2CFCA

Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
MSRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Stereoselectivity in the (R)-and (S)-Hydroxypropylthioethanesulfonate Dehydrogenases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
total genus 94
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.268: 2-(R)-hydroxypropyl-CoM dehydrogenase.
pdb deposition date 2006-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cfcA00
3JQFA 1TA4A 3V1YA 1WZIA 1LQUA 3DHNA 1B3RA 2NVBA 3OJEA 5A05A 5KJ1A 3VKVA 3TSCA 1EBUA 1LNQA 1YXMA 2FSSA 1PQPA 4RPHA 4D46A 1KVRA 3G3EA 5EQFA 3GEGA 5CEEA 3WBBA 2E4AA 4BGIA 4CM9D 1DC6A 2Q1UA 1BWSA 2AG5A 5L40A 4IUYA 3I23A 4HNHA 1L1FA 2YW9A 1R4MB 4OQYA 4CLRB 4GVLA 1ISFA 1C0KA 3BTOA 1RM3A 2V6BA 1DB3A 2VZ9A 4IQ8A 1U2DA 3CZMA 4YJFB 3GNTA 5AQ1A 1P45A 4L8VA 2NLOA 1PS0A 3GEMA 4U8GA 1JA9A 2NVWA 2WTBA 4EUEA 4WECA 5I7VA 1OOEA 4YYZA 4ND1A 3F4LA 5BSEA 3WMXA 1CQIA 4FN4A 4WLNA 3AW9A 3BHMA 1E3JA 1ZH8A 3JQ9A 5JMPA 3SXPA 4BNXA 5TSDA 5I9MA 4ZJUA 1CEQA 1GZ6A 3WGIA 2VWPA 4TRJA 3H9GA 3WLFA 5ILGA 1N92A 2C7VA 3VKUA 1DIAA 4D3SA 2O2SA 3BHJA 4R3NA 1HZZA 2GZ3A 1HLDA 5DBFA 2EW2A 3KETA 1DC4A 3F1LA 3GDFA 6ADHA 1U28A 1EFLA 4WJZA 5TIIA 3ZNNA 4HFJA 2YDXA 2WSBA 2X5JO 2Q2WA 3EVNA 4RVGA 4BNZA 1U5CA 2HAEA 3DBRB 3KSUA 5C7IO 1V8BA 1BW9A 1QXSA 1PJ3A 2ZQYA 4F6LA 3K5PA 1U3WA 3ZNOA 4E5PA 2G82A 1LBEA 4TQGA 4ALJA 4HADA 8ADHA 2WEKA 1EUDA 3S8MA 5EMHA 2YDYA 4DBZA 2O23A 4W6ZA 4N18A 4KP7A 4IMRA 1VSUA 2NQTA 5L4NA 3ANMA 1EDOA 3GMSA 5F21A 1X7HA 4PIVA 4II2A 4BNIA 3QVXA 5DNAA 2CUKA 3RUDA 4FCCA 4R4JA 3SC4A 1MB4A 4CQMD 1GPJA 4HP8A 4JJFA 4S3MA 4IDDA 1C0PA 3I1JA 1A72A 4NU6A 2B0JA 5JBIA 1U5AA 3BMQB 4RVFA 3DZJA 3H2ZA 2D3TA 2BGMA 2I67A 3VH2A 1DRUA 4R41A 4KTVE 3COSA 3RUCA 2C7GA 1NASA 1SEPA 3S55A 3WSVA 4I1IA 3BTSA 3ZDFA 2HRZA 1NFRA 4PG4A 4Q3NA 5L7YA 5ES3A 2EERA 3ONEA 2X9GA 3E9NA 2E82A 4BKRA 1M66A 1U8XX 2JL1A 5TJHA 4R9SA 1LI4A 4DREA 3M6IA 2IZ0A 3I5MA 4XIJA 3WG9A 2EHDA 3H3FA 4LW8A 4BQPA 1OC4A 2ZJ1A 3AOEC 4R1NA 4RQUA 3FNEA 3OM9A 2VTDA 1HWYA 4OXYA 1ZXLA 2UUPA 4G2NA 3DQPA 1ZIDA 1OAAA 3PEFA 4E5YA 3NDRA 2I76A 2O7SA 4TWRA 1LLCA 1XYGA 3Q6IA 2ZTMA 1FF9A 3ROQA 3NTOA 5ICMA 1R4MA 3STHA 4AJIA 4CMBA 3GVCA 3PI7A 4WGGA 5JW6A 4CM7A 4ZGWA 1GYRA 1BTOA 3QVOA 4XZ3A 1M67A 1C0LA 1P1RA 1YOVA 3SLKA 4AJKA 1CRWG 1SMKA 2CSUA 1R0KA 1MLDA 1GDHA 1W73A 3VDQA 1XLTA 3FCOA 4YQZA 1GEEA 4NU5A 1OZAA 3RWBA 1Y9AA 2DTEA 4P8RA 5IF3A 5JDIA 5JCXA 1UAYA 1AUPA 1FK8A 3WGTA 4F3YA 1DC3A 1MA0A 4C7KA 3JQAA 5DN9A 3GOHA 4W7IA 4ND2A 4ZN6A 1I5RA 5F1OA 3DBHA 3MJCA 4LCJA 4CV0A 1XCBA 1B8UA 2EF1A 1VSVA 2X8LA 2GZ2A 3VH1A 4LVUA 1YBAA 4ZA2A 1U4SA 1DIBA 3GUYA 4ZQHA 3A1NA 3RUIA 4MIOA 5CDSA 3DOOA 4IJKA 5L45A 4QFDA 2QRKA 4K6FA 5L4SA 3INGA 3F3SA 1W8DA 3RASA 3TNLA 4DC0A 5A5EA 2YYYA 4C7JA 4BB5A 2HMVA 1K2WA 4RVDA 1RM4A 4A03A 3G79A 1LEHA 3ZI0A 4AJ2A 4DMLA 4E5NA 2NADA 2HJSA 4XB2A 1CWUA 3KVOA 2GZ1A 2BD0A 3GDOA 3KXDA 3U4CA 3QWFA 4B8WA 5THKA 5HBRA 3OEWA 2BMAA 5F5NA 4RF2A 3JQCA 2PTGA 3WGQA 1X1EA 1A4IA 3JD2A 1YQGA 4B4UA 1BVRA 3IMFA 2H5LA 3DTTA 3EVTA 4GQAA 5JAMA 1LSJA 1N1GA 3FRJA 4FFMA 3QE3A 3IIEA 2PK3A 1D7OA 3I6IA 3BAZA 3TQHA 4I8XA 3DZGA 4E2WA 5IDYA 2FPIA 3JQEA 4I9NA 4WKGA 5F3RA 4YRAA 1Z7EA 3Q1LA 3RBZA 1YQXA 2IE0A 4IDCA 2NQ8A 3HZZA 4FPXA 2AEMA 1ZFNA 3C8MA 1V6AA 3BYZA 3AI1A 5JDIC 1MC5A 3HFGA 4J7XA 4AJOA 4IJVA 3HE3A 4Y8VA 1JVSA 5HA5A 3ZWAA 1PL7A 1N7HA 2AG8A 2GN9A 1WPQA 3ZWBA 5L7WA 2RAFA 4K26A 1B2LA 3AUAA 3CIFA 1XHLA 3HADA 3WDSA 2O50A 3FR7A 3E5RA 3HUDA 4LMRA 4DQUA 4OO3A 4M86A 2HMSA 2YV2A 3BTUA 4U0JA 1N5DA 2D1YA 4CM8B 4ZQGA 4IM7A 5TC4A 4BKUA 2FPGA 1LDYA 1D3AA 1DLJA 4Z9XA 1ZMOA 2EP7A 2I65A 2VOEA 5T57A 4DL9A 1C1DA 4ID9A 2ZTUA 3GFGA 1HL3A 3IDSA 4XGIA 3DOJA 2GD1O 4PZDA 2J5RA 4BUCA 4B4OA 4DIOA 3JD3A 1NVTA 4FOOA 1IULA 1PJSA 1WDLA 3AM3A 4R5HA 3JQDA 3QVSA 1ARZA 2JJYA 3L9XA 4MOWA 1KEUA 1UXJA 5CDTA 4DWVA 3C7DB 3NUGA 3WYEA 4YDRA 1U3UA 4P4GA 2PGJA 3C7AA 3M1AA 3IJPA 3MJTA 3CEAA 1LC3A 2YFQA 2J8ZA 3NT5A 1XQ1A 4DYDA 2W2LD 1GUFA 1WW8A 3HB5X 3JCZA 4ITUA 5U4QA 1E1MA 1GTMA 3L4SO 1T2DA 2OUIA 2PY6A 5T64A 4GGOA 3WR5A 1EK5A 1PGQA 4P4NA 4G65A 2PD6A 3JQAD 4H15A 4YA6A 4E30A 4GPD1 4NPCA 2BI8A 4MP6A 3L77A 3AM5A 4RLHA 2ZJ0A 1DXYA 4MPDA 4U6QA 2Y99A 3NJ4A 4NBUA 4ALIA 3ZGYA 4F45A 4Z9FA 5G0WA 4AJHA 2B37A 4J1NA 4K6CA 3BXXA 1TT5A 2R6JA 4Q3DA 1Q0HA 2H6EA 2G76A 4HFMA 1FMCA 4TVBA 3DHEA 5G4KB 4CR7A 3M2TA 4XWYA 3RSHA 4BNNA 4M55A 3I9NA 4LCEA 4MKXA 2R00C 4W9NC 4BNUA 4UULA 4E5MA 5C5IA 1EEHA 1I3NA 5EIOA 3Q9UA 4NHEA 3D3WB 4D7AA 4W99A 4JJIA 4AJEA 5BNIA 3JYLA 1M2WA 1PSDA 4WLFA 1V9LA 1WZEA 2B69A 3X2EA 2X6TA 3WGOA 1PJQA 4CLOB 2VHYA 4NI5A 1ISMA 2X0NA 4RL6A 3TDKA 3I83A 2NTVA 3LSYA 3AU8A 3PYXA 4FJ0A 2VWHA 4CM3A 1N1EA 2VNSA 4A5OA 1N9GB 3D3EA 2EGGA 2Q2QA 2SCUA 2YZ7A 2WYWA 3FTPA 4OSOA 1LLUA 1U1IA 5GY7A 3K73O 4UUMA 3ZWPA 4BGEA 2JFFA 3RFTA 2VT3A 1I0ZA 3ZU5A 3MJSA 4BMVA 1IB6A 5C7LO 4CUZA 1P1IA 3OA0A 1PGOA 1SB9A 1ULSA 2YFHA 4UVDA 3WJ7A 4FB5A 2X0JA 3C7CB 4J4HA 3PLRA 3ST7A 2VCYA 1GV0A 1P74A 4J0EA 5BSGA 2C0CA 2VYVA 2ZCUA 2LDXA 2HUNA 4DPMA 5G0VA 1NNUA 3CZRA 4OKNA 2DTXA 4MVJP 4A27A 5EERA 1NVGA 4PLTA 1NQTA 2EWMA 2NNLD 2YJZA 4R3WA 5G0SA 3ADPA 3E9MA 1YOVB 3FBTA 4K28A 4ZVVA 1HZJA 1J4AA 2JFGA 2Y1EA 3RCBA 3NAQA 1T1SA 2QRJA 1FDSA 3JD0A 4JQCA 3S2EA 2C20A 1I3LA 5G2OA 1BDBA 4J9UE 4CLXA 2B4RO 2H1SA 1T2CA 1U4OA 1FDUA 1NHGA 1TT7A 2C2YA 1EE2A 1T1RA 3U62A 1DRVA 2DBZA 2EKPA 3FNGA 4KOAA 2QG4A 1O94A 3KTDA 2Q2VA 1MG5A 2AMFA 4BO7A 2GN4A 3GVXA 1HF3A 5FEUA 1XGKA 3LVFO 4CM1A 2AQHA 1H2BA 2NU9A 1N8KA 1NPTO 1RWBA 2ET6A 5KVSA 3I9MA 1ORRA 2RH8A 1ISJA 3WS7A 3R0IA 3KYBA 1LLQA 4FOSA 1K6IA 3H5NA 1I33A 3DBVO 2F1KA 3TL2A 4OYRA 1PJCA 4EUFA 3DWFA 3NKLA 2ZB8A 3O8QB 1PJTA 4QUKA 4EITA 5DBGA 5I9LA 2OBYA 1MFPA 4NFYA 2I6TA 2Z1MA 3V2HA 4GKVA 2PWZA 1RJWA 4JN6B 3DOCA 3F6YA 2JD1A 3HB4X 3OEYA 4NIMA 3FNHA 4CV3A 4TZKA 1RPNA 1O89A 2ZQZA 2Q50A 4XQGA 3HJAA 3GLQA 4OOFA 3INTA 5HM8A 1B14A 4O6VA 3VZPA 1CETA 1BVUA 1PIWA 3L6OO 2Y05A 1F0YA 4RO0A 1R16A 1ZJZA 2VWGA 3IUPA 5ER9A 3UCFA 4YJGA 1DSSG 2WD8A 4PVCA 1DC5A 4JBGA 3E6AA 3ZZNA 2C82A 5JNLA 3PJEA 3D0OA 4HY3A 3H8VA 1ZEMA 5ITWA 1YBVA 4Q39A 1NQ5A 4PGFA 4ZQBA 3TZCA 3A06A 4OHUA 2FZEA 3E48A 1CDOA 3GZNB 3QSGA 1TLTA 2X9NA 2VYND 4OMUA 1V0JA 1Z6ZA 4LK3A 3TZKA 5IXYA 4HNGA 2I66A 4JCOA 5B12A 4Y67A 1T4BA 1X13A 2Q1WA 3DAFA 5JLAA 3VVCA 4UVGA 4CMIB 5B4TA 4OOEA 1PWXA 4UUNA 3EAGA 3AOEA 4R68A 2VNAA 1CYDA 5KKCA 5IN5A 2AEFA 2Y66A 4HXYA 2FHSA 1LSSA 4XYMA 4BB6A 4BO2A 1YJQA 4KMSA 1HSZA 2NV6A 4G81A 2A94A 2VTEA 3NEPX 4N5LA 3UW3A 2PZKA 3MWEB 5J23A 2VRCD 4J4TA 2HDHA 1PJ4A 1VM6A 3GG9A 2YQ4A 3BMCB 1GADO 4FQ8A 3ONFA 1HRDA 3R3JA 3DONA 5JFOA 4ROSA 5DOZA 2IODA 1GZ4A 2I5PO 1KEVA 3T7CA 3OF2A 3VDRA 2CF6A 4DLAA 1E6WA 4MVJG 3PGXA 1O95A 3CMCO 4EEXA 4ND4A 4RPGA 3O4RA 1EUCA 1H6CA 4PRLA 3JYQA 2PZJA 5FI5A 3N7UA 4Y6RA 3I9KA 3F5QA 1H9AA 2GLXA 4UREA 3AFMA 3PYMA 2P9GA 3JD4A 3E03A 2Y1CA 4GH5A 4AVYA 2OHXA 2TMDA 2WD7B 4CV2A 5HS4A 3I9OA 2JKVA 4KZPA 3H9UA 1B16A 4EW6A 4GAEA 3ZV3A 2EG9A 1VJTA 4TSKA 3AFNA 3T7EA 4DLLA 5IXSA 4R9RA 3D7LA 5HWSA 1LXCA 2G0TA 1PU2A 1QV6A 3QV1A 3ZHZA 4E2YA 2FN7A 2NSDA 2OL4A 2TMGA 3PP8A 5DBIA 4MVJH 3SVTA 1AHHA 1XWFA 1VKOA 2BKAA 3OQ1A 4R69A 3W8DA 1VPDA 5A1TA 5BNTA 1SBYA 2B5WA 3H2SA 2X5KO 4XA8A 3ORFA 3R1IA 1Q1NA 4DRYA 3DFZA 3S1LA 1I2ZA 3ZHBA 1XQ6A 1YDEA 1OI7A 2EIHA 3AJRA 3WGZA 1CIVA 1YWGO 1DBVO 4RJTA 4XQEA 5JDCC 1HT0A 4EZBA 3K6JA 2E6UX 3DFUA 3FD8A 1E6UA 2YY7A 1H93A 4U0KA 2PZLA 2CFCA 3AI3A 5KJEA 3ETEA 3KRTA 3SBOA 1MFZA 1NX6A 1E1NA 2GPTA 3GC6A 2JAHA 4PG6A 1S7CA 4YAJA 5H81A 4CMGA 2D5AA 1HDGO 1QRRA 2POQX 3OFSA 4RF5A 4R1SA 3H65A 3FBGA 2I99A 4CUKA 2NACA 1X7GA 5B1YA 3HSKA 3DEYX 3PPIA 1OC2A 4I5DA 3MJVA 4JNKA 2C07A 4OKIA 2X58A 2CVOA 3GVHA 3ZWYA 4YEDA 1AE1A 5LC1A 2VHZA 3RD5A 4AJJA 5DDIP 4AFNA 1PZGA 1U7TA 1MGOA 4IBOA 4WK6A 4ALLA 5JY6A 2YUTA 4IY1A 2Y1GA 3HN2A 3F47A 3FNFA 1BDMA 1DEHA 2VZ8A 4YACA 1VL6A 5ADHA 3FN4A 3PQFA 1EQUA 1FXSA 3JQ7B 5FI3A 4CQLB 4GSLA 1LDBA 1YB5A 5ENDA 3ABIA 3RI3A 4AJNA 4YR9A 1ML3A 3EUWA 4D3DA 4CPDA 3OIDA 1U9JA 3TZHA 1Z82A 2Y1OA 1IUKA 4FBGA 4FR5A 5KJCA 1M76A 2DKNA 3ANNA 1ZKMA 1NP3A 1H5QA 3FWNA 3JQBC 1YJ8A 3JQ6A 4R54A 1HDYA 2GUGA 3MTGA 4I5GA 2RHCA 2CDCA 2Z5LA 1G0NA 4JGBA 3N58A 3IP3A 3PJGA 4IDBA 3PQDA 2Q1TA 4J91A 1J6UA 4CMCA 3RUEA 1KIFA 1JW9B 2O3JA 3L6DA 1MV8A 3GA0A 3PQEA 4WNIA 1K6XA 5GZ3A 2VQ3A 3EHEA 4ZRNA 3GMDA 4IQGA 3BMNB 3Q3CA 3I3OA 5EQDA 2FPPA 3N74A 1HDCA 5JS6A 2O3TA 4URFA 3RROA 3GPIA 3OJ0A 1D4FA 3GUCA 4JP3A 5A06A 4DA9A 2DPGA 2HU2A 5TF4A 2G5CA 2GF2A 3EYWA 3P5SA 4ND3A 5EN4A 3WMWA 4M49A 4FJ2A 1DO8A 4YT4A 1I24A 1TEHA 1SNYA 1E7RA 4XIYA 3B6ZA 4DVJA 3R6DA 4YJFA 3GNSA 1V3TA 1J0XO 2CDBA 4P38A 4ALNA 3ANLA 3B70A 3FWZA 2CD9A 4BQRA 3ZW9A 2VUSA 2PGDA 4FW8A 4CODB 2Y0CA 1JDJA 1LRJA 5IFLA 2X86A 3NDJA 5JO0A 2VRBA 4FFOA 3DAGA 1DAPA 3QQPA 4IIVA 3BMCA 3JYNA 5C3MA 2JCVA 3TF5A 5T8KA 5MDHA 1Y8RA 4XRGA 4J1TA 4CMEA 4DXHA 1D8AA 4MO2A 2EEZA 2GR9A 3B1FA 1ENOA 2DFDA 2X7HA 4I9HA 3MOIA 1YL5A 4IDFA 4QQRA 3PDJA 4F46A 2HMTA 4YT2A 3G17A 4B4WA 4EJMA 3WGGA 2HMWA 4GX5A 1UDAA 2Y0DA 4B3HA 1H94A 4YAEA 3WGYA 3QIVA 2HK7A 3CINA 4M54A 4E4YA 3MTJA 3UKOA 3QWIA 1EVYA 1N9GA 2BELA 5HTOA 4E13A 2CF5A 3PFWO 3WNQA 1Z75A 1EVIA 4WOJA 3RQSA 1DFGA 1K3TA 4UUOA 3TZQA 3TZ6A 4J2HA 1JQBA 3QWAA 3VTFA 3A9WA 1ADGA 3IQDB 1B8VA 1YO6A 1ZUD1 3GHHA 2OBNA 3LYLA 5COBA 4E0BA 4B79A 3OMLA 5K6AA 1PX0A 3INRA 1Z7BA 5CDUA 5I9NA 2X0IA 4YJHA 3GY0A 3OECA 1XG5A 3PGJA 4OL9A 2R2GA 5CAEA 1EVZA 1R37A 3FTNA 1JVBA 4XB1A 1Y1PA 1QYDA 1E5QA 2WMDA 3AU9A 3OJLA 2BFMA 4RCVA 3ZCXA 2FWMX 3PTZA 5FWNA 1TB4A 4RF4A 4CMHA 3KM0A 4YRBA 4NBWA 3LU1A 2HRBA 3GN2A 2FMUA 1PL8A 3U4DA 4DIBA 2J5KA 2LDBA 2OOSA 4E33A 1LRKA 4PLZA 3L6EA 1EZ4A 2CMDA 2HO5A 3ZW8A 2AHRA 4J3FA 4D0SA 8LDHA 1I01A 1FDWA 1HE5A 1HDRA 5JCJA 2NVUB 2D8AA 3S2IA 1X0XA 4JIGA 5AXAA 3DC2A 3RBXA 5JAQA 3U5TA 3BA1A 4CM4A 2DQ4A 3H7AA 3ICPA 4DYVA 2GSDA 4GLLA 4AJLA 2J6IA 1SO8A 4JK3A 4DTIA 4PG5A 2P9EA 3DXFA 1AGNA 4UEKA 1VL8A 2OMEA 1C1XB 1IYZA 3WB9A 4N54A 2P4QA 2CVZA 4MINA 3ZWXA 4Y6PA 2WYVA 3UGKA 2W90A 2E48A 1U3TA 4KQWA 1AHIA 4WLOA 1SCUA 5A9RA 3UAGA 3AUUA 1E7QA 1LTHR 3K2BA 4NDNE 4BNWA 4JBHA 5DZSA 1KYQA 2PD4A 4J7UA 3ZU4A 4ALMA 1DHRA 1Y8QB 2IRWA 1PJLA 3PHGA 1DJQA 4B7XA 1KVQA 2VUTA 1ZEJA 1ISHA 3RVDA 5A02A 2VT2A 3JQAB 3I4CA 1CQJA 4TKLA 4Z0PA 4P4LA 2FR1A 2GCGA 1ZVMA 3DZHA 4CUJA 1RYDA 3OICA 2XAAA 4H3VA 1FDVA 4EJ0A 3IOYA 2J3HA 2JD0A 1OFGA 4L0QA 4L75A 1BRMA 1E92A 3O03A 4D0RA 3KZVA 1I3KA 5TS3A 1E1KA 4MVJI 1LDMA 1KS9A 2V6MA 4FS3A 5CPFA 5F1KA 3ZV6A 1HXHA 7MDHA 3HDJA 1ZMTA 1T24A 5AXCA 3GG2A 3RJ5A 3UCXA 3WFIA 1NWCA 2D2IA 5F5LA 2Q45A 4AG3A 4CMEC 2UV8A 2O3RA 5TLSA 3F9IA 4JROA 1C1XA 4OJNA 1EMDA 3L4BC 3OETA 4XKJA 3WWYA 4A2CA 2FRDA 3GVIA 1KEPA 4WEQA 3QP9A 4GX1A 3VOSA 3CKYA 2I3GA 2B83A 3BMQA 4MVJE 2P91A 2E37A 3E1KA 4OH1A 2IEDA 3PWZA 2AQIA 1SZJG 4L4RA 1GUZA 2E49A 2VUUA 3OIGA 2UYYA 5JAIA 1XELA 1MUUA 4J49A 4CLOA 5F1PA 1Q0LA 1QLHA 1BW9B 1W4ZA 1IZ0A 9LDTA 1NTOA 4NK5A 1E7SA 5BNFA 3QJ5A 1YDWA 1E6EA 1KC3A 1NM5A 4HKTA 3JQGA 1PR9A 3DBLB 5TT0A 2EGHA 1D1SA 5IG2A 4YAGA 2GGSA 3EZLA 4QXMA 5CP8A 3PIDA 2V65A 4DBVO 3ZWOA 1UP6A 3OBBA 1JKIA 3QY9A 2DLDA 4INAA 2X0RA 3ZNQA 2QHXA 5TQVA 3ADOA 1H9BA 4LVCA 1LX6A 1JWBB 1KERA 2JAPA 4KWIA 5DP1A 1X15A 2ZYAA 3QWBA 1U2GA 3JYOA 4OIMA 2O3UA 4BKPA 5T6BA 4PLWA 2P5YA 2Y93A 2G1UA 4WASA 2BFPA 3P2OA 4MKZA 2AW5A 1H0KA 3VZSA 3AM4A 3OIFA 3TWOA 2BGKA 2DBQA 2VHXA 3KB6A 3ZHXA 4BNFA 3HWRA 4JXKA 4BNMA 4A10A 1B3BA 5AXDA 1EVJA 3RC9A 4AICA 3Q0EA 2Y68A 5JCJD 4KUHA 3F1KA 4Z3KA 1WDKA 4TVOA 3GVPA 1GQQA 2HQ1A 4E12A 3DAPA 3FR8A 1FDTA 3WJAA 1R0SA 1Y8RB 1S6YA 2EJWA 3G0OA 2O4CA 1HETA 1Q7BA 1E3WB 1VKNA 4M87A 1ZSVA 1IPEA 1WDMA 1LDNA 2ZYDA 2X1HA 5KIAA 4W82A 3A14A 4CLDA 3H5AA 4E21A 1KEWA 1TXGA 3KLMX 3RKRA 5G0TA 3LLVA 1AXEA 3L9WA 3ULKA 4CM5A 4YJDA 1OBFO 4B7UA 4PCVA 1NQOA 1LJ8A 3CXRA 3WTBA 2W2KA 2IYOA 4QO7A 3AUSA 3ASUA 5TX7A 4CMKA 3P19A 4EEZA 3WFJA 3DZFA 2AQKA 4TRNA 1XU9A 1I8TA 4FFPA 3WQRA 3K31A 4D42A 2B36A 4C4OA 2PGLA 1C14A 4NZ9A 3VAZA 5A9SB 4JP2A 4IPTA 4RPLA 3ZHYA 3GT0A 4DMMA 5A03A 1EQ2A 1ZK4A 1YL7A 1GAEO 3FF4A 3V1TC 1UXIA 3LC1O 1VJ0A 2IDZA 1DLIA 3KYCA 3KLPX 4IGFA 4XGKA 5IDQA 4PRKA 5L53A 4GSKA 4ESOA 1UP7A 3DMTC 1PEDA 1ZSYA 4E2ZA 3OJFA 1PZEA 1B26A 1GCUA 3K30A 4RQTA 4K9DA 1O6ZA 1VC2A 5JY1A 1VL0A 1E3LA 2WJPA 4RVHA 3CUKA 3DR3A 1F12A 4TRRA 5AVOA 1A27A 2A92A 3A28A 4PLCA 4H16A 4GKBA 5JYEA 1YE3A 2VZ0A 1EUZA 5EESA 3D5QA 2V6GA 4GX2A 3ROPA 3JV7A 4K1LA 1NR7A 3W6UA 5CEFA 1Y6JA 3CPSA 1UZLA 1NFQA 4XCVA 3AY7A 3BHIA 2GERA 2J3JA 5JC8A 5L7TA 1UR5A 3O26A 3MOGA 4CMAA 1DOHA 4PG7A 1A7KA 1QR6A 4PLVA 5K0ZA 5IZCA 1IPFA 4GMFA 1P1KA 5KTKA 1HE4A 1LDGA 1DIRA 1WNTA 4PG8A 4LN1A 5IDXA 2GNAA 3DBLA 3AWDA 2W98A 4DLBA 2RCYA 4BL5A 4J6FA 2DPHA 2RBEA 3H6KA 5H82A 1XKQA 4X54A 5HRUA 5A9TA 1GYQA 4J1SA 1ZK2A 3RAJA 1ZCJA 3NT4A 3ITKA 3OSUA 4QFCA 1ONPA 1X14A 5C7OO 3U49A 5DULA 1I2CA 3T4XA 3C1TA 3GEDA 2NTJA 2IZZA 4CL3A 4PLGA 1G1AA 3SJ7A 1UAGA 1DAOA 4IZHA 1PWZA 1XDWA 1C3VA 3M1LA 4RPJA 4BGVA 4XR9A 1LC0A 5DCWA 5ILOA 1XR3A 1Q7CA 1LU9A 4E5KA 1P33A 3LT4A 4R1TA 2IZ1A 4LSWA 1T2FA 4E3ZA 3OJOA 1K89A 4KUEA 2A9FA 3PYLA 3LLSA 4L4XA 4E2XA 5TGDA 4HWKA 3DZBA 5DT9A 1QSGA 3KO8A 3LT0A 1AN9A 1E7MA 2EXXA 2ZCVA 4MJLA 5BT9A 4KDFA 1ID1A 5COQA 4WEOA 3UN1A 2BH9A 5LCXA 4U7WA 1YGYA 4FDAA 4UVEA 1N2SA 4AJ4A 3JQBA 4Z9YA 2I9PA 1P1HA 1GY8A 5L9AA 4D45A 3GN1A 5IJZA 3OH8A 3CSDA 4P22A 4BNLA 4ALKA 4DUPA 3IP1A 1DFHA 2GASA 3HN7A 5CFZA 4FIZA 4WCFA 4RF3A 1L7DA 4NJOA 3BMNA 4R01A 4PLHA 4CL8A 3WIDA 3IL2A 4Q3CA 4RVUA 1HDZA 3KBOA 4XQ9A 5JO9A 4CLRA 2A4KA 2X4GA 4A73A 4NJMA 4XRRA 3Q2IA 2XOXA 5ITVA 4AJ1A 9LDBA 4Z6KA 2YV1A 3OP4A 3Q9NA 2XXJA 2PKQP 3I9LA 3E8XA 4UAGA 3QVWA 3DHYA 2QIOA 1DHTA 3GFBA 1UP4A 4LISA 3VVBA 3RFVA 4FC6A 2AXQA 2WE7A 1SOWA 3K96A 4EUHA 2DU8A 1D1TA 1WLYA 1QG6A 2HK9A 2QZ9A 4JLWA 4RORA 4BNHA 1C0IA 2PKQO 4Y9DA 1MG0A 4D44A 2HK8A 3NGXA 1W0CA 4J43A 1O8CA 1IE3A 4B8ZA 1K6JA 4L4SA 2J5QA 4BNTA 3W8FA 1BXGB 3W4IA 3I52A 5A4DA 3DB2A 4RV9A 4CM8A 3T4EA 4EYEA 4MVJM 3RIHA 4XYLA 1ADBA 2IEBA 1LDEA 3MJEA 3UICA 2NTNA 1KVTA 3ZWNA 4CR8A 3OA2A 4GGPA 4AJPA 1XIVA 4M89A 4CLEA 3DTYA 2X23A 3B1JA 3DL2A 1ULUA 3DMTA 4BKOA 1M75A 1EDZA 4NFSA 3ZU2A 3JTMA 4CM4B 3H9QA 2I3AA 3E18A 1G0OA 2ZB7A 1O0SA 3GR6A 5DCYA 3VPSA 3EGOA 4NR0A 5THQA 5KVCA 1HYGA 1P0CA 3WBFA 1A9ZA 1P1JA 2IXAA 4Y98A 4CLHA 2P5UA 3IKTA 2FZWA 4TROA 1X0VA 3LF1A 4KQXA 3AK4A 2PKRA 3W4JA 1NAIA 3GAFA 3TOXA 2PR2A 1SPXA 1YRLA 2DFVA 4S1VA 3ROMA 3UOGA 3TRIA 1YQDA 5LDGA 2WM3A 4Z3DA 1EFKA 2O48X 2ZYGA 2ZATA 2EJVA 1UDCA 4FFRA 3PVZA 3DBHB 3UH1A 2Y67A 2WDZA 3BMOB 4BMNA 1TVEA 3GGPA 3EMKA 4JX8A 1I3MA 1QV7A 1EE9A 1ENPA 2D5CA 1JAXA 2QW8A 3V2UA 1HYHA 1UXGA 1I32A 1G6KA 5KKAA 5BSHA 3D4PA 4RZIA 4F6CA 3GPDG 1KY5A 1T2AA 1NFFA 3U4IA 3PHJA 2O2YA 4J0FA 3BTVA 2IYPA 1VRWA 2Q1SA 2P2SA 5DOVA 3AY6A 1QORA 1O9BA 2AQ8A 5MGBA 3ZWCA 4WOKA 2EP5A 2BFOA 4YQYA 1PL6A 3WQQA 3X2FA 5K9ZA 1I30A 4RGBA 2CVQA 2P9CA 2NUAA 1VJ1A 2Y1DA 3WWZA 2ZB4A 2EKLA 4UUPA 1BXKA 1JAYA 2DUWA 3U3XA 5L95A 4N5MA 5AXBA 1E7YA 5B4VA 3GHYA 5I7EA 4IDEA 4ZRMA 1BXZA 3UUWA 4WNCA 4NJMB 3VPHA 3JSAA 3KOUA 4I9UA 4IMPA 1PS9A 4QECA 3D64A 5AYVA 1R0LA 1XA0A 1XEAA 1Y5RA 3EY4A 2NU7A 4GWKA 2W2LA 4YJGB 5KOIA 4GLOA 3B1KA 3EW7A 3U0BA 1NAHA 3QWHA 2NVUA 4LRSB 2FSVA 1R15A 4J16A 3VTZA 4CMJA 3MJ4A 3P2YA 2BFAA 2PV7A 4R1UA 1MX3A 3VH4A 4BNKA 4A0SA 1ZK0A 1HTBA 3UF0A 5KJFA 1WVGA 4FC7A 3PLNA 2ILTA 1UH5A 4BV9A 3RBVA 4L73A 1NQAO 5GMOA 1LSUA 1W6UA 3AY3A 1MP0A 3LDHA 3JQ7A 4BNVA 2AEJA 4CQLA 4YAKA 4YPOA 1RM5A 3LQFA 1M6HA 4DC1A 1GYPA 3JQGB 3P7MA 4IXWA 5ICSA 1WMAA 1YBMA 2WE8A 1JN0A 1P0FA 2OXIA 3VPGA 4CQMA 2Q99A 1QYVA 3DBRA 1HDOA 4R16A 2GRAA 2IXBA 4YBZA 1HSOA 2JHGA 3HNPA 3KEOA 5COAA 4KUGA 3RKUA 1EK6A 3WLEA 5TNXA 1ZZEA 3NTRA 1JU9A 3PJDA 1ZSNA 3TN7A 2VHWA 1E3SA 1QYCA 4HBGA 3KYDA 5T8KC 5G4LA 4NMHA 3PRJA 4RPKA 2BRUA 1CF2O 3C1OA 1FJHA 1R6DA 4D43A 4QEDA 1ZBQA 2RHRA 3KYDB 4ILKA 4WLEA 3WQSB 3VHRA 4WCFC 3D5TA 4A26A 3E5MA 3UCEA 2QYTA 3D3WA 3KV3O 1KVSA 3D1LA 4NBTA 3ZV5A 3V1UA 1UDBA 1GEGA 3HG7A 2J3IA 5U9CA 3RUAA 4OXKA 1R12A 4BNJA 5EINA 3H9JA 4LMPA 5L3ZA 4XJSA 4BGUA 1IZ9A 4O63O 4IGEA 1WWKA 2EW8A 5IZ4A 2AE2A 4O59O 3WNVA 2OGUA 3H9EO 5JMWA 3R3SA 3TFQA 4UVIA 5JXWA 3NYWA 4XYBA 2VN8A 4BS9A 1Q2XA 1IHYA 4ZD6A 1YKFA 1IHXA 4OSPA 4U6SA 2NWQA 3FPLA 4WUVA 3V5NA 5KJ6A 1B7GO 1HE2A 4XDZA 2OO5A 3RC1A 3D4NA 2NM0A 1F06A 4B4VA 1ENZA 1BMDA 5JE8A 1PQUA 4J9VA 3PZRA 4XR4A 2QYSA 5A3VA 2EKQA 5CDYA 2B35A 4QTZA 3PIIA 4UVHA 2UUOA 4M8SA 3CH6A 1ONOA 3UVEA 3GNQA 1JLLA 1Q7GA 4ZQEA 5KVQA 4D41A 3WTCA 3VH3A 3M2PA 1F8FA 4YWJA 2Q46A 4YVFA 2HKIA 3U4HA 5G4KA 3PK0A 1A71A 1P44A 4YRDA 3HFSA 1GUYA 3IC5A 5L4LA 2CZCA 2WD7A 1WP4A 2FP4A 2NU8A 4IJUA 4JJGA 4B7CA 4WLUA 3C24A 3EK2A 1Y8QA 2R00A 4PFJA 4FJ1A 4ZU3A 1H2HA 1NVMB 2CY0A 4M1QA 3ETGA 3AI2A 1SEVA 3TL3A 5GZ1A 3ZWVA 2D0IA 4W4TA 3ONDA 4QO8A 3DZKA 4PZCA 2GN8A 4E31A 2GDZA 4NBRA 3GF4A 1I2BA 3PJFA 1E7WA 3WICA 2ZK7A 4XYEA 1KBZA 4DIFA 1E1LA 3EDMA 5B37A 1PGJA 4NNJA 2C5EA 4BNGA 5CDGA 3HDHA 5KCZA 1PR3A 4BHTA 5KVVA 5ENVA 3SX2A 1E3EA 1K5HA 4GX0A 2FR0A 3W6ZA 4J1QA 4PLFA 1GQ2A 1BHSA 4AL4A 4LGVA 2C59A 6LDHA 1JKFA 5AOVA 2Q3EA 3K92A 2ZIZA 5ER6A 1GQYA 4BO6A 4MP3A 3VPXA 5JSFA 2XF8A 1MC4A 4IDAA 3TJRA 1QP8A 2QRLA 4IIUA 4NQZA 4CMIA 4FFNA 4PLYA 4YT5A 2JCYA 4PN3A 3RC7A 1NR1A 1ADCA 1GR0A 1VLLA 2J3KA 3BZUA 3FI9A 1A4UA 1GD1O 1Z73A 1HLPA 3I9JA 4OGWA 5C37A 1UXHA 2HSDA 2Y0EA 3CMMA 3K9QO 1R4NB 4ND5A 2DAPA 1GL3A 1N7GA 2PFGA 3F46A 4YJHB 3KUXA 1DJNA 4RDIA 3EC7A 4G5HA 4CR6A 5A3JA 1ZW1A 5I7FA 3I4FA 4XJTA 3ENNA 4XD2A 3F5SA 4UEOA 1H6DA 1E5LA 3GZNA 4BIIA 2PNFA 3LK7A 3ROKA 1BXGA 1JKJA 2V7PA 3GRPA 1X1TA 1HYEA 2WWRA 4MIEA 1LSOA 3PHHA 3ITDA 2EV9A 1YB1A 2H63A 2O4UX 2PA3A 3A4VA 5EPOA 1Y5MA 2X22A 5I8ZA 3ZV4A 1DPGA 1YONA 3G49A 1TT5B 4O5OA 3GAZA 3RFXA 3ZWWA 2P68A 2JHFA 4TRMA 1IL0A 3RUFA 3RU7A 1MXHA 3H4VA 4LSMA 3QW2A 1J5PA 2GO1A 4IINA 2D4AA 3GK3A 1AXGA 1QMGA 3GRKA 2Y1FA 2C2XA 4PVDA 4XYGA 2HJRA 4MVJD 2YHIB 4EI2A 2P4HX 4GI2A 2GN6A 2JCXA 2UVDA 3K2EA 2XPCA 4ZQFA 4RLSA 4FD3A 1I36A 2BHLA 1WXDA 3VC7A 1C1DB 1UZNA 3DMYA 2PD3A 3NJ8A 3NV9A 1RKXA 2RIRA 4R51A 1LUAA 3GGOA 3WXBA 4DQXA 1Z74A 3OHSX 1OMOA 3RC2A 2OP0A 5JC1A 1U3VA 1DDOA 1P1FA 2VYVD 5CHEA 5T5QA 1ZK3A 1JTVA 3V8BA 1P9LA 2XXBA 3I6QA 3DDNA 4JBIA 3ZU3A 4W7HA 2V6FA 3PHIA 1M6WA 2JFHA 2ZTLA 3UFXA 1YB4A 3DZIA 1GV1A 5IDWA 3HHPA 2OORA 3JQ9C 2DT5A 3ICCA 2W2KB 3ZH2A 4PZEA 1A9YA 4XX0A 4IS2A 4IDGA 2DM6A 3AUTA 3S2GA 4TKMA 2ZTVA 4DQVA 3SJUA 1Y9EA 2DBVO 3HDQA 4J7CA 4B3JA 3W1VA 3NT2A 5JAZA 4HFNA 4N7RA 2A35A 3PWSA 3ENKA 1R4NA 2AE1A 1Q0QA 1ADFA 1BG6A 1XU7A 3IKVA 1KVUA 2QQ5A 1IOLA 4ZHSA 3V2GA 1ZK1A 3NTQA 3SEFA 5DF1A 4ZICA 3QA9A 3LF2A 1U7HA 1Y81A 4GWGA 4O1MA 5H83A 2O7QA 5JDCA 4BV8A 1GZ3A 2FR8A 4FFLA 4GL4A 3S2FA 3JQ8A 1BSVA 5IZCC 2VRCA 5KNLA 3WOHA 3ZNPA 5JPIA 1QYWA 1E77A 3GQVA 2BGLA 2YQ5A 1A5ZA 3W8EA 2DUUA 1NPDA 2HLPA 1EBFA 4HX5A 3LT1A 1SC6A 1GCOA 4IS3A 4O0LA 2PH5A 5HS6A 3L07A 1VI2A 4H7PA 3VPFA 3TFOA 4TMFA 5CEJA 1NHWA 2YHIA 2W8ZA 4L76A 4Q9NA 1GU7A 4II3A 4YAIA 2B5VA 5TJ9A 1SB8A 3CTMA 1PJBA 1R66A 5IAAA 3FHLA 4E32A 2Z95A 5CPBA 3TPCA 3DO5A 4YTEA 1KETA 1K0UA 1PZFA 3PDUA 1HKUA 3QLJA 2PZMA 2BLLA 1E3WA 2O3SA 3WX0A 5FF9A 3GH3A 4I08A 2X5OA 4RVSA 5I7SA 3H3JA 3WGHA 3ON5A 2DTDA 2PLAA 3IS3A 4ONEA 4QSMA 2HCTA 4Q3EA 1PGNA 3OQBA 5A5FA 3O9ZA 2YHUA 2OFPA 2B4QA 3PWKA 3L0DA 2CDAA 4N5NA 2O3QA 2VYNA 2ZB3A 4A7PA 1F14A 4DGSA 3JQ8B 5FYDA 2DVMA 1NYTA 1PJ2A 1MXFA 2B4TO 4J2OA 1U8FO 5DCUA 1QYXA 3GZ4A 3E82A 4CJXA 4I5EA 4XGNA 4BO3A 4Y6SA 4RDHA 1XSEA 3BIOA 1ZJYA 4FGWA 2HMUA 1A7AA 1QLJA 4EBFA 3D4OA 2F00A 3ZWMA 1UJMA 4DPLA 1ZXBA 4CQMB 1V3UA 4GVXA 3SC6A 4EDFA 1J49A 1RM0A 2WYUA 2VHVA 2X9VA 3E9QA 2DC1A 4NH4A 3WYBA 1IY8A 2D59A 4BOYA 2FY8A 3NDIA 3UXYA 1B0AA 2G17A 5A9SA 4I5FA 1B15A 4IXTA 2Z1NA 5CG2A 4DPKA 1QKIA 5GZ6A 1Z45A 2PH3A 4Q3BA 1L7EA 3F4BA 3PFFA 1HDXA 3NRCA 3KYCB 4FGSA 4BO9A 1YH3A 4YXFA 3C3XA 1ISIA 4FSHA 2OZPA 3KHUA 3C85A 1CERA 1T26A 4IQ0A 3UHAA 5LDHA 4MP8A 1ZNQO 1SOVA 3K8ZA 4CV1A 2C29D 3QVTA 4BNYA 4OQZA 4XDYA 4GBJA 4CM9A 1DIHA 2BI7A 5L51A 3U9LA 5FFFA 1NPYA 1JWAB 4B3IA 7ADHA 1PQWA 4BO1A 1SAYA 4BO4A 3B20A 4WCFB 2QX7A 1O5IA 4KTTE 3G1UA 1YVEI 3C1AA 4RZHA 1T2EA 5K6AC 5G0UA 1V35A 4W9NA 4HV4A 5BR7A 2C5AA 4D79A 3WIEA 4Z0HO 2OP1A 2Q49A 1P77A 4HUJA 5B4UA 1ONNA 3VZRA 4NFHA 3MCVA 2UDPA 3MWDB 3MZ0A 1ISGA 3OQ6A 4NK4A 4WE3A 5U1PA 3AOGA 1F8GA 4L74A 4U5QA 3QHAA 3MEQA 4EJ6A 1E0DA 3FSRA 4WCDA 4BKQA 5EJ2A 5A04A 3GDGA 4UEJA 3Q2KA 1VE9A 3BMOA 3HDYA 3W4KA 3NX4A 4Z0TA 1GFSA 4D3FA 3U09A 1YS4A 2YV3A 4BO5A 5CG1A 1PTJA 1LLDA 1ZO8A 2NU6A 5EL0A 1V3VA 4MVJA 1HEUA 3PXXA 5DP2A 3CE6A 2AA3A 3EZYA 3HQ4O 4IZIA 1KOLA 3KSZO 4MKRA 4XEHA 4HFRA 5I8WA 3JYPA 4YT8A 4BO0A 1P31A 2C54A 5IN4A 1LRLA 2FOIA 3GGGA 3KSDO 4NG5A 4TZTA 1PS8A 4YB8A 4BVAA 3LZ6A 1X7DA 2VWQA 3L4BA 4KDEA 2GYYA 3QRWA 4QX6A 1BGVA 3WYCA 1CJCA 1P3DA 3NGLA 3PHLA 4R5MA 3RU9A 1H6AA 4E6PA 1DRWA 4J4BA 2DBRA 4MDHA 1YL6A 4YCAA 4WPGA 1RYEA 5BSFA 4BMSA 3JD1A 1GPDG 4MVJF 3Q11A 2RH4A 5JYDA 3JQFC 3IJRA 1T4DA 3KEQA 1E3IA 1KC1A 1PZHA 3TOZA 4PLPA 3RJ9A 1ENYA 5TRTA 2VOJA 4Q3AA 1PGPA 2Q4EA 4XQCA 1UUFA 2UAGA 3ASVA 4BO8A 1NBOA 1LA2A 1UXKA 1Y7TA 3PZBA 3ETDA 3LC7O 2Q4BA 4IJWA 1HE3A 4J90A 3O38A 1DIGA 3G1TA 2H9IA 3IAHA 3WSWA 3LT2A 2BF7A 3LC2O 4LRTB 1T25A 2W4QA 1F17A 3VZQA 4QT0A 5KWEA 4KWHA 1WMBA 4OAQA 2ZKLA 3RUHA 3H5RA 3IUSA 1I10A 5BQFA 3ZN2A 1DFIA 5T67A 1LQTA 3SLGA 3O8QA 4CM6A 4WLVA 1KY4A 1TI7A 4GMGA 4OM8A 1UZMA 3FPCA 5TT1A 4EGFA 1B8PA 1NXQA 1NWHA 4L9RA 4OXNA 4NBVA 2JD2A 2CNBA 1WAMA 1H6BA 2QZZA 4MIYA
chains in the Genus database with same CATH superfamily
3OWXA 3ANTA 3CNLA 3RIYA 1LQUA 1NBWB 1B3RA 4NONA 4CTOA 4JC5A 3W9UA 5KNDD 2XMSA 3TSCA 3D59A 3GPLA 1LNQA 2FSSA 4GOLD 5BVGA 1PQPA 4I4TB 3ISTA 1KVRA 3RABA 3RS4A 3TLZA 5DHQA 5H5JA 1J20A 4B9AA 1PDOA 3GEGA 2X0EA 1U6IA 3R7SA 5KOHB 3OESA 1Z2AA 2HA5A 4NYMQ 1LKZA 5IVPA 2QT0A 3FMPB 4Q21A 2D1QA 3DEIA 3BB1A 3TNYA 3ZXIA 1DC6A 2CLIB 3FPBA 3KV1A 3V8EA 4IH1A 4PZ0A 5KWVA 1L1FA 2YW9A 1ZNZA 5HKKA 4XIIA 4A8TA 3SYMA 1S01A 4GVLA 5FCDA 1PT6A 2BOVA 2BIFA 1WKCA 4MJXA 2X13A 4XWWA 1KKLA 3IRVA 1RM3A 4FXPA 1I3CA 4M8LA 3WYNA 5LIPA 3SZGA 4WXPA 3CZMA 5E2IA 3ZH9B 3ZDDA 4IUBS 3GNTA 4YJFB 2D6FA 4L8VA 1TKBA 2LWIA 4OHBA 4WFIA 2JHPA 1U8TA 1Y6FA 4G8CA 2WTBA 3S27A 1JEEA 1AJEA 4YRMA 5DNEA 1C3EA 5AVRA 1N0UA 3L01A 4AURA 3R0XA 1OOEA 5BSEA 4HXFB 2IEGA 1IXKA 3PDIB 2HT1A 1PK8A 2H06A 2IXTA 4JLBA 2NAFA 2HA2A 3WNVA 5KNDA 5JS8A 2OLJA 2YV5A 4KLRA 2QQEA 4JSTA 2VWPA 2FX2A 1EHCA 2H5EA 2R8EA 2YN4A 2M6SA 3OMWA 4I1YA 3DYVA 4KIUA 3L7YA 4RM3A 3TVTA 4B3SB 4D3SA 2H1WA 4DAEA 1K7XB 1SCAA 3MNFA 3BHJA 1KAOA 2IZ6A 3ORSA 3CUUA 4RETA 4PTZA 1DC4A 1DEAA 1ORIA 2JEOA 2BDUA 3C74A 4LI0A 3VJKA 3UNXA 2HR1A 3HYLA 3OWHA 1U0TA 5TMDA 4BNZA 4MQFB 3DBRB 2GM5A 3EQ2A 3FJOA 3B53X 4ZQIA 5EFOA 1PR1A 2WTXA 3EXEA 4E5PA 2G82A 3AGPA 4ALJA 4JLNA 2WEKA 4J2TA 4OBBA 3FTDA 3N2KA 3WYDA 1P7PA 1AQUA 4O2AA 3S8MA 4KIFA 1KJYA 3AIKA 4LMBA 3EQ6A 2JI7A 2A67A 1TVMA 4N39A 3RKSA 3U31A 3SBEA 1FNSA 3GMSA 2M1XA 3E3LA 3REQA 3UTCA 1DAGA 3TD9A 4BNIA 3QVXA 1PNVA 1YI8A 5AI9A 2H4XA 4EMUA 3AR3A 3RUDA 1CJVC 3OZIA 4HP8A 2Q3BA 4S3MA 3UAOA 4IDDA 3IVCA 5AVWA 1Z0ZA 1V1MB 2ZIGA 3C4QA 1U5AA 1QGED 2RJ3A 3O3NB 5FUXA 3VPBA 3H2ZA 5JBIA 1YNOA 3BCSA 1QRDA 1F9AA 1UBLS 1M2HA 3COSA 3RUCA 2C7GA 1F4VA 1GITA 4GS5A 3BCRA 2B20A 3LX8A 4POOA 3T95A 2WLTA 2QGZA 3ZDFA 3O95A 2HRZA 1NFRA 4LDQA 4M1ZA 4PG4A 4GE0A 3M5CA 3MILA 2IUFA 4G4IA 5FUYA 4EG7A 2OCLA 4RWEA 4QGAA 4B40A 1L2TA 1QGUA 4BN0A 2EERA 4COKA 3ONEA 4BKRA 2V7XA 2JL1A 3SHTA 2QM7A 2A59A 3KOZA 3ICQB 1FUYB 1PD1A 3M6IA 2IZ0A 4UM9D 2CLDX 1YAHA 2HI0A 1SKBA 3H3FA 4LW8A 3V3TA 5HFAA 2GHIA 1KQGA 5E3JA 5E9JA 5D6NA 4A8PA 4OXYA 2B92A 1KP9A 4CGYA 2H0QA 5BMOA 1KZ7B 1NJ8A 3H9CA 3I42A 4GE3A 5LMNB 2J5XA 1CZRA 2C03A 3R8CA 4G2NA 1H1TA 1TJ5A 5HIMA 5ED0A 4ENSA 1CSEE 4CTKA 3MFQA 1NBAA 1L0BA 2I76A 3M4NA 1GPH1 1G55A 1DXQA 1P62B 1X7YA 5K03A 2ZTMA 3CY6A 1J24A 3TZLA 3NTOA 1R4MA 1PNOA 3N8DA 3I1FA 3LXXA 5K5EA 2OY0A 1R8JA 3VZCA 4ZHQF 4DF3A 2XVMA 4O2BF 1C0LA 1EK1A 1YOVA 5EXEA 4R0NA 5IPFA 1CYEA 3AUFA 5BMVB 2Q2NA 1UM9A 1E89A 3VDQA 1VB5A 2AF3C 1XLTA 3GEPA 3AF3A 1GEEA 5TR9A 4YPVA 1OZAA 1R6UA 5FUWA 1Y9AA 1OI2A 2EKBA 3IERA 4Q9HA 5IF3A 5JCXA 2RE8A 3CVUA 3FDXA 4DLYA 3LECA 4BZWA 1FK8A 3WGTA 1CG6A 3DF9A 5G1NA 4FWTA 2WF6A 2DXIA 4V0MA 1MA0A 2PLNA 5DN9A 2J3MA 2P67A 2QI9C 1NMYA 3GOHA 4ND2A 3TPZA 5EI5A 1I5RA 3WBJA 2PYDA 3DBHA 2D7CA 3MJCA 3OAAA 1XCBA 1B8UA 1QGUB 2SICE 3L7KA 3K6RA 3O83A 2PN1A 2X8LA 4C0WA 2VCEA 4R0VA 3G5MA 4IEIA 1YBAA 3VH1A 3W9BA 4QULA 1EK0A 3WLJA 4AWAA 1DIBA 3LUGA 5H7XA 1CY4A 4CNQA 3QUQA 1J07A 2JARA 1TTQB 3LUJA 3DOOA 4ZHQA 3SQNA 3HI4A 5C32A 5A5EA 2IUYA 4DC0A 4H0NA 4K2HA 4UCFA 2VTKA 4M7RA 2I6XA 2YYYA 2O7NA 3QXGA 2HMVA 2DUJA 2OAP1 3D6UA 3WHKA 4GXTA 3C6QA 3D8NA 3N3BC 1WTAA 3H1AA 3G79A 3QPCA 3ZI0A 3G59A 4AJ2A 2NADA 3EZ2A 4XB2A 1CWUA 3GDOA 2VJNA 1Q7RA 2DFTA 3GRCA 3OHMA 4JU9A 4B8WA 1GTG1 3P94A 1W93A 3B89A 1ESCA 1N2EA 2SNIE 1J0DA 2AL7A 1C4OA 4K7JA 2ZE6A 4OGGA 4Q5IA 5LDDC 2FSHA 4LOJA 4ZI3A 3ZQJA 1X1EA 1HLGA 3NTXA 3P8ZA 2ZPAA 4B74A 1BVRA 2GZSA 3IMFA 1O94D 1PDWA 2H5LA 4AMBA 4BBZA 2E5WA 2REXB 3AHFA 3H1TA 1L5WA 1ZI8A 1E9FA 1D7OA 1VSBA 2PK3A 4TYPA 4DJTA 1V7CA 3MWKA 1D04A 3JRXA 1K63A 3RTEA 4I8XA 2XIJA 3TXXA 4EQ6B 4B6SA 5KWJA 4DLKA 4ZO7A 3LP8A 1JIKA 1JHUA 3WHLA 4DUGA 4EY8A 3M3HA 4JCCA 5DGTA 3IUEA 1L9XA 4IUCS 1HNZB 3DEFA 1WSBA 2EC5A 1RFLA 4LBYA 2NQ8A 4LAFA 5I7OA 3K1AA 4JBWA 4FOTA 4P3PA 4WK2B 2AEMA 4G0NA 3GX1A 2NYUA 1USIA 1V6AA 4C5AA 1XWWA 2F8TA 4CL0A 1FB5A 2VRNA 2ZDGA 3IIKA 2IPXA 4PBTA 5FTKA 4L3OA 2B6NA 4J7XA 4JJAA 3WFZA 3ETHA 4AJOA 4UE6A 1U80A 2E4XA 3A3YA 3HE3A 5JAOA 3QLVC 3VZDA 4EYOA 5F7XA 2FMIA 3I8SA 1N7HA 2AS0A 4ZVOA 3RBAA 2GN9A 2CXNA 2R2AA 3ZWBA 4BU1A 4G0OA 5IULC 4LJ7A 5HGJA 1XB2A 3ZC3A 1ECFA 4BLSA 1CUDA 6REQA 1UMCA 1ZD1A 5LVAA 1JPNA 1V45E 3UPTA 4M0DA 1U7WA 2ZIVB 3JAWA 1T3HA 1JS1X 4M86A 4NPHA 1KEEA 1Z5NA 3I32A 1L7BA 5JCOA 1DG1G 4ZQGA 2JGJA 2I1WA 4PPNA 2FEAA 3ACBA 1E4VA 3JZIA 2ONYA 4G63A 1FVOA 1QFYA 5AQEA 2YHBA 2D1FA 1BD3A 2I29A 1D3AA 4XD7A 4BKUA 2EP7A 2I65A 4F6RA 1I7QB 5SYAA 2GHQA 2HF9A 1GKIA 1HDEA 2W4IA 4KYIB 1JL3A 1KMNA 1ZJ6A 5T57A 1J22A 3MGGA 4ID9A 3WRYA 2HH9A 1W0KD 3CH5A 3LQ4A 3QUBA 4S0ZA 1NVVR 1NJ6A 4XW2A 4RXMA 3MOSA 1SU7A 2GXSA 4UNRA 1FNMA 2H4HA 3B3FA 1RWQA 4JYMA 2ZU6A 3JD3A 1IULA 4PFQA 1W87A 1IFXA 1OFHA 4HAWA 4RY9A 2IYQA 4YP7A 4D82A 3WMGA 3LQKA 1NVFA 5J59A 2XT9A 1KEUA 2KBFA 1ITZA 5MFZA 1KH1A 1JKMA 3NC4A 3U2QA 1PF7E 3G2NA 2OFXA 3C7DB 3G0CA 3J81A 2VPQA 4O4IA 3C7AA 1B23P 3VFDA 2JGKA 3DT8A 5MFPA 1A97A 2PR7A 4J0JA 1YDHA 5KYWB 4JYPA 5C1IA 4D9JA 3NT5A 2WRZA 1QIJA 4C05A 1K8XB 5U4QA 5JFGA 3HB5X 2Z5VA 2H00A 4DJ5X 3IEPA 2OUIA 2PY6A 4M46A 2VJAA 4GGOA 3JWHA 1VZ3A 3TSWA 1EK5A 1PGQA 3J7TA 2AB0A 4OI4A 4P4NA 3SYRA 4D4JA 4BQEA 2FW7A 4EI8A 4HVLA 1P72A 3T61A 4GPD1 3IT3A 1P4SA 4WESB 4MW6A 4NPCA 2YW2A 1U2QA 3EOZA 2ZIWB 3ZGZA 4MP6A 3L77A 1IZZA 1UWVA 2C4VA 2II6A 3G02A 3BFJA 3M7IA 1KO4A 3OM1A 3NJ4A 4MDEA 3HYRA 1R18A 5FWYB 1FS5A 2JASA 5HG0A 3I39X 5LR6A 3FNBA 5B1DA 4BE9A 1DZIA 3BXXA 1E9VA 1G8SA 4UMFA 4B33A 2C1EA 3M6LA 2R6JA 3P1JA 5JXIA 4DCUA 4HEJA 4Y1GA 5EFZA 4X20A 1Z0SA 2C94A 3AR6A 5K7SA 3A31A 3ND9A 3VU1A 2B2XA 1DU4A 4URHA 5G4KB 2GK4A 4MRRA 5KQRA 1XKTA 3IURA 4QXAA 4KXMA 4OJMX 3REGA 1BU5A 2ZRGA 1OTYA 1I6WA 5I4KA 2F1JA 4TLMB 3A9UA 1DE0A 1V5WA 2BBSA 2OEPA 1EEHA 3M1YA 1BOFA 2ZWVA 3B9RA 3D3WB 4WZBA 4ZVUA 2QPLA 5FV7A 3WRXA 4W99A 4D7AA 1JSLA 1N6LA 3MD9A 5BNIA 1GG2A 2O8BA 5I9SA 2DJ5A 4L51A 1Z5UA 3C3BA 5JECA 1WZEA 3NANA 1JQDA 4B3RB 3DMHA 1U90A 4QIHA 2QZ4A 3VC3A 5KPJA 2O8CB 1GLNA 1P1CA 4L8WB 3E2IA 4HH0A 1KIAA 3NWOA 2NTVA 4KN6A 2HRQA 2Q27A 2F1RA 4PW0A 4MW2A 2VWHA 4U7PB 2VNSA 2VDRB 1N9GB 2X3UA 1TGYA 2Q2QA 4R98A 5B6PA 2WYWA 1PKEA 3K2QA 3NAZA 3PENA 1Z7YA 4IYJA 1U1IA 4LJ4A 3K73O 4BJ3A 2JG3A 1EHYA 4NZPA 1QO0A 1NF8A 4BGEA 5IC6A 3ORYA 3SZLA 4EG5A 1UPUA 2FW9A 1Q91A 1V4NA 5CB4A 3MJSA 2RIPA 4NARA 4CUZA 1WBDA 1SG6A 3I30X 2DSTA 2P7IA 4B6PA 4TWJA 3LUKA 4LYJA 2ARKA 1JFFB 3U1TA 1YFLA 1O96B 2ATCA 2RC6A 2GAIA 4EY6A 3EGCA 4J0EA 1C30B 1R00A 4D4GA 2C0CA 1TZJA 1IJFA 2QPOA 2ZCUA 2YFYA 4DPMA 4BAZA 1ZLXA 4MGIR 3COYA 4OKNA 5EE5B 4HB2A 1DWOA 4MVJP 4A27A 1G5PA 3GZTB 1NVGA 5A2QA 3J80A 1EXNA 2CFSA 2TYSB 1NQTA 2EWMA 4GW3A 3HDTA 4PLTA 2YJZA 1YE8A 4R3WA 5TF0A 3TS1A 2W6JA 2WTUA 1QIFA 1TVKA 4DIDA 1VKHA 2IZOA 2X77A 3KPVA 4AXXA 3HLKA 1P5ZB 1TFRA 2NV0A 1HEYA 1ZCFA 3E4CA 2AKYA 4OB7A 1DQZA 2CHEA 2NVOA 3PEYA 2QRJA 1FDSA 4Y0NA 4F92B 1SUEA 4K2AA 5IH7A 1B6GA 2CDRA 3TG2A 1HG1A 3SCZA 1KBOA 3OZWA 1I3LA 3N2NA 1AF4A 2H2DA 1JT2A 1S96A 3TTWA 3QEBZ 1T2CA 1Y9JA 2E87A 1TECE 3JRWA 2GYUA 1UJ5A 1SHZA 2N75A 3KWJA 3AESB 1V4BA 2YX1A 4Q4LA 4ZVQA 1I4DD 2JAUA 1T1RA 3TDNA 5KNCA 3ZDRA 3KTDA 5HIAA 1MG5A 3Q3HA 4TV8B 2ICAA 3SX0A 5EXSA 2HA4A 2WDPA 1JECA 1L5QA 1VHJA 3BE8A 2AI1A 3O4GA 3DPUA 5AHKA 1P6UA 1BMQA 2NU9A 3KDPA 4GLFA 2QRGA 4G1EB 4CM1A 1NPTO 2ET6A 5HK9A 5LP6B 1F3LA 2AMLA 4ZVSA 1J5XA 4TVKA 3KYBA 3GJSA 1NLFA 2REQA 4FOSA 4EG1A 5IS2A 3Q3EA 2F1KA 4ZGGA 1HUQA 4UQPA 1B42A 4I46A 1PUIA 2AOUA 4OYRA 4YASA 6YASA 2QUZA 2VHJA 1UKBA 4F4CA 3IQIX 4QAJA 1TCUA 3WQHA 4BVHA 4G8BA 4WKCA 4EITA 5BQ3A 1A5SB 3GP3A 3JR7A 5C5CA 4DCMA 1S2OA 1RJWA 4RV4A 3DOCA 3F6YA 2JD1A 3FUWA 3FGOA 3UC9A 4CT4B 5CVTA 2GARA 4AQYB 5IBQA 1VP3A 1ESEA 1MV5A 1VE6A 1VLVA 2R5FA 3HDVA 1XRPA 4XQGA 5I7RA 3GLQA 2RGEA 3RVBA 1B14A 5DNVA 1EQAA 4WN9A 5K3CA 2WJWA 1E9RA 1BVUA 1PIWA 3OFJA 3T5BA 4ERXA 1FFCA 4MRAA 4TS9A 1R16A 4D57A 1R9NA 3IUPA 3HZOA 3NH6A 3T7RA 3ZE8A 2E89A 5E95A 3ZI4A 1CU1A 1KI8A 3UCFA 2VYFA 2ZBFA 2WD8A 4FHGA 4PX3A 3DPIA 3E6AA 1MQAA 2PMKA 1MC8A 1VXOA 4JB2A 3PJEA 1HYQA 1SC1A 2WFZA 3COVA 4G5QA 2XHZA 3H05A 4B76A 4ZT3A 3R23A 2Q2OA 4ARVA 4Q39A 4ZRDA 4BV3A 2C3PA 4G5FA 5I5EA 1M6VA 2G6TA 4D9EA 1PK9A 1W581 3FOBA 1CDOA 5I9IA 2LVBA 1TLTA 1Q2UA 1V8OA 2VYND 4OMUA 3L8DA 3VU9A 4DBLE 3MAJA 2ANCA 3BD6A 4JELA 2Q3JA 2SCUB 3IVMA 4JCOA 2JW5A 5TEVA 5B12A 1C7IA 2Q1WA 4ZOAA 1ZM2A 2Z4TA 3IKJA 5I5GA 3ZK9A 1OA0A 3KKQA 4OOEA 5HUQA 1US8B 2A57A 1A76A 4UUNA 3LQQA 1FFGA 1ZOSA 4ZT7A 2AEFA 2Y66A 4QUGA 1X1AA 2OHOA 2VDPB 1YJQA 4KMSA 3FVTA 4TOIA 2GILA 3L7AA 1CP2A 3LXRA 2GH1A 5HE8A 3UW3A 1XUOA 4YRTA 5JNWA 3AERA 4KH0A 1U0SY 3GJYA 5KINB 5KCMA 5J23A 2QJFA 5EZYA 2HDHA 3F6PA 3FNQA 3GG9A 4P7FA 2UYOA 1Q1BA 3BMCB 3IEXA 3G9ZA 1F6BA 4MRMB 4B7AA 1X2EA 3GI1A 3R3JA 3K9NA 4ESHA 2YJTD 4R6WA 4ROSA 3U56A 2EKZA 2IODA 2P2YA 4RMGA 2WSSA 4LOLA 2CN1A 3TNFA 4U9HS 9ATCA 3WAKA 5ANRB 3E8MA 1N2ZA 4PRLA 1O87A 3HCPA 1J2TA 3JYQA 1L5NA 3RVMA 3U6BA 3W34A 3M4ZA 3I9KA 4HG2A 1U9CA 4D56A 1TZBA 2IFTA 2Z5FA 5AW5A 1ETHA 4QTXA 3DMPA 3JD4A 3KT8A 2XCTB 5ARDA 2Y1CA 5I3CA 3FVVA 4AVYA 1STOA 2OHXA 2WD7B 1O7JA 4UTRA 3GMIA 2V5AA 3HEBA 4ZPJA 2JKVA 4PYMA 2OCYC 2BWJA 5KYYA 4KFRA 3IFSA 3TBKA 1ZH0A 3D7RA 3HR8A 3TOCA 1SKQA 2YCLA 5IXSA 3EZGA 3EXHC 5B2ZA 7ADHA 5HWSA 4HDRB 5GADl 2LRHA 3OZXA 1SKYE 5BSUA 4E2YA 2IXEA 2J08A 2TMGA 5LBTA 4MHTA 1KSHA 2B4YA 1OE0A 5DBIA 1OX5A 4MVJH 3GLIE 4LZOA 3SVTA 2W6CX 1PUXA 3A3KA 4OK3A 2Y77A 2BKAA 4NYJR 4R69A 5BNTA 1JFFA 4W5TA 1DBSA 2Z1DA 4DSZA 1E2MA 1SBYA 3H2SA 1SBQA 2FWAA 4G1VA 2XGOA 4FE7A 2JFVA 4D9KA 4QQFA 4DLSA 4LZPA 4M7WA 3REFA 4C2AA 3PVSA 1PD0A 3R0QA 1D2RA 1OI7A 5CX1B 3TUJC 1KKUA 1Y5LA 1CIVA 1GIAA 4MLPA 1DBVO 2OUKA 3KHTA 4DDHA 1P80A 1TYEB 4XQEA 4NRDA 1KPGA 1FY2A 1MPXA 1WB5A 4NG4A 2E6UX 4B6GA 4Q1DA 4FOPA 4BWYA 1CUJA 5LZ8A 1H93A 3W6OA 2HK6A 2G09A 3TOSA 2CFCA 1QE3A 4NMMA 4ACAA 2NU7B 3SBOA 4RIIA 1E1NA 1WKVA 2JGDA 5T4EA 4BAUA 2M6RA 3MFYA 1E63A 4CMGA 1FSPA 4HMOA 5KYTA 3OFSA 1SUFA 2L19A 4R1SA 4EHLA 2ZZNA 2G9ZA 2SKDA 3W2FA 3P27A 2I99A 5AP9A 1XN1A 3RODA 2BEKA 4DWOA 2C1ZA 2NACA 1EGHA 3ZLJA 3UGJA 1JJFA 4Y0VA 3M0EA 1EU1A 1GGFA 2WLSA 3LJKA 1BO6A 3QVGB 4PHGA 4F84A 3GLHA 3GVHA 1WBBA 3ZWYA 1AE1A 5LC1A 3VAYA 5J2UA 1BQ3A 1Y48E 3B12A 2VHZA 3I04A 4ZOLB 3GPBA 3RD5A 1II8B 2WICA 4AJJA 1XTQA 4O29A 2Z9CA 3K20A 1U7XA 2R1VB 3D0RA 4MLZA 4D0NA 4GYJA 1AKTA 4HZGA 5JY6A 1TTTA 4IMIB 1JEOA 2YUTA 4Z86A 4B34A 3FNFA 1NUSA 5CAEB 1DEHA 5EWMB 3UHPA 3UXEA 5FI3A 1E66A 3A4TA 2JIPA 1YB5A 2V4UA 3ETJA 2VPYA 3CZ9A 2BW0A 1ML3A 4GSLA 4QXPA 1ZCAA 3U61B 3USCS 1VB3A 4I36A 2XE7A 4CTMA 3O9MA 3L05A 4CDMA 1QAQA 3RAEC 4JBYA 1IUKA 1VLHA 3C48A 3FFTA 3KDSE 4FBGA 5KJCA 1M76A 3GJZA 2PKCA 3CNOA 2NSYA 2QTLA 3QUAA 4M53A 5HF9A 1KU6A 3U4AA 3UMGA 3JQ6A 1H5QA 1NXTA 3JQBC 4GEKA 4R54A 3RFUA 2WAOA 2W00A 3IP5A 4LFAB 2X8JB 2RHCA 3L5OA 2CDCA 3LO5A 3R5HA 1G0NA 1FJGB 4JL5A 3OTIA 1R4ZA 3ZE2B 4L07A 4B0OA 2OKCA 3VYWA 2Q1TA 2HM7A 3TRJA 4J91A 4EF6A 5HOEA 1R0XA 2RGDA 4CMCA 1R7RA 2B8NA 4U7TB 4KLZA 2QN9A 4PQEA 2DSNA 5EMJA 3ADCA 2P2DA 3GA0A 2P1ZA 4D0GA 4ZCPA 4EOGA 4O25A 1NV8A 4IQGA 2PQMA 4JGIA 1BS1A 3ADKA 4MZXA 5IHPA 2NPFA 2FPPA 4GT1A 4KO4S 4WBNA 4OJKA 1RXIA 2O3TA 2GA9A 2GF9A 1JIQA 1RQXA 2BR3A 4ZYZA 3GPIA 2B8EA 4HMPA 4H7HA 4WBSA 3GUCA 4IX9A 5EZ5A 4AIIA 5A06A 4Y2TA 1OFUX 5SY6A 1J7JA 3BREA 4L02A 2Q3MA 5CM9C 5I7WA 5IBCA 1ECJA 2XH8A 5TF4A 3D31A 2ZUDA 3M49A 1E2NA 2GF2A 2AH5A 5F77A 4ND3A 2ZS8A 5HIJA 4WXMA 2WZDA 5JS1A 5K20A 2W6IA 2ACVA 1WBJB 2NUTB 4D8XA 1SNYA 3KP1A 1U1EA 4DVJA 2IBMA 1QH8B 1J0XO 2QMUA 3BGVA 3KTAA 1Y7PA 3B70A 4HVAA 2OE2A 4FNOA 1NVWQ 4FW8A 1L5GB 1XC7A 5JWHA 1C7EA 4MV7A 5EMKA 2A6PA 1F0NA 2QTRA 2IVFA 1WS6A 1DAPA 3KQPA 3BMCA 1JIUA 3JYNA 5D5PA 3C97A 1JI0A 1KQPA 3I5AA 1TCVA 3EJ6A 3MSXA 4LJAA 5LBUA 5LU8A 2X15A 4CMEA 4NAHA 3SI7A 3B1FA 2D2XA 1ENOA 1H2AS 2X7HA 2NUBA 3EXIB 3K9WA 1YL5A 3OJWA 4IDFA 4EGQA 5JNSA 1FBNA 2HMTA 5FRDA 4YT2A 5KOYA 4B4WA 4DT1A 3NRJA 3DFKA 4DCOA 2B9EA 4EJMA 3WGGA 3L6RA 4XM1A 1OUMA 2HMWA 1UDAA 4B3HA 2I4IA 3K4PA 1Z16A 4HJRA 2H65A 4TV8F 4YAEA 1JLMA 2HK7A 3BSSA 3V4ZA 3DA8A 1G98A 4P35A 1S3IA 4FT4A 4M54A 5DO9A 4ZMBA 4F4IA 3MTJA 2OFFA 3IDOA 4LZWA 2QMQA 5HTOA 1DZ3A 2XCLA 1G8YA 4WT7A 2CF5A 1MA3A 1Z4LA 1I9CA 1Y8CA 2BFCB 3CW2A 3NR2A 3RQSA 1ZH2A 1NXXA 1OYWA 1H8EA 1RMYA 4IX1A 5KTTA 1YQ9A 1BA3A 4MW0A 4TXNA 3NWEA 1RWWA 3DJYA 3O9VA 3IQDB 5EJ9A 5SZIA 1ZUD1 3VR4A 1W2GA 2OBNA 2GN0A 2PPVA 3SLRA 3FOFC 4B79A 3HPQA 1BYUA 1EX1A 4BC0A 1KYZA 1X77A 4KVZA 1PX0A 3INRA 3VHLB 1KDPA 1UINA 4LQ4A 4AZ0A 4CIBA 3TGLA 2WK1A 3H1EA 3VJLA 3SE7A 3AUYA 5K0GA 2CDNA 1R37A 4EI9A 3FTNA 5LYYA 2QTNA 1LPBB 4I6EA 1KY3A 1TAQA 3OJLA 3BZBA 3PQCA 5DHFA 4C4RA 4DABA 4F5YA 3GCDA 4RF4A 1JAZA 3IAS1 2KW5A 2OWEA 2XUJA 3KQUA 1BFUA 4PWZA 2BZ0A 2F3QA 1AO3A 1V1JA 2V3VA 4ZI5A 2OXRA 1NMEA 2V55B 4FN5A 2HRBA 4OBEA 4C2UA 2EP8A 3NM4A 3C6YA 1J9GA 2QD5A 3KUUA 1WUHS 2OOSA 4P2GA 4V38A 5CVDA 3RVRA 4E33A 2ZG6A 3OHPA 4GF5A 5F3DA 4IVPA 3WGNA 8LDHA 2CFIA 1I01A 1SKYB 1CB0A 1FDWA 5JCJA 2WJ3A 1BN7A 2D8AA 3WWOA 1X0XA 5AXAA 4H4EA 2IC5A 4CHTA 1K8ZB 1A9PA 3DMRA 4MO9A 4MVYA 4S24A 3UWOA 3QTTA 3U5TA 2C4HA 3QLUA 3SJCA 2VDMB 2QN6A 5CITA 3FPAA 2QW1A 4EA6A 1JIJA 4MGYR 4KNWA 3B6EA 3WP1B 3DCYA 1KMHB 2J6IA 4ZC8A 1K4MA 3UKDA 2ZAIA 3FE2A 4MJ3A 4KE7A 4P33A 1MOQA 2IYLD 4ZU6X 4AECA 3DXFA 4EJ2A 3BL6A 2XY4A 1VL8A 2OMEA 4FQ5A 2C92A 2WA2A 1IYZA 2XSZD 3PCXA 5C1DA 4O4LA 2P4QA 1YACA 2CVZA 4MINA 4RYDA 3SHVA 5HW0A 3ZQ6A 1F1BA 2E48A 4DHWA 1U3TA 2PU5A 1AHIA 2EFEB 4KQWA 2M6LA 1LTHR 3K2BA 4IF4A 4WIAA 1U2GC 4Q3LA 3SDBA 1X3LA 4JBHA 1NQUA 4A6XA 2FK7A 1T4CB 5DZSA 5TMBA 3NMUF 4X1YB 1DHRA 1MB9A 4GZMA 4UUQA 1PJLA 1YFKA 3PHGA 1GA6A 5IANA 3OKFA 5LBIA 2WIAA 4B2IA 1NBMA 4HWSA 3FROA 2EHJA 5DI3B 4H35A 1OLUA 1XZDA 1F4PA 2X41A 3JQAB 3SIPA 5KB3A 2QLLA 5ED4A 4KB5A 1CQJA 4RNDB 4Z0PA 3AJAA 1T36A 1FP4B 2VF4X 3HEAA 5LMUB 3DZHA 4D1YA 4E08A 1HL7A 2FQYA 2B1GA 1AUXA 3H2IA 4H3VA 2J3HA 4H1VA 2AXNA 2YWDA 5ESDA 5F23A 1RJFA 1BRMA 1E92A 1F60A 2JIBA 3VOTA 1U9IC 2WAMA 3P26A 3WZ2A 2V0GA 2ZJOA 1UZUA 4ZZ2A 2ZU0C 2AFRA 3GQBA 1KHTA 1NQXA 3G2PA 4QDJA 2X1VA 3TLGB 5FPSA 3V8PA 2XYPA 3EXG2 4FSDA 1ZMTA 3P0IA 4HRYA 3U4QA 1P75A 2O2CA 3FUCA 1T8RA 3SD7A 3WFIA 1NWCA 2PZ8A 1CHNA 1SD5A 2D2IA 5F5LA 1PFVA 4CEJA 1HX7A 5I4CA 3P5BA 1E3TA 4AG3A 3EPRA 3EX7C 5LM3A 4O4JB 2K2WA 2IEYA 4WZAE 2F2TA 1DP4A 1FXUA 3EIQA 3JY6A 2GCOB 5AVXA 1PV2A 2GPAA 3QP9A 1NN5A 3EA4A 3PXDA 1XAHA 1NXWA 1X87A 1V37A 5DLDA 5DSZA 3VOSA 5J4HA 3OO0A 1RKQA 2CB0A 1Q12A 3CJTA 4JD5A 5L3SB 1CRPA 1YS9A 3SOPA 1GNQA 4MJ7A 5ABPA 1H3NA 2ZAGA 3DWGA 1MJ5A 1XU4A 3HYCA 3U4GA 4CKCB 1IK4A 1VMAA 3N2GA 5IM4F 3PWZA 2AQIA 1E4EA 1SZJG 2VA9A 3ODPA 3BIWA 4ISCA 1B41A 5JAIA 2E6KA 1XELA 2EZUA 1HH4A 5F1PA 1QLHA 5FNVF 1BW9B 3OOSA 1AUQA 1FJ2A 3D0KA 1O0CA 1IZ0A 1VKRA 2Z8XA 2G7ZA 3BWBA 4OMFG 4ZVKA 5B3AA 4BFZA 2FSVC 3GUUA 1H2YA 5AVVA 2I1LA 2PX6A 1PR9A 3I1IA 3RF6A 2EGHA 2AOVA 5JROA 1HI9A 4P32A 2GGSA 3DE7X 2VPWA 4FHFA 2POCA 3H84A 2V65A 3BSYA 4DBVO 3OBBA 1JKIA 1SXQA 4I9GA 2BISA 1KO5A 1H9BA 1BMFD 2N9UA 4L7QA 1KERA 4G23A 1K8YB 1X15A 4Y2XA 1SBIA 4GM0A 4JQZA 4MPTA 4Q1EA 3HA2A 3W2HA 1WRBA 2ZW9A 2HYIC 4YUAA 5EOVA 1G7SA 1MD9A 4GEGA 3EWAA 3INNA 4F8YA 2G1UA 2DFNA 5DNUA 2EOAA 1FVFA 3FNRA 1XTBA 3R5SA 2F8SA 3VZSA 3JVUA 3OIFA 4INPA 1MIOB 3TWOA 2BGKA 2IXGA 2VZEA 5LQSA 3ZD6A 3MM4A 1C9EA 1D4ZA 1K7CA 1TQ6A 2FLKA 4WESA 3RYTC 5BSWA 3F9CA 3HWRA 3KB1A 4NMXB 4BNMA 3H16A 1Z8FA 5CYFA 3RC9A 1EVJA 3FLBA 4LTDA 5G1OA 4NBNA 1GPWB 2NQ2C 4IICA 5HKAA 3RYIA 4ZARA 3SXUB 5DEIA 2F64A 4BBPA 1Y8RB 2FUNB 3FX2A 4HK4A 1YULA 1NNEA 2PT6A 3KWMA 2LXNA 1DDGA 1JJAA 1GVNB 1SURA 1QG4A 3F9RA 4ZXPA 3SIWA 1P19A 1LDNA 1MO6A 5EMLA 4OGKA 1C7RA 3LDGA 2IUEA 2DFLA 3LW7A 3ZVLA 3DV0B 3KR9A 3ZOZA 2XYVA 1I80A 3H5AA 4JWTA 1M2KA 4E21A 3RKRA 1ACLA 5BN5A 1PV1A 1AXEA 3LLVA 3ZHQA 4LGMA 3ULKA 4CM5A 1M1ZA 4YJDA 4B7UA 3GA7A 1LJ8A 4KL8S 1FS6A 3FA2A 3WA6A 3WK9A 3TQTA 4D96A 3O2JA 4PQFA 5TX7A 4HX2A 1ZYUA 4CMKA 3P19A 5EHGA 2AQKA 1FP2A 2EVWX 3K5WA 4M1EA 3WQRA 2BFDB 2ZOSA 1XJ5A 1OGIA 3ZHVA 4OI2A 2ZVDA 2B36A 4WXYB 3PX3A 4MVWA 1RHRA 3VAZA 4L2IB 4MA0A 4N5DA 3BJZA 2B1IA 3IA2A 3F6RA 4YALA 3VKFA 4ZEOA 3WKAA 4AG6A 4G1CA 5T3UA 1XRNA 3PE3A 4WY8A 3PUYA 1WP9A 4MIKA 1DBQA 3H8JA 3FF4A 2NO6A 3LC1O 3MUNA 4OB6A 4RD1A 1DLIA 3VUEA 4EY7A 5KOJA 3Q5GA 4H9GA 5CT6A 1DGQA 4GSKA 1JAHA 4MWGA 1G4UR 4G01B 1PEDA 1CVLA 4UUAA 2DFPA 1RXCA 3MT9A 4RY2A 3FJYA 4LG1A 1IH8A 2QJWA 2EX1A 3G5LA 3HU3A 5GM2A 4E2ZA 4XASA 2QRUA 2D5IA 1XZ8A 2ZI6A 2HX1A 2JAWA 1XPUA 4LA4A 3OJFA 2HPHA 3NUZA 2QM8A 5EPUA 4QGSA 1PZEA 1WMFA 4UU0A 3CLTD 3KXIA 3S1AA 5L3QA 3OQNA 4RQTA 4RFLA 2R87A 1MQ9A 3B7GA 5CXSA 3OUZA 1N5OX 4RXUA 5JY1A 4QXOA 3D8BA 4JUAA 5FL7A 2WJPA 1IN1A 3CUKA 3DV0A 3P9RA 4L9AA 5IJAA 1A27A 2E4ZA 4M99A 3F3MA 4PLCA 1QH1B 3HBJA 4H16A 2VDWA 5CJJA 5A3QA 2BF4A 2BBOA 2V4ZA 2IOQA 3JAMA 2D2FA 3IBTA 2J07A 1KMCA 1H2XA 5THXA 4AUNA 4JHLA 3ROPA 2H4JA 4FYHA 3JV7A 4RTRA 421PA 4P4SB 4MUIA 4K1LA 5CEFA 1Y6JA 4MI3A 4EMBA 1YI0A 3CFYA 4LWOA 3IA7A 4RELA 1GZHB 3VSCA 1L4HA 1M1YA 3AY7A 3BHIA 5CD9A 1CFZA 3DMGA 1A8PA 1GPLA 2Z2JA 4D81A 4KMMA 3SXJA 4PG7A 1QR6A 2VXOA 5IZCA 2EBWA 2H1LA 3AVPA 2EJCA 1JSCA 2D1SA 2E3JA 2NV2B 4WKNA 1LDGA 3KQTA 5KTKA 2ZXUA 4HQNA 1RWNA 1DT5A 2V5VA 4J0CA 4UC0A 2J45A 2Z0MA 3RTAA 2CZGA 4DLBA 4DV2B 4BL5A 5E2AA 1SELA 2C5GA 3E0XA 5CNMA 2DMRA 3I2YX 4Q00A 4RFVA 1GYQA 2JLBA 2X2OA 3S99A 3AUKA 2AUTA 2VSNA 1SVOA 2ZSAA 3NT4A 4QFCA 3DMFA 1SC4A 2HMAA 4EPWA 3AT1A 2A4MA 3OF5A 2O8BB 3IAS6 3OX1A 3OQOA 4OHRA 4LQDA 5EHQA 5LA6A 3VGPA 5KHOC 4CL3A 3UJPA 3B3QA 3WYFA 4Z2AA 3N8IA 5AHXA 4Q4HA 3UMSA 1G1AA 1FSFA 5BWLA 1O58A 1UAGA 2BKLA 2QTTA 1DAOA 1PWZA 2FSUA 4KQEA 1BE8A 1C3VA 4ZTZB 1JPUA 1LC0A 5DCWA 3D3JA 1G38A 5JJKA 4R2IA 5C0OE 2AX3A 2AJBA 2IZ1A 2D4HA 3RSSA 4E3ZA 4Y2RA 2QX6A 3ER9A 2VJQA 3UAZA 4RGYA 1QB7A 4L4XA 5HMLA 5TGDA 4AO7A 1NJ2A 2OGSA 4HWKA 2D7JA 2RHOA 3F6CA 1AN9A 1E7MA 3W5HA 2ZCVA 4JVMA 3PUVA 1JUDA 1GNPA 4KDFA 4KV9A 2ON6A 3RYCA 4C3VA 3IP8A 1YGYA 5F52A 3HEMA 5TMEA 1XMOB 2MWMA 4GL2A 2Y4NA 1YMQA 2PX0A 4F1JA 4XM0A 2R1VA 4M1SA 4R71A 2I9PA 2ECQA 3O8DA 4P92A 4ZYTA 1GTJ1 2GFQA 4U2KA 4WK4B 2PX3A 3V4LA 2CYBA 1HFEL 3IP1A 2GASA 2DG2A 3O82A 1CE8B 1VG1A 1KSGA 5BRAA 2WV7A 3HY3A 5BQ5A 1OAKA 5CFZA 1L7DA 4NJOA 3BMNA 4PLHA 3DULA 2J5BA 1NI4B 3FRIA 3LCVB 3WIDA 1A2QA 4HUQA 4JC4A 4Q3CA 1HDZA 1T29A 4RVUA 5TQ2A 1M34B 1QG0A 2A4KA 2CLCX 3GJ6A 3MCTA 1WB9A 2IE8A 4NJMA 1RKBA 4XRRA 2R8RA 3G8YA 3FETA 1H5NA 2IIBA 3CNBA 4QDZA 4GMDA 4AJ1A 1EZZA 2YV1A 4C6TB 3GMTA 2VHUA 3Q9NA 4ZO6A 4Z6KA 5FWAA 3P32A 4AY5A 2FUCA 4HWTA 4NOKA 3I9LA 2PUAA 3A6KA 1TCAA 3DH0A 2QSUA 5F33A 3DHYA 1GAJA 4QPZA 5SICE 1EAMA 3AHGA 4NZOA 3L4KA 1UQRA 2QIOA 5KYYB 1UP4A 2OBBA 3VVBA 3RVQA 3RFVA 4FC6A 2AXQA 1U0NA 3FIJA 1SOWA 3HO6A 3PSHA 5KS2A 4A23A 4JXZA 2QZ9A 3I34X 4OXRA 3G0GA 3D6AA 3EVEA 1K1EA 1U8EA 3L4EA 2VPIA 3REQB 3WNDA 1G6Q1 4PS0A 5K01A 2RD2A 3LL4A 3OCVA 1A4XA 2M6KA 3RS0A 4XCXA 1GL7A 2AFHE 2QR2A 2Z2IA 3FSGD 4FYVA 1BXGB 3BM5A 4MW5A 3VR3A 4EP1A 3UAVA 2CBXA 4ZT6A 4Z4QA 4KG7A 1XZMA 3KKKA 3DB2A 3GJ5A 4G5OA 1IDN1 1OFUA 4DLWA 4N48A 3T4EA 1DIOB 1GCAA 4XYLA 4ED9A 2GEDA 2IEBA 1LDEA 3LUBA 2IWHA 2GEJA 3KEMA 3UICA 2IP1A 3Q1KA 4D92A 3N2YA 3HJRA 3ZWNA 5I7HA 3D2BA 4XWKA 3KT6A 2IW3A 2OHHA 1QUFA 3E3MA 2FQ1A 1E5TA 1QIIA 1Z0FA 2JJQA 4HXEB 1SD2A 2HXGA 1Y82A 2X3YA 3FYHA 4HRXA 1Y6ZA 5SZKB 3IULA 4F4DA 5GJCA 1L4NA 3ED1A 4OHOA 3O7MA 4CM4B 3RHZA 4YIKA 2I3AA 1F8UA 1KXZA 3KXKA 1O0SA 4IOLA 4KVFA 4BGDA 1I2DA 2OQRA 5THQA 2VQSA 5KVCA 2AOWA 2AMYA 3BN3A 1P1JA 1M9NA 2F7SA 3N1UA 1FYXA