2CFAA

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
217
structure length
179
Chain Sequence
b'MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDWVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE SYNTHASE
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 55
structure length 179
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaA01
5IOSA 1O2BA 3N0CA 1O29A 4GTBA 5IOTA 4GTDA 4GTEA 5IOQA 3AH5A 1O26A 1O25A 4KARA 5CHPA 3N0BA 4KASA 4GTAA 5JFEA 4KATA 5IORA 1O2AA 4P5BA 4P5AA 1KQ4A 2CFAA 1O27A 3G4CA 4GTCA 1O28A 4FZBA 3G4AA 4GTLA 2CFAB 3N3YA 1O24A 4GTFA 4GT9A
chains in the Genus database with same CATH superfamily
2E2HA 3S1RK 2V6TA 3GTPC 1YNJA 1O26A 4KARA 5IYCK 2R93K 4QJVB 4X6AK 3M3YK 4DDQA 3RZOC 1VJEA 5IYBK 4ZH4A 1YX2A 4LK1A 5E68A 1VRQC 1WCMA 5FLMC 5EGEA 2NVYC 1DCOA 3S14K 3GTPA 5C3EC 3H3VL 1TWHK 4KC6A 1C0AA 1WQHA 3N3YA 3GTJK 2ZUFA 1IQ0A 1UV7A 2XCRB 1DCPA 3RZDK 4KN4A 5C4XK 1EK8A 2NVTC 2JA7K 1XZQA 1TWAC 3HOVC 1AB4A 5FJ8K 1G51A 3H0GC 2VUMK 1INNA 2A6EA 4BBRK 1WOOA 5M5WK 3M4OK 2ZUEA 3GTLC 3A8JA 3GTQC 1YCLA 3BP3A 1EFWA 2FQTA 3G4CA 3AQOA 4FZBA 2P5MA 2CFAB 4BXXK 1VLOA 3GTOK 1B4AA 2A69A 2V6UA 2E2HK 2ZFZA 1ISEA 1SFOC 1BS2A 3N0CA 5TMFA 3GTQA 2JA8C 3I4MK 4OIPA 3OEPA 4Q5SA 2GSUA 2P8TA 4KM8A 2V6SA 3GTPK 4RMFA 1R9TA 4A3DC 4WJ3M 2R92A 1O24A 4Y7NC 3H3VD 4Q4ZA 3RZOK 1J6XA 3BP8C 1EH1A 2D6FC 1WSRA 5C3EK 2RGRA 3AD8C 3OPFA 4C3HC 3GDZA 5CHPA 4C3IK 2JA6C 3JSTA 2R93A 5M5XK 1PJ6A 4J3NA 5CJ9A 2KWAA 1XZQB 4P5AA 3FOFA 4A3MC 3LPXA 2YU9A 1WOPA 1ZVUA 1TWAK 1TWHA 3AQPA 4OIRA 3HOVK 5IP9C 4C45A 3AD7C 2PA8L 3GTLK 3GTQK 3FKIC 1ZBSA 3S1QK 2JA7A 3FHZA 3S2HC 4LOWA 1SMYA 4A3IC 1SFOK 3FKIA 2NVXC 4KB2A 2E2JC 3HOWC 2JA8K 1R9TK 4NOIA 4A3CC 4GT9A 3GTOA 3S2DC 4YG2A 3VA7A 1IW7A 4BBSC 4JK1A 2XCOA 3HOZC 1I50A 4KASA 3OREA 3S0XA 1Y1WA 1IS1A 3NUHA 4Y52C 2JA5C 4Y7NK 4C2MC 4A3LC 3K7AK 4MEXA 2E2IC 5IP7C 2YU9K 1WORA 3T02A 4KM9A 4KMAA 4A3EK 1J6WA 1O28A 4C3HK 2JA6K 1K83C 5C44C 2JA5A 4AYBD 4A3MK 4GTEA 3PO3C 1J6VA 2JH3A 3AH5A 2PA8D 2NVYA 5D4DA 2B63C 4WJ4A 4KAWX 5IP9K 3S17C 1XZPB 3HOUC 4KB4A 3FKIK 3SZZA 2PPBA 3G4AA 1TWAA 1JQWA 4A3GC 3S2HK 4P5BA 3H0GA 1WQFA 3ERED 5M3MK 4A3BC 1TWCC 4GTDA 3GTLA 5IOQA 2NVXK 1XXCA 3HOWK 1I50K 1WOSA 1Y1WK 3QX3A 3MMLB 4A3CK 1JOEA 2WAQD 2EBBA 3S2DK 3TFJA 1SFOA 3GSIA 4BBSK 2XCQA 3HOZK 4GTCA 2CW0A 1GE9A 1EI6A 2W7VA 1IL2A 2JA5K 4C2MK 1O2BA 1Y1VC 4A3LK 2PHCB 3HOXC 3GTGC 5M3FK 2GAHC 5IOTA 5IP7K 4LLGA 5FLMK 2NVYK 1XXBA 4XLNA 1K83K 5JFEA 3GTKC 4KDDA 4C3JC 3PO3K 3GIRA 3CQZC 3AD9C 5L46A 4AH6A 2NVTK 1I6HC 3GEHA 5TMCA 2B63K 2A6HA 2JA6A 4AYBL 3ADAC 4A3KC 1F93A 2GSOA 3H0GK 3HKZL 3S17K 3S1MC 2GSNA 1I3QC 4MQ9A 1XPPA 4WILA 1RU0A 2BE5A 3EQLA 1TWGC 3CQZA 1O25A 3GTJC 2Y0SD 3I4NC 3FOEA 2R7ZC 1L0WA 5C4XC 4OINA 4A3BK 1TWCK 1JVIA 3S16C 1TWFC 1F7VA 4BBRC 2GAGC 1BDFA 3SZYA 5IOSA 2WB1L 2PMZL 4G0VA 1F9NA 1DCHA 2WAQL 4PABA 2NVXA 5C4JC 1IBAA 4A3JC 5IYDC 4A3DK 3GTMC 1Y1VK 4G0WA 3LAPA 3HOXK 3GTGK 4A3FC 1USMA 3S15C 3I4MC 4BY7C 4GFQA 3T00A 2NVQC 4GTLA 4G7OA 5IORA 3GTKK 4FM9A 3GTMA 1ZYRA 1WCMC 1V5VA 5HL8A 3TTGA 2E2IA 4C3JK 3HKZD 3CQZK 3L4KA 1I6HK 3GEIA 1VH2A 4OIQA 4BLBA 5M5YK 4A3KK 4BKWA 1K83A 3CAGA 1YNNA 3S1MK 4OIOA 4XLPA 1I3QK 4YFNA 4C3IC 1TWGK 1DD5A 5TJ3A 1USOA 3I4NK 2B63A 4LQYA 1PJ5A 4M1XA 1J98A 1PJ7A 2R7ZK 4G7ZA 1WSVA 4A3IK 2Y0SL 1X31C 2Y3PA 3S16K 4YFKA 1ZXOA 1TWFK 4PAAA 2WB1D 3A8KA 2PMZD 2E2JK 3N0BA 3S1NC 3HOYC 3PO2C 4LR2A 3IPJA 1O2AA 4A93C 3S1QC 4BLAA 5EGHA 1TWCA 1WQGA 4BY1C 5C4JK 4KN7A 4A3JK 5IYDK 4Y52K 3GTMK 3T01A 4GTBA 4A3FK 2E2IK 4MEYA 3S15K 1R9TC 4BY7K 2R92C 4ILDA 2NVQK 2RH6A 4GTAA 1F7UA 4KATA 4XCHA 5C44K 3S1RC 4QIWL 4YFXA 1Y1VA 1WCMK 4P9SA 3GTGA 3DXJA 3L4JA 1O27A 1BGWA 2R93C 5IYCC 1B4BA 2O5IA 4X6AC 3K7AC 4KMHA 3M3YC 3GTKA 2YU9C 4KMDA 1VGXA 5IYBC 4QJVA 3HOUK 3V4GA 4A3EC 5JVOA 3S14C 1XXAA 1TWHC 3HXAA 3TFHA 4G7HA 4A3GK 4XSXA 2A68A 4O2DA 3RZDC 1IE0A 1KQ4A 1I3QA 4GZYA 2JA7C 3TFIA 1TWGA 3S1NK 3Q3QA 3GTJA 2VUMC 1O2FB 3HOYK 3PO2K 2O5JA 3WODA 3M4OC 3BUEA 4A93K 2R7ZA 1O29A 4G0UA 3LAJA 1WIHA 1EQRA 1XZPA 3GEEA 4BY1K 1TWFA 4BXXC 1I6VA 3GTOC 2VUMA 2E2HC 3A8IA 4LJZA 4XSZA 2CFAA 1HQMA 1I50C 4QIWD 1Y1WC 4KMUA 2R92K 1ZQ1C 1HI9A 4LK0A 4GTFA 1BJTA 2FQOA
chains in the Genus database with same CATH topology
2E2HA 1O2BA 2PHCB 5IOTA 2Y3PA 1ZXOA 1ZBSA 1O26A 4KARA 2JA7A 1XXBA 3FHZA 3N0BA 5JFEA 4LR2A 4KDDA 4DDQA 1O2AA 4C3JC 4BLAA 1WCMA 5EGHA 1TWCA 3FKIA 5EGEA 3GTPA 4KB2A 1WQGA 4KC6A 1WQHA 3N3YA 2JA6A 2GSOA 4GT9A 3GTOA 2GSNA 2XCRB 3VA7A 4GTBA 1EK8A 2XCOA 3CQZA 1O25A 4ILDA 1I50A 2RH6A 1AB4A 3OREA 4KASA 3S0XA 1IS1A 3NUHA 4GTAA 3FOEA 1Y1WA 4KATA 4C2MC 1Y1VA 3GTGA 3L4JA 1O27A 4KM9A 4KMAA 1BGWA 3G4CA 3AQOA 1B4BA 1O28A 4FZBA 2P5MA 2CFAB 4KMHA 1B4AA 2JA5A 5IOSA 3GTKA 2ZFZA 1ISEA 4KMDA 4M1XA 3N0CA 3V4GA 4G0VA 3GTQA 1F9NA 4GTEA 5JVOA 1XXAA 2JH3A 3AH5A 2NVYA 2NVXA 4KAWX 3OEPA 4G0WA 3LAPA 1KQ4A 2GSUA 4KB4A 4KM8A 1I3QA 4GFQA 1TWGA 3G4AA 3Q3QA 4GTLA 1R9TA 1TWAA 3GTJA 2R92A 1O24A 5IORA 4P5BA 3H0GA 4FM9A 1WQFA 3GTMA 3BUEA 3ERED 2R7ZA 1O29A 4G0UA 4GTDA 3GTLA 3LAJA 2E2IA 1EH1A 5IOQA 1WIHA 2RGRA 3L4KA 1XXCA 4C3HC 3OPFA 1TWFA 5CHPA 2R93A 3QX3A 3MMLB 4J3NA 5CJ9A 4BLBA 2KWAA 2VUMA 4BKWA 1K83A 3CAGA 4P5AA 3FOFA 3LPXA 2YU9A 2CFAA 1SFOA 2XCQA 4C3IC 1ZVUA 4GTCA 1DD5A 5TJ3A 1GE9A 1TWHA 3AQPA 2B63A 4LQYA 4GTFA 1BJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOS A;  1O2B A;  3N0C A;  1O29 A;  4GTB A;  5IOT A;  4GTD A;  4GTE A;  5IOQ A;  3AH5 A;  1O26 A;  1O25 A;  4KAR A;  5CHP A;  3N0B A;  4KAS A;  4GTA A;  5JFE A;  4KAT A;  5IOR A;  1O2A A;  4P5B A;  4P5A A;  1KQ4 A;  2CFA A;  1O27 A;  3G4C A;  4GTC A;  1O28 A;  4FZB A;  3G4A A;  4GTL A;  2CFA B;  3N3Y A;  1O24 A;  4GTF A;  4GT9 A; 
#chains in the Genus database with same CATH topology
 2E2H A;  3S1R K;  2V6T A;  3GTP C;  1YNJ A;  1O26 A;  4KAR A;  5IYC K;  2R93 K;  4QJV B;  4X6A K;  3M3Y K;  4DDQ A;  3RZO C;  1VJE A;  5IYB K;  4ZH4 A;  1YX2 A;  4LK1 A;  5E68 A;  1VRQ C;  1WCM A;  5FLM C;  5EGE A;  2NVY C;  1DCO A;  3S14 K;  3GTP A;  5C3E C;  3H3V L;  1TWH K;  4KC6 A;  1C0A A;  1WQH A;  3N3Y A;  3GTJ K;  2ZUF A;  1IQ0 A;  1UV7 A;  2XCR B;  1DCP A;  3RZD K;  4KN4 A;  5C4X K;  1EK8 A;  2NVT C;  2JA7 K;  1XZQ A;  1TWA C;  3HOV C;  1AB4 A;  5FJ8 K;  1G51 A;  3H0G C;  2VUM K;  1INN A;  2A6E A;  4BBR K;  1WOO A;  5M5W K;  3M4O K;  2ZUE A;  3GTL C;  3A8J A;  3GTQ C;  1YCL A;  3BP3 A;  1EFW A;  2FQT A;  3G4C A;  3AQO A;  4FZB A;  2P5M A;  2CFA B;  4BXX K;  1VLO A;  3GTO K;  1B4A A;  2A69 A;  2V6U A;  2E2H K;  2ZFZ A;  1ISE A;  1SFO C;  1BS2 A;  3N0C A;  5TMF A;  3GTQ A;  2JA8 C;  3I4M K;  4OIP A;  3OEP A;  4Q5S A;  2GSU A;  2P8T A;  4KM8 A;  2V6S A;  3GTP K;  4RMF A;  1R9T A;  4A3D C;  4WJ3 M;  2R92 A;  1O24 A;  4Y7N C;  3H3V D;  4Q4Z A;  3RZO K;  1J6X A;  3BP8 C;  1EH1 A;  2D6F C;  1WSR A;  5C3E K;  2RGR A;  3AD8 C;  3OPF A;  4C3H C;  3GDZ A;  5CHP A;  4C3I K;  2JA6 C;  3JST A;  2R93 A;  5M5X K;  1PJ6 A;  4J3N A;  5CJ9 A;  2KWA A;  1XZQ B;  4P5A A;  3FOF A;  4A3M C;  3LPX A;  2YU9 A;  1WOP A;  1ZVU A;  1TWA K;  1TWH A;  3AQP A;  4OIR A;  3HOV K;  5IP9 C;  4C45 A;  3AD7 C;  2PA8 L;  3GTL K;  3GTQ K;  3FKI C;  1ZBS A;  3S1Q K;  2JA7 A;  3FHZ A;  3S2H C;  4LOW A;  1SMY A;  4A3I C;  1SFO K;  3FKI A;  2NVX C;  4KB2 A;  2E2J C;  3HOW C;  2JA8 K;  1R9T K;  4NOI A;  4A3C C;  4GT9 A;  3GTO A;  3S2D C;  4YG2 A;  3VA7 A;  1IW7 A;  4BBS C;  4JK1 A;  2XCO A;  3HOZ C;  1I50 A;  4KAS A;  3ORE A;  3S0X A;  1Y1W A;  1IS1 A;  3NUH A;  4Y52 C;  2JA5 C;  4Y7N K;  4C2M C;  4A3L C;  3K7A K;  4MEX A;  2E2I C;  5IP7 C;  2YU9 K;  1WOR A;  3T02 A;  4KM9 A;  4KMA A;  4A3E K;  1J6W A;  1O28 A;  4C3H K;  2JA6 K;  1K83 C;  5C44 C;  2JA5 A;  4AYB D;  4A3M K;  4GTE A;  3PO3 C;  1J6V A;  2JH3 A;  3AH5 A;  2PA8 D;  2NVY A;  5D4D A;  2B63 C;  4WJ4 A;  4KAW X;  5IP9 K;  3S17 C;  1XZP B;  3HOU C;  4KB4 A;  3FKI K;  3SZZ A;  2PPB A;  3G4A A;  1TWA A;  1JQW A;  4A3G C;  3S2H K;  4P5B A;  3H0G A;  1WQF A;  3ERE D;  5M3M K;  4A3B C;  1TWC C;  4GTD A;  3GTL A;  5IOQ A;  2NVX K;  1XXC A;  3HOW K;  1I50 K;  1WOS A;  1Y1W K;  3QX3 A;  3MML B;  4A3C K;  1JOE A;  2WAQ D;  2EBB A;  3S2D K;  3TFJ A;  1SFO A;  3GSI A;  4BBS K;  2XCQ A;  3HOZ K;  4GTC A;  2CW0 A;  1GE9 A;  1EI6 A;  2W7V A;  1IL2 A;  2JA5 K;  4C2M K;  1O2B A;  1Y1V C;  4A3L K;  2PHC B;  3HOX C;  3GTG C;  5M3F K;  2GAH C;  5IOT A;  5IP7 K;  4LLG A;  5FLM K;  2NVY K;  1XXB A;  4XLN A;  1K83 K;  5JFE A;  3GTK C;  4KDD A;  4C3J C;  3PO3 K;  3GIR A;  3CQZ C;  3AD9 C;  5L46 A;  4AH6 A;  2NVT K;  1I6H C;  3GEH A;  5TMC A;  2B63 K;  2A6H A;  2JA6 A;  4AYB L;  3ADA C;  4A3K C;  1F93 A;  2GSO A;  3H0G K;  3HKZ L;  3S17 K;  3S1M C;  2GSN A;  1I3Q C;  4MQ9 A;  1XPP A;  4WIL A;  1RU0 A;  2BE5 A;  3EQL A;  1TWG C;  3CQZ A;  1O25 A;  3GTJ C;  2Y0S D;  3I4N C;  3FOE A;  2R7Z C;  1L0W A;  5C4X C;  4OIN A;  4A3B K;  1TWC K;  1JVI A;  3S16 C;  1TWF C;  1F7V A;  4BBR C;  2GAG C;  1BDF A;  3SZY A;  5IOS A;  2WB1 L;  2PMZ L;  4G0V A;  1F9N A;  1DCH A;  2WAQ L;  4PAB A;  2NVX A;  5C4J C;  1IBA A;  4A3J C;  5IYD C;  4A3D K;  3GTM C;  1Y1V K;  4G0W A;  3LAP A;  3HOX K;  3GTG K;  4A3F C;  1USM A;  3S15 C;  3I4M C;  4BY7 C;  4GFQ A;  3T00 A;  2NVQ C;  4GTL A;  4G7O A;  5IOR A;  3GTK K;  4FM9 A;  3GTM A;  1ZYR A;  1WCM C;  1V5V A;  5HL8 A;  3TTG A;  2E2I A;  4C3J K;  3HKZ D;  3CQZ K;  3L4K A;  1I6H K;  3GEI A;  1VH2 A;  4OIQ A;  4BLB A;  5M5Y K;  4A3K K;  4BKW A;  1K83 A;  3CAG A;  1YNN A;  3S1M K;  4OIO A;  4XLP A;  1I3Q K;  4YFN A;  4C3I C;  1TWG K;  1DD5 A;  5TJ3 A;  1USO A;  3I4N K;  2B63 A;  4LQY A;  1PJ5 A;  4M1X A;  1J98 A;  1PJ7 A;  2R7Z K;  4G7Z A;  1WSV A;  4A3I K;  2Y0S L;  1X31 C;  2Y3P A;  3S16 K;  4YFK A;  1ZXO A;  1TWF K;  4PAA A;  2WB1 D;  3A8K A;  2PMZ D;  2E2J K;  3N0B A;  3S1N C;  3HOY C;  3PO2 C;  4LR2 A;  3IPJ A;  1O2A A;  4A93 C;  3S1Q C;  4BLA A;  5EGH A;  1TWC A;  1WQG A;  4BY1 C;  5C4J K;  4KN7 A;  4A3J K;  5IYD K;  4Y52 K;  3GTM K;  3T01 A;  4GTB A;  4A3F K;  2E2I K;  4MEY A;  3S15 K;  1R9T C;  4BY7 K;  2R92 C;  4ILD A;  2NVQ K;  2RH6 A;  4GTA A;  1F7U A;  4KAT A;  4XCH A;  5C44 K;  3S1R C;  4QIW L;  4YFX A;  1Y1V A;  1WCM K;  4P9S A;  3GTG A;  3DXJ A;  3L4J A;  1O27 A;  1BGW A;  2R93 C;  5IYC C;  1B4B A;  2O5I A;  4X6A C;  3K7A C;  4KMH A;  3M3Y C;  3GTK A;  2YU9 C;  4KMD A;  1VGX A;  5IYB C;  4QJV A;  3HOU K;  3V4G A;  4A3E C;  5JVO A;  3S14 C;  1XXA A;  1TWH C;  3HXA A;  3TFH A;  4G7H A;  4A3G K;  4XSX A;  2A68 A;  4O2D A;  3RZD C;  1IE0 A;  1KQ4 A;  1I3Q A;  4GZY A;  2JA7 C;  3TFI A;  1TWG A;  3S1N K;  3Q3Q A;  3GTJ A;  2VUM C;  1O2F B;  3HOY K;  3PO2 K;  2O5J A;  3WOD A;  3M4O C;  3BUE A;  4A93 K;  2R7Z A;  1O29 A;  4G0U A;  3LAJ A;  1WIH A;  1EQR A;  1XZP A;  3GEE A;  4BY1 K;  1TWF A;  4BXX C;  1I6V A;  3GTO C;  2VUM A;  2E2H C;  3A8I A;  4LJZ A;  4XSZ A;  2CFA A;  1HQM A;  1I50 C;  4QIW D;  1Y1W C;  4KMU A;  2R92 K;  1ZQ1 C;  1HI9 A;  4LK0 A;  4GTF A;  1BJT A;  2FQO A; 
#chains in the Genus database with same CATH homology
 2E2H A;  1O2B A;  2PHC B;  5IOT A;  2Y3P A;  1ZXO A;  1ZBS A;  1O26 A;  4KAR A;  2JA7 A;  1XXB A;  3FHZ A;  3N0B A;  5JFE A;  4LR2 A;  4KDD A;  4DDQ A;  1O2A A;  4C3J C;  4BLA A;  1WCM A;  5EGH A;  1TWC A;  3FKI A;  5EGE A;  3GTP A;  4KB2 A;  1WQG A;  4KC6 A;  1WQH A;  3N3Y A;  2JA6 A;  2GSO A;  4GT9 A;  3GTO A;  2GSN A;  2XCR B;  3VA7 A;  4GTB A;  1EK8 A;  2XCO A;  3CQZ A;  1O25 A;  4ILD A;  1I50 A;  2RH6 A;  1AB4 A;  3ORE A;  4KAS A;  3S0X A;  1IS1 A;  3NUH A;  4GTA A;  3FOE A;  1Y1W A;  4KAT A;  4C2M C;  1Y1V A;  3GTG A;  3L4J A;  1O27 A;  4KM9 A;  4KMA A;  1BGW A;  3G4C A;  3AQO A;  1B4B A;  1O28 A;  4FZB A;  2P5M A;  2CFA B;  4KMH A;  1B4A A;  2JA5 A;  5IOS A;  3GTK A;  2ZFZ A;  1ISE A;  4KMD A;  4M1X A;  3N0C A;  3V4G A;  4G0V A;  3GTQ A;  1F9N A;  4GTE A;  5JVO A;  1XXA A;  2JH3 A;  3AH5 A;  2NVY A;  2NVX A;  4KAW X;  3OEP A;  4G0W A;  3LAP A;  1KQ4 A;  2GSU A;  4KB4 A;  4KM8 A;  1I3Q A;  4GFQ A;  1TWG A;  3G4A A;  3Q3Q A;  4GTL A;  1R9T A;  1TWA A;  3GTJ A;  2R92 A;  1O24 A;  5IOR A;  4P5B A;  3H0G A;  4FM9 A;  1WQF A;  3GTM A;  3BUE A;  3ERE D;  2R7Z A;  1O29 A;  4G0U A;  4GTD A;  3GTL A;  3LAJ A;  2E2I A;  1EH1 A;  5IOQ A;  1WIH A;  2RGR A;  3L4K A;  1XXC A;  4C3H C;  3OPF A;  1TWF A;  5CHP A;  2R93 A;  3QX3 A;  3MML B;  4J3N A;  5CJ9 A;  4BLB A;  2KWA A;  2VUM A;  4BKW A;  1K83 A;  3CAG A;  4P5A A;  3FOF A;  3LPX A;  2YU9 A;  2CFA A;  1SFO A;  2XCQ A;  4C3I C;  1ZVU A;  4GTC A;  1DD5 A;  5TJ3 A;  1GE9 A;  1TWH A;  3AQP A;  2B63 A;  4LQY A;  4GTF A;  1BJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...