2CFAA

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
179
Chain Sequence
MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDWVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
molecule keywords THYMIDYLATE SYNTHASE
total genus 55
structure length 179
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaA01
5IOQA 1O29A 1O24A 4KARA 1KQ4A 4KASA 5IOSA 3AH5A 3G4AA 3G4CA 2CFAA 4GTLA 4P5BA 1O27A 1O2BA 3N0BA 4GTDA 1O28A 3N0CA 4GTBA 1O25A 3N3YA 4KATA 2CFAB 4GTCA 5IOTA 1O2AA 5IORA 4GTAA 4GTFA 5JFEA 4GT9A 4P5AA 4FZBA 4GTEA 5CHPA 1O26A
chains in the Genus database with same CATH superfamily
5IOQA 4A3LK 4KASA 1VH2A 1PJ5A 2GSNA 3GTLC 4KMHA 3HOXC 5IP9C 3A8KA 3GTMK 3FKIA 4A3KC 3OREA 2A69A 1BS2A 3S0XA 4BXXC 1TWCC 1ZQ1C 2O5IA 3N3YA 3S1QC 4C45A 4Y52K 4G0VA 4QIWD 3S16K 5TMFA 3S2DK 2R93K 1O29A 2PHCB 5C44K 4P9SA 4BY1C 4YFXA 1DCHA 3GTLK 1DCOA 3S1RC 2PMZL 1O2BA 1J6XA 3H3VD 2NVYK 4FM9A 2WAQD 1TWGK 1O28A 4G7ZA 2R92C 1TWHK 3HXAA 1IW7A 2Y0SD 4J3NA 4G7OA 2E2HK 4C2MK 3L4KA 5FLMK 1F7VA 3MMLB 3V4GA 4LK1A 2NVXC 4KC6A 3GTOA 3HOZK 1F93A 2JA7K 1JVIA 1F7UA 1XXAA 1EI6A 4C3JK 4A3MK 4KN4A 3HOWK 4A3CK 1J98A 2CFAB 1O2AA 4C3JC 4XLNA 4A3MC 3PO3K 1YNNA 2JA6C 3GTQA 2PPBA 5TMCA 3GTKC 3RZOC 3GTJC 1PJ7A 1V5VA 1YCLA 2V6SA 4A3JC 2V6UA 4OIPA 1Y1VK 4GZYA 4C2MC 1USOA 2CW0A 3I4NK 2R93A 3GTGK 4G7HA 1TWCK 2E2HA 1AB4A 2XCQA 4MEXA 2VUMK 4LQYA 4WJ3M 4KMDA 4LR2A 2NVTK 3GTLA 5EGHA 3H0GC 3AQOA 2R7ZC 3H0GA 4Q5SA 2R7ZA 1R9TC 1VGXA 1XXCA 1YX2A 3S1NC 3ERED 3T01A 1O24A 5HL8A 4A93K 3CAGA 1WQHA 3K7AC 1WQGA 2GSOA 3QX3A 2ZUEA 2GAHC 4AYBD 4Y7NC 4BBRC 2BE5A 3M3YK 3GTJA 1I6HC 4BBRK 3M3YC 1TWCA 1I6VA 3GEEA 3N0CA 5IYCC 1GE9A 4MEYA 4GTCA 5IOTA 3HKZD 5IYBK 5M5YK 3VA7A 1TWAA 4LK0A 1UV7A 3L4JA 1O26A 2JA6K 5C3EC 4A3FK 4A3DC 3Q3QA 4KAWX 4KN7A 1B4AA 4YFKA 3AD7C 5IP7K 2KWAA 2E2IA 5EGEA 3PO2C 1WOOA 4BBSK 3BP3A 2B63C 4KM9A 3DXJA 2RGRA 2PMZD 4A3GK 1TWAC 3EQLA 3I4NC 2FQTA 4KDDA 4MQ9A 3CQZK 3S1MC 1RU0A 1SMYA 3GTGC 3GTGA 5IYDC 3HOVC 1PJ6A 4BXXK 1Y1VA 4P5AA 1WCMA 3TTGA 4C3IC 4PABA 2R92A 4A93C 1EH1A 3GTKK 1VRQC 4YFNA 4LLGA 3HOZC 1I3QA 5JVOA 2XCOA 1EK8A 3FOFA 4A3IK 4M1XA 2P8TA 1ZVUA 2NVYA 3GTQK 4GTBA 2JA7C 1HI9A 5C4JK 3WODA 4Y52C 3HOVK 5IYDK 1C0AA 2E2HC 3H3VL 2NVQC 1I50A 1L0WA 1JOEA 1ZYRA 1R9TA 2FQOA 4G0WA 5IP7C 3GTKA 1TWFK 1DCPA 4BBSC 1BGWA 3GTQC 3GEIA 5IP9K 2JA6A 2R92K 1XZPB 2NVTC 3AQPA 3S15K 1O25A 4KATA 5FJ8K 3M4OC 5CJ9A 1TWHA 5M5XK 3S16C 1O2FB 1TWGA 5M3FK 3GTOC 4OINA 3GTPK 1EQRA 4KM8A 4BY7K 4PAAA 5FLMC 2JH3A 2WB1L 5IOSA 3BP8C 1ZBSA 4A3KK 3PO2K 4GTLA 5M5WK 4Q4ZA 1TWGC 4A3EK 1K83K 3HOWC 1TWAK 4C3HK 1IL2A 3PO3C 3HOYC 1TWFA 3HOUC 4GTAA 2NVXA 4DDQA 4ZH4A 5IYBC 1VLOA 1WOSA 2W7VA 3FKIK 1B4BA 3ADAC 3GTPA 3S2DC 1KQ4A 5D4DA 1IE0A 4OIQA 3AH5A 1I50C 2XCRB 3S1MK 1SFOA 5C4XC 3GTMC 2VUMA 1EFWA 4X6AC 2GSUA 3CQZC 2JA5A 4RMFA 3S14C 1R9TK 4A3CC 4FZBA 1WOPA 3FKIC 4GTEA 2A6HA 3GEHA 1VJEA 1WQFA 4LJZA 5CHPA 4A3LC 5TJ3A 5C44C 4A3DK 3BUEA 2Y3PA 2O5JA 1XZPA 1K83C 5M3MK 1I6HK 1XXBA 1WCMC 4AYBL 4XLPA 3N0BA 1J6VA 4AH6A 4Y7NK 4QIWL 2WAQL 5C4XK 3FOEA 2GAGC 1Y1WC 4GTFA 4KMUA 3RZOK 4BY7C 2JA7A 1HQMA 4QJVA 1SFOK 3GTOK 3S17C 4KARA 1I3QK 1J6WA 3GIRA 3HOXK 1I3QC 1TWFC 3G4CA 3TFIA 2NVXK 1IS1A 3OPFA 3S1RK 4BY1K 2YU9K 3TFHA 1O27A 2V6TA 5IYCK 3CQZA 2JA5C 3FHZA 4A3EC 3A8IA 4O2DA 1Y1WK 2Y0SL 3S1QK 2VUMC 3GTMA 1DD5A 1XZQB 3GSIA 2NVQK 3GTJK 2P5MA 1INNA 3AD8C 4A3JK 3S2HC 2WB1D 4KB2A 3GTPC 3LAPA 3S1NK 1IQ0A 3TFJA 4GFQA 2B63K 4XCHA 3HKZL 2E2IC 1USMA 3RZDK 4JK1A 4A3BK 3RZDC 3HOUK 2YU9A 4X6AK 5JFEA 1Y1WA 4NOIA 2R93C 3SZZA 1XPPA 4WJ4A 4XSZA 4QJVB 5L46A 1ZXOA 2RH6A 1YNJA 3G4AA 1WSVA 3I4MK 3K7AK 3JSTA 1JQWA 2PA8D 4WILA 1IBAA 2CFAA 4XSXA 3A8JA 4A3GC 2JA8K 4A3IC 3H0GK 2R7ZK 2A6EA 2JA8C 3LPXA 4A3BC 4C3HC 4YG2A 4BLBA 1F9NA 1WORA 2E2JK 3OEPA 4GT9A 3T02A 3S14K 2ZFZA 4KMAA 5C3EK 4A3FC 3S2HK 4C3IK 2D6FC 2ZUFA 1SFOC 4KB4A 1I50K 2JA5K 1BDFA 1XZQA 1BJTA 3NUHA 2YU9C 2NVYC 2E2JC 4ILDA 3S15C 5E68A 4BLAA 5IORA 3HOYK 3M4OK 3S17K 3GDZA 4G0UA 4OIOA 3I4MC 1ISEA 1WSRA 2E2IK 2EBBA 1Y1VC 2A68A 4P5BA 4LOWA 3SZYA 4GTDA 1WCMK 3T00A 1WIHA 3LAJA 3IPJA 3AD9C 4BKWA 1TWHC 1X31C 2B63A 5C4JC 1G51A 4OIRA 1K83A 2PA8L
chains in the Genus database with same CATH topology
5IOQA 1O24A 2JH3A 4KB2A 4KASA 3CAGA 1WQHA 5IOSA 3LAPA 1WQGA 4GFQA 2GSNA 2GSOA 3QX3A 1ZBSA 4KMHA 3FKIA 4GTLA 3OREA 3S0XA 3GTJA 1TWCA 3N0CA 1GE9A 2YU9A 3N3YA 1TWFA 4GTCA 5IOTA 4GTAA 2NVXA 5JFEA 4DDQA 1Y1WA 3VA7A 1TWAA 4G0VA 3L4JA 1O26A 1B4BA 3Q3QA 4KAWX 1O29A 3GTPA 1KQ4A 1B4AA 2PHCB 1ZXOA 3AH5A 2RH6A 2KWAA 3G4AA 5EGEA 2E2IA 2CFAA 4KM9A 2XCRB 2RGRA 1SFOA 4KDDA 1O2BA 4FM9A 2VUMA 1O28A 2GSUA 3GTGA 2JA5A 3LPXA 4C3HC 4BLBA 1F9NA 3OEPA 4GT9A 1Y1VA 4P5AA 1WCMA 4J3NA 4FZBA 2ZFZA 4KMAA 4C3IC 4GTEA 1WQFA 2R92A 5CHPA 5TJ3A 1EH1A 3L4KA 3BUEA 2Y3PA 3MMLB 3V4GA 4KB4A 1I3QA 5JVOA 4KC6A 2XCOA 1EK8A 3GTOA 1XXBA 3FOFA 4M1XA 3N0BA 1BJTA 3NUHA 1ZVUA 1XXAA 2NVYA 4GTBA 3FOEA 4ILDA 2CFAB 1O2AA 4C3JC 4BLAA 5IORA 4GTFA 3GTQA 2JA7A 4G0UA 1I50A 4KARA 1ISEA 4C2MC 3G4CA 1IS1A 3OPFA 1R9TA 4G0WA 3GTKA 2R93A 4P5BA 1BGWA 1O27A 2JA6A 2E2HA 1AB4A 2XCQA 3CQZA 4LQYA 4GTDA 3AQPA 3FHZA 4KMDA 1WIHA 3GTMA 1O25A 4KATA 1DD5A 4LR2A 3LAJA 5EGHA 3GTLA 5CJ9A 4BKWA 3AQOA 1TWHA 3H0GA 2R7ZA 2B63A 1TWGA 1K83A 2P5MA 1XXCA 4KM8A 3ERED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOQ A;  1O29 A;  1O24 A;  4KAR A;  1KQ4 A;  4KAS A;  5IOS A;  3AH5 A;  3G4A A;  3G4C A;  2CFA A;  4GTL A;  4P5B A;  1O27 A;  1O2B A;  3N0B A;  4GTD A;  1O28 A;  3N0C A;  4GTB A;  1O25 A;  3N3Y A;  4KAT A;  2CFA B;  4GTC A;  5IOT A;  1O2A A;  5IOR A;  4GTA A;  4GTF A;  5JFE A;  4GT9 A;  4P5A A;  4FZB A;  4GTE A;  5CHP A;  1O26 A; 
#chains in the Genus database with same CATH topology
 5IOQ A;  4A3L K;  4KAS A;  1VH2 A;  1PJ5 A;  2GSN A;  3GTL C;  4KMH A;  3HOX C;  5IP9 C;  3A8K A;  3GTM K;  3FKI A;  4A3K C;  3ORE A;  2A69 A;  1BS2 A;  3S0X A;  4BXX C;  1TWC C;  1ZQ1 C;  2O5I A;  3N3Y A;  3S1Q C;  4C45 A;  4Y52 K;  4G0V A;  4QIW D;  3S16 K;  5TMF A;  3S2D K;  2R93 K;  1O29 A;  2PHC B;  5C44 K;  4P9S A;  4BY1 C;  4YFX A;  1DCH A;  3GTL K;  1DCO A;  3S1R C;  2PMZ L;  1O2B A;  1J6X A;  3H3V D;  2NVY K;  4FM9 A;  2WAQ D;  1TWG K;  1O28 A;  4G7Z A;  2R92 C;  1TWH K;  3HXA A;  1IW7 A;  2Y0S D;  4J3N A;  4G7O A;  2E2H K;  4C2M K;  3L4K A;  5FLM K;  1F7V A;  3MML B;  3V4G A;  4LK1 A;  2NVX C;  4KC6 A;  3GTO A;  3HOZ K;  1F93 A;  2JA7 K;  1JVI A;  1F7U A;  1XXA A;  1EI6 A;  4C3J K;  4A3M K;  4KN4 A;  3HOW K;  4A3C K;  1J98 A;  2CFA B;  1O2A A;  4C3J C;  4XLN A;  4A3M C;  3PO3 K;  1YNN A;  2JA6 C;  3GTQ A;  2PPB A;  5TMC A;  3GTK C;  3RZO C;  3GTJ C;  1PJ7 A;  1V5V A;  1YCL A;  2V6S A;  4A3J C;  2V6U A;  4OIP A;  1Y1V K;  4GZY A;  4C2M C;  1USO A;  2CW0 A;  3I4N K;  2R93 A;  3GTG K;  4G7H A;  1TWC K;  2E2H A;  1AB4 A;  2XCQ A;  4MEX A;  2VUM K;  4LQY A;  4WJ3 M;  4KMD A;  4LR2 A;  2NVT K;  3GTL A;  5EGH A;  3H0G C;  3AQO A;  2R7Z C;  3H0G A;  4Q5S A;  2R7Z A;  1R9T C;  1VGX A;  1XXC A;  1YX2 A;  3S1N C;  3ERE D;  3T01 A;  1O24 A;  5HL8 A;  4A93 K;  3CAG A;  1WQH A;  3K7A C;  1WQG A;  2GSO A;  3QX3 A;  2ZUE A;  2GAH C;  4AYB D;  4Y7N C;  4BBR C;  2BE5 A;  3M3Y K;  3GTJ A;  1I6H C;  4BBR K;  3M3Y C;  1TWC A;  1I6V A;  3GEE A;  3N0C A;  5IYC C;  1GE9 A;  4MEY A;  4GTC A;  5IOT A;  3HKZ D;  5IYB K;  5M5Y K;  3VA7 A;  1TWA A;  4LK0 A;  1UV7 A;  3L4J A;  1O26 A;  2JA6 K;  5C3E C;  4A3F K;  4A3D C;  3Q3Q A;  4KAW X;  4KN7 A;  1B4A A;  4YFK A;  3AD7 C;  5IP7 K;  2KWA A;  2E2I A;  5EGE A;  3PO2 C;  1WOO A;  4BBS K;  3BP3 A;  2B63 C;  4KM9 A;  3DXJ A;  2RGR A;  2PMZ D;  4A3G K;  1TWA C;  3EQL A;  3I4N C;  2FQT A;  4KDD A;  4MQ9 A;  3CQZ K;  3S1M C;  1RU0 A;  1SMY A;  3GTG C;  3GTG A;  5IYD C;  3HOV C;  1PJ6 A;  4BXX K;  1Y1V A;  4P5A A;  1WCM A;  3TTG A;  4C3I C;  4PAB A;  2R92 A;  4A93 C;  1EH1 A;  3GTK K;  1VRQ C;  4YFN A;  4LLG A;  3HOZ C;  1I3Q A;  5JVO A;  2XCO A;  1EK8 A;  3FOF A;  4A3I K;  4M1X A;  2P8T A;  1ZVU A;  2NVY A;  3GTQ K;  4GTB A;  2JA7 C;  1HI9 A;  5C4J K;  3WOD A;  4Y52 C;  3HOV K;  5IYD K;  1C0A A;  2E2H C;  3H3V L;  2NVQ C;  1I50 A;  1L0W A;  1JOE A;  1ZYR A;  1R9T A;  2FQO A;  4G0W A;  5IP7 C;  3GTK A;  1TWF K;  1DCP A;  4BBS C;  1BGW A;  3GTQ C;  3GEI A;  5IP9 K;  2JA6 A;  2R92 K;  1XZP B;  2NVT C;  3AQP A;  3S15 K;  1O25 A;  4KAT A;  5FJ8 K;  3M4O C;  5CJ9 A;  1TWH A;  5M5X K;  3S16 C;  1O2F B;  1TWG A;  5M3F K;  3GTO C;  4OIN A;  3GTP K;  1EQR A;  4KM8 A;  4BY7 K;  4PAA A;  5FLM C;  2JH3 A;  2WB1 L;  5IOS A;  3BP8 C;  1ZBS A;  4A3K K;  3PO2 K;  4GTL A;  5M5W K;  4Q4Z A;  1TWG C;  4A3E K;  1K83 K;  3HOW C;  1TWA K;  4C3H K;  1IL2 A;  3PO3 C;  3HOY C;  1TWF A;  3HOU C;  4GTA A;  2NVX A;  4DDQ A;  4ZH4 A;  5IYB C;  1VLO A;  1WOS A;  2W7V A;  3FKI K;  1B4B A;  3ADA C;  3GTP A;  3S2D C;  1KQ4 A;  5D4D A;  1IE0 A;  4OIQ A;  3AH5 A;  1I50 C;  2XCR B;  3S1M K;  1SFO A;  5C4X C;  3GTM C;  2VUM A;  1EFW A;  4X6A C;  2GSU A;  3CQZ C;  2JA5 A;  4RMF A;  3S14 C;  1R9T K;  4A3C C;  4FZB A;  1WOP A;  3FKI C;  4GTE A;  2A6H A;  3GEH A;  1VJE A;  1WQF A;  4LJZ A;  5CHP A;  4A3L C;  5TJ3 A;  5C44 C;  4A3D K;  3BUE A;  2Y3P A;  2O5J A;  1XZP A;  1K83 C;  5M3M K;  1I6H K;  1XXB A;  1WCM C;  4AYB L;  4XLP A;  3N0B A;  1J6V A;  4AH6 A;  4Y7N K;  4QIW L;  2WAQ L;  5C4X K;  3FOE A;  2GAG C;  1Y1W C;  4GTF A;  4KMU A;  3RZO K;  4BY7 C;  2JA7 A;  1HQM A;  4QJV A;  1SFO K;  3GTO K;  3S17 C;  4KAR A;  1I3Q K;  1J6W A;  3GIR A;  3HOX K;  1I3Q C;  1TWF C;  3G4C A;  3TFI A;  2NVX K;  1IS1 A;  3OPF A;  3S1R K;  4BY1 K;  2YU9 K;  3TFH A;  1O27 A;  2V6T A;  5IYC K;  3CQZ A;  2JA5 C;  3FHZ A;  4A3E C;  3A8I A;  4O2D A;  1Y1W K;  2Y0S L;  3S1Q K;  2VUM C;  3GTM A;  1DD5 A;  1XZQ B;  3GSI A;  2NVQ K;  3GTJ K;  2P5M A;  1INN A;  3AD8 C;  4A3J K;  3S2H C;  2WB1 D;  4KB2 A;  3GTP C;  3LAP A;  3S1N K;  1IQ0 A;  3TFJ A;  4GFQ A;  2B63 K;  4XCH A;  3HKZ L;  2E2I C;  1USM A;  3RZD K;  4JK1 A;  4A3B K;  3RZD C;  3HOU K;  2YU9 A;  4X6A K;  5JFE A;  1Y1W A;  4NOI A;  2R93 C;  3SZZ A;  1XPP A;  4WJ4 A;  4XSZ A;  4QJV B;  5L46 A;  1ZXO A;  2RH6 A;  1YNJ A;  3G4A A;  1WSV A;  3I4M K;  3K7A K;  3JST A;  1JQW A;  2PA8 D;  4WIL A;  1IBA A;  2CFA A;  4XSX A;  3A8J A;  4A3G C;  2JA8 K;  4A3I C;  3H0G K;  2R7Z K;  2A6E A;  2JA8 C;  3LPX A;  4A3B C;  4C3H C;  4YG2 A;  4BLB A;  1F9N A;  1WOR A;  2E2J K;  3OEP A;  4GT9 A;  3T02 A;  3S14 K;  2ZFZ A;  4KMA A;  5C3E K;  4A3F C;  3S2H K;  4C3I K;  2D6F C;  2ZUF A;  1SFO C;  4KB4 A;  1I50 K;  2JA5 K;  1BDF A;  1XZQ A;  1BJT A;  3NUH A;  2YU9 C;  2NVY C;  2E2J C;  4ILD A;  3S15 C;  5E68 A;  4BLA A;  5IOR A;  3HOY K;  3M4O K;  3S17 K;  3GDZ A;  4G0U A;  4OIO A;  3I4M C;  1ISE A;  1WSR A;  2E2I K;  2EBB A;  1Y1V C;  2A68 A;  4P5B A;  4LOW A;  3SZY A;  4GTD A;  1WCM K;  3T00 A;  1WIH A;  3LAJ A;  3IPJ A;  3AD9 C;  4BKW A;  1TWH C;  1X31 C;  2B63 A;  5C4J C;  1G51 A;  4OIR A;  1K83 A;  2PA8 L; 
#chains in the Genus database with same CATH homology
 5IOQ A;  1O24 A;  2JH3 A;  4KB2 A;  4KAS A;  3CAG A;  1WQH A;  5IOS A;  3LAP A;  1WQG A;  4GFQ A;  2GSN A;  2GSO A;  3QX3 A;  1ZBS A;  4KMH A;  3FKI A;  4GTL A;  3ORE A;  3S0X A;  3GTJ A;  1TWC A;  3N0C A;  1GE9 A;  2YU9 A;  3N3Y A;  1TWF A;  4GTC A;  5IOT A;  4GTA A;  2NVX A;  5JFE A;  4DDQ A;  1Y1W A;  3VA7 A;  1TWA A;  4G0V A;  3L4J A;  1O26 A;  1B4B A;  3Q3Q A;  4KAW X;  1O29 A;  3GTP A;  1KQ4 A;  1B4A A;  2PHC B;  1ZXO A;  3AH5 A;  2RH6 A;  2KWA A;  3G4A A;  5EGE A;  2E2I A;  2CFA A;  4KM9 A;  2XCR B;  2RGR A;  1SFO A;  4KDD A;  1O2B A;  4FM9 A;  2VUM A;  1O28 A;  2GSU A;  3GTG A;  2JA5 A;  3LPX A;  4C3H C;  4BLB A;  1F9N A;  3OEP A;  4GT9 A;  1Y1V A;  4P5A A;  1WCM A;  4J3N A;  4FZB A;  2ZFZ A;  4KMA A;  4C3I C;  4GTE A;  1WQF A;  2R92 A;  5CHP A;  5TJ3 A;  1EH1 A;  3L4K A;  3BUE A;  2Y3P A;  3MML B;  3V4G A;  4KB4 A;  1I3Q A;  5JVO A;  4KC6 A;  2XCO A;  1EK8 A;  3GTO A;  1XXB A;  3FOF A;  4M1X A;  3N0B A;  1BJT A;  3NUH A;  1ZVU A;  1XXA A;  2NVY A;  4GTB A;  3FOE A;  4ILD A;  2CFA B;  1O2A A;  4C3J C;  4BLA A;  5IOR A;  4GTF A;  3GTQ A;  2JA7 A;  4G0U A;  1I50 A;  4KAR A;  1ISE A;  4C2M C;  3G4C A;  1IS1 A;  3OPF A;  1R9T A;  4G0W A;  3GTK A;  2R93 A;  4P5B A;  1BGW A;  1O27 A;  2JA6 A;  2E2H A;  1AB4 A;  2XCQ A;  3CQZ A;  4LQY A;  4GTD A;  3AQP A;  3FHZ A;  4KMD A;  1WIH A;  3GTM A;  1O25 A;  4KAT A;  1DD5 A;  4LR2 A;  3LAJ A;  5EGH A;  3GTL A;  5CJ9 A;  4BKW A;  3AQO A;  1TWH A;  3H0G A;  2R7Z A;  2B63 A;  1TWG A;  1K83 A;  2P5M A;  1XXC A;  4KM8 A;  3ERE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...