2CFAA

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
179
Chain Sequence
MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDWVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE SYNTHASE
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 55
structure length 179
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaA01
5IOSA 1O2AA 3N3YA 1O28A 3AH5A 5IOTA 5IOQA 3G4CA 4GTEA 1O24A 1O2BA 1O29A 4KARA 4P5AA 4P5BA 4GTDA 4GTCA 3N0CA 3G4AA 1O27A 4GTBA 1O26A 1KQ4A 4GTFA 4KASA 5IORA 3N0BA 5CHPA 5JFEA 4GT9A 4GTLA 2CFAB 2CFAA 1O25A 4FZBA 4GTAA 4KATA
chains in the Genus database with same CATH superfamily
3GTKA 3SZZA 1WORA 4QJVB 5IOTA 1BS2A 3OREA 1R9TA 2V6TA 3S1RC 4P5BA 4A3DK 2CW0A 3TFIA 1XXAA 4OIRA 5M5YK 1K83A 4A3IK 3CQZA 4GFQA 2E2IK 4BY1C 1TWCC 2PA8D 3FKIK 4A93C 2JA6C 1WOPA 3HOVC 2E2HK 4C2MC 3S0XA 2NVQK 2JA5A 2YU9A 1Y1WC 3VA7A 1TWGA 3S1RK 3MMLB 2WB1L 4PABA 3PO3C 3JSTA 3GTLA 5IP7C 4LLGA 2Y3PA 4BY1K 1TWCK 2V6SA 4A93K 2JA6K 1WSRA 3HOVK 3S16C 3GTOC 1KQ4A 4C2MK 3PO2C 1Y1WK 1Y1VA 2PHCB 3AQPA 1ZBSA 4A3GC 5IOSA 1O2AA 1TWAA 3GDZA 2P8TA 3EQLA 3PO3K 5IOQA 5IP7K 4KARA 1PJ7A 4KMUA 3GEIA 3S1NC 1EI6A 3OEPA 3S16K 3GTOK 1VH2A 4BXXC 1ZVUA 2A6HA 3ERED 3PO2K 1X31C 3A8KA 3AD8C 3N0BA 2CFAB 5IYCC 4A3GK 1EK8A 3NUHA 1V5VA 1BDFA 1JVIA 2PA8L 3GTJC 3S1NK 3LAJA 2R92A 2VUMC 3TFHA 2P5MA 4BXXK 2XCQA 3RZOK 1TWFC 5HL8A 1O26A 3GTGA 3LAPA 3GTPC 5IYCK 1I3QA 4G0UA 3GIRA 1J6WA 1HQMA 3GEHA 1VJEA 5JVOA 3N3YA 2JA7C 1SMYA 4C3IC 3GTJK 3H0GA 5L46A 1O24A 1XZQB 1R9TC 3GTQC 2R93C 2VUMK 3H3VD 2NVYC 2A69A 1AB4A 1TWFK 5CJ9A 4KMHA 4Q4ZA 2PMZD 4MEYA 4XLPA 3GTPK 1PJ5A 1XPPA 2FQTA 1WOSA 1XZPA 4LK0A 1DCHA 4GTLA 1I6HC 4GTAA 4G7OA 2YU9C 4BBRC 2JA7K 4C3IK 4KAWX 3M3YC 1O28A 2GAGC 1R9TK 3M4OC 4WJ4A 3GTQK 1TWGC 2R93K 1USOA 2BE5A 4KMAA 1I50A 1BJTA 2NVYK 2XCRB 1J98A 4LR2A 2R7ZA 3GTMC 3HOYC 4GTBA 4NOIA 1VRQC 1JQWA 3FHZA 2ZFZA 2NVXA 5M3FK 2NVTC 1I6HK 4LQYA 4QIWD 2YU9K 4BBRK 3M3YK 2B63C 1ZXOA 4XLNA 3HXAA 3LPXA 3M4OK 4QJVA 4KN7A 2XCOA 1WIHA 5TMFA 4JK1A 1F7UA 4OIPA 4LOWA 5C4XC 3GTMK 3HOWC 4XSXA 1ZYRA 1L0WA 2E2IA 4OIQA 1O2FB 1GE9A 3FKIA 3T00A 1IBAA 2NVTK 2E2HA 4GTFA 1TWHC 1B4AA 2B63K 3H3VL 2W7VA 3QX3A 4Q5SA 2PMZL 1YNNA 2ZUFA 4WJ3M 5C4XK 3BP3A 4C3JC 5EGEA 3SZYA 1TWCA 2JA6A 3G4AA 3AD7C 2PPBA 1TWHK 3HOUC 1SFOC 1Y1WA 5JFEA 1J6VA 5IYBC 3L4KA 2JH3A 3S17C 1O25A 1YNJA 4Y52C 2V6UA 3V4GA 3BP8C 1ZQ1C 5M3MK 3FOFA 3AD9C 4C3JK 4YFXA 4QIWL 5TJ3A 5FLMC 3N0CA 2RGRA 3GTOA 1DCOA 1O27A 2A6EA 3HOUK 1SFOK 2O5JA 1WQGA 4ZH4A 5IYBK 1WCMC 3S14C 5CHPA 3S17K 4BY7C 5C3EC 1B4BA 2CFAA 4Y52K 1YCLA 4YG2A 4ILDA 3GTKC 3G4CA 1IE0A 4FM9A 5FLMK 4MEXA 4GTDA 1F7VA 3DXJA 1K83C 3A8JA 3CQZC 1WCMK 3S14K 5C3EK 3ADAC 1DD5A 2Y0SD 4PAAA 2KWAA 4BBSC 3A8IA 4G7ZA 1INNA 1RU0A 4FZBA 3S2DC 3I4MC 4AH6A 3L4JA 2JA5C 3GTKK 4C45A 4YFNA 3HOXC 3GTJA 4GTEA 1XZQA 1O29A 2VUMA 1TWFA 3HOZC 3GTLC 1K83K 4AYBD 1WQHA 4YFKA 3CQZK 3GTPA 1G51A 3CAGA 4C3HC 3S15C 5D4DA 1VLOA 4BBSK 4P9SA 5IORA 1YX2A 3S2DK 3I4MK 2EBBA 3S1MC 2JA5K 1UV7A 2JA7A 4KATA 1Y1VC 3HOXK 4BKWA 1F93A 3AH5A 3GTQA 2R93A 1TWGK 1TWAC 1WQFA 2GAHC 2NVYA 4WILA 4A3JC 1EFWA 4BLAA 3HOZK 3GTLK 4KB2A 3GSIA 2RH6A 4C3HK 3HOYK 3BUEA 3S15K 3RZDC 1IQ0A 4J3NA 4O2DA 3S1MK 4XSZA 1Y1VK 4X6AC 1TWAK 4KC6A 4A3JK 2JA8C 1IS1A 4A3MC 4A3BC 2WAQL 1HI9A 2Y0SL 3GEEA 3GTMA 4LK1A 3HOWK 4KM9A 2ZUEA 3WODA 3RZDK 2R92C 2A68A 3OPFA 4A3FC 4KM8A 2B63A 2GSNA 3IPJA 3GTGC 4X6AK 1I3QC 5C4JC 4AYBL 3HKZD 1ISEA 2JA8K 4XCHA 4A3MK 4A3BK 1EQRA 2GSUA 4KMDA 4A3CC 3H0GC 5TMCA 1IL2A 5C44C 2R92K 4BLBA 3TFJA 4A3FK 3Q3QA 4OINA 3RZOC 1TWHA 3TTGA 4KN4A 4RMFA 5IP9C 3GTGK 3AQOA 1WOOA 1I3QK 4A3KC 5FJ8K 5C4JK 4A3EC 4KDDA 3I4NC 3K7AC 1BGWA 4A3CK 1XXBA 3T02A 2E2JC 4A3LC 3H0GK 4P5AA 4G7HA 4G0VA 5C44K 5EGHA 4GTCA 1IW7A 4M1XA 1I50C 3S1QC 5IYDC 1USMA 2R7ZC 1SFOA 4DDQA 5M5XK 5IP9K 2WB1D 4A3KK 4KASA 3S2HC 1PJ6A 1I6VA 4BY7K 1XZPB 5M5WK 4A3EK 2WAQD 1F9NA 2NVXC 3I4NK 1J6XA 3K7AK 1XXCA 3T01A 2GSOA 4Y7NC 2O5IA 2E2JK 4GZYA 4A3LK 1VGXA 3FOEA 1O2BA 4LJZA 4OIOA 1JOEA 4A3DC 1I50K 3S1QK 5IYDK 2R7ZK 4MQ9A 3HKZL 4A3IC 2E2IC 1WCMA 3S2HK 1DCPA 3FKIC 1WSVA 5E68A 1EH1A 2NVXK 2FQOA 4GT9A 2E2HC 4KB4A 1C0AA 4G0WA 2D6FC 2NVQC 4Y7NK
chains in the Genus database with same CATH topology
3GTKA 3N3YA 3V4GA 5IOTA 4KC6A 3OREA 4C3IC 1R9TA 3H0GA 3FOFA 1O24A 1IS1A 4P5BA 1XXAA 3GTMA 5TJ3A 4KM9A 1K83A 3N0CA 1AB4A 2RGRA 3CQZA 3GTOA 4GFQA 5CJ9A 4KMHA 1O27A 3OPFA 4KM8A 1WQGA 4C2MC 2B63A 2GSNA 5CHPA 4GTLA 3S0XA 1B4BA 2CFAA 2JA5A 2YU9A 3VA7A 4GTAA 4KAWX 1O28A 1ISEA 1TWGA 4ILDA 3MMLB 3G4CA 2GSUA 4KMDA 4KMAA 1I50A 4FM9A 3GTLA 1BJTA 4GTDA 2Y3PA 2XCRB 4LR2A 2R7ZA 4BLBA 3Q3QA 4GTBA 1TWHA 1KQ4A 3FHZA 2ZFZA 2NVXA 3AQOA 1DD5A 2KWAA 4LQYA 1Y1VA 4FZBA 2PHCB 3AQPA 1ZBSA 4KDDA 1ZXOA 3L4JA 5IOSA 1O2AA 1TWAA 3LPXA 1BGWA 3GTJA 2XCOA 1WIHA 1XXBA 5IOQA 4GTEA 4P5AA 1O29A 4KARA 2VUMA 4G0VA 5EGHA 1TWFA 4GTCA 4M1XA 2E2IA 3OEPA 1WQHA 1GE9A 3GTPA 3FKIA 3CAGA 1ZVUA 4C3HC 4DDQA 1SFOA 3ERED 2E2HA 4GTFA 4KASA 5IORA 3N0BA 1B4AA 2CFAB 1F9NA 1XXCA 3NUHA 1EK8A 3QX3A 2JA7A 2GSOA 4KATA 4BKWA 3AH5A 3GTQA 2R93A 1WQFA 3FOEA 1O2BA 2NVYA 4BLAA 4C3JC 5EGEA 4KB2A 3LAJA 2R92A 1TWCA 2RH6A 2P5MA 2JA6A 2XCQA 3BUEA 3G4AA 1WCMA 1O26A 4J3NA 3GTGA 3LAPA 1I3QA 1EH1A 4G0UA 1Y1WA 5JFEA 4GT9A 3L4KA 4KB4A 2JH3A 4G0WA 1O25A 5JVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOS A;  1O2A A;  3N3Y A;  1O28 A;  3AH5 A;  5IOT A;  5IOQ A;  3G4C A;  4GTE A;  1O24 A;  1O2B A;  1O29 A;  4KAR A;  4P5A A;  4P5B A;  4GTD A;  4GTC A;  3N0C A;  3G4A A;  1O27 A;  4GTB A;  1O26 A;  1KQ4 A;  4GTF A;  4KAS A;  5IOR A;  3N0B A;  5CHP A;  5JFE A;  4GT9 A;  4GTL A;  2CFA B;  2CFA A;  1O25 A;  4FZB A;  4GTA A;  4KAT A; 
#chains in the Genus database with same CATH topology
 3GTK A;  3SZZ A;  1WOR A;  4QJV B;  5IOT A;  1BS2 A;  3ORE A;  1R9T A;  2V6T A;  3S1R C;  4P5B A;  4A3D K;  2CW0 A;  3TFI A;  1XXA A;  4OIR A;  5M5Y K;  1K83 A;  4A3I K;  3CQZ A;  4GFQ A;  2E2I K;  4BY1 C;  1TWC C;  2PA8 D;  3FKI K;  4A93 C;  2JA6 C;  1WOP A;  3HOV C;  2E2H K;  4C2M C;  3S0X A;  2NVQ K;  2JA5 A;  2YU9 A;  1Y1W C;  3VA7 A;  1TWG A;  3S1R K;  3MML B;  2WB1 L;  4PAB A;  3PO3 C;  3JST A;  3GTL A;  5IP7 C;  4LLG A;  2Y3P A;  4BY1 K;  1TWC K;  2V6S A;  4A93 K;  2JA6 K;  1WSR A;  3HOV K;  3S16 C;  3GTO C;  1KQ4 A;  4C2M K;  3PO2 C;  1Y1W K;  1Y1V A;  2PHC B;  3AQP A;  1ZBS A;  4A3G C;  5IOS A;  1O2A A;  1TWA A;  3GDZ A;  2P8T A;  3EQL A;  3PO3 K;  5IOQ A;  5IP7 K;  4KAR A;  1PJ7 A;  4KMU A;  3GEI A;  3S1N C;  1EI6 A;  3OEP A;  3S16 K;  3GTO K;  1VH2 A;  4BXX C;  1ZVU A;  2A6H A;  3ERE D;  3PO2 K;  1X31 C;  3A8K A;  3AD8 C;  3N0B A;  2CFA B;  5IYC C;  4A3G K;  1EK8 A;  3NUH A;  1V5V A;  1BDF A;  1JVI A;  2PA8 L;  3GTJ C;  3S1N K;  3LAJ A;  2R92 A;  2VUM C;  3TFH A;  2P5M A;  4BXX K;  2XCQ A;  3RZO K;  1TWF C;  5HL8 A;  1O26 A;  3GTG A;  3LAP A;  3GTP C;  5IYC K;  1I3Q A;  4G0U A;  3GIR A;  1J6W A;  1HQM A;  3GEH A;  1VJE A;  5JVO A;  3N3Y A;  2JA7 C;  1SMY A;  4C3I C;  3GTJ K;  3H0G A;  5L46 A;  1O24 A;  1XZQ B;  1R9T C;  3GTQ C;  2R93 C;  2VUM K;  3H3V D;  2NVY C;  2A69 A;  1AB4 A;  1TWF K;  5CJ9 A;  4KMH A;  4Q4Z A;  2PMZ D;  4MEY A;  4XLP A;  3GTP K;  1PJ5 A;  1XPP A;  2FQT A;  1WOS A;  1XZP A;  4LK0 A;  1DCH A;  4GTL A;  1I6H C;  4GTA A;  4G7O A;  2YU9 C;  4BBR C;  2JA7 K;  4C3I K;  4KAW X;  3M3Y C;  1O28 A;  2GAG C;  1R9T K;  3M4O C;  4WJ4 A;  3GTQ K;  1TWG C;  2R93 K;  1USO A;  2BE5 A;  4KMA A;  1I50 A;  1BJT A;  2NVY K;  2XCR B;  1J98 A;  4LR2 A;  2R7Z A;  3GTM C;  3HOY C;  4GTB A;  4NOI A;  1VRQ C;  1JQW A;  3FHZ A;  2ZFZ A;  2NVX A;  5M3F K;  2NVT C;  1I6H K;  4LQY A;  4QIW D;  2YU9 K;  4BBR K;  3M3Y K;  2B63 C;  1ZXO A;  4XLN A;  3HXA A;  3LPX A;  3M4O K;  4QJV A;  4KN7 A;  2XCO A;  1WIH A;  5TMF A;  4JK1 A;  1F7U A;  4OIP A;  4LOW A;  5C4X C;  3GTM K;  3HOW C;  4XSX A;  1ZYR A;  1L0W A;  2E2I A;  4OIQ A;  1O2F B;  1GE9 A;  3FKI A;  3T00 A;  1IBA A;  2NVT K;  2E2H A;  4GTF A;  1TWH C;  1B4A A;  2B63 K;  3H3V L;  2W7V A;  3QX3 A;  4Q5S A;  2PMZ L;  1YNN A;  2ZUF A;  4WJ3 M;  5C4X K;  3BP3 A;  4C3J C;  5EGE A;  3SZY A;  1TWC A;  2JA6 A;  3G4A A;  3AD7 C;  2PPB A;  1TWH K;  3HOU C;  1SFO C;  1Y1W A;  5JFE A;  1J6V A;  5IYB C;  3L4K A;  2JH3 A;  3S17 C;  1O25 A;  1YNJ A;  4Y52 C;  2V6U A;  3V4G A;  3BP8 C;  1ZQ1 C;  5M3M K;  3FOF A;  3AD9 C;  4C3J K;  4YFX A;  4QIW L;  5TJ3 A;  5FLM C;  3N0C A;  2RGR A;  3GTO A;  1DCO A;  1O27 A;  2A6E A;  3HOU K;  1SFO K;  2O5J A;  1WQG A;  4ZH4 A;  5IYB K;  1WCM C;  3S14 C;  5CHP A;  3S17 K;  4BY7 C;  5C3E C;  1B4B A;  2CFA A;  4Y52 K;  1YCL A;  4YG2 A;  4ILD A;  3GTK C;  3G4C A;  1IE0 A;  4FM9 A;  5FLM K;  4MEX A;  4GTD A;  1F7V A;  3DXJ A;  1K83 C;  3A8J A;  3CQZ C;  1WCM K;  3S14 K;  5C3E K;  3ADA C;  1DD5 A;  2Y0S D;  4PAA A;  2KWA A;  4BBS C;  3A8I A;  4G7Z A;  1INN A;  1RU0 A;  4FZB A;  3S2D C;  3I4M C;  4AH6 A;  3L4J A;  2JA5 C;  3GTK K;  4C45 A;  4YFN A;  3HOX C;  3GTJ A;  4GTE A;  1XZQ A;  1O29 A;  2VUM A;  1TWF A;  3HOZ C;  3GTL C;  1K83 K;  4AYB D;  1WQH A;  4YFK A;  3CQZ K;  3GTP A;  1G51 A;  3CAG A;  4C3H C;  3S15 C;  5D4D A;  1VLO A;  4BBS K;  4P9S A;  5IOR A;  1YX2 A;  3S2D K;  3I4M K;  2EBB A;  3S1M C;  2JA5 K;  1UV7 A;  2JA7 A;  4KAT A;  1Y1V C;  3HOX K;  4BKW A;  1F93 A;  3AH5 A;  3GTQ A;  2R93 A;  1TWG K;  1TWA C;  1WQF A;  2GAH C;  2NVY A;  4WIL A;  4A3J C;  1EFW A;  4BLA A;  3HOZ K;  3GTL K;  4KB2 A;  3GSI A;  2RH6 A;  4C3H K;  3HOY K;  3BUE A;  3S15 K;  3RZD C;  1IQ0 A;  4J3N A;  4O2D A;  3S1M K;  4XSZ A;  1Y1V K;  4X6A C;  1TWA K;  4KC6 A;  4A3J K;  2JA8 C;  1IS1 A;  4A3M C;  4A3B C;  2WAQ L;  1HI9 A;  2Y0S L;  3GEE A;  3GTM A;  4LK1 A;  3HOW K;  4KM9 A;  2ZUE A;  3WOD A;  3RZD K;  2R92 C;  2A68 A;  3OPF A;  4A3F C;  4KM8 A;  2B63 A;  2GSN A;  3IPJ A;  3GTG C;  4X6A K;  1I3Q C;  5C4J C;  4AYB L;  3HKZ D;  1ISE A;  2JA8 K;  4XCH A;  4A3M K;  4A3B K;  1EQR A;  2GSU A;  4KMD A;  4A3C C;  3H0G C;  5TMC A;  1IL2 A;  5C44 C;  2R92 K;  4BLB A;  3TFJ A;  4A3F K;  3Q3Q A;  4OIN A;  3RZO C;  1TWH A;  3TTG A;  4KN4 A;  4RMF A;  5IP9 C;  3GTG K;  3AQO A;  1WOO A;  1I3Q K;  4A3K C;  5FJ8 K;  5C4J K;  4A3E C;  4KDD A;  3I4N C;  3K7A C;  1BGW A;  4A3C K;  1XXB A;  3T02 A;  2E2J C;  4A3L C;  3H0G K;  4P5A A;  4G7H A;  4G0V A;  5C44 K;  5EGH A;  4GTC A;  1IW7 A;  4M1X A;  1I50 C;  3S1Q C;  5IYD C;  1USM A;  2R7Z C;  1SFO A;  4DDQ A;  5M5X K;  5IP9 K;  2WB1 D;  4A3K K;  4KAS A;  3S2H C;  1PJ6 A;  1I6V A;  4BY7 K;  1XZP B;  5M5W K;  4A3E K;  2WAQ D;  1F9N A;  2NVX C;  3I4N K;  1J6X A;  3K7A K;  1XXC A;  3T01 A;  2GSO A;  4Y7N C;  2O5I A;  2E2J K;  4GZY A;  4A3L K;  1VGX A;  3FOE A;  1O2B A;  4LJZ A;  4OIO A;  1JOE A;  4A3D C;  1I50 K;  3S1Q K;  5IYD K;  2R7Z K;  4MQ9 A;  3HKZ L;  4A3I C;  2E2I C;  1WCM A;  3S2H K;  1DCP A;  3FKI C;  1WSV A;  5E68 A;  1EH1 A;  2NVX K;  2FQO A;  4GT9 A;  2E2H C;  4KB4 A;  1C0A A;  4G0W A;  2D6F C;  2NVQ C;  4Y7N K; 
#chains in the Genus database with same CATH homology
 3GTK A;  3N3Y A;  3V4G A;  5IOT A;  4KC6 A;  3ORE A;  4C3I C;  1R9T A;  3H0G A;  3FOF A;  1O24 A;  1IS1 A;  4P5B A;  1XXA A;  3GTM A;  5TJ3 A;  4KM9 A;  1K83 A;  3N0C A;  1AB4 A;  2RGR A;  3CQZ A;  3GTO A;  4GFQ A;  5CJ9 A;  4KMH A;  1O27 A;  3OPF A;  4KM8 A;  1WQG A;  4C2M C;  2B63 A;  2GSN A;  5CHP A;  4GTL A;  3S0X A;  1B4B A;  2CFA A;  2JA5 A;  2YU9 A;  3VA7 A;  4GTA A;  4KAW X;  1O28 A;  1ISE A;  1TWG A;  4ILD A;  3MML B;  3G4C A;  2GSU A;  4KMD A;  4KMA A;  1I50 A;  4FM9 A;  3GTL A;  1BJT A;  4GTD A;  2Y3P A;  2XCR B;  4LR2 A;  2R7Z A;  4BLB A;  3Q3Q A;  4GTB A;  1TWH A;  1KQ4 A;  3FHZ A;  2ZFZ A;  2NVX A;  3AQO A;  1DD5 A;  2KWA A;  4LQY A;  1Y1V A;  4FZB A;  2PHC B;  3AQP A;  1ZBS A;  4KDD A;  1ZXO A;  3L4J A;  5IOS A;  1O2A A;  1TWA A;  3LPX A;  1BGW A;  3GTJ A;  2XCO A;  1WIH A;  1XXB A;  5IOQ A;  4GTE A;  4P5A A;  1O29 A;  4KAR A;  2VUM A;  4G0V A;  5EGH A;  1TWF A;  4GTC A;  4M1X A;  2E2I A;  3OEP A;  1WQH A;  1GE9 A;  3GTP A;  3FKI A;  3CAG A;  1ZVU A;  4C3H C;  4DDQ A;  1SFO A;  3ERE D;  2E2H A;  4GTF A;  4KAS A;  5IOR A;  3N0B A;  1B4A A;  2CFA B;  1F9N A;  1XXC A;  3NUH A;  1EK8 A;  3QX3 A;  2JA7 A;  2GSO A;  4KAT A;  4BKW A;  3AH5 A;  3GTQ A;  2R93 A;  1WQF A;  3FOE A;  1O2B A;  2NVY A;  4BLA A;  4C3J C;  5EGE A;  4KB2 A;  3LAJ A;  2R92 A;  1TWC A;  2RH6 A;  2P5M A;  2JA6 A;  2XCQ A;  3BUE A;  3G4A A;  1WCM A;  1O26 A;  4J3N A;  3GTG A;  3LAP A;  1I3Q A;  1EH1 A;  4G0U A;  1Y1W A;  5JFE A;  4GT9 A;  3L4K A;  4KB4 A;  2JH3 A;  4G0W A;  1O25 A;  5JVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...