBA 1H76A 5H8FA 4RNSA 2OBGA 2I58A 1US5A 1MRPA 2I4BA 1NUZA 2O1LA 3S4UA 1B9JA 3JYRA 3Q29A 3OO8A 4GLIA 4OESA 3GBAA 2FBPA 2E1SA 4U22A 3K01A 4ZE8A 3K4UA 1SW1A 1LBXA 1P1UA 5DEXA 1FPBA 5I2NB 3PPQA 1O7TA 3C36A 3T1BA 4E0WA 2I3VA 4DE8A 1YCJA 1IITA 1IZ1A 4IY6A 2B3FA 4H45A 4F2OA 4WXJA 2Y84A 1GTKA 3OSRA 1PB8A 5I58A 3BIGA 4X9TA 2CEXA 3RT8A 1AWBA 4N81A 3ZKLA 1P1WA 2H99A 4P11A 2UYFA 3M8UA 4GL8A 2O7UA 1T0KA 4H6DA 4Z7EA 5FBPA 2QL3A 1MQJA 1IUDA 3TTLA 2DWHA 5KDTB 5FHMA 4N8YA 4MNCA 2KR0A 1I69A 2OZZA 2HEUA 3OELA 4QSCA 4MMPA 4C0RA 4DXCA 5LDZA 1JEVA 4HCYA 3G3HA 1M5CA 5H8QA 4XKQA 3QXMA 4FEBA 4HE1A 1VFDA 1URGA 2CMOA 3BFUA 2ABHA 4G68B 4OVQA 2Q88A 4MJOA 4DXBA 1B3LA 2PMSA 2GH9A 1FTJA 3K0VA 3DP4A 1SPIA 4ZEKA 4MIJA 2VPOA 1N3WA 3VXBA 4TOZA 2VGQA 4EDPA 3PUVE 1B7UA 2A5TA 1Y3QA 2AL4A 4R2FA 5I56A 2XXPA 2QVVA 3SETA 4C1TA 4O7IA 3KBZA 1YTVA 5ELVA 4NAPA 2F3DA 4ND9A 1FTOA 4R72A 4N6PA 3OSQA 4GVOA 3D4CA 2P0SA 4OZ9A 3EHTA 3MUQA 3DELB 3K6WA 1IQ7A 1FTKA 2I48A 3H6VA 3S9NC 3C32A 4LZ7A 1B7HA 1EZPA 3CR9A 4AQ4A 4N4UA 4F29A 1ZKBA 3PTYA 4RJZA 1NNTA 4GIZA 4QFLA 1A8FA 2OK2A 2Q2AA 4F1VA 4QF9A 2XXYA 4AS5A 5ET7A 1JVXA 2OX3A 4ELOA 1FBGA 3W15C 3IX1A 3EF7A 1G0HA 3L6HA 3IFCA 4FE8A 4PGPA 1A55A 2Y7IA 4I1DA 2FYIA 5I5PA 4R6HA 2P3VA 1Y3NA 3IOWA 1P1QA 3G7WA 3BIHA 2WX9A 5TPAB 5HM4B 4FEDA 4IO5A 5DEXB 4JWOA 5CRYA 2DYXA 2DXYA 5I57B 3VFJA 3MVZA 4UA8A 2Y5LA 2KLFA 2F6GA 2ZYOA 1FQFA 4RPNA 2VP1A 4YB5A 3B50A 1WDNA 4U2RA 4U23A 1VDWA 3IFAA 3IR1A 4NF5A 1SQYA 4Z0IA 5CMKA 4KCDA 4FATA 2Q8JA 1O64A 3P7IA 4PFBA 4OVTA 3C4MA 2I0CA 5ET6A 3OMBA 3IO6A 3KJ7A 4POXA 4MHFA 4JWYA 2B65A 2O51A 1EZOA 4XTCQ 3WAEA 4I62A 1US4A 5DVIA 2QPQA 1JP4A 3PPPA 1LCFA 3H6TA 1M5BA 2RCBA 4G2ZA 2OLBA 1RDZA 2O1MA 1LLSA 5TP9A 3IB2A 2I0BA 4GOTA 3UGWA 3MC2A 3RPWA 2ZZVA 3CHGA 1ZU0A 1PBQA 5AE4A 1B3HA 3OEMA 5ET8A 3GLBA 3FZVA 2YPNA 2HFBA 2DWJA 1SI0A 1VE4A 4LZ8A 5DTBA 5EQAA 4PAKA 1DMBA 3KBRA 5IZ1A 2B4LA 3RN8A 1ZIUA 4PBQA 2ZZXA 2X26A 3O29A 2XA5A 5H8NA 3RY3A 1EYKA 2LAOA 4F1YA 4OWDA 5BWJA 3CFZA 4GWUA 3T9HB 4H5GA 1FBCA 1MXXA 4NWCA 2NOOA 1NV3A 2HAUA 4UACA 1ATGA 2UXAA 4IGTA 3U94A 3MJNA 3B7DA 4H65A 3RNNA 2MKZA 3CG3A 3FVOA 3L6GA 4OVJA 5ISUA 4KFQA 3MWBA 2QS2A 2BJJX 2WKYA 4P1EA 1IMCA 2Q89A 5I3SA 3ODBA 2Y7WA 4F18A 3D4GA 3QMFA 2B3BA 3H7MA 3T66A 4PDDA 5IM2A 4O3CA 1FPFA 1LEVA 5TPAA 2GRVA 4MH5A 1RKMA 3MVXA 2D21A 2WBDA 4GF8A 2CZIA 3LSLA 1A7LA 5F1QA 2O6AA 1MXWA 1B7ZA 4NE4A 3K02A 2V3UA 4NHBA 1M5EA 2F35A 3H03A 3UK4A 5EYFA 3K2DA 2VD2A 4EUOA 2RC7A 4GXAA 5H8SA 2H5YA 3CIJA 4P9KA 2XXTA 2F34A 3A3CA 4F2QA 1LAXA 2M8CA 5JTYA 2Z8DA 3RGYA 2HHMA 3IJXB 4EQ9A 1GVCA 2DWIA 1IMAA 4JB7A 5I58B 4F19A 4P1LA 2R71A 3QUJA 4EF1A 1D9VA 2FIEA 4KR5A 3N94A 1MXYA 4PQJA 1BKAA 2VOZA 4QXDA 1IMDA 4Q5TA 5IZ3A 3KC1A 2O84X 3H4ZA 3FD3A 4YMAA 1IMEA 4FBPA 1XHYA 4QFKA 5B7DA 3IOVA 1B3EA 3HSTA 2F7BA 1ELJA 2OWSA 2Q9TA 4NG7A 3H6UA 1OVTA 5CI5A 3VLWA 1EH3A 1N84A 4NF8B 4KD5A 3UA8A 1FSAA 4DI4B 3WAFA 4H0WA 3R7XA 4KHZE 5EYHA 2P3NA 1FQAA 4NGUA 4MAGA 4PP0A 4R74A 4NQ8A 5KCJB 3UIFA 1FPKA 1HSJA 4FECA 1EU8A 1MXUA 1YPNA 1NNFA 2V4CA 1H43A 4IB2A 4PE3A 3TKDA 4LA9A 1XS5A 1URSA 1SW4A 5IKBA 1MPBA 4HTGA 3PUWE 2REGA 5FHOA 1FJ9A 3ROJA 3G3FA 1AMFA 3FBPA 4GX4A 4IO6A 3BBRA 1FW0A 3M3KA 2ANJA 3LR1A 3VVEA 3Q28A 2UVGA 1B2HA 3PUXE 4HXVA 4KI0E 4PAFA 3M3LA 4NMYA 3S2VA 5FTIA 3FXRA 3CFLA 4XEQA 4YICA 5L8DA 2REJA 1VSOA 3O97A 4KYEA 1CB6A 1OMPA 2ZXTA 5CMMA 2IA4A 4H46A 2ONSA 3FATA 4OVSA 4N91A 1NUXA 3LUYA 1I6QA 1SVXB 1Q1KA 3KN8A 4OEVA 1B52A 1EZ9A 2AYSA 1G0IA 2Q74A 4GBWA 5I59B 4IGRA 1JEUA 1S7YA 3EKIA 3M3FA 1FJ6A 1SW2A 5CMCA 4RY1A 1QJMA 4ZEFA 4YU0A 3O9PA 4BDMA 4PGNA 1NV6A 4JSDA 3DP6A 2V84A 3FXQA 3IOTA 1MM7A 3K00A 1MS7A 4IO4A 4MEVA 1JVYA 4KCCA 1K9YA 4O8MA 3O2AA 4X48A 5ICTA 4KXPA 3H6WA 4DCYA 2R9JA 1TFDA 3QIMA 1B0HA 4F22A 5AA2B 4IO3A 4LATA 3IOUA 3DP8A 4OANA 4Q8RA 3CI8A 2XXHA 1EYJA 4O3AA 4OVPA 3USDA 4C1UA 1ZJLA 1RDYA 3U1OA 3NOHA 4GRKA 4QRZA 4LUBA 3C35A 3SEVA 1FTAA 3HHGA 2WYPA 2THIA 1B4HA 2FHYA 3KFMA 2E0SA 3G3KA 1LB8A 2CZKA 4NF4A 1URDA 4NF8A 1NNPA 4N07A 4THIA 2VHAA 4F3BA 5F7VA 4BDOA 3E79A 3CG1A 1NH8A 2RC9A 1A99A 4AB6A 5AA1A 3TQLA 1UTHA 4NWDA 1P99A 4G61A 3MBPA 1I6BA 1N7WA 4EQ7A 4OVRA 1IXGA 3SEUA 1KZ8A 3EN3A 2I4CA 2P1SA 3W9VA 2V25A 4RYAA 3R6UA 1Y1ZA 3LSFB 2RKMA 5EHSA 5HPQA 5K2XA 4DCXA 1B0LA 1B4ZA 2GHAA 1KA0A 5ICQA 1MDQA 3KSXA 1MXVA 3KOSA 4OEUA 2R8TA 1MY4A 4OFJA 3MAMA 1VR5A 3IAZA 4HE0A 4GBVA 3SKPA 4E0XA 1R6ZA 2BJIA 4GWSA 3S9MC 2D5WA 4JBZA 4GWWA 1TXFA 1YYZA 2XXUA 4KYDA 2QVRA 2P2AA 4H5FA 2Q2CA 1UQWA 2F78A 2F3BA 1UTHB 4XKRA 5AA2D 2I49A 1MDP1 4H8JA 5H8FB 1AH5A 2Z8FA 3A3UA 4M4GA 3OXNA 4JVIA 2PFZA 3FUZA 4XF5A 1N0TA 3JZJA 4PF6A 2PT1A 4YKJA 3ZSFA 5JK4A 1ZTYA 4ECFA 5ITPA 1B5HA 2F6PA 4XFEA 4YAHX 4TLLB 3IB0A 2VT5A 4OYVA 4U1ZA 2QRYA 1MQGA 4DDDA 4H67A 1SBPA 1BK4A 3FASA 4P0GA 4PFTA 3KG2A 4WEPA 5J16A 1DPPA 3HHFA 2H9BA 3VE1B 3I5OA 1HSLA 3IK6B 5FHNA 2Y7KA 5DW8A 1QUIA 4X1DA 5IGAA 1CE2A 5FTHA 4XXUA 1SDXA 3VV5A 1MH4A 1MXZA 3K6XA 3K1PA 4X04A 2DE2A 3HCQA 4P8BA 4ZEIA 1Y20A 5H8HB 3LC8A 4RK2A 3MQ9A 2DQVA 4PFRA 3TELA 3HN0A 3E78A 1B1HA 3PUYE 4JWXA 4MFIA 4QFPA 3KEIA 1NV2A 3TCGA 4PF8A 1FQBA 3G3IA 3GXAA 4FAJA 2RINA 3TTMA 2X7PA 4NF4B 1EYIA 4I9DA 3E9XA 3C31A 2ZYMA 3U65A 1QUJA 1O63A 1B58A 1D4NA 3T0JA 4AB5A 4LQ2A 3GBBA 1N7XA 4G77A 1UIVA 3HFUA 1FBFA 4HS7A 1LBBA 4OFOA 5BUUA 5F24A 3PPNA 4PFIA 1H44A 3PPRA 3PU5A 1B51A 2AL5A 3GYYA 1XVXA 2RC8A 5I84A 3BFTA 4PFUA 4IR8A 1FPIA 1Y4CA 1XOCA 2H25A 4OA4A 1DK4A 2RF1A 3T9VA 1LFIA 2WYKA 4Q30B 2NUVA 1FQDA 1NV4A 3SEWA 1MM6A 4G8NA 3FIRA 4BDLA 1K9ZA 2QS3A 2XX7A 1B05A 3FV2A 3FGSA 3RPLA 4P3LA 4O94A 1FTLA 1PEBA 1D9YA 3PUZE 3LBSA 3A29A 2NXOA 2QMXA 4ZE9A 1QGXA 4HE2A 1FBEA 1FTMA 2ZZWA 4OMBA 1USYH 2FNCA 1IIWA 2ZNTA 2FA7A 4RA1A 1LBCA 2Y5KA 4O7MA 4NEDA 3KN3A 2DE4A 4PFWA 3S9LC 2ZYKA 4H1XA 1DTGA 3TTRA 1DBZA 2Y7PA 1KWHA 3MZBA 3TTNA 4MNIA 5EHMA 4O3BA 1LSTA 1QKBA 2OCUA 1TWYA 1JW1A 1OLCA 1NV0A 5ITOA 3U92A 1MY1A 1NFTA 3PV0E 4EQBA 2OJTA 3I6VA 1MY2A 3DLNA 1HSEA 4Q0CA 2ZYNA 1WODA 4NX1A 2G29A 2QFLA 4MX6A 1OIBA 1NUWA 4RK9A 2DVZA 4LONB 2HZLA 3Q27A 4MCOA 4RPOA 3B8BA 5L9OA 2UVIA 3B6QA 2QJEA 4ELQA 4GWXA 3MP6A 5DT6A 5AA3A 3E13X 5I2KB 3T9XB 1NUYA 4HW8A 3MZ1A 1D9QA 4PDHA 2QMWA 2O68A 1BIYA 2R6GE 1QUKA 4N15A 3TZAA 2Y7RA 1B6HA 1IXCA 4X8RA 1SD3A 3A09A 4G68C 2B4MA 2FVZA 4F39A 3W9WA 2HXWA 2OWTA 3UORA 1Q9DA 2CEYA 2YJPA 3TAJA 4U4SA 2DDKA 1LAFE 3CFXA 2HQ0A 1UIUA 2H98A 4DXUA 5I2NA 3MVWA 1R9LA 1M5FA 3FVKA 5H8NB 2O69A 4BDQA 2HPGA 1LBYA 4ZZAA 1B46A 3RTWB 1BP5A 1XT8A 5IZ3B 3Q25A 1MPCA 4L17A 5M2VA 2QVUA 5TU0A 4IY5A 4YMBA 3QK6A 4ELRA 2RCAA 1B3GA 3SEXA 4P56A 1Y3PA 3PPOA 3TTKA 1OQGA 4PETA 4IO2A 2G93A 1PB9A 5CM6A 2NWJA 2QS1A 3HV1A 4G8HA 1A40A 3MP8A 4U1OA 3VVDA 1QW0A 3V5AA 5KDTA 2AIXA 1LBWA 3HPIA 3SEYA 5I57A 4LQ5A 4FORA 3T22A 3B6TA 4GWZA 3OO7A 1II5A 3MYUA 3PMWA 3ISPA 1SYHA 1AIVA 3KOTA
chains in the Genus database with same CATH topology
5IZ1A 3BIHA 2DE2A 2WX9A 4NF0A 4X04A 1QGXA 2B4LA 4HE2A 4P8BA 2WBBA 1FBEA 4HE1A 4LN5A 4N15A 1FJ9A 2ZZWA 2R8TA 3ROJA 1NV1A 4PBQA 1YXIA 2ZZXA 4P9KA 4X8RA 3FBPA 2B4MA 4OANA 2FVZA 2XA5A 4PFRA 1EYJA 4GX4A 5T3JA 4OVPA 5J1DA 4F1UA 4DI3D 1FPGA 2PCRA 4GBVA 4HE0A 4PAIA 4OVQA 1FPLA 3W9WA 5A5LA 1EYKA 2XWKA 2Y5LA 3E78A 1FBPA 3LV0A 4MJOA 4AS4A 2BJIA 4GWSA 4PC9A 2HHMA 1RDYA 2L5VA 4GWUA 2Y5KA 4YZZA 1NV2A 3NOHA 1Q9DA 1FBCA 5IZZA 2CEYA 4HXVA 4O7MA 1IMAA 4PAFA 4PF8A 1NUZA 1SPIA 2DE4A 1NV3A 1NV7A 4F19A 4MIJA 1FTAA 2DDKA 2VPOA 1FBDA 3B50A 3MSTA 4MNPA 4P1LA 2WYPA 4I3YA 4XEQA 1VDWA 2XWIA 4GWWA 2FIEA 1YYZA 3IFAA 4M1VA 4YICA 2FBPA 2FHYA 1DBZA 2CZHA 2JJKA 2QVRA 1EYIA 2MKZA 2Q8MA 4GWYA 2CZKA 4MNIA 4QXDA 1LBXA 2WEFA 3U65A 5LTCA 1IMDA 1FPBA 3T0JA 2F3BA 4H46A 1NV0A 4N6KA 4N8GA 4PFBA 4OVTA 2HPGA 2QVVA 5ET6A 3HFUA 2DE3A 3KC1A 3T1BA 1FBFA 1LBYA 2KQZA 4OVSA 4N91A 4O7IA 3RYDA 3KBZA 5I5PA 5IZ3B 1NUXA 2XWVA 5F24A 1FPEA 4P1EA 1FPDA 1IMEA 1NI9A 4PFIA 4JVIA 2QVUA 4FBPA 4MHFA 2PFZA 3GYYA 4HCWA 2F3DA 3E79A 4NAPA 4H45A 4XF5A 1IMCA 2GQ1A 5I3SA 3KC0A 4PF6A 4F18A 2XXKA 4NX1A 5JK4A 1IMFA 1FPJA 1G0IA 2QFLA 3QMFA 4JVDA 2Q74A 4GBWA 4IR8A 4MX6A 4N6DA 1FPIA 1NUWA 4P56A 2QPQA 1JP4A 4XFEA 3EKIA 1INPA 4PETA 2DVZA 1FJ6A 1LBVA 3BIGA 4G61A 4OA4A 4PDDA 2Q9TA 1RDXA 4GX3A 2CEXA 4NG7A 4UABA 1AWBA 4N81A 2VT5A 4PTKA 1DCUA 1DK4A 1FPFA 1LEVA 1RDZA 2HZLA 5CM6A 4OVRA 4NN3A 1FSAA 2WYKA 5ESYA 4DI4B 5EQ8A 1KZ8A 2HZKA 4MCOA 4N4UA 1NV5A 5EYGA 3PTYA 1BK4A 3RPLB 2V3QA 1NV4A 2FIXA 4PGNA 3B8BA 3W9VA 4F1VA 2HXRA 4PBHA 1NV6A 5EYHA 2VPNA 4AS5A 2P3NA 2ZZVA 3CHGA 4N17A 5ET7A 1LBZA 4NGUA 5I7IA 1YZ0A 1K9ZA 1FBHA 4MAGA 5J16A 5IZ3A 5FBPA 2WBDA 2OX3A 2CZIA 1CNQA 2OWZA 3D1RA 3LUZA 1FBGA 4GWXA 4I3EA 4JVCA 1LBWA 3RPLA 4P3LA 4NQ8A 4O94A 5ET8A 1FPKA 1IMBA 4MEVA 1G0HA 1XI6A 4MNCA 4N8YA 2KR0A 5DW8A 1FRPA 5ET5A 4GX6A 2PFYA 3IFCA 4I40A 4PGPA 4PCDA 4MMPA 4QBAA 5IGAA 3A29A 5EQ7A 4GWZA 1K9YA 4P47A 1KA0A 2XWOA 4X9TA 4O8MA 5LDZA 5EQAA 1NUYA 3SZPA 3MYUA 4HCYA 4PAKA 3FXBA 2V4CA 3ISPA 2P3VA 4KXPA 4NHBA 5EQ9A 2F5XA 1D9QA 4PE3A 4PDHA 5IM2A 1KA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF0 A;  2WX9 A;  4X04 A;  4P8B A;  4LN5 A;  4N15 A;  2ZZW A;  4PBQ A;  2ZZX A;  4P9K A;  4X8R A;  4OAN A;  2XA5 A;  4PFR A;  4OVP A;  4PAI A;  4OVQ A;  2XWK A;  4PC9 A;  4YZZ A;  5IZZ A;  2CEY A;  4O7M A;  4PAF A;  4PF8 A;  4MIJ A;  2VPO A;  3B50 A;  4MNP A;  4P1L A;  2WYP A;  4XEQ A;  2XWI A;  4YIC A;  4MNI A;  3U65 A;  5LTC A;  4N6K A;  4N8G A;  4PFB A;  4OVT A;  2HPG A;  4OVS A;  4N91 A;  2XWV A;  4P1E A;  4PFI A;  4MHF A;  4DI3 D;  2PFZ A;  3GYY A;  4NAP A;  4XF5 A;  4PF6 A;  2XXK A;  4NX1 A;  4MX6 A;  4N6D A;  4P56 A;  4XFE A;  4PET A;  4PDD A;  4OA4 A;  4UAB A;  5IM2 A;  4NG7 A;  2CEX A;  2HZL A;  5CM6 A;  4OVR A;  4NN3 A;  4DI4 B;  2WYK A;  2HZK A;  4MCO A;  4N4U A;  4PGN A;  4PBH A;  2VPN A;  5I7I A;  2ZZV A;  4N17 A;  4NGU A;  4MAG A;  4P3L A;  4NQ8 A;  4O94 A;  4MEV A;  4N8Y A;  4MNC A;  2PFY A;  4PGP A;  4PCD A;  4MMP A;  5IGA A;  4P47 A;  2XWO A;  4O8M A;  5I5P A;  4PAK A;  3FXB A;  2V4C A;  4NHB A;  4PE3 A;  4PDH A; 
#chains in the Genus database with same CATH topology
 3GZG A;  4NF5 B;  1LFG A;  1MH3 A;  2CZL A;  2F8D A;  3VLU A;  3TCF A;  4IO7 A;  1M5D A;  1QKA A;  1MQD A;  5J1D A;  2PCR A;  1FPL A;  4YKK A;  1FBP A;  3LV0 A;  4PC9 A;  4YKI A;  1PB7 A;  1RYO A;  4XKN A;  1B5I A;  2ZNS A;  4ZEC A;  1BLF A;  4MNP A;  1ANF A;  4KPT A;  4GFR A;  1POY 1;  1N76 A;  2ALU A;  4OQO A;  4MLQ A;  3B6W A;  5LTC A;  1UTB A;  3KN7 A;  1AOV A;  1S50 A;  2ONK E;  5K2Y A;  3IOR A;  3SES A;  3H3G A;  2XWV A;  1AL3 A;  1DTZ A;  1NI9 A;  3CSG A;  4OHN A;  1A8E A;  4GWO A;  3TEP A;  4GQO A;  5I2K A;  2ESN A;  2X7Q A;  3CVG A;  4F31 B;  2XXI A;  4KYS A;  4QSD A;  3N26 A;  2I6E A;  4PTK A;  1DCU A;  2UVH A;  1LFH A;  2HZK A;  3EQ1 A;  3FV1 A;  2V3Q A;  3RPL B;  3VLV A;  2HAV A;  4OEN A;  1A54 A;  4BDR A;  3AXF A;  4F3P A;  4XIG Q;  4ZEB A;  4QSE A;  4P0I A;  2ZNU A;  3N6U A;  4ESX A;  4R6K A;  1OQH A;  2XHD A;  4GX6 A;  2PFY A;  5IAI A;  2F7A A;  2IEE A;  4I40 A;  5KZT A;  2XWO A;  2F5X A;  4NF0 A;  4BDN A;  1SW5 A;  1QUL A;  3U8Q A;  4U4X A;  2Z23 A;  3KZG A;  2DSF A;  3OD7 A;  3C34 A;  2F7C A;  5T3J A;  1MPD A;  2XXR A;  4OET A;  5A5L A;  4RXL A;  3SER A;  2L5V A;  4GL0 A;  4YZZ A;  5IZZ A;  4ESW A;  3Q26 A;  1JNF A;  2I3W A;  3ILT B;  2XD2 A;  3VXC A;  3PD9 A;  2CZH A;  4QHQ A;  2Q8M A;  5JEI A;  1SYI A;  4BLA A;  3E3K A;  4ONY A;  3FVG A;  3PMX A;  5L9S A;  4N8G A;  4GD5 A;  1LCT A;  2KQZ A;  2XXV A;  3RYD A;  1BTJ A;  1MG1 A;  1DOT A;  2UVJ A;  1GGG A;  5LOM A;  3F11 A;  1IMF A;  1FPJ A;  3PGF A;  5H8Q B;  4N6D A;  1LAG E;  4QFO A;  3IB1 A;  1INP A;  3EPE A;  4F3G A;  3K6U A;  2F97 A;  4YB6 A;  1RYX A;  3CRB A;  4NN3 A;  1NV5 A;  4MF3 A;  3IO4 A;  1N3X A;  3EHS A;  4DZ1 A;  3HO7 A;  2V93 A;  3QYT A;  1CNQ A;  3D1R A;  3LUZ A;  1N04 A;  2O7I A;  3PMV A;  4LP2 B;  1IMB A;  3FJM A;  5I59 A;  2DWA A;  1FRP A;  5ET5 A;  1IEJ A;  1PDA A;  2D3I A;  5EQ7 A;  3MW0 A;  1JW4 A;  4R9G A;  3G3G A;  1R9Q A;  2WBB A;  1DSN A;  3K1M A;  1NV1 A;  1XVY A;  2PX1 A;  4QFN A;  3TFL A;  4ZZE A;  5L9M A;  2PBW A;  4N13 A;  1FPG A;  3ILU B;  1PBP A;  1MY0 A;  1Y1M A;  3LSX A;  5CBS A;  3RT6 B;  4OXV A;  1IXI A;  3O6I A;  2H4I A;  3QAX A;  3VVF A;  1FQE A;  1FBD A;  4OER A;  3TQW A;  3RUM A;  2XWI A;  1YAE A;  2JJK A;  4GWY A;  2NVU B;  2V3T A;  4KQP A;  3UP9 A;  3O6H A;  2Z22 A;  3V83 A;  4N6K A;  1MQI A;  4R9F A;  3VDF A;  5A5X B;  4OFL A;  1Y4T A;  2ONR A;  3RTF B;  4JSO A;  3THI A;  4F3S A;  1MY3 A;  1NKX A;  2GQ1 A;  1F9B A;  2XXK A;  5AA2 A;  4EXK A;  1TT1 A;  2DXR A;  4ZDM A;  5CMB A;  2YLN A;  5KCJ A;  3LSW A;  2W7Y A;  1LBV A;  4UAB A;  4GX3 A;  3TOD A;  5HBC A;  3S9E A;  1R1N A;  3MVY A;  4YKP A;  3T9U A;  1ZLQ A;  1S9T A;  2HXR A;  2XXW A;  4G8M A;  1FBH A;  2PT2 A;  3FJ7 A;  1LGB C;  4NTL A;  2DVC A;  5TP9 B;  3H06 B;  4QBA A;  3OEN A;  4P47 A;  5EQ9 A;  3EHU A;  2F36 A;  3OO9 A;  1KA1 A;  3RQT A;  3RLF E;  3TMG A;  2Z8E A;  4LN5 A;  5JTY B;  1ZMG A;  5DVF A;  4WED A;  2GFE A;  4F1U A;  1POT A;  1Z7N E;  3KJT A;  4AS4 A;  1NH7 A;  2DP8 A;  4X1B A;  5A5X A;  3U72 A;  1NV7 A;  1FCK A;  3MST A;  2XXQ A;  1UTB B;  1OLA A;  3R26 A;  4ZED A;  2WEF A;  2HCA A;  5AA4 A;  2XX8 A;  1JQF A;  3TCH A;  2DOJ A;  2DE3 A;  3C9H A;  3UN6 A;  3JV9 A;  2UYE A;  2A5S A;  1B32 A;  1FPD A;  1OVB A;  1SI1 A;  1MQH A;  1H3D A;  3G3J A;  1FQC A;  1JET A;  3KC0 A;  4PFY A;  1Z7M E;  4JVD A;  4R2B A;  1B5J A;  4LVQ A;  4PE5 B;  1IXH A;  3MP1 A;  3T96 B;  3TUS A;  1GR2 A;  2PVU A;  1P1O A;  5DVJ A;  3MPL A;  1NMU A;  2XXX A;  5ESY A;  5EQ8 A;  4EXL A;  5EYG A;  3C33 A;  3IJO B;  4NF6 B;  5CC2 A;  1VFE A;  1QVS A;  1H45 A;  4LZ5 A;  2VPN A;  1LBZ A;  4JDF A;  3ZKK A;  4I3E A;  1USY E;  2PYY A;  3TPA A;  1LAH E;  1I6A A;  2QS4 A;  5DYH A;  3N6T A;  3PD8 A;  3SZP A;  3FXB A;  2VD3 A;  3V89 B;  3O6G A;  3OO6 A;  3ZS6 A;  1P1N A;  1B1X A;  1YXI A;  4H8I A;  5AA4 B;  3QUF A;  3I3V A;  4PAI A;  4TLM B;  4R6Y A;  3ECR A;  3T93 B;  1XC1 A;  1JW5 A;  2XD3 A;  4MLV A;  4GXS B;  4I3Y A;  4M1V A;  3ONM A;  2GHB A;  3KSJ A;  3O28 A;  1D3K A;  4YB7 A;  4K3F A;  1Y9U A;  1B3F A;  4G68 A;  1Q35 A;  5I56 B;  3KGC A;  3SDF A;  1FPE A;  3K1N A;  4NF6 A;  4DI3 D;  4HCW A;  4DLD A;  3K6V A;  4R75 A;  3IL1 B;  1GV8 A;  4JXI A;  3QSL A;  4XKP A;  4G4P A;  5H8H A;  1RDX A;  3O66 A;  4FIM A;  4MBP A;  1B40 A;  2A5T B;  1LB9 A;  4R73 A;  3FVN A;  2FIX A;  4DIG A;  4PBH A;  2DS9 A;  3FJG A;  5I7I A;  4N17 A;  4I8C A;  1YZ0 A;  1ZBM A;  4EF2 A;  3MZ9 A;  1WVJ A;  2OWZ A;  3U93 A;  4JVC A;  3N5L A;  2QSX A;  1L5T A;  1J1N A;  1XI6 A;  4ISU A;  3DM0 A;  4ZS9 A;  1TFA A;  1DPE A;  4PCD A;  4U21 A;  1NNK A;  3E4R A;  3TYH A;  4ELP A;  3OOA A;  3OEK A;  4POW A;  4WKM A;  4OTE A;  3MPK A;  1NL5 A;  3TDJ A;  3BKI B;  3V8X B;  2XX9 A;  4TQU Q;  3CSB A;  1PC3 A;  3FXU A;  4FJP A;  5B70 A;  5CBR A;  2XWK A;  2ZMB A;  1H76 A;  5H8F A;  4RNS A;  2OBG A;  2I58 A;  1US5 A;  1MRP A;  2I4B A;  1NUZ A;  2O1L A;  3S4U A;  1B9J A;  3JYR A;  3Q29 A;  3OO8 A;  4GLI A;  4OES A;  3GBA A;  2FBP A;  2E1S A;  4U22 A;  3K01 A;  4ZE8 A;  3K4U A;  1SW1 A;  1LBX A;  1P1U A;  5DEX A;  1FPB A;  5I2N B;  3PPQ A;  1O7T A;  3C36 A;  3T1B A;  4E0W A;  2I3V A;  4DE8 A;  1YCJ A;  1IIT A;  1IZ1 A;  4IY6 A;  2B3F A;  4H45 A;  4F2O A;  4WXJ A;  2Y84 A;  1GTK A;  3OSR A;  1PB8 A;  5I58 A;  3BIG A;  4X9T A;  2CEX A;  3RT8 A;  1AWB A;  4N81 A;  3ZKL A;  1P1W A;  2H99 A;  4P11 A;  2UYF A;  3M8U A;  4GL8 A;  2O7U A;  1T0K A;  4H6D A;  4Z7E A;  5FBP A;  2QL3 A;  1MQJ A;  1IUD A;  3TTL A;  2DWH A;  5KDT B;  5FHM A;  4N8Y A;  4MNC A;  2KR0 A;  1I69 A;  2OZZ A;  2HEU A;  3OEL A;  4QSC A;  4MMP A;  4C0R A;  4DXC A;  5LDZ A;  1JEV A;  4HCY A;  3G3H A;  1M5C A;  5H8Q A;  4XKQ A;  3QXM A;  4FEB A;  4HE1 A;  1VFD A;  1URG A;  2CMO A;  3BFU A;  2ABH A;  4G68 B;  4OVQ A;  2Q88 A;  4MJO A;  4DXB A;  1B3L A;  2PMS A;  2GH9 A;  1FTJ A;  3K0V A;  3DP4 A;  1SPI A;  4ZEK A;  4MIJ A;  2VPO A;  1N3W A;  3VXB A;  4TOZ A;  2VGQ A;  4EDP A;  3PUV E;  1B7U A;  2A5T A;  1Y3Q A;  2AL4 A;  4R2F A;  5I56 A;  2XXP A;  2QVV A;  3SET A;  4C1T A;  4O7I A;  3KBZ A;  1YTV A;  5ELV A;  4NAP A;  2F3D A;  4ND9 A;  1FTO A;  4R72 A;  4N6P A;  3OSQ A;  4GVO A;  3D4C A;  2P0S A;  4OZ9 A;  3EHT A;  3MUQ A;  3DEL B;  3K6W A;  1IQ7 A;  1FTK A;  2I48 A;  3H6V A;  3S9N C;  3C32 A;  4LZ7 A;  1B7H A;  1EZP A;  3CR9 A;  4AQ4 A;  4N4U A;  4F29 A;  1ZKB A;  3PTY A;  4RJZ A;  1NNT A;  4GIZ A;  4QFL A;  1A8F A;  2OK2 A;  2Q2A A;  4F1V A;  4QF9 A;  2XXY A;  4AS5 A;  5ET7 A;  1JVX A;  2OX3 A;  4ELO A;  1FBG A;  3W15 C;  3IX1 A;  3EF7 A;  1G0H A;  3L6H A;  3IFC A;  4FE8 A;  4PGP A;  1A55 A;  2Y7I A;  4I1D A;  2FYI A;  5I5P A;  4R6H A;  2P3V A;  1Y3N A;  3IOW A;  1P1Q A;  3G7W A;  3BIH A;  2WX9 A;  5TPA B;  5HM4 B;  4FED A;  4IO5 A;  5DEX B;  4JWO A;  5CRY A;  2DYX A;  2DXY A;  5I57 B;  3VFJ A;  3MVZ A;  4UA8 A;  2Y5L A;  2KLF A;  2F6G A;  2ZYO A;  1FQF A;  4RPN A;  2VP1 A;  4YB5 A;  3B50 A;  1WDN A;  4U2R A;  4U23 A;  1VDW A;  3IFA A;  3IR1 A;  4NF5 A;  1SQY A;  4Z0I A;  5CMK A;  4KCD A;  4FAT A;  2Q8J A;  1O64 A;  3P7I A;  4PFB A;  4OVT A;  3C4M A;  2I0C A;  5ET6 A;  3OMB A;  3IO6 A;  3KJ7 A;  4POX A;  4MHF A;  4JWY A;  2B65 A;  2O51 A;  1EZO A;  4XTC Q;  3WAE A;  4I62 A;  1US4 A;  5DVI A;  2QPQ A;  1JP4 A;  3PPP A;  1LCF A;  3H6T A;  1M5B A;  2RCB A;  4G2Z A;  2OLB A;  1RDZ A;  2O1M A;  1LLS A;  5TP9 A;  3IB2 A;  2I0B A;  4GOT A;  3UGW A;  3MC2 A;  3RPW A;  2ZZV A;  3CHG A;  1ZU0 A;  1PBQ A;  5AE4 A;  1B3H A;  3OEM A;  5ET8 A;  3GLB A;  3FZV A;  2YPN A;  2HFB A;  2DWJ A;  1SI0 A;  1VE4 A;  4LZ8 A;  5DTB A;  5EQA A;  4PAK A;  1DMB A;  3KBR A;  5IZ1 A;  2B4L A;  3RN8 A;  1ZIU A;  4PBQ A;  2ZZX A;  2X26 A;  3O29 A;  2XA5 A;  5H8N A;  3RY3 A;  1EYK A;  2LAO A;  4F1Y A;  4OWD A;  5BWJ A;  3CFZ A;  4GWU A;  3T9H B;  4H5G A;  1FBC A;  1MXX A;  4NWC A;  2NOO A;  1NV3 A;  2HAU A;  4UAC A;  1ATG A;  2UXA A;  4IGT A;  3U94 A;  3MJN A;  3B7D A;  4H65 A;  3RNN A;  2MKZ A;  3CG3 A;  3FVO A;  3L6G A;  4OVJ A;  5ISU A;  4KFQ A;  3MWB A;  2QS2 A;  2BJJ X;  2WKY A;  4P1E A;  1IMC A;  2Q89 A;  5I3S A;  3ODB A;  2Y7W A;  4F18 A;  3D4G A;  3QMF A;  2B3B A;  3H7M A;  3T66 A;  4PDD A;  5IM2 A;  4O3C A;  1FPF A;  1LEV A;  5TPA A;  2GRV A;  4MH5 A;  1RKM A;  3MVX A;  2D21 A;  2WBD A;  4GF8 A;  2CZI A;  3LSL A;  1A7L A;  5F1Q A;  2O6A A;  1MXW A;  1B7Z A;  4NE4 A;  3K02 A;  2V3U A;  4NHB A;  1M5E A;  2F35 A;  3H03 A;  3UK4 A;  5EYF A;  3K2D A;  2VD2 A;  4EUO A;  2RC7 A;  4GXA A;  5H8S A;  2H5Y A;  3CIJ A;  4P9K A;  2XXT A;  2F34 A;  3A3C A;  4F2Q A;  1LAX A;  2M8C A;  5JTY A;  2Z8D A;  3RGY A;  2HHM A;  3IJX B;  4EQ9 A;  1GVC A;  2DWI A;  1IMA A;  4JB7 A;  5I58 B;  4F19 A;  4P1L A;  2R71 A;  3QUJ A;  4EF1 A;  1D9V A;  2FIE A;  4KR5 A;  3N94 A;  1MXY A;  4PQJ A;  1BKA A;  2VOZ A;  4QXD A;  1IMD A;  4Q5T A;  5IZ3 A;  3KC1 A;  2O84 X;  3H4Z A;  3FD3 A;  4YMA A;  1IME A;  4FBP A;  1XHY A;  4QFK A;  5B7D A;  3IOV A;  1B3E A;  3HST A;  2F7B A;  1ELJ A;  2OWS A;  2Q9T A;  4NG7 A;  3H6U A;  1OVT A;  5CI5 A;  3VLW A;  1EH3 A;  1N84 A;  4NF8 B;  4KD5 A;  3UA8 A;  1FSA A;  4DI4 B;  3WAF A;  4H0W A;  3R7X A;  4KHZ E;  5EYH A;  2P3N A;  1FQA A;  4NGU A;  4MAG A;  4PP0 A;  4R74 A;  4NQ8 A;  5KCJ B;  3UIF A;  1FPK A;  1HSJ A;  4FEC A;  1EU8 A;  1MXU A;  1YPN A;  1NNF A;  2V4C A;  1H43 A;  4IB2 A;  4PE3 A;  3TKD A;  4LA9 A;  1XS5 A;  1URS A;  1SW4 A;  5IKB A;  1MPB A;  4HTG A;  3PUW E;  2REG A;  5FHO A;  1FJ9 A;  3ROJ A;  3G3F A;  1AMF A;  3FBP A;  4GX4 A;  4IO6 A;  3BBR A;  1FW0 A;  3M3K A;  2ANJ A;  3LR1 A;  3VVE A;  3Q28 A;  2UVG A;  1B2H A;  3PUX E;  4HXV A;  4KI0 E;  4PAF A;  3M3L A;  4NMY A;  3S2V A;  5FTI A;  3FXR A;  3CFL A;  4XEQ A;  4YIC A;  5L8D A;  2REJ A;  1VSO A;  3O97 A;  4KYE A;  1CB6 A;  1OMP A;  2ZXT A;  5CMM A;  2IA4 A;  4H46 A;  2ONS A;  3FAT A;  4OVS A;  4N91 A;  1NUX A;  3LUY A;  1I6Q A;  1SVX B;  1Q1K A;  3KN8 A;  4OEV A;  1B52 A;  1EZ9 A;  2AYS A;  1G0I A;  2Q74 A;  4GBW A;  5I59 B;  4IGR A;  1JEU A;  1S7Y A;  3EKI A;  3M3F A;  1FJ6 A;  1SW2 A;  5CMC A;  4RY1 A;  1QJM A;  4ZEF A;  4YU0 A;  3O9P A;  4BDM A;  4PGN A;  1NV6 A;  4JSD A;  3DP6 A;  2V84 A;  3FXQ A;  3IOT A;  1MM7 A;  3K00 A;  1MS7 A;  4IO4 A;  4MEV A;  1JVY A;  4KCC A;  1K9Y A;  4O8M A;  3O2A A;  4X48 A;  5ICT A;  4KXP A;  3H6W A;  4DCY A;  2R9J A;  1TFD A;  3QIM A;  1B0H A;  4F22 A;  5AA2 B;  4IO3 A;  4LAT A;  3IOU A;  3DP8 A;  4OAN A;  4Q8R A;  3CI8 A;  2XXH A;  1EYJ A;  4O3A A;  4OVP A;  3USD A;  4C1U A;  1ZJL A;  1RDY A;  3U1O A;  3NOH A;  4GRK A;  4QRZ A;  4LUB A;  3C35 A;  3SEV A;  1FTA A;  3HHG A;  2WYP A;  2THI A;  1B4H A;  2FHY A;  3KFM A;  2E0S A;  3G3K A;  1LB8 A;  2CZK A;  4NF4 A;  1URD A;  4NF8 A;  1NNP A;  4N07 A;  4THI A;  2VHA A;  4F3B A;  5F7V A;  4BDO A;  3E79 A;  3CG1 A;  1NH8 A;  2RC9 A;  1A99 A;  4AB6 A;  5AA1 A;  3TQL A;  1UTH A;  4NWD A;  1P99 A;  4G61 A;  3MBP A;  1I6B A;  1N7W A;  4EQ7 A;  4OVR A;  1IXG A;  3SEU A;  1KZ8 A;  3EN3 A;  2I4C A;  2P1S A;  3W9V A;  2V25 A;  4RYA A;  3R6U A;  1Y1Z A;  3LSF B;  2RKM A;  5EHS A;  5HPQ A;  5K2X A;  4DCX A;  1B0L A;  1B4Z A;  2GHA A;  1KA0 A;  5ICQ A;  1MDQ A;  3KSX A;  1MXV A;  3KOS A;  4OEU A;  2R8T A;  1MY4 A;  4OFJ A;  3MAM A;  1VR5 A;  3IAZ A;  4HE0 A;  4GBV A;  3SKP A;  4E0X A;  1R6Z A;  2BJI A;  4GWS A;  3S9M C;  2D5W A;  4JBZ A;  4GWW A;  1TXF A;  1YYZ A;  2XXU A;  4KYD A;  2QVR A;  2P2A A;  4H5F A;  2Q2C A;  1UQW A;  2F78 A;  2F3B A;  1UTH B;  4XKR A;  5AA2 D;  2I49 A;  1MDP 1;  4H8J A;  5H8F B;  1AH5 A;  2Z8F A;  3A3U A;  4M4G A;  3OXN A;  4JVI A;  2PFZ A;  3FUZ A;  4XF5 A;  1N0T A;  3JZJ A;  4PF6 A;  2PT1 A;  4YKJ A;  3ZSF A;  5JK4 A;  1ZTY A;  4ECF A;  5ITP A;  1B5H A;  2F6P A;  4XFE A;  4YAH X;  4TLL B;  3IB0 A;  2VT5 A;  4OYV A;  4U1Z A;  2QRY A;  1MQG A;  4DDD A;  4H67 A;  1SBP A;  1BK4 A;  3FAS A;  4P0G A;  4PFT A;  3KG2 A;  4WEP A;  5J16 A;  1DPP A;  3HHF A;  2H9B A;  3VE1 B;  3I5O A;  1HSL A;  3IK6 B;  5FHN A;  2Y7K A;  5DW8 A;  1QUI A;  4X1D A;  5IGA A;  1CE2 A;  5FTH A;  4XXU A;  1SDX A;  3VV5 A;  1MH4 A;  1MXZ A;  3K6X A;  3K1P A;  4X04 A;  2DE2 A;  3HCQ A;  4P8B A;  4ZEI A;  1Y20 A;  5H8H B;  3LC8 A;  4RK2 A;  3MQ9 A;  2DQV A;  4PFR A;  3TEL A;  3HN0 A;  3E78 A;  1B1H A;  3PUY E;  4JWX A;  4MFI A;  4QFP A;  3KEI A;  1NV2 A;  3TCG A;  4PF8 A;  1FQB A;  3G3I A;  3GXA A;  4FAJ A;  2RIN A;  3TTM A;  2X7P A;  4NF4 B;  1EYI A;  4I9D A;  3E9X A;  3C31 A;  2ZYM A;  3U65 A;  1QUJ A;  1O63 A;  1B58 A;  1D4N A;  3T0J A;  4AB5 A;  4LQ2 A;  3GBB A;  1N7X A;  4G77 A;  1UIV A;  3HFU A;  1FBF A;  4HS7 A;  1LBB A;  4OFO A;  5BUU A;  5F24 A;  3PPN A;  4PFI A;  1H44 A;  3PPR A;  3PU5 A;  1B51 A;  2AL5 A;  3GYY A;  1XVX A;  2RC8 A;  5I84 A;  3BFT A;  4PFU A;  4IR8 A;  1FPI A;  1Y4C A;  1XOC A;  2H25 A;  4OA4 A;  1DK4 A;  2RF1 A;  3T9V A;  1LFI A;  2WYK A;  4Q30 B;  2NUV A;  1FQD A;  1NV4 A;  3SEW A;  1MM6 A;  4G8N A;  3FIR A;  4BDL A;  1K9Z A;  2QS3 A;  2XX7 A;  1B05 A;  3FV2 A;  3FGS A;  3RPL A;  4P3L A;  4O94 A;  1FTL A;  1PEB A;  1D9Y A;  3PUZ E;  3LBS A;  3A29 A;  2NXO A;  2QMX A;  4ZE9 A;  1QGX A;  4HE2 A;  1FBE A;  1FTM A;  2ZZW A;  4OMB A;  1USY H;  2FNC A;  1IIW A;  2ZNT A;  2FA7 A;  4RA1 A;  1LBC A;  2Y5K A;  4O7M A;  4NED A;  3KN3 A;  2DE4 A;  4PFW A;  3S9L C;  2ZYK A;  4H1X A;  1DTG A;  3TTR A;  1DBZ A;  2Y7P A;  1KWH A;  3MZB A;  3TTN A;  4MNI A;  5EHM A;  4O3B A;  1LST A;  1QKB A;  2OCU A;  1TWY A;  1JW1 A;  1OLC A;  1NV0 A;  5ITO A;  3U92 A;  1MY1 A;  1NFT A;  3PV0 E;  4EQB A;  2OJT A;  3I6V A;  1MY2 A;  3DLN A;  1HSE A;  4Q0C A;  2ZYN A;  1WOD A;  4NX1 A;  2G29 A;  2QFL A;  4MX6 A;  1OIB A;  1NUW A;  4RK9 A;  2DVZ A;  4LON B;  2HZL A;  3Q27 A;  4MCO A;  4RPO A;  3B8B A;  5L9O A;  2UVI A;  3B6Q A;  2QJE A;  4ELQ A;  4GWX A;  3MP6 A;  5DT6 A;  5AA3 A;  3E13 X;  5I2K B;  3T9X B;  1NUY A;  4HW8 A;  3MZ1 A;  1D9Q A;  4PDH A;  2QMW A;  2O68 A;  1BIY A;  2R6G E;  1QUK A;  4N15 A;  3TZA A;  2Y7R A;  1B6H A;  1IXC A;  4X8R A;  1SD3 A;  3A09 A;  4G68 C;  2B4M A;  2FVZ A;  4F39 A;  3W9W A;  2HXW A;  2OWT A;  3UOR A;  1Q9D A;  2CEY A;  2YJP A;  3TAJ A;  4U4S A;  2DDK A;  1LAF E;  3CFX A;  2HQ0 A;  1UIU A;  2H98 A;  4DXU A;  5I2N A;  3MVW A;  1R9L A;  1M5F A;  3FVK A;  5H8N B;  2O69 A;  4BDQ A;  2HPG A;  1LBY A;  4ZZA A;  1B46 A;  3RTW B;  1BP5 A;  1XT8 A;  5IZ3 B;  3Q25 A;  1MPC A;  4L17 A;  5M2V A;  2QVU A;  5TU0 A;  4IY5 A;  4YMB A;  3QK6 A;  4ELR A;  2RCA A;  1B3G A;  3SEX A;  4P56 A;  1Y3P A;  3PPO A;  3TTK A;  1OQG A;  4PET A;  4IO2 A;  2G93 A;  1PB9 A;  5CM6 A;  2NWJ A;  2QS1 A;  3HV1 A;  4G8H A;  1A40 A;  3MP8 A;  4U1O A;  3VVD A;  1QW0 A;  3V5A A;  5KDT A;  2AIX A;  1LBW A;  3HPI A;  3SEY A;  5I57 A;  4LQ5 A;  4FOR A;  3T22 A;  3B6T A;  4GWZ A;  3OO7 A;  1II5 A;  3MYU A;  3PMW A;  3ISP A;  1SYH A;  1AIV A;  3KOT A; 
#chains in the Genus database with same CATH homology
 5IZ1 A;  3BIH A;  2DE2 A;  2WX9 A;  4NF0 A;  4X04 A;  1QGX A;  2B4L A;  4HE2 A;  4P8B A;  2WBB A;  1FBE A;  4HE1 A;  4LN5 A;  4N15 A;  1FJ9 A;  2ZZW A;  2R8T A;  3ROJ A;  1NV1 A;  4PBQ A;  1YXI A;  2ZZX A;  4P9K A;  4X8R A;  3FBP A;  2B4M A;  4OAN A;  2FVZ A;  2XA5 A;  4PFR A;  1EYJ A;  4GX4 A;  5T3J A;  4OVP A;  5J1D A;  4F1U A;  4DI3 D;  1FPG A;  2PCR A;  4GBV A;  4HE0 A;  4PAI A;  4OVQ A;  1FPL A;  3W9W A;  5A5L A;  1EYK A;  2XWK A;  2Y5L A;  3E78 A;  1FBP A;  3LV0 A;  4MJO A;  4AS4 A;  2BJI A;  4GWS A;  4PC9 A;  2HHM A;  1RDY A;  2L5V A;  4GWU A;  2Y5K A;  4YZZ A;  1NV2 A;  3NOH A;  1Q9D A;  1FBC A;  5IZZ A;  2CEY A;  4HXV A;  4O7M A;  1IMA A;  4PAF A;  4PF8 A;  1NUZ A;  1SPI A;  2DE4 A;  1NV3 A;  1NV7 A;  4F19 A;  4MIJ A;  1FTA A;  2DDK A;  2VPO A;  1FBD A;  3B50 A;  3MST A;  4MNP A;  4P1L A;  2WYP A;  4I3Y A;  4XEQ A;  1VDW A;  2XWI A;  4GWW A;  2FIE A;  1YYZ A;  3IFA A;  4M1V A;  4YIC A;  2FBP A;  2FHY A;  1DBZ A;  2CZH A;  2JJK A;  2QVR A;  1EYI A;  2MKZ A;  2Q8M A;  4GWY A;  2CZK A;  4MNI A;  4QXD A;  1LBX A;  2WEF A;  3U65 A;  5LTC A;  1IMD A;  1FPB A;  3T0J A;  2F3B A;  4H46 A;  1NV0 A;  4N6K A;  4N8G A;  4PFB A;  4OVT A;  2HPG A;  2QVV A;  5ET6 A;  3HFU A;  2DE3 A;  3KC1 A;  3T1B A;  1FBF A;  1LBY A;  2KQZ A;  4OVS A;  4N91 A;  4O7I A;  3RYD A;  3KBZ A;  5I5P A;  5IZ3 B;  1NUX A;  2XWV A;  5F24 A;  1FPE A;  4P1E A;  1FPD A;  1IME A;  1NI9 A;  4PFI A;  4JVI A;  2QVU A;  4FBP A;  4MHF A;  2PFZ A;  3GYY A;  4HCW A;  2F3D A;  3E79 A;  4NAP A;  4H45 A;  4XF5 A;  1IMC A;  2GQ1 A;  5I3S A;  3KC0 A;  4PF6 A;  4F18 A;  2XXK A;  4NX1 A;  5JK4 A;  1IMF A;  1FPJ A;  1G0I A;  2QFL A;  3QMF A;  4JVD A;  2Q74 A;  4GBW A;  4IR8 A;  4MX6 A;  4N6D A;  1FPI A;  1NUW A;  4P56 A;  2QPQ A;  1JP4 A;  4XFE A;  3EKI A;  1INP A;  4PET A;  2DVZ A;  1FJ6 A;  1LBV A;  3BIG A;  4G61 A;  4OA4 A;  4PDD A;  2Q9T A;  1RDX A;  4GX3 A;  2CEX A;  4NG7 A;  4UAB A;  1AWB A;  4N81 A;  2VT5 A;  4PTK A;  1DCU A;  1DK4 A;  1FPF A;  1LEV A;  1RDZ A;  2HZL A;  5CM6 A;  4OVR A;  4NN3 A;  1FSA A;  2WYK A;  5ESY A;  4DI4 B;  5EQ8 A;  1KZ8 A;  2HZK A;  4MCO A;  4N4U A;  1NV5 A;  5EYG A;  3PTY A;  1BK4 A;  3RPL B;  2V3Q A;  1NV4 A;  2FIX A;  4PGN A;  3B8B A;  3W9V A;  4F1V A;  2HXR A;  4PBH A;  1NV6 A;  5EYH A;  2VPN A;  4AS5 A;  2P3N A;  2ZZV A;  3CHG A;  4N17 A;  5ET7 A;  1LBZ A;  4NGU A;  5I7I A;  1YZ0 A;  1K9Z A;  1FBH A;  4MAG A;  5J16 A;  5IZ3 A;  5FBP A;  2WBD A;  2OX3 A;  2CZI A;  1CNQ A;  2OWZ A;  3D1R A;  3LUZ A;  1FBG A;  4GWX A;  4I3E A;  4JVC A;  1LBW A;  3RPL A;  4P3L A;  4NQ8 A;  4O94 A;  5ET8 A;  1FPK A;  1IMB A;  4MEV A;  1G0H A;  1XI6 A;  4MNC A;  4N8Y A;  2KR0 A;  5DW8 A;  1FRP A;  5ET5 A;  4GX6 A;  2PFY A;  3IFC A;  4I40 A;  4PGP A;  4PCD A;  4MMP A;  4QBA A;  5IGA A;  3A29 A;  5EQ7 A;  4GWZ A;  1K9Y A;  4P47 A;  1KA0 A;  2XWO A;  4X9T A;  4O8M A;  5LDZ A;  5EQA A;  1NUY A;  3SZP A;  3MYU A;  4HCY A;  4PAK A;  3FXB A;  2V4C A;  3ISP A;  2P3V A;  4KXP A;  4NHB A;  5EQ9 A;  2F5X A;  1D9Q A;  4PE3 A;  4PDH A;  5IM2 A;  1KA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...