2CFAA

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
179
Chain Sequence
MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDWVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
molecule keywords THYMIDYLATE SYNTHASE
total genus 55
structure length 179
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaA01
4KARA 3G4AA 1O29A 3AH5A 1O2AA 5CHPA 4P5AA 5IOQA 1KQ4A 4GTAA 4GTDA 4KASA 4GTLA 3G4CA 3N0CA 4KATA 4GTBA 5IORA 1O2BA 4GTFA 1O25A 1O28A 4FZBA 2CFAB 1O24A 3N0BA 4GTCA 5IOTA 1O26A 5JFEA 4P5BA 2CFAA 5IOSA 4GT9A 3N3YA 4GTEA 1O27A
chains in the Genus database with same CATH superfamily
4OINA 1VH2A 3GEEA 3HKZD 2E2JK 3M3YC 4A3BC 3CQZA 4DDQA 4OIRA 4AYBD 5C44K 3S1NK 1G51A 3S16C 5C44C 3PO2K 4MEYA 4XSZA 3N0CA 5FLMK 3S1NC 5TMFA 2FQTA 4LLGA 3K7AC 1GE9A 3GEHA 4YFKA 2JA6C 3GTOA 2PA8L 3S1RC 2NVYA 2VUMC 3H3VD 3HOVK 2R92K 1TWHA 1EFWA 1JQWA 2E2IA 2JA8C 1XPPA 2RH6A 3S2DC 4A3LC 3HOZK 5IOQA 3HXAA 3TFIA 5FJ8K 5D4DA 3CAGA 1TWGA 1AB4A 1VRQC 4GTLA 5IYBK 4G0VA 1TWHC 4A3GC 3T00A 1TWAK 4GZYA 2ZUFA 5C4JC 4P5BA 2V6TA 5FLMC 5M5YK 4MQ9A 1R9TA 3GTGC 1YNNA 1WQFA 5CHPA 2O5IA 2B63C 4QJVB 3S0XA 4KAWX 1XZQB 4LK1A 3GTJK 1JVIA 3GTJC 3S14C 5EGEA 4MEXA 4KDDA 1O28A 4A3EK 4YG2A 1TWGC 2BE5A 4C2MC 5C3EC 2JH3A 4A3JC 4BBSC 4KARA 1ZBSA 4Q4ZA 5IP7K 4LR2A 4XLNA 2E2IC 3PO3K 4A3KK 4A93C 3M4OC 4ZH4A 3GTQC 3S2HK 1WOOA 2RGRA 1Y1WK 1ZXOA 1USMA 1B4BA 4Y52K 4KMHA 4YFNA 4Y52C 4WJ4A 2B63A 3GTLA 4Y7NK 4G7HA 2NVQC 4A3KC 2VUMK 2A69A 1VLOA 5JFEA 4PAAA 1USOA 3N3YA 4NOIA 3HOXC 2NVXC 2YU9K 4BLBA 1RU0A 1O29A 2A68A 1O2AA 3RZDK 3IPJA 3K7AK 3S1MC 2NVTC 1TWGK 1XXCA 2O5JA 1HQMA 2V6UA 3MMLB 4A3IK 2XCQA 3H0GC 3GSIA 1JOEA 2E2HC 4WJ3M 1X31C 3HOXK 1EH1A 3FKIK 2JA5C 3GTQK 3S2HC 1K83C 3N0BA 3S15K 1O26A 1SFOK 1XXAA 2NVYK 1SFOC 3A8IA 3GTPA 2R93A 3AD9C 4QIWL 3QX3A 2WAQD 4WILA 1KQ4A 4G0UA 3I4MC 2NVXA 4A3FC 3GTKK 1O2FB 1TWCA 4JK1A 2NVXK 3BP8C 3BP3A 1YX2A 2NVQK 2FQOA 3S2DK 3LAJA 4XCHA 4YFXA 1INNA 1B4AA 1EI6A 3HOZC 1L0WA 2R7ZA 3V4GA 5M5XK 4A3CC 1J98A 4KMAA 1TWHK 4RMFA 5M3MK 1O2BA 1HI9A 1DD5A 3T01A 5JVOA 3S17C 3LPXA 2JA7A 4Y7NC 2P8TA 2JA7K 5IP9C 1TWCC 1XXBA 4BXXC 2YU9C 1O27A 3GTGA 2XCOA 3CQZK 4BY1K 3LAPA 5TJ3A 3A8KA 1XZQA 4KASA 5M3FK 2JA5A 3HKZL 2R7ZK 4KM9A 2JA7C 5TMCA 3H0GK 3G4CA 2E2HK 4C45A 4GTBA 1I3QC 2Y3PA 3FKIA 1WORA 3RZDC 2PHCB 4A3EC 3AQPA 4P9SA 2JA6A 4BY7C 4QJVA 1WSRA 5EGHA 1IBAA 4AH6A 4A3BK 1IW7A 5L46A 2WB1D 1ZQ1C 3AD7C 1BDFA 4A3LK 1F7VA 4O2DA 4KN7A 4BBRK 4C3JC 1R9TC 4GTFA 1O25A 1VGXA 3GTLC 4OIPA 3T02A 4Q5SA 1TWAA 2GSUA 2A6EA 4XLPA 3GTMC 2R92C 4BBSK 3OREA 4GTEA 3PO2C 3TFHA 2GAGC 1PJ7A 1I3QK 1C0AA 5IYDK 1BGWA 2W7VA 4AYBL 4FM9A 4QIWD 4C2MK 3S1MK 4BLAA 5C4XC 4KMDA 3FOEA 4KATA 4A3CK 4ILDA 1IE0A 2JA8K 3S1QK 1BJTA 3M4OK 3GDZA 3DXJA 2CFAB 3H0GA 3FKIC 4LQYA 5IP9K 1SMYA 1IS1A 1YCLA 1TWCK 3VA7A 3FOFA 4LK0A 1ZVUA 1PJ5A 1WOSA 4GFQA 4P5AA 2GSNA 4A3GK 4GTDA 1I6HC 3AD8C 3I4MK 1I6HK 3GTKA 4XSXA 4BKWA 2Y0SD 1WSVA 5IORA 3HOWK 2GAHC 3GTQA 2GSOA 1J6XA 3RZOC 1XZPA 3FHZA 5IOSA 3ERED 2R7ZC 3GTPK 3S1QC 3GEIA 2WB1L 1ISEA 3Q3QA 2JA5K 1WQHA 1DCPA 1EQRA 4C3HK 4BXXK 1F93A 1Y1VA 2PPBA 3GTGK 3GTKC 2R92A 3S16K 3L4JA 5IYBC 3S17K 1VJEA 1BS2A 4G7OA 1TWAC 4GTCA 3NUHA 1WCMA 5IOTA 4C3HC 3GTMK 3HOUK 3ADAC 1Y1WA 3S14K 1J6WA 4KMUA 1DCHA 4A3DC 3AH5A 4C3JK 1R9TK 2B63K 3GTPC 4X6AK 1WQGA 1I50K 2E2IK 3PO3C 3HOWC 4A93K 5IP7C 4FZBA 5HL8A 3WODA 1WOPA 5C4JK 2NVTK 4G0WA 3GTOK 4GT9A 2PMZD 1EK8A 4A3FK 4KB4A 1TWFA 1I3QA 4A3JK 1V5VA 3GTJA 3BUEA 1F9NA 3G4AA 4A3MK 1I50C 2V6SA 5IYCK 2YU9A 1Y1VC 4OIOA 4LOWA 2NVYC 2VUMA 1IL2A 1Y1WC 3HOUC 1UV7A 2P5MA 4KN4A 2XCRB 4A3DK 2JA6K 3CQZC 4BY1C 3HOVC 3HOYK 1IQ0A 1Y1VK 1O24A 5C4XK 3S1RK 5C3EK 2ZUEA 4A3IC 2WAQL 3TTGA 3SZYA 1TWFC 2EBBA 1TWFK 2PA8D 4G7ZA 5E68A 3H3VL 5IYDC 1ZYRA 3EQLA 3OPFA 1F7UA 2ZFZA 4GTAA 4C3IC 1K83K 1I6VA 5CJ9A 3I4NK 2KWAA 3I4NC 2CW0A 1DCOA 4J3NA 2E2HA 2Y0SL 4A3MC 3JSTA 3OEPA 5M5WK 5IYCC 3A8JA 1XZPB 3TFJA 1YNJA 3GTOC 3GTMA 1WCMC 4PABA 2A6HA 3HOYC 1WCMK 2R93K 4M1XA 4LJZA 2R93C 3L4KA 3GTLK 3AQOA 1PJ6A 1WIHA 4X6AC 3SZZA 1SFOA 3GIRA 2PMZL 2D6FC 2E2JC 3M3YK 1I50A 3RZOK 3S15C 4KM8A 1K83A 2CFAA 4C3IK 4KC6A 1J6VA 4OIQA 4BBRC 4BY7K 4KB2A
chains in the Genus database with same CATH topology
4BLBA 1O29A 3AH5A 1O2AA 5EGHA 1XXCA 3CQZA 4DDQA 3MMLB 2XCQA 3N0CA 1WQGA 4C3JC 4GTFA 1O25A 1EH1A 1GE9A 4FZBA 3GTOA 2NVYA 1TWAA 2GSUA 3N0BA 1O26A 4G0WA 1XXAA 4GT9A 1EK8A 1TWHA 3OREA 4KB4A 1TWFA 2E2IA 1I3QA 4GTEA 2RH6A 3GTJA 3GTPA 3BUEA 1F9NA 3G4AA 2R93A 3QX3A 5IOQA 1BGWA 4FM9A 2YU9A 1KQ4A 3CAGA 4BLAA 1TWGA 4G0UA 1AB4A 4GTLA 4KMDA 3FOEA 2VUMA 2NVXA 2P5MA 4G0VA 4KATA 4ILDA 2XCRB 1TWCA 1BJTA 2CFAB 3H0GA 1O24A 4LQYA 1IS1A 4P5BA 3VA7A 3FOFA 3LAJA 1R9TA 1ZVUA 1B4AA 1WQFA 4GFQA 5CHPA 4P5AA 2GSNA 3OPFA 2R7ZA 3V4GA 2ZFZA 4GTAA 3S0XA 4GTDA 4C3IC 4KAWX 1Y1WA 5CJ9A 3GTKA 4KMAA 2KWAA 4BKWA 5EGEA 5IORA 1O2BA 4J3NA 2E2HA 3GTQA 1DD5A 2GSOA 4KDDA 1O28A 5JVOA 3OEPA 3LPXA 2JA7A 4C2MC 3FHZA 5IOSA 3ERED 2JH3A 1XXBA 1O27A 4KARA 3GTGA 1ZBSA 2XCOA 3GTMA 4LR2A 1ISEA 3Q3QA 3LAPA 1WQHA 5TJ3A 4M1XA 3L4KA 4KASA 2JA5A 3AQOA 2RGRA 1WIHA 4KM9A 1ZXOA 1Y1VA 3G4CA 1B4BA 1SFOA 2R92A 3L4JA 4GTBA 2Y3PA 3FKIA 4KMHA 2B63A 3GTLA 1I50A 2PHCB 4KM8A 1K83A 4GTCA 3AQPA 1WCMA 3NUHA 5IOTA 5JFEA 2CFAA 4C3HC 3N3YA 4KC6A 2JA6A 4KB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAR A;  3G4A A;  1O29 A;  3AH5 A;  1O2A A;  5CHP A;  4P5A A;  5IOQ A;  1KQ4 A;  4GTA A;  4GTD A;  4KAS A;  4GTL A;  3G4C A;  3N0C A;  4KAT A;  4GTB A;  5IOR A;  1O2B A;  4GTF A;  1O25 A;  1O28 A;  4FZB A;  2CFA B;  1O24 A;  3N0B A;  4GTC A;  5IOT A;  1O26 A;  5JFE A;  4P5B A;  2CFA A;  5IOS A;  4GT9 A;  3N3Y A;  4GTE A;  1O27 A; 
#chains in the Genus database with same CATH topology
 4OIN A;  1VH2 A;  3GEE A;  3HKZ D;  2E2J K;  3M3Y C;  4A3B C;  3CQZ A;  4DDQ A;  4OIR A;  4AYB D;  5C44 K;  3S1N K;  1G51 A;  3S16 C;  5C44 C;  3PO2 K;  4MEY A;  4XSZ A;  3N0C A;  5FLM K;  3S1N C;  5TMF A;  2FQT A;  4LLG A;  3K7A C;  1GE9 A;  3GEH A;  4YFK A;  2JA6 C;  3GTO A;  2PA8 L;  3S1R C;  2NVY A;  2VUM C;  3H3V D;  3HOV K;  2R92 K;  1TWH A;  1EFW A;  1JQW A;  2E2I A;  2JA8 C;  1XPP A;  2RH6 A;  3S2D C;  4A3L C;  3HOZ K;  5IOQ A;  3HXA A;  3TFI A;  5FJ8 K;  5D4D A;  3CAG A;  1TWG A;  1AB4 A;  1VRQ C;  4GTL A;  5IYB K;  4G0V A;  1TWH C;  4A3G C;  3T00 A;  1TWA K;  4GZY A;  2ZUF A;  5C4J C;  4P5B A;  2V6T A;  5FLM C;  5M5Y K;  4MQ9 A;  1R9T A;  3GTG C;  1YNN A;  1WQF A;  5CHP A;  2O5I A;  2B63 C;  4QJV B;  3S0X A;  4KAW X;  1XZQ B;  4LK1 A;  3GTJ K;  1JVI A;  3GTJ C;  3S14 C;  5EGE A;  4MEX A;  4KDD A;  1O28 A;  4A3E K;  4YG2 A;  1TWG C;  2BE5 A;  4C2M C;  5C3E C;  2JH3 A;  4A3J C;  4BBS C;  4KAR A;  1ZBS A;  4Q4Z A;  5IP7 K;  4LR2 A;  4XLN A;  2E2I C;  3PO3 K;  4A3K K;  4A93 C;  3M4O C;  4ZH4 A;  3GTQ C;  3S2H K;  1WOO A;  2RGR A;  1Y1W K;  1ZXO A;  1USM A;  1B4B A;  4Y52 K;  4KMH A;  4YFN A;  4Y52 C;  4WJ4 A;  2B63 A;  3GTL A;  4Y7N K;  4G7H A;  2NVQ C;  4A3K C;  2VUM K;  2A69 A;  1VLO A;  5JFE A;  4PAA A;  1USO A;  3N3Y A;  4NOI A;  3HOX C;  2NVX C;  2YU9 K;  4BLB A;  1RU0 A;  1O29 A;  2A68 A;  1O2A A;  3RZD K;  3IPJ A;  3K7A K;  3S1M C;  2NVT C;  1TWG K;  1XXC A;  2O5J A;  1HQM A;  2V6U A;  3MML B;  4A3I K;  2XCQ A;  3H0G C;  3GSI A;  1JOE A;  2E2H C;  4WJ3 M;  1X31 C;  3HOX K;  1EH1 A;  3FKI K;  2JA5 C;  3GTQ K;  3S2H C;  1K83 C;  3N0B A;  3S15 K;  1O26 A;  1SFO K;  1XXA A;  2NVY K;  1SFO C;  3A8I A;  3GTP A;  2R93 A;  3AD9 C;  4QIW L;  3QX3 A;  2WAQ D;  4WIL A;  1KQ4 A;  4G0U A;  3I4M C;  2NVX A;  4A3F C;  3GTK K;  1O2F B;  1TWC A;  4JK1 A;  2NVX K;  3BP8 C;  3BP3 A;  1YX2 A;  2NVQ K;  2FQO A;  3S2D K;  3LAJ A;  4XCH A;  4YFX A;  1INN A;  1B4A A;  1EI6 A;  3HOZ C;  1L0W A;  2R7Z A;  3V4G A;  5M5X K;  4A3C C;  1J98 A;  4KMA A;  1TWH K;  4RMF A;  5M3M K;  1O2B A;  1HI9 A;  1DD5 A;  3T01 A;  5JVO A;  3S17 C;  3LPX A;  2JA7 A;  4Y7N C;  2P8T A;  2JA7 K;  5IP9 C;  1TWC C;  1XXB A;  4BXX C;  2YU9 C;  1O27 A;  3GTG A;  2XCO A;  3CQZ K;  4BY1 K;  3LAP A;  5TJ3 A;  3A8K A;  1XZQ A;  4KAS A;  5M3F K;  2JA5 A;  3HKZ L;  2R7Z K;  4KM9 A;  2JA7 C;  5TMC A;  3H0G K;  3G4C A;  2E2H K;  4C45 A;  4GTB A;  1I3Q C;  2Y3P A;  3FKI A;  1WOR A;  3RZD C;  2PHC B;  4A3E C;  3AQP A;  4P9S A;  2JA6 A;  4BY7 C;  4QJV A;  1WSR A;  5EGH A;  1IBA A;  4AH6 A;  4A3B K;  1IW7 A;  5L46 A;  2WB1 D;  1ZQ1 C;  3AD7 C;  1BDF A;  4A3L K;  1F7V A;  4O2D A;  4KN7 A;  4BBR K;  4C3J C;  1R9T C;  4GTF A;  1O25 A;  1VGX A;  3GTL C;  4OIP A;  3T02 A;  4Q5S A;  1TWA A;  2GSU A;  2A6E A;  4XLP A;  3GTM C;  2R92 C;  4BBS K;  3ORE A;  4GTE A;  3PO2 C;  3TFH A;  2GAG C;  1PJ7 A;  1I3Q K;  1C0A A;  5IYD K;  1BGW A;  2W7V A;  4AYB L;  4FM9 A;  4QIW D;  4C2M K;  3S1M K;  4BLA A;  5C4X C;  4KMD A;  3FOE A;  4KAT A;  4A3C K;  4ILD A;  1IE0 A;  2JA8 K;  3S1Q K;  1BJT A;  3M4O K;  3GDZ A;  3DXJ A;  2CFA B;  3H0G A;  3FKI C;  4LQY A;  5IP9 K;  1SMY A;  1IS1 A;  1YCL A;  1TWC K;  3VA7 A;  3FOF A;  4LK0 A;  1ZVU A;  1PJ5 A;  1WOS A;  4GFQ A;  4P5A A;  2GSN A;  4A3G K;  4GTD A;  1I6H C;  3AD8 C;  3I4M K;  1I6H K;  3GTK A;  4XSX A;  4BKW A;  2Y0S D;  1WSV A;  5IOR A;  3HOW K;  2GAH C;  3GTQ A;  2GSO A;  1J6X A;  3RZO C;  1XZP A;  3FHZ A;  5IOS A;  3ERE D;  2R7Z C;  3GTP K;  3S1Q C;  3GEI A;  2WB1 L;  1ISE A;  3Q3Q A;  2JA5 K;  1WQH A;  1DCP A;  1EQR A;  4C3H K;  4BXX K;  1F93 A;  1Y1V A;  2PPB A;  3GTG K;  3GTK C;  2R92 A;  3S16 K;  3L4J A;  5IYB C;  3S17 K;  1VJE A;  1BS2 A;  4G7O A;  1TWA C;  4GTC A;  3NUH A;  1WCM A;  5IOT A;  4C3H C;  3GTM K;  3HOU K;  3ADA C;  1Y1W A;  3S14 K;  1J6W A;  4KMU A;  1DCH A;  4A3D C;  3AH5 A;  4C3J K;  1R9T K;  2B63 K;  3GTP C;  4X6A K;  1WQG A;  1I50 K;  2E2I K;  3PO3 C;  3HOW C;  4A93 K;  5IP7 C;  4FZB A;  5HL8 A;  3WOD A;  1WOP A;  5C4J K;  2NVT K;  4G0W A;  3GTO K;  4GT9 A;  2PMZ D;  1EK8 A;  4A3F K;  4KB4 A;  1TWF A;  1I3Q A;  4A3J K;  1V5V A;  3GTJ A;  3BUE A;  1F9N A;  3G4A A;  4A3M K;  1I50 C;  2V6S A;  5IYC K;  2YU9 A;  1Y1V C;  4OIO A;  4LOW A;  2NVY C;  2VUM A;  1IL2 A;  1Y1W C;  3HOU C;  1UV7 A;  2P5M A;  4KN4 A;  2XCR B;  4A3D K;  2JA6 K;  3CQZ C;  4BY1 C;  3HOV C;  3HOY K;  1IQ0 A;  1Y1V K;  1O24 A;  5C4X K;  3S1R K;  5C3E K;  2ZUE A;  4A3I C;  2WAQ L;  3TTG A;  3SZY A;  1TWF C;  2EBB A;  1TWF K;  2PA8 D;  4G7Z A;  5E68 A;  3H3V L;  5IYD C;  1ZYR A;  3EQL A;  3OPF A;  1F7U A;  2ZFZ A;  4GTA A;  4C3I C;  1K83 K;  1I6V A;  5CJ9 A;  3I4N K;  2KWA A;  3I4N C;  2CW0 A;  1DCO A;  4J3N A;  2E2H A;  2Y0S L;  4A3M C;  3JST A;  3OEP A;  5M5W K;  5IYC C;  3A8J A;  1XZP B;  3TFJ A;  1YNJ A;  3GTO C;  3GTM A;  1WCM C;  4PAB A;  2A6H A;  3HOY C;  1WCM K;  2R93 K;  4M1X A;  4LJZ A;  2R93 C;  3L4K A;  3GTL K;  3AQO A;  1PJ6 A;  1WIH A;  4X6A C;  3SZZ A;  1SFO A;  3GIR A;  2PMZ L;  2D6F C;  2E2J C;  3M3Y K;  1I50 A;  3RZO K;  3S15 C;  4KM8 A;  1K83 A;  2CFA A;  4C3I K;  4KC6 A;  1J6V A;  4OIQ A;  4BBR C;  4BY7 K;  4KB2 A; 
#chains in the Genus database with same CATH homology
 4BLB A;  1O29 A;  3AH5 A;  1O2A A;  5EGH A;  1XXC A;  3CQZ A;  4DDQ A;  3MML B;  2XCQ A;  3N0C A;  1WQG A;  4C3J C;  4GTF A;  1O25 A;  1EH1 A;  1GE9 A;  4FZB A;  3GTO A;  2NVY A;  1TWA A;  2GSU A;  3N0B A;  1O26 A;  4G0W A;  1XXA A;  4GT9 A;  1EK8 A;  1TWH A;  3ORE A;  4KB4 A;  1TWF A;  2E2I A;  1I3Q A;  4GTE A;  2RH6 A;  3GTJ A;  3GTP A;  3BUE A;  1F9N A;  3G4A A;  2R93 A;  3QX3 A;  5IOQ A;  1BGW A;  4FM9 A;  2YU9 A;  1KQ4 A;  3CAG A;  4BLA A;  1TWG A;  4G0U A;  1AB4 A;  4GTL A;  4KMD A;  3FOE A;  2VUM A;  2NVX A;  2P5M A;  4G0V A;  4KAT A;  4ILD A;  2XCR B;  1TWC A;  1BJT A;  2CFA B;  3H0G A;  1O24 A;  4LQY A;  1IS1 A;  4P5B A;  3VA7 A;  3FOF A;  3LAJ A;  1R9T A;  1ZVU A;  1B4A A;  1WQF A;  4GFQ A;  5CHP A;  4P5A A;  2GSN A;  3OPF A;  2R7Z A;  3V4G A;  2ZFZ A;  4GTA A;  3S0X A;  4GTD A;  4C3I C;  4KAW X;  1Y1W A;  5CJ9 A;  3GTK A;  4KMA A;  2KWA A;  4BKW A;  5EGE A;  5IOR A;  1O2B A;  4J3N A;  2E2H A;  3GTQ A;  1DD5 A;  2GSO A;  4KDD A;  1O28 A;  5JVO A;  3OEP A;  3LPX A;  2JA7 A;  4C2M C;  3FHZ A;  5IOS A;  3ERE D;  2JH3 A;  1XXB A;  1O27 A;  4KAR A;  3GTG A;  1ZBS A;  2XCO A;  3GTM A;  4LR2 A;  1ISE A;  3Q3Q A;  3LAP A;  1WQH A;  5TJ3 A;  4M1X A;  3L4K A;  4KAS A;  2JA5 A;  3AQO A;  2RGR A;  1WIH A;  4KM9 A;  1ZXO A;  1Y1V A;  3G4C A;  1B4B A;  1SFO A;  2R92 A;  3L4J A;  4GTB A;  2Y3P A;  3FKI A;  4KMH A;  2B63 A;  3GTL A;  1I50 A;  2PHC B;  4KM8 A;  1K83 A;  4GTC A;  3AQP A;  1WCM A;  3NUH A;  5IOT A;  5JFE A;  2CFA A;  4C3H C;  3N3Y A;  4KC6 A;  2JA6 A;  4KB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...