2CEXA

Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
DYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of Structure and Mechanism in Primary and Secondary Transporters Exemplified by Siap, a Sialic Acid Binding Virulence Factor from Haemophilus Influenzae
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport
molecule keywords PROTEIN HI0146
total genus 112
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2cexA00
2CEXA 4MMPA 4PDDA 4N4UA 5IZZA 2V4CA 4MIJA 5IGAA 4PETA 3U65A 4PDHA 4MNPA 4P47A 4DI4B 4NAPA 4P9KA 4PFRA 3B50A 4PBQA 4PC9A 2HZKA 4PFIA 4LN5A 4MCOA 4PAKA 2VPOA 2VPNA 3GYYA 4NGUA 4PAFA 4UABA 2XWKA 2ZZWA 4NN3A 4N8YA 2XXKA 4OVSA 4NF0A 2ZZVA 4PCDA 4PGPA 2WYKA 4MHFA 2XWVA 4P3LA 5I5PA 2HPGA 5I7IA 4XEQA 4O8MA 2WX9A 4PFBA 4O7MA 4PF6A 2XWIA 4OVQA 4MNCA 4N6KA 4OA4A 4PGNA 2ZZXA 4PE3A 4P1EA 4MAGA 4NX1A 3FXBA 4YICA 4X8RA 5IM2A 4P56A 4O94A 4N6DA 4YZZA 4P8BA 4OVTA 4X04A 2HZLA 4NHBA 4MEVA 2PFYA 2XWOA 4PAIA 4MNIA 4N17A 4P1LA 4OVPA 4DI3D 4N91A 2WYPA 4NQ8A 4N8GA 2XA5A 5CM6A 4PBHA 2PFZA 2CEYA 4MX6A 4XF5A 4OVRA 4NG7A 4OANA 4XFEA 4PF8A 5LTCA 4N15A
chains in the Genus database with same CATH superfamily
3UA8A 1NNPA 4IGTA 3FXRA 2CZHA 4XIGQ 1FBEA 1HSJA 4IY6A 2RC7A 5IZZA 3RN8A 4EUOA 4MF3A 5M2VA 3VXCA 4NAPA 1FPLA 3S9NC 1NNFA 5CMBA 1LBZA 5ET7A 5K2YA 3V89B 3G3IA 1ZIUA 3OELA 4KI0E 3IOVA 3RT6B 1BK4A 3H4ZA 5KDTA 1URSA 3FATA 3LC8A 4LQ5A 1DCUA 4RK9A 5B7DA 1JW1A 3K1MA 4R2BA 4H65A 5I2KA 1TFDA 1FTJA 5FTIA 2L5VA 4ZECA 4G61A 2XWIA 1FBCA 4U4SA 3RQTA 3H7MA 1P99A 5L9OA 2DE4A 3TCGA 1OMPA 1TT1A 2Y7RA 3L6HA 3C33A 3C9HA 4X8RA 4F3BA 2VD3A 1LBXA 1PEBA 2GHAA 1NV7A 2HZLA 3FXUA 4GL0A 2PFYA 1EYIA 3FVGA 3ILTB 3O6GA 4MFIA 2HEUA 1G0HA 3H6WA 4GX4A 3TELA 3TTNA 3M3LA 5L8DA 4G2ZA 1OVTA 3MZ9A 3O29A 1QW0A 4XF5A 2O6AA 1B6HA 4EXKA 5LTCA 3U8QA 3LUYA 1UIUA 2QS3A 1NV5A 5A5XB 2OCUA 1POTA 1P1NA 3E13X 3PD9A 4I3EA 4R6YA 3IB2A 1DK4A 3OO8A 3IO6A 4KPTA 4MLQA 2R8TA 2CZLA 1QVSA 4MNPA 3W9WA 3HO7A 3S9EA 3GLBA 1WODA 1LLSA 1S7YA 4DXBA 4U4XA 4YMAA 4MH5A 2DVCA 1B7UA 2XXWA 3KN8A 5AA2A 3KSXA 1I6QA 4P0GA 3MSTA 2AIXA 1DBZA 1FPBA 5F24A 2KQZA 4NWDA 3RLFE 4XKQA 4O7IA 5A5XA 4GWSA 2HPGA 1JW5A 4AS4A 1NFTA 1US5A 5TPAA 3BFUA 5EQAA 3FD3A 3I5OA 4PE3A 4IO4A 2R6GE 1JETA 3B8BA 5I58B 1B3GA 3UIFA 4IGRA 4G68B 4ND9A 3UP9A 1LBVA 1SW2A 3N6UA 1Q1KA 4G8NA 4GX3A 3OO9A 2OWZA 1GVCA 4E0XA 3MW0A 1RDZA 5H8QA 1QKBA 1YYZA 1TWYA 3K01A 4EF2A 1NNKA 3UK4A 3OXNA 1IITA 1I69A 1LGBC 4FJPA 3V5AA 2P2AA 2CEYA 4NF5A 2D21A 3Q27A 2GQ1A 1JQFA 2Z8DA 1MQHA 1MXUA 3WAFA 3TTMA 4WEPA 1ZLQA 3KBRA 3M3FA 2WBBA 3CIJA 4MIJA 1MY1A 5CMKA 1B52A 3FJGA 1NV0A 3R26A 2HQ0A 4EQ9A 2RCBA 3V8XB 2V25A 3RPWA 2I49A 3S4UA 5TPAB 1Y9UA 1CB6A 4U21A 5BUUA 1B5JA 1WVJA 1O7TA 1B2HA 1R6ZA 2Q74A 5I58A 1AOVA 2H5YA 3FJ7A 3K2DA 5HPQA 2I6EA 3JV9A 3KC0A 1SD3A 1MS7A 2XWVA 1P1QA 4PFYA 3RY3A 2DXYA 3HCQA 2F3BA 4POWA 2O69A 4ELPA 4N07A 1NV1A 1B1HA 2I48A 1NMUA 4N6KA 3QUFA 3IOTA 1B3FA 4Z0IA 1B4HA 3IJXB 4TLLB 1B3HA 2HAUA 4KFQA 1B9JA 1H76A 4F31B 2I3WA 4RY1A 2CZKA 1N3XA 2I58A 1DTZA 1POY1 1FTOA 5J16A 4OVPA 2UVGA 4ESXA 4ESWA 3H6UA 4POXA 3O6IA 1Y20A 5KZTA 1BP5A 1LCFA 5JK4A 4F3PA 1UTHB 5DW8A 1D9YA 1IQ7A 4ZS9A 3QSLA 4MMPA 2DDKA 4GQOA 1N04A 2D5WA 2REJA 1H44A 2NXOA 2H25A 1QKAA 1MQIA 3U72A 4QFKA 3UN6A 3IO4A 2BJJX 1LFHA 1MY0A 1H45A 3T9UA 1AL3A 4OVJA 3UGWA 1MXXA 5DT6A 4P0IA 2DE3A 4MCOA 3GYYA 2RCAA 1F9BA 3OOAA 4YB5A 5FHOA 4NN3A 3ROJA 3FASA 4GWWA 4G68A 1Y3QA 4YKPA 1SDXA 1FW0A 2XXIA 5DVJA 2YJPA 2UXAA 4OHNA 3O28A 4AB6A 4ZE9A 1FTMA 1FTKA 5H8QB 4NMYA 2FA7A 1AH5A 3PPQA 4WXJA 1LB9A 4AS5A 1MM7A 3CFXA 3QK6A 3VFJA 4P56A 5ITPA 1P1OA 5EQ9A 4HTGA 3GZGA 3D4GA 4FECA 4PAIA 4KXPA 2QMXA 2XXPA 2VHAA 1ZKBA 5CMMA 1LCTA 3KC1A 3E79A 2F6PA 2DS9A 4JB7A 2I0CA 4NF6B 5CBRA 1Y3NA 5DEXB 3THIA 1N7XA 1SI0A 4KYEA 1ZJLA 1IEJA 2IEEA 2WX9A 1NI9A 5CBSA 4N4UA 3C31A 4GBVA 5I3SA 2FHYA 2X26A 1IUDA 5IGAA 4H45A 1IMBA 4P47A 1FPIA 3B50A 3V83A 5AA2B 3MZ1A 1MQJA 1DPEA 2VPOA 4RJZA 3RTWB 1RDYA 4F3GA 4QBAA 1HSLA 2H4IA 4IO6A 3OMBA 2XXKA 3N6TA 3U92A 2FYIA 4PP0A 4F18A 3CRBA 3BFTA 4LATA 3MQ9A 4MHFA 1A55A 3T9VA 4OEUA 2ANJA 3OENA 2V3QA 3K6XA 3EKIA 2QVUA 3PMXA 3T9XB 4PFBA 4O7MA 1IXCA 5KDTB 2ZZXA 5EHMA 4P1EA 1VFDA 1JNFA 2GFEA 4ZDMA 2Y84A 4MLVA 4ZEFA 4R9FA 3EHUA 4OENA 3OO6A 1R1NA 3ODBA 5TU0A 1FBGA 2PCRA 3TCFA 1CNQA 1MXWA 3B6TA 1ELJA 3HV1A 5CRYA 5ICQA 4OERA 1MY4A 1MQGA 5I2NA 4I40A 3E78A 2LAOA 4NG7A 3VVDA 3TODA 1NV4A 4O3AA 1PB8A 4WKMA 3NOHA 2VP1A 3GXAA 3MPLA 1G0IA 2OK2A 3SEXA 1JVYA 4JVDA 3N94A 3S2VA 4ISUA 3PV0E 4JDFA 4YB6A 4PDHA 2Q88A 3K02A 4KYSA 3IORA 4DI4B 3FJMA 4RNSA 2QS4A 4R74A 5EYFA 1DOTA 2UYFA 1IMFA 1XS5A 1SW1A 2O1LA 3KSJA 4OTEA 5I2NB 2BJIA 4OVSA 2Y7WA 3VLVA 4QRZA 4U1OA 3MC2A 1T0KA 3RPLB 2ONKE 1XOCA 2R71A 3TTLA 1B05A 1K9ZA 3MVWA 5A5LA 3QMFA 2CMOA 4PF6A 4NF8B 1SW5A 2F35A 1TFAA 3I6VA 3BIGA 1M5EA 4NF6A 4R73A 3G3JA 4RYAA 4OYVA 3Q26A 2GH9A 5H8FA 3T9HB 4OVTA 2WEFA 2XXVA 2HCAA 2KR0A 3O2AA 3MAMA 1A99A 4LZ8A 4QF9A 4I9DA 1JW4A 2ZNTA 3ECRA 4DIGA 3SESA 4BDOA 2HAVA 3RPLA 3CFZA 4JBZA 4N8GA 2XA5A 4EF1A 3PU5A 1FQEA 2O84X 3K4UA 2XXHA 3LUZA 5LDZA 2F34A 3L6GA 4QFLA 4NF5B 4PE5B 2O68A 1IMDA 4H46A 4P9KA 2PVUA 4PFRA 4GRKA 1LAXA 3LSLA 4PAKA 1J1NA 2XXXA 1B7HA 1OQHA 4AB5A 4PAFA 3VVFA 5ELVA 1XVXA 1NUYA 3EQ1A 2THIA 4BDNA 1ZMGA 2A5TA 1KZ8A 3Q29A 4OMBA 5EYGA 2D3IA 4ZZEA 2PT2A 5H8HA 3T96B 4AQ4A 4H1XA 1JVXA 5HM4B 2Z22A 1MXYA 3TQLA 2Z8FA 1NNTA 4LQ2A 4G77A 3FBPA 4HS7A 2F7AA 1B7ZA 2XXQA 4O94A 4C1UA 1GTKA 1N76A 2PMSA 3O6HA 2XWOA 2ONRA 1S50A 5DEXA 1NKXA 5IZ1A 1Y1MA 1IMCA 2AYSA 3PUVE 2YPNA 3B6WA 5ET8A 5I59A 3MWBA 3KOSA 4GBWA 1XI6A 2DVZA 2Q2AA 3CSBA 4QSEA 4FEBA 4PF8A 4PDDA 3KJTA 5TP9A 3LSWA 2H98A 4F29A 3TQWA 2V4CA 2V93A 2GRVA 3IL1B 1AMFA 4C1TA 1TXFA 2PT1A 3KFMA 4DDDA 1SVXB 1PBPA 4RPNA 1OLAA 5ITOA 4O3CA 3FV1A 4I8CA 3A29A 1PDAA 2ZZWA 5FHNA 2P1SA 4RA1A 4N8YA 4GD5A 4DZ1A 3MVXA 1IXGA 1H43A 4YU0A 4Q8RA 2F36A 4PGPA 2XX8A 4O3BA 2DOJA 2F6GA 1EZ9A 3IOWA 4RPOA 4OEVA 1M5CA 5LOMA 4ZEDA 2Y7PA 1KWHA 1URGA 4JWOA 3W15C 1US4A 4BDLA 5EHSA 1RYOA 3MP1A 5L9MA 3IR1A 5I56B 4YAHX 4DCYA 1YCJA 3IK6B 2VT5A 4H5GA 4LVQA 3KJ7A 5DVIA 4ZEIA 2B65A 2OLBA 3M3KA 4NQ8A 1FBPA 1RDXA 1PB9A 1D3KA 1NUZA 3PPOA 3EHSA 5I57A 4R75A 4XFEA 3C4MA 4N15A 4IR8A 4MBPA 3OEMA 2O7IA 4LZ5A 3CG1A 1FSAA 2ONSA 3CHGA 3O9PA 2OX3A 2H9BA 4GXAA 2QL3A 1QUKA 5AA3A 2QVRA 2I4CA 3PUZE 1MM6A 3MZBA 2P3VA 4GX6A 4G68C 3KEIA 5ESYA 3G3GA 2QS2A 3IJOB 4PC9A 3BIHA 1D9VA 3R7XA 3SEYA 2Y7KA 1UTHA 4M4GA 5B70A 1MPBA 4H0WA 2QJEA 3G3FA 4PFUA 1CE2A 4PFWA 3B7DA 4EQ7A 1D9QA 1R9LA 4NF0A 4OFLA 3PD8A 2FIEA 1AIVA 2ZZVA 2E0SA 3FVKA 5I84A 1ATGA 2W7YA 3DELB 4TOZA 2QPQA 2UYEA 1K9YA 3JZJA 2PYYA 1EZOA 3Q25A 1M5BA 5EQ7A 5FHMA 3RYDA 3DM0A 4OA4A 4PGNA 4R6KA 1N0TA 4THIA 3CI8A 5I59B 4GXSB 3TUSA 3F11A 2I4BA 1EZPA 1R9QA 2P3NA 1LBBA 4BDRA 4G8MA 1Y4CA 3TKDA 4DCXA 1QGXA 4FEDA 3PMWA 2MKZA 3U94A 3T66A 1B58A 2WYPA 1PBQA 1FTAA 4F2OA 3HHFA 2Q8JA 2V3UA 4U23A 2F7BA 4U2RA 4N13A 3TTRA 3TDJA 1XVYA 3T1BA 3SEUA 3KGCA 5H8NA 2B3FA 1SI1A 1LAGE 1YTVA 3PUXE 3QXMA 1DTGA 3E4RA 4WEDA 4EDPA 4JVCA 1MDQA 1B5IA 4ZE8A 3G7WA 2F8DA 3PPNA 4JXIA 2XX9A 3R6UA 4G4PA 5ISUA 4RK2A 2VPNA 1VDWA 3H3GA 3H6TA 3N26A 4UABA 5F1QA 4XKNA 4ECFA 4GOTA 5I56A 4RXLA 1OLCA 2F5XA 2Q2CA 4LONB 4NEDA 1EH3A 4P3LA 2VGQA 3M8UA 3C32A 2Y5LA 3SZPA 3HFUA 4L17A 1LBCA 5AA2D 1O64A 1FCKA 4MNCA 1OIBA 3AXFA 2Q8MA 2O7UA 4F39A 4NX1A 3DP6A 3OSRA 1INPA 5IM2A 1UIVA 2B4LA 1FBDA 2B4MA 3P7IA 4R6HA 5H8HB 2G93A 3U93A 3RUMA 1NV2A 4NF8A 4H8JA 4NHBA 4HW8A 5AA1A 1UTBB 5ICTA 3PMVA 4G8HA 4P1LA 2ZYOA 1B0LA 2DQVA 1SYIA 3T22A 5AE4A 4X1BA 3MVYA 4BDMA 1GGGA 4LUBA 1FBFA 1URDA 4OZ9A 1OVBA 5FTHA 1KA0A 1FQFA 2B3BA 1LAFE 4GIZA 4QSCA 3TTKA 2RINA 3DLNA 3IFCA 3IB1A 1YPNA 3Q28A 2HXRA 1MY2A 2WKYA 1DSNA 1SPIA 3FGSA 4HCWA 1BKAA 2HZKA 4LN5A 1YZ0A 4GWOA 4MJOA 4FE8A 2ZMBA 3K1PA 4LA9A 3OSQA 3KBZA 4GFRA 3LSFB 2RF1A 2ALUA 1KA1A 2XD3A 5DTBA 3S9MC 4IO5A 3K6VA 3LV0A 3MUQA 4XKRA 3C34A 5I5PA 1B4ZA 5ET6A 3TEPA 3IAZA 1B51A 1L5TA 4I3YA 4EQBA 1BIYA 2XXYA 2Z8EA 2UVHA 4XXUA 2M8CA 1JP4A 4IO2A 3SEWA 3VXBA 4GWZA 1H3DA 3I3VA 4Q30B 4DLDA 4U22A 4LZ7A 4X04A 5CMCA 3FVNA 4F3SA 1XHYA 1I6AA 4PFTA 4MNIA 1AWBA 4N17A 3FUZA 2F3DA 2HHMA 5I57B 3KG2A 2I0BA 2O1MA 2QS1A 1A7LA 2X7QA 1ZU0A 2F7CA 5CM6A 1IZ1A 2ABHA 2PFZA 2AL4A 2DWHA 4QFPA 4YKJA 2DWJA 2ESNA 3TYHA 2XXRA 2JJKA 2UVIA 1MXZA 2CZIA 4GF8A 3LSXA 1IXIA 2QSXA 1NUXA 4Q0CA 2NVUB 1FTLA 2XX7A 4F1UA 4OETA 4KR5A 4Q5TA 4PFIA 3K6UA 2HFBA 2VOZA 3USDA 1USYH 3MYUA 4X9TA 3S9LC 4E0WA 1FPFA 5HBCA 4YMBA 1MDP1 2DSFA 5KCJA 1M5DA 2Q9TA 2WYKA 3IX1A 1FJ9A 1FQAA 4ZEBA 4TQUQ 1B1XA 3O97A 1UTBA 1NV6A 4XEQA 4O8MA 5ET5A 4NF4A 2IA4A 1RYXA 1NH8A 1LBYA 3MVZA 1FRPA 4MAGA 3QAXA 3A09A 1VR5A 4FIMA 1N84A 2V84A 5AA4A 1BLFA 2F78A 3TAJA 4MEVA 5EQ8A 3SKPA 3ZKKA 3CG3A 2A5TB 1FPDA 5KCJB 2DWIA 4QFNA 1N3WA 2RKMA 4H67A 2NWJA 1MH4A 4JWXA 4F22A 2ZYKA 4K3FA 4UACA 4BLAA 4HXVA 3HN0A 4QHQA 2FVZA 3C35A 1LBWA 4FORA 3TMGA 1FPEA 4PTKA 2E1SA 3TFLA 3T93B 1SW4A 2AL5A 2ZYNA 4KQPA 3HPIA 1B3LA 4HCYA 2DE2A 4OWDA 1B0HA 2V3TA 3GBAA 5J1DA 1A8EA 2FNCA 1S9TA 2YLNA 1B3EA 2FBPA 3B6QA 2A5SA 3K0VA 2XWKA 1II5A 1VE4A 3VE1B 2ZNUA 1PC3A 4OESA 5F7VA 2XXTA 2DYXA 2P0SA 4R2FA 4ZEKA 3PGFA 2DWAA 4C0RA 1A8FA 3LBSA 1A54A 4ELQA 4I1DA 5IAIA 4OFJA 4DXUA 2F97A 4KD5A 1Y4TA 4UA8A 4HE2A 4N6DA 4YZZA 1FBHA 2NUVA 1VSOA 3K1NA 1NUWA 3RGYA 3TPAA 1EU8A 1MXVA 2FIXA 1DMBA 2G29A 3KN7A 4HE1A 3ZS6A 4N91A 4GVOA 1P1UA 3C36A 4PBHA 1HSEA 4OANA 1D4NA 3E3KA 4FBPA 2CEXA 1NL5A 1EYKA 4YKIA 3SEVA 3KOTA 3CR9A 3WAEA 3RTFB 4F19A 3MP8A 3QUJA 5IKBA 4YB7A 4N6PA 4OQOA 4R9GA 3LR1A 1Z7ME 4PETA 1FQBA 5FBPA 2Z23A 1YAEA 4PBQA 3TCHA 5H8NB 3VDFA 3FXQA 5JTYB 4NF4B 3MPKA 5L9SA 3A3CA 4KYDA 2WBDA 3OEKA 3FV2A 3H06B 3O66A 3SETA 1FPJA 1MRPA 3VLUA 5DYHA 4GWUA 4X48A 2QFLA 5I7IA 3PPPA 1MPDA 4GWXA 4JSDA 5I2KB 1FPGA 3EPEA 4M1VA 1IMAA 3IB0A 3FXBA 3CFLA 1JEUA 1MH3A 2O51A 3KN3A 2ZYMA 4NTLA 4JVIA 1GV8A 3BBRA 4NE4A 3SDFA 1FQCA 5IZ3B 4R72A 2KLFA 2REGA 2I3VA 1ANFA 2ZXTA 1Z7NE 1DPPA 3OD7A 4KHZE 2OBGA 2R9JA 4IO3A 4ELRA 1UQWA 5H8FB 5EYHA 4ELOA 3ILUB 1ZTYA 5K2XA 1WDNA 1LB8A 1NH7A 1MY3A 3W9VA 1VFEA 4DE8A 3EF7A 3FIRA 2ZNSA 5DVFA 1LEVA 3CSGA 2RC8A 1GR2A 4FAJA 3FZVA 3SERA 4BDQA 2GHBA 3D1RA 4QXDA 4YKKA 3CVGA 4ONYA 2PX1A 4GL8A 4F1YA 1SYHA 3ONMA 4IB2A 1OQGA 4IY5A 4PCDA 3PUYE 5BWJA 3IFAA 1QUJA 3EN3A 4I62A 4Z7EA 3MBPA 1FQDA 1ZBMA 5AA4B 4EXLA 3VLWA 4N81A 1N7WA 4GWYA 4KCCA 1XT8A 4YICA 3DP4A 5H8SA 3E9XA 4LP2B 2OWTA 3A3UA 3H6VA 3KZGA 1B5HA 1P1WA 2VD2A 1SQYA 4JSOA 3JYRA 2OZZA 2Y5KA 1QULA 3QYTA 3OO7A 4DI3D 2XHDA 1I6BA 1NV3A 3RNNA 2OWSA 1IMEA 2QMWA 1Y3PA 4X1DA 4KCDA 1BTJA 4HE0A 4DXCA 2QRYA 2XD2A 3MP6A 5JTYA 3PPRA 4ZZAA 3PUWE 3ISPA 1B40A 1XC1A 1QUIA 3RT8A 1M5FA 3MJNA 2H99A 3U65A 1B46A 1SBPA 3HHGA 4H8IA 3N5LA 4OFOA 4PQJA 5TP9B 4H6DA 2NOOA 3T0JA 2Y7IA 5T3JA 2Q89A 1USYE 3QIMA 4XKPA 1JEVA 4NGUA 2XXUA 1QJMA 1FJ6A 1PB7A 2HXWA 3IOUA 3U1OA 4NWCA 2UVJA 4XTCQ 1MPCA 3PTYA 1Q9DA 1LAHE 2RC9A 1RKMA 5IZ3A 2DXRA 3DP8A 1O63A 3ZKLA 2QVVA 5JEIA 1B32A 1IIWA 4OVQA 3VVEA 1MQDA 1MG1A 4TLMB 4QSDA 4P11A 4FATA 3FVOA 4P8BA 1IXHA 1Q35A 3GBBA 3TZAA 4H5FA 1LFGA 3VV5A 4GLIA 1LSTA 1YXIA 2DP8A 3UORA 3HSTA 5CI5A 3G3KA 2X7PA 1EYJA 4U1ZA 3K00A 3K6WA 3D4CA 3G3HA 3BKIB 3H03A 3ZSFA 1LFIA 1FPKA 4JWYA 1Y1ZA 4MX6A 4F1VA 3EHTA 4QFOA 4OVRA 4OXVA 1A40A 2PBWA 2OJTA 5CC2A 4F2QA 4IO7A
chains in the Genus database with same CATH topology
1FBFA 1NI9A 3LUZA 4FBPA 2CEXA 4HXVA 4MMPA 5LDZA 2DDKA 4PDDA 2CZHA 1KA0A 2JJKA 1EYKA 1FBEA 4N4UA 5I7IA 1FSAA 2FVZA 3CHGA 3NOHA 1NV5A 2OX3A 2CZIA 4GBVA 5I3SA 3T1BA 2FHYA 1LBWA 3ISPA 4F19A 5IZZA 3IFCA 1G0IA 2V4CA 4JVDA 1FPEA 2WBBA 4I3EA 2HXRA 4MIJA 2QVRA 4PTKA 3W9VA 1NUXA 5IGAA 1DK4A 4PETA 4PF8A 4H45A 3U65A 2P3VA 4GX6A 2R8TA 4HCYA 4PDHA 2DE2A 1SPIA 5ESYA 1IMBA 1IMDA 4JVCA 4MNPA 1NV0A 4H46A 4P47A 4NAPA 3W9WA 1LEVA 4P9KA 4HCWA 4DI4B 5FBPA 4N15A 1FPLA 4PFRA 4F1UA 1FPIA 3B50A 2DE3A 1IMFA 2HZKA 4PBQA 4PC9A 4PFIA 3T0JA 4LN5A 1LBZA 1YZ0A 3BIHA 4MCOA 5ET7A 4MJOA 4PAKA 5J1DA 2VPOA 5T3JA 3D1RA 4QXDA 2VPNA 1RDYA 3GYYA 2FBPA 1VDWA 4QBAA 4NGUA 2WBDA 3MYUA 3A29A 3KBZA 4PAFA 4UABA 2XWKA 2ZZWA 4X9TA 2BJIA 1FJ6A 1KA1A 2Q74A 3MSTA 1D9QA 2XXKA 4N8YA 4NN3A 3ROJA 4OVSA 1FPFA 4GWWA 4NF0A 1BK4A 1DBZA 1FPBA 2FIEA 5F24A 1FPJA 2ZZVA 4PCDA 1NUYA 2F5XA 4F18A 2Q9TA 1DCUA 3KC0A 2KQZA 3RPLB 4PGPA 4GWUA 2WYKA 3PTYA 4MHFA 1Q9DA 1FJ9A 2XWVA 4P3LA 3IFAA 2F3BA 3LV0A 2V3QA 5IZ3A 2QFLA 1KZ8A 2Y5LA 4O7IA 5EYGA 5I5PA 2QPQA 3EKIA 2HPGA 4GWSA 5ET6A 3SZPA 1K9ZA 1NV1A 1NV6A 2QVUA 4XEQA 1K9YA 2QVVA 4O8MA 2L5VA 3HFUA 5A5LA 4PFBA 3QMFA 4GWXA 4O7MA 4PF6A 5ET5A 4G61A 2XWIA 4OVQA 1FBCA 4I3YA 4MNCA 5EQ7A 5EQAA 3RYDA 1LBYA 4AS4A 4N6KA 4N81A 4OA4A 1FPGA 2ZZXA 4PE3A 4PGNA 2Q8MA 3BIGA 4P1EA 1FRPA 4MAGA 2DE4A 3FBPA 3B8BA 4GWYA 4M1VA 1IMAA 4NX1A 4AS5A 1JP4A 3FXBA 4YICA 1INPA 4X8RA 4HE2A 2P3NA 5IM2A 4P56A 4O94A 1LBXA 4N6DA 4YZZA 4GWZA 2B4LA 4P8BA 1FBHA 1FBDA 2B4MA 4OVTA 2WEFA 1NV7A 2CZKA 1LBVA 4JVIA 2KR0A 5EQ9A 1NV2A 4X04A 1NUWA 2HZLA 1FBGA 2PCRA 4NHBA 4MEVA 5IZ3B 2PFYA 2XWOA 4GX3A 2OWZA 5EQ8A 1YXIA 2Y5KA 4PAIA 4MNIA 2VT5A 1RDZA 1EYIA 1AWBA 1QGXA 2FIXA 1YYZA 4KXPA 4N17A 4P1LA 5J16A 1CNQA 4OVPA 4HE1A 2F3DA 1FPDA 2HHMA 2MKZA 4N91A 5IZ1A 4DI3D 2WYPA 1EYJA 1G0HA 1NV3A 1IMCA 4NQ8A 1FTAA 3RPLA 4GX4A 1FBPA 1IMEA 1RDXA 2XA5A 3KC1A 3E79A 4N8GA 5ET8A 5CM6A 5EYHA 4I40A 1NUZA 4GBWA 4PBHA 2PFZA 3E78A 1XI6A 2DVZA 2CEYA 5JK4A 1FPKA 4MX6A 4F1VA 4XF5A 4HE0A 4OVRA 4NG7A 4OANA 4XFEA 5DW8A 2WX9A 5LTCA 4IR8A 2GQ1A 1NV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CEX A;  4MMP A;  4PDD A;  4N4U A;  5IZZ A;  2V4C A;  4MIJ A;  5IGA A;  4PET A;  3U65 A;  4PDH A;  4MNP A;  4P47 A;  4DI4 B;  4NAP A;  4P9K A;  4PFR A;  3B50 A;  4PBQ A;  4PC9 A;  2HZK A;  4PFI A;  4LN5 A;  4MCO A;  4PAK A;  2VPO A;  2VPN A;  3GYY A;  4NGU A;  4PAF A;  4UAB A;  2XWK A;  2ZZW A;  4NN3 A;  4N8Y A;  2XXK A;  4OVS A;  4NF0 A;  2ZZV A;  4PCD A;  4PGP A;  2WYK A;  4MHF A;  2XWV A;  4P3L A;  5I5P A;  2HPG A;  5I7I A;  4XEQ A;  4O8M A;  2WX9 A;  4PFB A;  4O7M A;  4PF6 A;  2XWI A;  4OVQ A;  4MNC A;  4N6K A;  4OA4 A;  4PGN A;  2ZZX A;  4PE3 A;  4P1E A;  4MAG A;  4NX1 A;  3FXB A;  4YIC A;  4X8R A;  5IM2 A;  4P56 A;  4O94 A;  4N6D A;  4YZZ A;  4P8B A;  4OVT A;  4X04 A;  2HZL A;  4NHB A;  4MEV A;  2PFY A;  2XWO A;  4PAI A;  4MNI A;  4N17 A;  4P1L A;  4OVP A;  4DI3 D;  4N91 A;  2WYP A;  4NQ8 A;  4N8G A;  2XA5 A;  5CM6 A;  4PBH A;  2PFZ A;  2CEY A;  4MX6 A;  4XF5 A;  4OVR A;  4NG7 A;  4OAN A;  4XFE A;  4PF8 A;  5LTC A;  4N15 A; 
#chains in the Genus database with same CATH topology
 3UA8 A;  1NNP A;  4IGT A;  3FXR A;  2CZH A;  4XIG Q;  1FBE A;  1HSJ A;  4IY6 A;  2RC7 A;  5IZZ A;  3RN8 A;  4EUO A;  4MF3 A;  5M2V A;  3VXC A;  4NAP A;  1FPL A;  3S9N C;  1NNF A;  5CMB A;  1LBZ A;  5ET7 A;  5K2Y A;  3V89 B;  3G3I A;  1ZIU A;  3OEL A;  4KI0 E;  3IOV A;  3RT6 B;  1BK4 A;  3H4Z A;  5KDT A;  1URS A;  3FAT A;  3LC8 A;  4LQ5 A;  1DCU A;  4RK9 A;  5B7D A;  1JW1 A;  3K1M A;  4R2B A;  4H65 A;  5I2K A;  1TFD A;  1FTJ A;  5FTI A;  2L5V A;  4ZEC A;  4G61 A;  2XWI A;  1FBC A;  4U4S A;  3RQT A;  3H7M A;  1P99 A;  5L9O A;  2DE4 A;  3TCG A;  1OMP A;  1TT1 A;  2Y7R A;  3L6H A;  3C33 A;  3C9H A;  4X8R A;  4F3B A;  2VD3 A;  1LBX A;  1PEB A;  2GHA A;  1NV7 A;  2HZL A;  3FXU A;  4GL0 A;  2PFY A;  1EYI A;  3FVG A;  3ILT B;  3O6G A;  4MFI A;  2HEU A;  1G0H A;  3H6W A;  4GX4 A;  3TEL A;  3TTN A;  3M3L A;  5L8D A;  4G2Z A;  1OVT A;  3MZ9 A;  3O29 A;  1QW0 A;  4XF5 A;  2O6A A;  1B6H A;  4EXK A;  5LTC A;  3U8Q A;  3LUY A;  1UIU A;  2QS3 A;  1NV5 A;  5A5X B;  2OCU A;  1POT A;  1P1N A;  3E13 X;  3PD9 A;  4I3E A;  4R6Y A;  3IB2 A;  1DK4 A;  3OO8 A;  3IO6 A;  4KPT A;  4MLQ A;  2R8T A;  2CZL A;  1QVS A;  4MNP A;  3W9W A;  3HO7 A;  3S9E A;  3GLB A;  1WOD A;  1LLS A;  1S7Y A;  4DXB A;  4U4X A;  4YMA A;  4MH5 A;  2DVC A;  1B7U A;  2XXW A;  3KN8 A;  5AA2 A;  3KSX A;  1I6Q A;  4P0G A;  3MST A;  2AIX A;  1DBZ A;  1FPB A;  5F24 A;  2KQZ A;  4NWD A;  3RLF E;  4XKQ A;  4O7I A;  5A5X A;  4GWS A;  2HPG A;  1JW5 A;  4AS4 A;  1NFT A;  1US5 A;  5TPA A;  3BFU A;  5EQA A;  3FD3 A;  3I5O A;  4PE3 A;  4IO4 A;  2R6G E;  1JET A;  3B8B A;  5I58 B;  1B3G A;  3UIF A;  4IGR A;  4G68 B;  4ND9 A;  3UP9 A;  1LBV A;  1SW2 A;  3N6U A;  1Q1K A;  4G8N A;  4GX3 A;  3OO9 A;  2OWZ A;  1GVC A;  4E0X A;  3MW0 A;  1RDZ A;  5H8Q A;  1QKB A;  1YYZ A;  1TWY A;  3K01 A;  4EF2 A;  1NNK A;  3UK4 A;  3OXN A;  1IIT A;  1I69 A;  1LGB C;  4FJP A;  3V5A A;  2P2A A;  2CEY A;  4NF5 A;  2D21 A;  3Q27 A;  2GQ1 A;  1JQF A;  2Z8D A;  1MQH A;  1MXU A;  3WAF A;  3TTM A;  4WEP A;  1ZLQ A;  3KBR A;  3M3F A;  2WBB A;  3CIJ A;  4MIJ A;  1MY1 A;  5CMK A;  1B52 A;  3FJG A;  1NV0 A;  3R26 A;  2HQ0 A;  4EQ9 A;  2RCB A;  3V8X B;  2V25 A;  3RPW A;  2I49 A;  3S4U A;  5TPA B;  1Y9U A;  1CB6 A;  4U21 A;  5BUU A;  1B5J A;  1WVJ A;  1O7T A;  1B2H A;  1R6Z A;  2Q74 A;  5I58 A;  1AOV A;  2H5Y A;  3FJ7 A;  3K2D A;  5HPQ A;  2I6E A;  3JV9 A;  3KC0 A;  1SD3 A;  1MS7 A;  2XWV A;  1P1Q A;  4PFY A;  3RY3 A;  2DXY A;  3HCQ A;  2F3B A;  4POW A;  2O69 A;  4ELP A;  4N07 A;  1NV1 A;  1B1H A;  2I48 A;  1NMU A;  4N6K A;  3QUF A;  3IOT A;  1B3F A;  4Z0I A;  1B4H A;  3IJX B;  4TLL B;  1B3H A;  2HAU A;  4KFQ A;  1B9J A;  1H76 A;  4F31 B;  2I3W A;  4RY1 A;  2CZK A;  1N3X A;  2I58 A;  1DTZ A;  1POY 1;  1FTO A;  5J16 A;  4OVP A;  2UVG A;  4ESX A;  4ESW A;  3H6U A;  4POX A;  3O6I A;  1Y20 A;  5KZT A;  1BP5 A;  1LCF A;  5JK4 A;  4F3P A;  1UTH B;  5DW8 A;  1D9Y A;  1IQ7 A;  4ZS9 A;  3QSL A;  4MMP A;  2DDK A;  4GQO A;  1N04 A;  2D5W A;  2REJ A;  1H44 A;  2NXO A;  2H25 A;  1QKA A;  1MQI A;  3U72 A;  4QFK A;  3UN6 A;  3IO4 A;  2BJJ X;  1LFH A;  1MY0 A;  1H45 A;  3T9U A;  1AL3 A;  4OVJ A;  3UGW A;  1MXX A;  5DT6 A;  4P0I A;  2DE3 A;  4MCO A;  3GYY A;  2RCA A;  1F9B A;  3OOA A;  4YB5 A;  5FHO A;  4NN3 A;  3ROJ A;  3FAS A;  4GWW A;  4G68 A;  1Y3Q A;  4YKP A;  1SDX A;  1FW0 A;  2XXI A;  5DVJ A;  2YJP A;  2UXA A;  4OHN A;  3O28 A;  4AB6 A;  4ZE9 A;  1FTM A;  1FTK A;  5H8Q B;  4NMY A;  2FA7 A;  1AH5 A;  3PPQ A;  4WXJ A;  1LB9 A;  4AS5 A;  1MM7 A;  3CFX A;  3QK6 A;  3VFJ A;  4P56 A;  5ITP A;  1P1O A;  5EQ9 A;  4HTG A;  3GZG A;  3D4G A;  4FEC A;  4PAI A;  4KXP A;  2QMX A;  2XXP A;  2VHA A;  1ZKB A;  5CMM A;  1LCT A;  3KC1 A;  3E79 A;  2F6P A;  2DS9 A;  4JB7 A;  2I0C A;  4NF6 B;  5CBR A;  1Y3N A;  5DEX B;  3THI A;  1N7X A;  1SI0 A;  4KYE A;  1ZJL A;  1IEJ A;  2IEE A;  2WX9 A;  1NI9 A;  5CBS A;  4N4U A;  3C31 A;  4GBV A;  5I3S A;  2FHY A;  2X26 A;  1IUD A;  5IGA A;  4H45 A;  1IMB A;  4P47 A;  1FPI A;  3B50 A;  3V83 A;  5AA2 B;  3MZ1 A;  1MQJ A;  1DPE A;  2VPO A;  4RJZ A;  3RTW B;  1RDY A;  4F3G A;  4QBA A;  1HSL A;  2H4I A;  4IO6 A;  3OMB A;  2XXK A;  3N6T A;  3U92 A;  2FYI A;  4PP0 A;  4F18 A;  3CRB A;  3BFT A;  4LAT A;  3MQ9 A;  4MHF A;  1A55 A;  3T9V A;  4OEU A;  2ANJ A;  3OEN A;  2V3Q A;  3K6X A;  3EKI A;  2QVU A;  3PMX A;  3T9X B;  4PFB A;  4O7M A;  1IXC A;  5KDT B;  2ZZX A;  5EHM A;  4P1E A;  1VFD A;  1JNF A;  2GFE A;  4ZDM A;  2Y84 A;  4MLV A;  4ZEF A;  4R9F A;  3EHU A;  4OEN A;  3OO6 A;  1R1N A;  3ODB A;  5TU0 A;  1FBG A;  2PCR A;  3TCF A;  1CNQ A;  1MXW A;  3B6T A;  1ELJ A;  3HV1 A;  5CRY A;  5ICQ A;  4OER A;  1MY4 A;  1MQG A;  5I2N A;  4I40 A;  3E78 A;  2LAO A;  4NG7 A;  3VVD A;  3TOD A;  1NV4 A;  4O3A A;  1PB8 A;  4WKM A;  3NOH A;  2VP1 A;  3GXA A;  3MPL A;  1G0I A;  2OK2 A;  3SEX A;  1JVY A;  4JVD A;  3N94 A;  3S2V A;  4ISU A;  3PV0 E;  4JDF A;  4YB6 A;  4PDH A;  2Q88 A;  3K02 A;  4KYS A;  3IOR A;  4DI4 B;  3FJM A;  4RNS A;  2QS4 A;  4R74 A;  5EYF A;  1DOT A;  2UYF A;  1IMF A;  1XS5 A;  1SW1 A;  2O1L A;  3KSJ A;  4OTE A;  5I2N B;  2BJI A;  4OVS A;  2Y7W A;  3VLV A;  4QRZ A;  4U1O A;  3MC2 A;  1T0K A;  3RPL B;  2ONK E;  1XOC A;  2R71 A;  3TTL A;  1B05 A;  1K9Z A;  3MVW A;  5A5L A;  3QMF A;  2CMO A;  4PF6 A;  4NF8 B;  1SW5 A;  2F35 A;  1TFA A;  3I6V A;  3BIG A;  1M5E A;  4NF6 A;  4R73 A;  3G3J A;  4RYA A;  4OYV A;  3Q26 A;  2GH9 A;  5H8F A;  3T9H B;  4OVT A;  2WEF A;  2XXV A;  2HCA A;  2KR0 A;  3O2A A;  3MAM A;  1A99 A;  4LZ8 A;  4QF9 A;  4I9D A;  1JW4 A;  2ZNT A;  3ECR A;  4DIG A;  3SES A;  4BDO A;  2HAV A;  3RPL A;  3CFZ A;  4JBZ A;  4N8G A;  2XA5 A;  4EF1 A;  3PU5 A;  1FQE A;  2O84 X;  3K4U A;  2XXH A;  3LUZ A;  5LDZ A;  2F34 A;  3L6G A;  4QFL A;  4NF5 B;  4PE5 B;  2O68 A;  1IMD A;  4H46 A;  4P9K A;  2PVU A;  4PFR A;  4GRK A;  1LAX A;  3LSL A;  4PAK A;  1J1N A;  2XXX A;  1B7H A;  1OQH A;  4AB5 A;  4PAF A;  3VVF A;  5ELV A;  1XVX A;  1NUY A;  3EQ1 A;  2THI A;  4BDN A;  1ZMG A;  2A5T A;  1KZ8 A;  3Q29 A;  4OMB A;  5EYG A;  2D3I A;  4ZZE A;  2PT2 A;  5H8H A;  3T96 B;  4AQ4 A;  4H1X A;  1JVX A;  5HM4 B;  2Z22 A;  1MXY A;  3TQL A;  2Z8F A;  1NNT A;  4LQ2 A;  4G77 A;  3FBP A;  4HS7 A;  2F7A A;  1B7Z A;  2XXQ A;  4O94 A;  4C1U A;  1GTK A;  1N76 A;  2PMS A;  3O6H A;  2XWO A;  2ONR A;  1S50 A;  5DEX A;  1NKX A;  5IZ1 A;  1Y1M A;  1IMC A;  2AYS A;  3PUV E;  2YPN A;  3B6W A;  5ET8 A;  5I59 A;  3MWB A;  3KOS A;  4GBW A;  1XI6 A;  2DVZ A;  2Q2A A;  3CSB A;  4QSE A;  4FEB A;  4PF8 A;  4PDD A;  3KJT A;  5TP9 A;  3LSW A;  2H98 A;  4F29 A;  3TQW A;  2V4C A;  2V93 A;  2GRV A;  3IL1 B;  1AMF A;  4C1T A;  1TXF A;  2PT1 A;  3KFM A;  4DDD A;  1SVX B;  1PBP A;  4RPN A;  1OLA A;  5ITO A;  4O3C A;  3FV1 A;  4I8C A;  3A29 A;  1PDA A;  2ZZW A;  5FHN A;  2P1S A;  4RA1 A;  4N8Y A;  4GD5 A;  4DZ1 A;  3MVX A;  1IXG A;  1H43 A;  4YU0 A;  4Q8R A;  2F36 A;  4PGP A;  2XX8 A;  4O3B A;  2DOJ A;  2F6G A;  1EZ9 A;  3IOW A;  4RPO A;  4OEV A;  1M5C A;  5LOM A;  4ZED A;  2Y7P A;  1KWH A;  1URG A;  4JWO A;  3W15 C;  1US4 A;  4BDL A;  5EHS A;  1RYO A;  3MP1 A;  5L9M A;  3IR1 A;  5I56 B;  4YAH X;  4DCY A;  1YCJ A;  3IK6 B;  2VT5 A;  4H5G A;  4LVQ A;  3KJ7 A;  5DVI A;  4ZEI A;  2B65 A;  2OLB A;  3M3K A;  4NQ8 A;  1FBP A;  1RDX A;  1PB9 A;  1D3K A;  1NUZ A;  3PPO A;  3EHS A;  5I57 A;  4R75 A;  4XFE A;  3C4M A;  4N15 A;  4IR8 A;  4MBP A;  3OEM A;  2O7I A;  4LZ5 A;  3CG1 A;  1FSA A;  2ONS A;  3CHG A;  3O9P A;  2OX3 A;  2H9B A;  4GXA A;  2QL3 A;  1QUK A;  5AA3 A;  2QVR A;  2I4C A;  3PUZ E;  1MM6 A;  3MZB A;  2P3V A;  4GX6 A;  4G68 C;  3KEI A;  5ESY A;  3G3G A;  2QS2 A;  3IJO B;  4PC9 A;  3BIH A;  1D9V A;  3R7X A;  3SEY A;  2Y7K A;  1UTH A;  4M4G A;  5B70 A;  1MPB A;  4H0W A;  2QJE A;  3G3F A;  4PFU A;  1CE2 A;  4PFW A;  3B7D A;  4EQ7 A;  1D9Q A;  1R9L A;  4NF0 A;  4OFL A;  3PD8 A;  2FIE A;  1AIV A;  2ZZV A;  2E0S A;  3FVK A;  5I84 A;  1ATG A;  2W7Y A;  3DEL B;  4TOZ A;  2QPQ A;  2UYE A;  1K9Y A;  3JZJ A;  2PYY A;  1EZO A;  3Q25 A;  1M5B A;  5EQ7 A;  5FHM A;  3RYD A;  3DM0 A;  4OA4 A;  4PGN A;  4R6K A;  1N0T A;  4THI A;  3CI8 A;  5I59 B;  4GXS B;  3TUS A;  3F11 A;  2I4B A;  1EZP A;  1R9Q A;  2P3N A;  1LBB A;  4BDR A;  4G8M A;  1Y4C A;  3TKD A;  4DCX A;  1QGX A;  4FED A;  3PMW A;  2MKZ A;  3U94 A;  3T66 A;  1B58 A;  2WYP A;  1PBQ A;  1FTA A;  4F2O A;  3HHF A;  2Q8J A;  2V3U A;  4U23 A;  2F7B A;  4U2R A;  4N13 A;  3TTR A;  3TDJ A;  1XVY A;  3T1B A;  3SEU A;  3KGC A;  5H8N A;  2B3F A;  1SI1 A;  1LAG E;  1YTV A;  3PUX E;  3QXM A;  1DTG A;  3E4R A;  4WED A;  4EDP A;  4JVC A;  1MDQ A;  1B5I A;  4ZE8 A;  3G7W A;  2F8D A;  3PPN A;  4JXI A;  2XX9 A;  3R6U A;  4G4P A;  5ISU A;  4RK2 A;  2VPN A;  1VDW A;  3H3G A;  3H6T A;  3N26 A;  4UAB A;  5F1Q A;  4XKN A;  4ECF A;  4GOT A;  5I56 A;  4RXL A;  1OLC A;  2F5X A;  2Q2C A;  4LON B;  4NED A;  1EH3 A;  4P3L A;  2VGQ A;  3M8U A;  3C32 A;  2Y5L A;  3SZP A;  3HFU A;  4L17 A;  1LBC A;  5AA2 D;  1O64 A;  1FCK A;  4MNC A;  1OIB A;  3AXF A;  2Q8M A;  2O7U A;  4F39 A;  4NX1 A;  3DP6 A;  3OSR A;  1INP A;  5IM2 A;  1UIV A;  2B4L A;  1FBD A;  2B4M A;  3P7I A;  4R6H A;  5H8H B;  2G93 A;  3U93 A;  3RUM A;  1NV2 A;  4NF8 A;  4H8J A;  4NHB A;  4HW8 A;  5AA1 A;  1UTB B;  5ICT A;  3PMV A;  4G8H A;  4P1L A;  2ZYO A;  1B0L A;  2DQV A;  1SYI A;  3T22 A;  5AE4 A;  4X1B A;  3MVY A;  4BDM A;  1GGG A;  4LUB A;  1FBF A;  1URD A;  4OZ9 A;  1OVB A;  5FTH A;  1KA0 A;  1FQF A;  2B3B A;  1LAF E;  4GIZ A;  4QSC A;  3TTK A;  2RIN A;  3DLN A;  3IFC A;  3IB1 A;  1YPN A;  3Q28 A;  2HXR A;  1MY2 A;  2WKY A;  1DSN A;  1SPI A;  3FGS A;  4HCW A;  1BKA A;  2HZK A;  4LN5 A;  1YZ0 A;  4GWO A;  4MJO A;  4FE8 A;  2ZMB A;  3K1P A;  4LA9 A;  3OSQ A;  3KBZ A;  4GFR A;  3LSF B;  2RF1 A;  2ALU A;  1KA1 A;  2XD3 A;  5DTB A;  3S9M C;  4IO5 A;  3K6V A;  3LV0 A;  3MUQ A;  4XKR A;  3C34 A;  5I5P A;  1B4Z A;  5ET6 A;  3TEP A;  3IAZ A;  1B51 A;  1L5T A;  4I3Y A;  4EQB A;  1BIY A;  2XXY A;  2Z8E A;  2UVH A;  4XXU A;  2M8C A;  1JP4 A;  4IO2 A;  3SEW A;  3VXB A;  4GWZ A;  1H3D A;  3I3V A;  4Q30 B;  4DLD A;  4U22 A;  4LZ7 A;  4X04 A;  5CMC A;  3FVN A;  4F3S A;  1XHY A;  1I6A A;  4PFT A;  4MNI A;  1AWB A;  4N17 A;  3FUZ A;  2F3D A;  2HHM A;  5I57 B;  3KG2 A;  2I0B A;  2O1M A;  2QS1 A;  1A7L A;  2X7Q A;  1ZU0 A;  2F7C A;  5CM6 A;  1IZ1 A;  2ABH A;  2PFZ A;  2AL4 A;  2DWH A;  4QFP A;  4YKJ A;  2DWJ A;  2ESN A;  3TYH A;  2XXR A;  2JJK A;  2UVI A;  1MXZ A;  2CZI A;  4GF8 A;  3LSX A;  1IXI A;  2QSX A;  1NUX A;  4Q0C A;  2NVU B;  1FTL A;  2XX7 A;  4F1U A;  4OET A;  4KR5 A;  4Q5T A;  4PFI A;  3K6U A;  2HFB A;  2VOZ A;  3USD A;  1USY H;  3MYU A;  4X9T A;  3S9L C;  4E0W A;  1FPF A;  5HBC A;  4YMB A;  1MDP 1;  2DSF A;  5KCJ A;  1M5D A;  2Q9T A;  2WYK A;  3IX1 A;  1FJ9 A;  1FQA A;  4ZEB A;  4TQU Q;  1B1X A;  3O97 A;  1UTB A;  1NV6 A;  4XEQ A;  4O8M A;  5ET5 A;  4NF4 A;  2IA4 A;  1RYX A;  1NH8 A;  1LBY A;  3MVZ A;  1FRP A;  4MAG A;  3QAX A;  3A09 A;  1VR5 A;  4FIM A;  1N84 A;  2V84 A;  5AA4 A;  1BLF A;  2F78 A;  3TAJ A;  4MEV A;  5EQ8 A;  3SKP A;  3ZKK A;  3CG3 A;  2A5T B;  1FPD A;  5KCJ B;  2DWI A;  4QFN A;  1N3W A;  2RKM A;  4H67 A;  2NWJ A;  1MH4 A;  4JWX A;  4F22 A;  2ZYK A;  4K3F A;  4UAC A;  4BLA A;  4HXV A;  3HN0 A;  4QHQ A;  2FVZ A;  3C35 A;  1LBW A;  4FOR A;  3TMG A;  1FPE A;  4PTK A;  2E1S A;  3TFL A;  3T93 B;  1SW4 A;  2AL5 A;  2ZYN A;  4KQP A;  3HPI A;  1B3L A;  4HCY A;  2DE2 A;  4OWD A;  1B0H A;  2V3T A;  3GBA A;  5J1D A;  1A8E A;  2FNC A;  1S9T A;  2YLN A;  1B3E A;  2FBP A;  3B6Q A;  2A5S A;  3K0V A;  2XWK A;  1II5 A;  1VE4 A;  3VE1 B;  2ZNU A;  1PC3 A;  4OES A;  5F7V A;  2XXT A;  2DYX A;  2P0S A;  4R2F A;  4ZEK A;  3PGF A;  2DWA A;  4C0R A;  1A8F A;  3LBS A;  1A54 A;  4ELQ A;  4I1D A;  5IAI A;  4OFJ A;  4DXU A;  2F97 A;  4KD5 A;  1Y4T A;  4UA8 A;  4HE2 A;  4N6D A;  4YZZ A;  1FBH A;  2NUV A;  1VSO A;  3K1N A;  1NUW A;  3RGY A;  3TPA A;  1EU8 A;  1MXV A;  2FIX A;  1DMB A;  2G29 A;  3KN7 A;  4HE1 A;  3ZS6 A;  4N91 A;  4GVO A;  1P1U A;  3C36 A;  4PBH A;  1HSE A;  4OAN A;  1D4N A;  3E3K A;  4FBP A;  2CEX A;  1NL5 A;  1EYK A;  4YKI A;  3SEV A;  3KOT A;  3CR9 A;  3WAE A;  3RTF B;  4F19 A;  3MP8 A;  3QUJ A;  5IKB A;  4YB7 A;  4N6P A;  4OQO A;  4R9G A;  3LR1 A;  1Z7M E;  4PET A;  1FQB A;  5FBP A;  2Z23 A;  1YAE A;  4PBQ A;  3TCH A;  5H8N B;  3VDF A;  3FXQ A;  5JTY B;  4NF4 B;  3MPK A;  5L9S A;  3A3C A;  4KYD A;  2WBD A;  3OEK A;  3FV2 A;  3H06 B;  3O66 A;  3SET A;  1FPJ A;  1MRP A;  3VLU A;  5DYH A;  4GWU A;  4X48 A;  2QFL A;  5I7I A;  3PPP A;  1MPD A;  4GWX A;  4JSD A;  5I2K B;  1FPG A;  3EPE A;  4M1V A;  1IMA A;  3IB0 A;  3FXB A;  3CFL A;  1JEU A;  1MH3 A;  2O51 A;  3KN3 A;  2ZYM A;  4NTL A;  4JVI A;  1GV8 A;  3BBR A;  4NE4 A;  3SDF A;  1FQC A;  5IZ3 B;  4R72 A;  2KLF A;  2REG A;  2I3V A;  1ANF A;  2ZXT A;  1Z7N E;  1DPP A;  3OD7 A;  4KHZ E;  2OBG A;  2R9J A;  4IO3 A;  4ELR A;  1UQW A;  5H8F B;  5EYH A;  4ELO A;  3ILU B;  1ZTY A;  5K2X A;  1WDN A;  1LB8 A;  1NH7 A;  1MY3 A;  3W9V A;  1VFE A;  4DE8 A;  3EF7 A;  3FIR A;  2ZNS A;  5DVF A;  1LEV A;  3CSG A;  2RC8 A;  1GR2 A;  4FAJ A;  3FZV A;  3SER A;  4BDQ A;  2GHB A;  3D1R A;  4QXD A;  4YKK A;  3CVG A;  4ONY A;  2PX1 A;  4GL8 A;  4F1Y A;  1SYH A;  3ONM A;  4IB2 A;  1OQG A;  4IY5 A;  4PCD A;  3PUY E;  5BWJ A;  3IFA A;  1QUJ A;  3EN3 A;  4I62 A;  4Z7E A;  3MBP A;  1FQD A;  1ZBM A;  5AA4 B;  4EXL A;  3VLW A;  4N81 A;  1N7W A;  4GWY A;  4KCC A;  1XT8 A;  4YIC A;  3DP4 A;  5H8S A;  3E9X A;  4LP2 B;  2OWT A;  3A3U A;  3H6V A;  3KZG A;  1B5H A;  1P1W A;  2VD2 A;  1SQY A;  4JSO A;  3JYR A;  2OZZ A;  2Y5K A;  1QUL A;  3QYT A;  3OO7 A;  4DI3 D;  2XHD A;  1I6B A;  1NV3 A;  3RNN A;  2OWS A;  1IME A;  2QMW A;  1Y3P A;  4X1D A;  4KCD A;  1BTJ A;  4HE0 A;  4DXC A;  2QRY A;  2XD2 A;  3MP6 A;  5JTY A;  3PPR A;  4ZZA A;  3PUW E;  3ISP A;  1B40 A;  1XC1 A;  1QUI A;  3RT8 A;  1M5F A;  3MJN A;  2H99 A;  3U65 A;  1B46 A;  1SBP A;  3HHG A;  4H8I A;  3N5L A;  4OFO A;  4PQJ A;  5TP9 B;  4H6D A;  2NOO A;  3T0J A;  2Y7I A;  5T3J A;  2Q89 A;  1USY E;  3QIM A;  4XKP A;  1JEV A;  4NGU A;  2XXU A;  1QJM A;  1FJ6 A;  1PB7 A;  2HXW A;  3IOU A;  3U1O A;  4NWC A;  2UVJ A;  4XTC Q;  1MPC A;  3PTY A;  1Q9D A;  1LAH E;  2RC9 A;  1RKM A;  5IZ3 A;  2DXR A;  3DP8 A;  1O63 A;  3ZKL A;  2QVV A;  5JEI A;  1B32 A;  1IIW A;  4OVQ A;  3VVE A;  1MQD A;  1MG1 A;  4TLM B;  4QSD A;  4P11 A;  4FAT A;  3FVO A;  4P8B A;  1IXH A;  1Q35 A;  3GBB A;  3TZA A;  4H5F A;  1LFG A;  3VV5 A;  4GLI A;  1LST A;  1YXI A;  2DP8 A;  3UOR A;  3HST A;  5CI5 A;  3G3K A;  2X7P A;  1EYJ A;  4U1Z A;  3K00 A;  3K6W A;  3D4C A;  3G3H A;  3BKI B;  3H03 A;  3ZSF A;  1LFI A;  1FPK A;  4JWY A;  1Y1Z A;  4MX6 A;  4F1V A;  3EHT A;  4QFO A;  4OVR A;  4OXV A;  1A40 A;  2PBW A;  2OJT A;  5CC2 A;  4F2Q A;  4IO7 A; 
#chains in the Genus database with same CATH homology
 1FBF A;  1NI9 A;  3LUZ A;  4FBP A;  2CEX A;  4HXV A;  4MMP A;  5LDZ A;  2DDK A;  4PDD A;  2CZH A;  1KA0 A;  2JJK A;  1EYK A;  1FBE A;  4N4U A;  5I7I A;  1FSA A;  2FVZ A;  3CHG A;  3NOH A;  1NV5 A;  2OX3 A;  2CZI A;  4GBV A;  5I3S A;  3T1B A;  2FHY A;  1LBW A;  3ISP A;  4F19 A;  5IZZ A;  3IFC A;  1G0I A;  2V4C A;  4JVD A;  1FPE A;  2WBB A;  4I3E A;  2HXR A;  4MIJ A;  2QVR A;  4PTK A;  3W9V A;  1NUX A;  5IGA A;  1DK4 A;  4PET A;  4PF8 A;  4H45 A;  3U65 A;  2P3V A;  4GX6 A;  2R8T A;  4HCY A;  4PDH A;  2DE2 A;  1SPI A;  5ESY A;  1IMB A;  1IMD A;  4JVC A;  4MNP A;  1NV0 A;  4H46 A;  4P47 A;  4NAP A;  3W9W A;  1LEV A;  4P9K A;  4HCW A;  4DI4 B;  5FBP A;  4N15 A;  1FPL A;  4PFR A;  4F1U A;  1FPI A;  3B50 A;  2DE3 A;  1IMF A;  2HZK A;  4PBQ A;  4PC9 A;  4PFI A;  3T0J A;  4LN5 A;  1LBZ A;  1YZ0 A;  3BIH A;  4MCO A;  5ET7 A;  4MJO A;  4PAK A;  5J1D A;  2VPO A;  5T3J A;  3D1R A;  4QXD A;  2VPN A;  1RDY A;  3GYY A;  2FBP A;  1VDW A;  4QBA A;  4NGU A;  2WBD A;  3MYU A;  3A29 A;  3KBZ A;  4PAF A;  4UAB A;  2XWK A;  2ZZW A;  4X9T A;  2BJI A;  1FJ6 A;  1KA1 A;  2Q74 A;  3MST A;  1D9Q A;  2XXK A;  4N8Y A;  4NN3 A;  3ROJ A;  4OVS A;  1FPF A;  4GWW A;  4NF0 A;  1BK4 A;  1DBZ A;  1FPB A;  2FIE A;  5F24 A;  1FPJ A;  2ZZV A;  4PCD A;  1NUY A;  2F5X A;  4F18 A;  2Q9T A;  1DCU A;  3KC0 A;  2KQZ A;  3RPL B;  4PGP A;  4GWU A;  2WYK A;  3PTY A;  4MHF A;  1Q9D A;  1FJ9 A;  2XWV A;  4P3L A;  3IFA A;  2F3B A;  3LV0 A;  2V3Q A;  5IZ3 A;  2QFL A;  1KZ8 A;  2Y5L A;  4O7I A;  5EYG A;  5I5P A;  2QPQ A;  3EKI A;  2HPG A;  4GWS A;  5ET6 A;  3SZP A;  1K9Z A;  1NV1 A;  1NV6 A;  2QVU A;  4XEQ A;  1K9Y A;  2QVV A;  4O8M A;  2L5V A;  3HFU A;  5A5L A;  4PFB A;  3QMF A;  4GWX A;  4O7M A;  4PF6 A;  5ET5 A;  4G61 A;  2XWI A;  4OVQ A;  1FBC A;  4I3Y A;  4MNC A;  5EQ7 A;  5EQA A;  3RYD A;  1LBY A;  4AS4 A;  4N6K A;  4N81 A;  4OA4 A;  1FPG A;  2ZZX A;  4PE3 A;  4PGN A;  2Q8M A;  3BIG A;  4P1E A;  1FRP A;  4MAG A;  2DE4 A;  3FBP A;  3B8B A;  4GWY A;  4M1V A;  1IMA A;  4NX1 A;  4AS5 A;  1JP4 A;  3FXB A;  4YIC A;  1INP A;  4X8R A;  4HE2 A;  2P3N A;  5IM2 A;  4P56 A;  4O94 A;  1LBX A;  4N6D A;  4YZZ A;  4GWZ A;  2B4L A;  4P8B A;  1FBH A;  1FBD A;  2B4M A;  4OVT A;  2WEF A;  1NV7 A;  2CZK A;  1LBV A;  4JVI A;  2KR0 A;  5EQ9 A;  1NV2 A;  4X04 A;  1NUW A;  2HZL A;  1FBG A;  2PCR A;  4NHB A;  4MEV A;  5IZ3 B;  2PFY A;  2XWO A;  4GX3 A;  2OWZ A;  5EQ8 A;  1YXI A;  2Y5K A;  4PAI A;  4MNI A;  2VT5 A;  1RDZ A;  1EYI A;  1AWB A;  1QGX A;  2FIX A;  1YYZ A;  4KXP A;  4N17 A;  4P1L A;  5J16 A;  1CNQ A;  4OVP A;  4HE1 A;  2F3D A;  1FPD A;  2HHM A;  2MKZ A;  4N91 A;  5IZ1 A;  4DI3 D;  2WYP A;  1EYJ A;  1G0H A;  1NV3 A;  1IMC A;  4NQ8 A;  1FTA A;  3RPL A;  4GX4 A;  1FBP A;  1IME A;  1RDX A;  2XA5 A;  3KC1 A;  3E79 A;  4N8G A;  5ET8 A;  5CM6 A;  5EYH A;  4I40 A;  1NUZ A;  4GBW A;  4PBH A;  2PFZ A;  3E78 A;  1XI6 A;  2DVZ A;  2CEY A;  5JK4 A;  1FPK A;  4MX6 A;  4F1V A;  4XF5 A;  4HE0 A;  4OVR A;  4NG7 A;  4OAN A;  4XFE A;  5DW8 A;  2WX9 A;  5LTC A;  4IR8 A;  2GQ1 A;  1NV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...