2CFCA

Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
MSRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Stereoselectivity in the (R)-and (S)-Hydroxypropylthioethanesulfonate Dehydrogenases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
total genus 94
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.268: 2-(R)-hydroxypropyl-CoM dehydrogenase.
pdb deposition date 2006-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cfcA00
4XYEA 3BMCB 4K1LA 4ND1A 4D0RA 4E5PA 1EQ2A 1GUFA 1ZK4A 4PGFA 5FI5A 4CLHA 4OAQA 3V2GA 2JCYA 3DO5A 5G0VA 3T4XA 1LBEA 4HADA 3LC1O 3PGJA 1SMKA 4CM4B 4A5OA 4HFJA 2BI7A 1GPJA 3LDHA 5A9TA 3GHHA 3I9MA 4FDAA 2CSUA 3AM3A 2DUWA 4I9HA 3HJAA 3ZW8A 3DMTA 4B7UA 1P74A 1QLHA 2AQKA 1O95A 1PGJA 4IMPA 3DZIA 4WJZA 4FOOA 1WDLA 2O3UA 3KOUA 5TC4A 4DPMA 4RVDA 3ONFA 2E37A 1G6KA 2JFFA 1ZK2A 2EP5A 2ET6A 1LSSA 3M1AA 2B4TO 3RBVA 4XYBA 4ZICA 1T1SA 3BTOA 4FOSA 3KLMX 1ONNA 3GN2A 5ITVA 1Z7BA 3KBOA 3I6QA 5EJ2A 5J23A 2WDZA 4RPHA 2EIHA 1YBAA 4U8GA 1TEHA 1EFLA 3PHGA 5KJFA 3NTQA 4TMFA 2VT2A 1MP0A 3E9NA 1ULSA 3E03A 4R9SA 2JCXA 3KYCA 2QIOA 1HRDA 3PPIA 4NQZA 3OA2A 5TLSA 1GYRA 2O4CA 5CFZA 3F46A 3KB6A 1ZW1A 2DPHA 4NDNE 4G81A 2GYYA 2OP0A 1M66A 4DIFA 4AJOA 1PS8A 3WQSB 5DOVA 4XEHA 4JP3A 5ER9A 4H15A 3C24A 3OICA 4CMHA 4RPJA 3ZU4A 1HYGA 1NQ5A 2WMDA 3ICCA 4FJ1A 4FW8A 2RHCA 2LDXA 3OECA 4M54A 4W9NC 5C3MA 4IS2A 1U8FO 4HFNA 2JD1A 3DZJA 3NGXA 1HE2A 3NT4A 2VWPA 5BR7A 2AE1A 4YJGB 2O7SA 2E48A 4HBGA 4MVJE 5T57A 2VQ3A 3U4IA 4CM3A 1UZNA 4EJ0A 5HTOA 4YTEA 4L0QA 4BO8A 3I4CA 1UXKA 3KYCB 3V5NA 3VHRA 3PYXA 4KQWA 1LDEA 2R2GA 3GFBA 3ZWNA 1U7HA 1VC2A 4W7IA 4L9RA 1NQTA 3QVOA 3TDKA 1LSOA 3KM0A 1U3TA 4JJIA 3GR6A 3RFTA 3I9OA 3FR7A 4MIOA 2ZB8A 5T67A 1B15A 1R4MB 1ENYA 3PZBA 2R00A 4FQ8A 5K0ZA 3O38A 5K6AC 3O9ZA 2O3QA 4F46A 2PR2A 4QTZA 2X5JO 2O2YA 4Q3AA 4YA6A 3Q3CA 1GCUA 4IDAA 3DZBA 3KXDA 3JQ8B 3WGHA 5HA5A 2I5PO 5THQA 1H6DA 3MJEA 1UXIA 3F5QA 2PFGA 4CQLB 1CYDA 2D59A 1H2HA 2QHXA 3ASUA 1GEEA 3WYEA 4BHTA 4U5QA 2H5LA 3QWFA 4GVXA 1I2CA 5DT9A 5KJEA 1Z7EA 4ZN6A 2FZEA 3QHAA 3HDHA 2G82A 1SPXA 3DEYX 4OO3A 2TMGA 3QJ5A 4UUNA 3AM5A 4DQVA 2R6JA 3PI7A 1C0LA 1R4MA 5IDQA 2GZ1A 4Q3DA 5BSFA 3UOGA 1XQ1A 2NVWA 3K31A 5T8KC 4E5YA 2Y1DA 4JBIA 1DAOA 1XEAA 3ADPA 2GGSA 2Y68A 1NVTA 3LC7O 4Z0TA 2B0JA 5IDXA 1E7MA 1SNYA 1HLDA 4CMAA 3I83A 1CF2O 1TT7A 3CSDA 1DIAA 4FGSA 4DLLA 1X7GA 1HWYA 3IAHA 1XQ6A 2DBQA 5ADHA 3W8FA 3BMNA 3V2HA 1SEVA 3F4BA 4ILKA 1WDKA 3WNVA 3PQDA 2EP7A 5JC1A 3SBOA 3E48A 2X8LA 1B7GO 4KP7A 2YQ5A 3DZFA 4N5LA 2CNBA 1GZ6A 5G0TA 3FR8A 1EBFA 2AHRA 2W2KB 3O26A 4I5DA 3D4OA 4NBUA 1G0NA 1I8TA 1SOVA 4IXWA 3RUCA 2H63A 4BS9A 1YO6A 4D41A 1U5CA 3P19A 4DUPA 3ON5A 3GVXA 4ZGWA 4EEXA 1YQXA 1XLTA 4AJLA 3JYLA 4JBGA 3L4BA 1LDGA 1PX0A 3QE3A 5EQDA 5CDTA 4X54A 3VPGA 5I7EA 1PWZA 4A26A 2FPGA 1DDOA 4TVBA 3OF2A 3BMNB 1I24A 2BMAA 3WICA 4Y6RA 2GLXA 4YACA 2OXIA 5DULA 3BMCA 4C4OA 3K96A 2D5CA 2HLPA 1C1XB 1EFKA 1WZIA 2AQIA 4OM8A 4J2HA 2HO5A 4GKVA 3S55A 4BKPA 5I7VA 5DP2A 1EBUA 1D8AA 3GF4A 3JQBA 4I8XA 4XYMA 4FN4A 3QW2A 4RF5A 3GZNA 1TXGA 5TX7A 4GMFA 3ZWMA 3DR3A 3RUAA 2Q1UA 2JFHA 4XYLA 5CEFA 4KWIA 2Y1EA 4YYZA 3WFIA 3GY0A 2VUUA 2Q2QA 4KUEA 2GPTA 3DBHA 3COSA 4RF3A 4RPLA 3RKRA 4TZKA 4HV4A 3U9LA 3IP3A 4CMCA 3KYDA 1YB4A 1DFHA 4YT5A 1KY5A 3DBRB 3JQAB 3B6ZA 3I9JA 4CQMA 2OBYA 4Y6SA 2C54A 3UGKA 1E3WA 4GQAA 1C1XA 3I9NA 5CPBA 3FHLA 2Q1TA 3CPSA 4L73A 3ZZNA 5ITWA 3BTSA 4Q9NA 1DRWA 4XQCA 4AL4A 1VSUA 2PK3A 4IZIA 3WGTA 4AFNA 3AUSA 4GX1A 4TROA 1PJ3A 5CDSA 1V3VA 1ZSVA 2DVMA 4MVJH 3PFWO 4XB2A 1P45A 1PR9A 1LRLA 3IMFA 3RVDA 1SAYA 1B8PA 1HEUA 2Y1CA 3I5MA 4HWKA 3RASA 4E13A 1ZSNA 4AJKA 3LLVA 2HMUA 3IJPA 5BT9A 1F8FA 1ZJYA 2A94A 1H6CA 1LSUA 2NTVA 4Z6KA 3GUYA 4JIGA 3ZU2A 4ZQBA 4PLCA 4RVFA 4FC6A 2GN8A 5KJCA 3INRA 2HK8A 2NSDA 4KTTE 5I9NA 1MUUA 3WB9A 1ZSYA 1N1EA 3E5MA 1HYEA 4E2XA 1W8DA 3RIHA 3GDOA 1TI7A 3FBTA 1MC4A 1OBFO 5CP8A 5FI3A 4ZQFA 4LGVA 4PLGA 5C7OO 4BNWA 3EVTA 3GMSA 2DC1A 4NH4A 4OL9A 3TL2A 1XU7A 2X23A 4R9RA 3RC9A 4TRJA 1PGNA 2OMEA 3RUFA 2NQTA 2X9NA 3PYMA 1R12A 1DIGA 1DBVO 4K6CA 2Q99A 5F1KA 4YAGA 3TQHA 3Q11A 3PHJA 3HFGA 4PLPA 1FJHA 1ZMTA 2C07A 2NTNA 2PKQP 3PIDA 1BWSA 1E1NA 1ZZEA 1HETA 3S2FA 1CETA 1GV0A 3Q9UA 1UZMA 1C3VA 1GFSA 1YWGO 4ND4A 4J0FA 3U4CA 2FY8A 3OEYA 5KCZA 5EINA 1R0KA 2I3GA 1MB4A 5JDIC 4IJVA 4LK3A 5U9CA 5A05A 3TZKA 5DBFA 4DMMA 3DL2A 1SC6A 1SBYA 2ZCUA 3OJLA 3BHIA 2ZCVA 2D1YA 1N1GA 4NBRA 4ALKA 4YJFA 5LDHA 3GVHA 1U28A 3WWZA 3KTDA 4AJIA 3P5SA 1UP6A 2NADA 4B7XA 1JWBB 4IDEA 1DB3A 3ROKA 3MOIA 2H9IA 2JFGA 2QRLA 3I6IA 3NDIA 3I52A 3WS7A 2X9GA 2BF7A 5HM8A 4E3ZA 2J5RA 2RH8A 3LF2A 2QYTA 1YS4A 3PVZA 1Q2XA 1NVGA 4EDFA 5ES3A 5MDHA 2P4HX 1PQWA 4CPDA 4I9UA 1O8CA 2Y93A 3PIIA 3MTGA 4RPGA 2AQHA 1OFGA 3ITKA 3L77A 5DZSA 3RQSA 1EK5A 3UKOA 4RQUA 5B4VA 1BW9A 1MG0A 3BMOA 1BXKA 4UULA 1ZK0A 3H7AA 4YT8A 3GEDA 3Q2IA 3NUGA 2ZQZA 4MP3A 2DPGA 5TGDA 3PJEA 1FDUA 1E3IA 2AEFA 4BB5A 1Y8QB 2QRKA 1O9BA 3KLPX 4QECA 4BMVA 3ZU5A 2YFQA 3WYCA 4EITA 4LSWA 1HT0A 2J3HA 3OFSA 3WJ7A 1OC2A 4XCVA 4MKXA 1ISFA 3TFQA 4HP8A 3ZNPA 5CEEA 4UEKA 3GAZA 4AJ4A 3S8MA 3O03A 3DOJA 2PTGA 3PJDA 3O8QB 1XHLA 3OIFA 1L7DA 3B1FA 3CKYA 5ICSA 2B4QA 3GQVA 4W6ZA 3ANMA 1V3TA 2PLAA 5JYEA 4IDBA 2H6EA 5AXAA 2HMSA 1ZXLA 3EY4A 3IKTA 3W4KA 2HMWA 4J16A 4IGFA 4IY1A 5A4DA 4FGWA 1PWXA 4EI2A 2PWZA 4NK5A 1Y8QA 4YJHB 4CL8A 5FF9A 2P91A 3NX4A 1R4NB 1MFPA 2G1UA 3GZNB 4D79A 4ESOA 4XGIA 2J8ZA 3DHNA 3PLRA 2ZB7A 2GR9A 4J3FA 2CZCA 1C1DB 1P1HA 3UW3A 2DT5A 3B1KA 3VH3A 1A72A 1XELA 3DBHB 5HWSA 4IBOA 3A1NA 1TT5B 1Y5RA 3HFSA 3OJEA 1ZXBA 5BQFA 4WOJA 1M75A 2CD9A 3DBRA 3JQBC 1PL6A 3H5AA 3O8QA 5DCYA 3DZKA 4JX8A 3RBXA 2W8ZA 2JD2A 1C14A 1T1RA 1SO8A 1E1LA 4CJXA 4Z9YA 1GV1A 1NXQA 2F00A 1ADFA 1CDOA 4CM6A 5IZCA 2EXXA 1H9BA 5G0WA 3B20A 1EUDA 2YW9A 4IDDA 2BELA 2DBRA 1ENZA 1YXMA 2Q3EA 1U3VA 1A5ZA 2Q45A 4JXKA 1N7HA 3TOXA 3RU7A 3I9LA 3RUEA 1DO8A 1H94A 4OXYA 4DIBA 1NHWA 3WBFA 4JROA 2SCUA 3JYPA 2OHXA 2G76A 4IINA 3TSCA 4JK3A 4R68A 1C1DA 1KC3A 1KVSA 3VPFA 3BXXA 3EVNA 4YEDA 3SEFA 3OM9A 3VKUA 3PK0A 2VNSA 4EZBA 1P31A 3CTMA 3GNTA 1BRMA 1F06A 2FWMX 4CV1A 3EUWA 4Y8VA 4ALLA 1HKUA 2B36A 2EHDA 3DXFA 4IS3A 3IOYA 3WQQA 1A4IA 1E7RA 1A9YA 1M2WA 3KVOA 1BDBA 2V6FA 1SZJG 4MKZA 4XWYA 4MVJD 4MVJG 1JN0A 4JQCA 4XJTA 2WYVA 1L1FA 3TZ6A 1PSDA 3VH2A 3C8MA 4BO9A 3E18A 5TNXA 1K0UA 4RDIA 4TRRA 4EUEA 2IDZA 1YRLA 3ONDA 1U2GA 1H93A 3BHJA 1JWAB 3DTYA 1X13A 1HDXA 3H4VA 3FTNA 1NPYA 3E6AA 3ADOA 4WEQA 4ALNA 1MV8A 1OMOA 3PLNA 3JQ9A 1UAGA 1IB6A 3GRPA 3GMDA 4WOKA 2B4RO 3T4EA 1QG6A 1PJLA 4WCFC 2OP1A 2RH4A 3DOCA 2NV6A 4M89A 1MG5A 2EG9A 3ZV5A 1IHYA 2P4QA 2VHZA 1JAXA 1QKIA 2EV9A 3OIDA 5DNAA 3DONA 5CDGA 1OC4A 2F1KA 3HG7A 3PWSA 4FJ2A 4YBZA 1JVSA 5A03A 5I9MA 2WEKA 1AHHA 1GUZA 1UDBA 5IDWA 1UAYA 3F1KA 4RJTA 4QSMA 9LDTA 3UN1A 5GZ1A 4CV3A 4WLVA 1BG6A 1SOWA 2O3JA 1JQBA 1CEQA 4BO4A 5JFOA 1YDEA 3ONEA 4I5EA 3JQDA 1XCBA 3VTZA 4MDHA 1X1EA 5G4KA 1W73A 1UH5A 3ZWOA 4J1TA 3INTA 4J43A 4NBVA 3DC2A 4O0LA 2GCGA 5TT0A 4MKRA 1VLLA 2GERA 1I3MA 3W4IA 5EL0A 4WGGA 3HWRA 4PLYA 1GTMA 3HADA 3WTCA 1KOLA 2DBVO 2VHWA 2EKPA 1CRWG 3OP4A 2UVDA 2X0RA 4CM4A 4OHUA 1V3UA 2PZLA 1KBZA 5T64A 3JCZA 4U0JA 1ONPA 4OQZA 3P2OA 4A73A 3ANNA 2A92A 4RLSA 4Z3KA 3AY3A 1PIWA 2HCTA 1GQYA 1ADBA 2XPCA 4JBHA 1HDZA 5I9LA 3BZUA 1ZCJA 3FF4A 3CZMA 5GZ6A 4GX0A 1DC5A 2GDZA 3H9QA 3D5QA 4S3MA 1B2LA 1E1MA 1Y81A 1YBVA 4R51A 3RFXA 4G5HA 1NM5A 1I3NA 1K3TA 1GU7A 3UVEA 4XYGA 3NJ8A 3JQ9C 3H9UA 1C0KA 2FP4A 2R00C 3A9WA 3C3XA 3JQEA 4YRAA 1R16A 3QP9A 4WLUA 4F6LA 4IZHA 4J4HA 2O7QA 4Y67A 2Q49A 5L51A 8ADHA 2ZJ0A 1E3LA 1EVJA 2RHRA 2Y67A 2VWQA 4EEZA 1WZEA 1IOLA 4MP6A 1B3RA 1DIBA 1ENOA 1I30A 1VL6A 1R15A 3GDGA 4UVGA 4OJNA 5TJHA 4AICA 4CM8A 1LA2A 1GDHA 3IJRA 3MEQA 3SLGA 4BNHA 1Y6JA 3DFZA 3RC1A 1D3AA 3LSYA 1ZEJA 2ZJ1A 3VPHA 4WNCA 2UDPA 4QEDA 3WSWA 4YT4A 1PJBA 2EF1A 4NIMA 5JBIA 2NVUA 3PQFA 4PLHA 3D0OA 1LJ8A 1ZVMA 2HRBA 2J5KA 4NFSA 5IAAA 2BRUA 2GZ2A 4YRDA 3IIEA 4UVDA 3RUHA 3JD1A 3EW7A 4Z9FA 1DOHA 5F1OA 4PLTA 4J4TA 3GGPA 3HHPA 3ASVA 1MGOA 3Q6IA 1MC5A 1IZ9A 1EQUA 2CY0A 2X4GA 3C1TA 2HDHA 4XQEA 1NYTA 2CUKA 1PTJA 3JQAD 4M86A 4R01A 4F6CA 1YKFA 1RPNA 4M55A 1RM4A 2C82A 4BQPA 1GUYA 3DAFA 3GA0A 3C7CB 3H8VA 4CM8B 2O50A 2FPPA 1E7WA 1P3DA 1E92A 1PJCA 2OORA 4XIJA 4CM5A 1UXJA 2PGDA 3FN4A 4DVJA 3KEOA 2XAAA 1DFIA 3NDJA 4II3A 4Q3NA 1X1TA 3GZ4A 1GR0A 1RM3A 3ZHBA 3GVCA 4RVUA 4Z0PA 5TF4A 3GG2A 3E82A 1RM0A 3PRJA 1Y8RB 5BSEA 2QRJA 5HS4A 4OQYA 4HFMA 5JSFA 3PHLA 2J3KA 3MJ4A 1BXZA 3ZWCA 1VJ1A 2BH9A 4NJMB 3W8EA 5JLAA 1HL3A 1P44A 2X22A 4YXFA 1DAPA 1U8XX 4GX2A 5FWNA 4J2OA 3WOHA 3FCOA 4NFYA 1ID1A 4CM1A 4BNUA 4E5KA 1LDNA 1LDYA 3NAQA 4E0BA 4C7JA 5KJ1A 3HE3A 1DPGA 5FYDA 2JJYA 2YQ4A 3JQCA 4J90A 4A10A 3L9WA 4CODB 4YRBA 2C2XA 2PD6A 3I9KA 2VYNA 5DN9A 1LEHA 3ZV6A 3PXXA 1ZMOA 3BTUA 2Z1MA 1KS9A 3MZ0A 3O4RA 5JCJD 4IDCA 1AUPA 5DBIA 1QSGA 3NDRA 1Y8RA 4JJGA 1NPTO 5EIOA 3WYBA 1R0LA 1E5LA 1N7GA 4CMBA 4B4OA 3DFUA 1QV6A 4O63O 5HBRA 1R6DA 3BMQB 4BNLA 3DBLA 2DQ4A 4PLZA 3RBZA 5DCUA 3GGOA 5L95A 4PZEA 3ZN2A 1EVIA 5JY1A 1K89A 1U3WA 3ZNNA 1VM6A 1EVYA 3WMWA 4GBJA 4WASA 4E12A 4PG5A 2DUUA 2DU8A 5FEUA 2PH3A 1GQQA 2GN4A 2CDAA 3OA0A 2VHVA 4J1QA 4EYEA 2IYPA 3DQPA 1J5PA 3ITDA 4J4BA 4XRRA 2E6UX 5G0SA 3I1JA 3H5NA 1RYEA 3WMXA 4D0SA 5JCXA 4D7AA 2VHYA 1X0XA 2E4AA 2NVBA 4DPKA 3ZHYA 4PLWA 2OL4A 4KDEA 1AGNA 3OQBA 3N7UA 3VTFA 4A7PA 2NUAA 1KEPA 3EMKA 3BMQA 2X58A 2HRZA 4D42A 3GVPA 2TMDA 2W4QA 3AI1A 1JA9A 3QWBA 3WQRA 1KY4A 3EHEA 3GK3A 5G4KB 4O5OA 4YPOA 4QUKA 1GD1O 4R5HA 4FFMA 4R54A 4UEOA 2X5KO 4UUMA 3QWIA 2JAHA 2A4KA 4XR9A 4ZRMA 3M1LA 3I23A 1NAHA 4M87A 1EVZA 5L9AA 2C5AA 1VJ0A 3HDYA 5DBGA 1DRVA 4GGPA 1YOVB 4B3IA 3X2EA 3H2SA 4FR5A 3ZV4A 4PN3A 3SC4A 4R16A 3H2ZA 3K5PA 3OH8A 1E0DA 4BGUA 4AJ2A 5T8KA 3WGIA 3DMTC 4IJUA 1E7YA 1A7KA 2FZWA 5L7WA 4QFDA 4R1SA 1WNTA 3FNHA 2B5VA 1B0AA 4O59O 1WVGA 1PGPA 1I33A 4HNGA 1ZFNA 2OOSA 3LF1A 5B12A 4O1MA 3IUPA 5F5LA 5KVSA 3C7DB 5ICMA 2XXJA 4LW8A 2YHIB 1ZJZA 3X2FA 4E31A 1U3UA 3BA1A 4GSKA 4KUGA 3RC2A 2BFPA 4NHEA 5A04A 1YGYA 2EGHA 2CF5A 3EZLA 2ZIZA 2VZ0A 3NRCA 1ONOA 2Q4BA 2O2SA 2WE7A 4DXHA 2IEBA 5TIIA 2BGKA 1WMBA 1HXHA 1YOVA 3HN2A 4DL9A 5CDUA 4XQ9A 1EUZA 4B4UA 4R5MA 6ADHA 4TSKA 1VI2A 4Y6PA 4E2YA 2NQ8A 1D4FA 1MXHA 2I9PA 3OETA 2CFCA 3QVWA 5F1PA 1S7CA 2P2SA 3ETEA 2OZPA 1BHSA 2HMTA 2FRDA 1ZO8A 3JYOA 1N92A 1YJ8A 4PLVA 1XWFA 2AEJA 3RCBA 3NTOA 4ZQGA 1AE1A 4L76A 1JVBA 2YHIA 4XGKA 2IXBA 6LDHA 1B8UA 3WR5A 3QVTA 3C85A 2WJPA 1QYXA 4E5NA 4WCFA 4DQUA 2I3AA 2X6TA 5B37A 1YH3A 2HK9A 2P9GA 4CLRA 4M49A 1K2WA 4A03A 1MX3A 3PFFA 4RZHA 1NR7A 3GH3A 4DQXA 5TJ9A 2X1HA 4JGBA 1Z82A 5JY6A 3VPXA 1LU9A 3LT0A 3FBGA 3G1UA 4KZPA 3AM4A 4XR4A 5EPOA 1VPDA 3Q0EA 3DBVO 5DP1A 3INGA 3JD2A 4S1VA 1NPDA 5K6AA 1OOEA 3JYQA 4MINA 2VZ8A 4ZVVA 3WG9A 3W8DA 2Y0CA 4IGEA 4GPD1 4ZRNA 2X5OA 4UUOA 2HSDA 3IL2A 3F4LA 3A06A 2QZZA 3DHYA 3K2EA 1YL6A 1ARZA 4RORA 3JD4A 4MVJM 1M6WA 3ZW9A 4C7KA 4F45A 4RVHA 5IN4A 3QLJA 4NJMA 5DCWA 2EKQA 4XRGA 1P0CA 1Q1NA 2C0CA 4OH1A 3TN7A 2JCVA 1Q7BA 5IG2A 3OJOA 1UXHA 2IZ0A 5ILGA 3SX2A 2YY7A 2AEMA 2NACA 2NWQA 4QO7A 4L4RA 4FFRA 4AJEA 2BI8A 3CEAA 2Y99A 4XA8A 1JW9B 3JTMA 3NYWA 3V1UA 4KUHA 2PGLA 3KUXA 1U7TA 3STHA 4EUFA 4YAKA 1GQ2A 1T2FA 2D8AA 3AW9A 4Y9DA 1B26A 5THKA 2ZYDA 4L4SA 2RCYA 4DYVA 1VKNA 3D64A 4CV2A 2YV2A 1UP4A 2I99A 1HSZA 4CM9D 1EE2A 1MXFA 2YYYA 3LT2A 1PEDA 5L4SA 1LDMA 2DM6A 2V6MA 3PZRA 4IMRA 5TRTA 3PP8A 4BNMA 4TWRA 2DTXA 1CQIA 4OOFA 3LLSA 3KHUA 4P22A 2FR8A 3DB2A 3NT5A 4JN6B 1LRKA 3WFJA 1EK6A 4XJSA 5L7YA 1NWHA 4MJLA 3ROQA 2O3RA 4JLWA 4CMJA 1BW9B 1UP7A 4DA9A 1KVQA 3AUAA 2YHUA 1M6HA 5JPIA 4DMLA 3GNSA 2YV3A 3K2BA 4R1NA 1MLDA 1MA0A 3CH6A 4OGWA 3HDJA 4ALMA 5JW6A 3LT1A 3FI9A 3H9JA 1H5QA 2YZ7A 2OFPA 3JQ6A 1B16A 4J9VA 1A9ZA 2IYOA 1A7AA 1LDBA 1DHTA 4BNZA 4D46A 3DWFA 2NTJA 2J5QA 3L0DA 5IN5A 4LMPA 1XIVA 2GZ3A 2ZYAA 3DAGA 3KETA 5CAEA 4J7UA 2AW5A 5L3ZA 1W0CA 1PJ4A 2BLLA 4XD2A 4DWVA 4WLNA 3JQAA 1LLQA 1WP4A 4B8ZA 4W7HA 2D2IA 3RU9A 1JKFA 1XYGA 2E82A 3AUUA 1IHXA 1R0SA 3RJ5A 3H5RA 1E6UA 4NR0A 2J6IA 4BKUA 3D1LA 3KZVA 3U62A 1GYPA 4J7CA 1F8GA 5CG1A 1EE9A 1R4NA 1HE3A 2Y1OA 5ENVA 3R6DA 3UHAA 1AN9A 3HSKA 2ZQYA 4J1SA 1HDCA 1E1KA 2DLDA 4FBGA 3TFOA 4L8VA 2B35A 4N54A 2PH5A 5AYVA 5C5IA 3FPLA 4HUJA 3DMYA 3WNQA 2A35A 1B3BA 1BDMA 1PS0A 4AVYA 4YR9A 3IUSA 3K92A 1NFQA 1R37A 2Q4EA 3UXYA 2CMDA 1N9GA 3RWBA 3U4HA 4CR7A 4WLFA 1F12A 1T2DA 4INAA 4BO0A 2AMFA 1YB1A 5I8ZA 5BNTA 1HZZA 1TLTA 1DC6A 1X15A 3UCFA 1WDMA 1H9AA 3WGZA 2CVZA 1CWUA 2GNAA 3F6YA 3LK7A 4BB6A 2QQ5A 3GLQA 4H16A 4YAIA 2X0JA 1IULA 3DZHA 3SJUA 4FB5A 4BUCA 2I66A 2C7VA 2PA3A 2WM3A 1LQTA 4QO8A 3CE6A 4E6PA 2PKQO 5JXWA 4WNIA 1LLUA 1E3SA 4NMHA 2Y1GA 4EJMA 5BNIA 4IQGA 3C1OA 3G1TA 4ONEA 3U4DA 4ND3A 4U7WA 4ZJUA 4DLBA 3N58A 1K6XA 1PJSA 3KO8A 3S1LA 1O94A 1Y9EA 4IM7A 4K9DA 1LNQA 1NWCA 3D3WA 4R1TA 4JNKA 1AXGA 3AUTA 2VTDA 2DTEA 3V1TC 2B37A 4I5GA 5ER6A 3Q2KA 1WWKA 3OJFA 3GFGA 4TKLA 1DHRA 2CF6A 3K8ZA 2PV7A 4HXYA 4DIOA 4LISA 1UDAA 3F5SA 2HUNA 3ENNA 3TWOA 5IXSA 4JJFA 4WK6A 4KOAA 5B4TA 3ZWXA 4E4YA 3BYZA 3HUDA 5DF1A 1LRJA 3GHYA 4NZ9A 1M67A 3HQ4O 2VWHA 1G1AA 3K73O 3PGXA 4G65A 4PVDA 4BMNA 5A9SB 1QYVA 4J0EA 4XZ3A 3UF0A 4AJJA 1BSVA 3QVXA 4YJFB 4J7XA 3U3XA 2JHFA 4A2CA 2I6TA 2FOIA 2WYUA 3JQFA 4WKGA 3FSRA 4XB1A 3DTTA 2IODA 3JQGB 1VKOA 4CLOB 3IS3A 1HLPA 3D3WB 3ZNQA 3PYLA 3IKVA 4CLEA 4TQGA 3AY6A 3AY7A 1WPQA 1DIHA 3SJ7A 4A27A 4FIZA 4QQRA 4W82A 2QG4A 1I0ZA 3UCEA 3SVTA 2OGUA 1E3EA 1RYDA 1ISGA 5MGBA 1SCUA 2VOJA 1P9LA 4N18A 5AXCA 1Y9AA 4CQMD 5EMHA 3RD5A 3AJRA 4CM7A 2EJVA 4MVJF 3NKLA 4U6QA 4Q3BA 5JCJA 3A28A 4QT0A 4CMEA 4N5MA 2CVQA 3GG9A 4YAEA 3HB5X 2ZATA 4QFCA 4PZCA 4CLOA 4I9NA 1YL7A 3UFXA 4MO2A 4P38A 2I76A 7ADHA 2BFMA 1ZK1A 5L53A 5L4NA 1UDCA 4BNIA 1EDZA 2IE0A 4FFOA 1IZ0A 4MIEA 3TZHA 4N5NA 1V8BA 3GVIA 1O89A 3JQ7A 3L4SO 4XGNA 3VVCA 4CLDA 4GI2A 5H81A 1IY8A 2C29D 2VRBA 3F9IA 1WMAA 1H6AA 2G5CA 4KTVE 5KKAA 3ZU3A 5IZ4A 1ADCA 3GC6A 4Q3EA 4BNFA 4YT2A 3RKUA 4FC7A 4DREA 1AHIA 2Q1WA 1E77A 2GUGA 3TL3A 4E5MA 3ZHZA 3PTZA 3BIOA 2J3JA 1A71A 3H3FA 4N7RA 4NU6A 2WWRA 1FDWA 4IPTA 1SB9A 1F0YA 2GASA 4YB8A 1C0IA 1BGVA 1QORA 4OMUA 1PJTA 4TZTA 4YCAA 4NPCA 3VZSA 5L4LA 5A5EA 1E6WA 1QP8A 1Z6ZA 2C5EA 3L6DA 4LN1A 2FR1A 4EGFA 3G17A 1YBMA 2X86A 3WTBA 1E7SA 4YQYA 4BQRA 3QY9A 2V65A 3OBBA 3G3EA 4YJGA 1O5IA 2XOXA 4URFA 2WD7A 3JQ7B 3UUWA 3JYNA 4EW6A 3RFVA 1HDRA 1XU9A 4YJDA 1LTHR 4YWJA 1KVRA 1RJWA 4H3VA 4R3NA 1KEVA 4I5FA 2VOEA 2HMVA 1PQUA 3ZWYA 2Q2WA 2ZB4A 4GWKA 1H2BA 2UYYA 5JAZA 1BXGB 4AJHA 1DSSG 1G0OA 5COQA 1JU9A 3ICPA 2GN6A 4B3JA 3LZ6A 2FR0A 1CQJA 4PG8A 4F3YA 4MPDA 3D7LA 4L75A 1ULUA 4UVHA 3CXRA 4ITUA 4XQGA 5IJZA 3PDUA 3GAFA 4NBWA 2VT3A 3MWDB 1U5AA 1FDTA 2OO5A 4BNTA 2I65A 2WD7B 1QYCA 4NU5A 5LCXA 3UICA 3ORFA 1IPEA 3L9XA 2Z5LA 5KVVA 4D3FA 5EERA 3AK4A 1DJNA 1ML3A 1VE9A 1ISHA 3IC5A 1DIRA 1DRUA 1ORRA 1QXSA 1T4BA 5U1PA 4BV9A 5H82A 3TOZA 3BTVA 1JAYA 3DZGA 3MJVA 1U9JA 3R1IA 2UAGA 1ZUD1 2IEDA 1A27A 2W2LD 4YDRA 1NNUA 1DJQA 3E9QA 1U4SA 4B3HA 3VAZA 4Q39A 4Z3DA 3EC7A 1EUCA 1NAIA 2PD4A 4R4JA 4YAJA 3WWYA 3WXBA 1HE4A 4NJOA 2D0IA 2BGMA 1N8KA 5GMOA 3PHIA 5BNFA 4J91A 3H6KA 1UXGA 4BNVA 2AQ8A 5JDIA 3ZWWA 1YQDA 5TQVA 1JKJA 2JL1A 3I4FA 5U4QA 4DPLA 4TRMA 3KYBA 1Q0QA 3LYLA 1OZAA 1PL8A 4IXTA 4J1NA 4LVUA 1JKIA 2NLOA 4ZA2A 1VL8A 2A9FA 5BSHA 2IZZA 1YJQA 4RQTA 3JV7A 1P1JA 4CMIB 1I5RA 3OSUA 4WE3A 3TZQA 4CR6A 1RM5A 3D3EA 2IZ1A 1ADGA 3ZWPA 1FDVA 4BV8A 2QW8A 1V35A 2FHSA 4FS3A 4WPGA 2BKAA 2W2KA 1HYHA 3F1LA 4R41A 1LLDA 1TB4A 4I08A 1Y1PA 3WDSA 5C37A 3AOEC 1E3JA 3LQFA 2O48X 4RLHA 4XIYA 4HY3A 3MCVA 2BFAA 2W98A 1T24A 4BNJA 4IUYA 4E33A 4BNXA 4GLLA 4RL6A 3GT0A 2Z95A 4AJPA 5CG2A 1LI4A 3JQGA 2JHGA 1PGOA 1PL7A 5ILOA 2ZYGA 1PS9A 1NASA 1K6IA 1FXSA 1K6JA 4P4LA 2HKIA 3M2PA 1ZEMA 4BO7A 4B8WA 4DBZA 1JTVA 4XX0A 2O4UX 5KKCA 2NU9A 2POQX 1PQPA 2VZ9A 3AOGA 1J4AA 2PZJA 2UUPA 4GMGA 5A3VA 5F21A 4FJ0A 3JQFC 4D3DA 4G2NA 4OKIA 4BO3A 3T7CA 5HS6A 3OQ1A 4R69A 2Y0DA 4OOEA 1BMDA 3GOHA 1TVEA 3VH1A 5IFLA 1HE5A 3P2YA 4JP2A 2EW8A 3KRTA 3KYDB 5EESA 3BAZA 3U0BA 3DAPA 1P1FA 1H0KA 5G4LA 1PJQA 2X0IA 1V9LA 3D4NA 2GSDA 4CQMB 3M2TA 2DBZA 1DC4A 3FNFA 3FRJA 1NR1A 1WXDA 3ABIA 3JD3A 2P9EA 4J49A 3RUDA 1I36A 5JAMA 5G2OA 1DEHA 1ZKMA 1JLLA 4PIVA 3V8BA 3WGQA 3ZCXA 1GPDG 1GZ4A 4DRYA 4CMEC 5KNLA 1D7OA 4DC0A 1NQOA 2HQ1A 4UEJA 1FMCA 1O6ZA 4MVJP 3MWEB 2VN8A 4GH5A 1XGKA 1HDGO 1Y5MA 3IP1A 4ID9A 1TA4A 1KVTA 2ILTA 2QX7A 3C1AA 4FD3A 1NFRA 1X0VA 4LMRA 2Y0EA 1AXEA 2EJWA 3EYWA 3AOEA 5B1YA 3WGYA 4CUKA 5GY7A 5IZCC 5K9ZA 5L45A 3ZWBA 2VYVA 3SLKA 1P33A 3GRKA 1LX6A 3AFNA 1QMGA 3ZNOA 5AQ1A 1T2AA 4HX5A 1ZH8A 4Z9XA 1I2ZA 1KVUA 2X9VA 3AU9A 4PZDA 4OXKA 4BKQA 4ALIA 5A02A 2DFVA 3L4BC 3B1JA 4CUJA 4P8RA 3ST7A 3EGOA 3L07A 4CQLA 5I7SA 3QV1A 1H6BA 2QZ9A 3E8XA 4M1QA 1GZ3A 5TT1A 1EEHA 4D43A 3AFMA 2JAPA 5TS3A 3EZYA 4WUVA 2YDYA 1QR6A 2NU6A 3AU8A 4QX6A 3PJFA 4PG4A 5JDCA 1DLIA 5KWEA 8LDHA 1V0JA 4E32A 5JO0A 4NI5A 1J6UA 3CMMA 3V1YA 3Q9NA 1P1KA 2AG8A 1YVEI 4WCDA 4LVCA 1V6AA 4WEOA 2D5AA 1YE3A 3W6UA 3QQPA 5IF3A 3GUCA 1X7DA 1Y7TA 4R3WA 1GAEO 4WCFB 4GGOA 3ZGYA 4L74A 1M76A 3SC6A 1GCOA 4H7PA 4E21A 3S2IA 1Q0LA 4A0SA 3NT2A 2H1SA 5JC8A 5JAQA 3KSZO 3AI3A 4MIYA 3H9EO 1U1IA 4P4NA 3ANLA 1P1IA 3ETGA 4BMSA 4ND2A 3WJAA 1B8VA 2P5UA 3UH1A 1FF9A 4BNKA 1L7EA 1XSEA 2ZTUA 3CUKA 5AXDA 4DYDA 3JD0A 4GKBA 3EK2A 1HDOA 2Q2VA 2B83A 4IIUA 1NTOA 2RBEA 1E7QA 3S2GA 5EN4A 2B5WA 3NGLA 5KVCA 4MP8A 1CIVA 3VZRA 4Q3CA 2V6GA 3KV3O 1QLJA 1Z74A 2GN9A 2EEZA 5JAIA 1KERA 2D3TA 2CDBA 1QYDA 3HZZA 1T26A 3VPSA 4NG5A 1NP3A 4RVSA 3EAGA 4DLAA 1NHGA 2P9CA 4ZU3A 4BGVA 1D1SA 2YFHA 3WIDA 1J0XO 3OMLA 3BMOB 1VSVA 1GY8A 1XG5A 3ETDA 5IDYA 2YV1A 4GLOA 4BNNA 4MOWA 4CMIA 2NU7A 4BIIA 3PDJA 2DAPA 3L6OO 2OBNA 4BO2A 4M8SA 2AXQA 2HJSA 2VYND 3VDRA 2PZMA 5KIAA 2O23A 5CPFA 2GF2A 1B14A 3SXPA 5JNLA 2PKRA 3PHHA 4D45A 5CDYA 1NFFA 3E5RA 4GX5A 2QYSA 4FSHA 3B70A 3RAJA 3VVBA 3H65A 1SEPA 2WE8A 4TRNA 1LQUA 3KSDO 4BNYA 4RPKA 3WBBA 2BGLA 2PY6A 3OIGA 1SB8A 4EBFA 5B4UA 3ZWAA 4NK4A 2DFDA 4RZIA 2NNLD 3MJCA 4RCVA 2FPIA 3ROMA 3HDQA 4UREA 2VNAA 4WLEA 1PZEA 3DDNA 1YDWA 4E2ZA 4CM9A 1KEUA 1EMDA 1E3WB 2J3IA 3RROA 1T2CA 3ZV3A 5AVOA 1E6EA 2YDXA 4YVFA 1XR3A 3D5TA 4YJHA 2NU8A 3VZPA 1A4UA 4AG3A 4IDGA 3A14A 1KEWA 3RI3A 1VJTA 2Q1SA 3K30A 4ZQHA 1U4OA 4OSPA 3GEMA 3WX0A 4BKRA 2FN7A 2G17A 4UVEA 2I67A 3G49A 1UJMA 5A5FA 3H9GA 3HB4X 4II2A 1E5QA 4DGSA 3WGOA 4CUZA 2JD0A 4DBVO 2BD0A 1ZIDA 1P1RA 4IJWA 4IQ0A 1DXYA 3CINA 1ENPA 1Q7CA 5FFFA 1DFGA 1HF3A 4RGBA 3NEPX 2GO1A 4E30A 2DKNA 1I10A 2GD1O 5JS6A 1FDSA 1ISIA 4MVJA 7MDHA 2ZK7A 5F3RA 2O3SA 4PVCA 3U49A 1ISJA 2P5YA 1I01A 2CDCA 3G0OA 3QIVA 4L4XA 4BKOA 4NBTA 1GYQA 4KDFA 4FFNA 1IL0A 2DTDA 5F5NA 5C7LO 5GZ3A 2AG5A 3CZRA 3VH4A 3FD8A 4WLOA 1IE3A 4K26A 2EERA 2EGGA 3R0IA 1VL0A 1HDYA 3OHSX 4WECA 4EJ6A 4IQ8A 4W9NA 2Q46A 1XDWA 4BNGA 4OSOA 4OYRA 4RF4A 2VWGA 5JMWA 3VOSA 3S2EA 4IDFA 2V7PA 2YUTA 2VTEA 3F47A 3M6IA 4BGEA 2WSBA 2FMUA 2C7GA 1Z45A 2C59A 2CVOA 4PFJA 4TVOA 3WIEA 4RDHA 1HTBA 4UUPA 4BO6A 1NBOA 1QYWA 4ALJA 5KOIA 4RV9A 1N2SA 4CLRB 3VKVA 5IXYA 4J9UE 5ENDA 4CMGA 3CMCO 1GL3A 5T5QA 1QV7A 3QWHA 2ZTMA 1ZK3A 1ZNQO 5COBA 3W6ZA 2ZTVA 5H83A 3U09A 2EKLA 5LDGA 3VC7A 5KJ6A 2C2YA 3P7MA 1U2DA 3PQEA 1YB5A 2PGJA 3TNLA 3MJSA 3FNGA 4ND5A 4LCJA 5TSDA 5KTKA 1W6UA 3QVSA 3OEWA 2P68A 3FPCA 4AJ1A 3H3JA 3RSHA 2C20A 3WLEA 5BSGA 5L7TA 1PZHA 3ZHXA 1S6YA 2VRCD 3R3SA 4B4WA 4LRSB 1PZGA 2XF8A 1YONA 2NM0A 3TF5A 5DDIP 2RIRA 3FWZA 4BL5A 4ZD6A 4MVJI 4UVIA 5LC1A 1RWBA 9LDBA 2PZKA 2G0TA 1T4DA 4CL3A 3UCXA 1GADO 1LXCA 5A9SA 4BO5A 3IQDB 2W2LA 4XKJA 5DOZA 3ZH2A 4E2WA 1I32A 4KMSA 3WLFA 2FSVA 5A3JA 1Q7GA 1X7HA 1UZLA 1F17A 3WGGA 5L40A 3E1KA 1YL5A 4PLFA 1JDJA 4GSLA 3GPDG 4W4TA 4R1UA 4BVAA 4K6FA 3RJ9A 3QRWA 2V6BA 4I1IA 2UUOA 4ZHSA 4EUHA 3GDFA 1PZFA 3TZCA 1ZBQA 1OAAA 2D4AA 1C0PA 4GVLA 3W1VA 3GGGA 2Y1FA 1LUAA 3T7EA 1XA0A 4DTIA 1PU2A 4RO0A 4PRLA 4B79A 4XDYA 3HN7A 4HNHA 4U0KA 1UR5A 4RVGA 2RAFA 3IDSA 4OKNA 3OQ6A 3MTJA 3G79A 1I3LA 3BHMA 4NNJA 4LRTB 4CLXA 5I8WA 2W90A 4D44A 4O6VA 5I7FA 5T6BA 1F14A 4B7CA 1Z75A 2IRWA 4GWGA 1LSJA 3VZQA 4NFHA 3R3JA 1K5HA 5A06A 3F3SA 3AI2A 3V2UA 1W4ZA 3U5TA 2JKVA 5A9RA 3LVFO 4XDZA 2X0NA 1DLJA 3LT4A 3VDQA 5CEJA 1WAMA 2VHXA 5JE8A 3ZDFA 2HU2A 1N5DA 4B4VA 4DC1A 1Q0HA 2WTBA 3UAGA 1O0SA 4ROSA 4W99A 1NX6A 3D4PA 4KQXA 5CHEA 1T25A 3I3OA 1TT5A 3KEQA 1R66A 4D3SA 3K9QO 4Y98A 1Z73A 3K6JA 3PWZA 3QSGA 3TRIA 1IPFA 1GEGA 4BO1A 4CV0A 1EDOA 2OUIA 2E49A 4Z0HO 1PGQA 4PRKA 4LCEA 2NVUB 3DHEA 3GPIA 3FTPA 2HJRA 3AWDA 1HSOA 3ZWVA 1KETA 2FSSA 3N74A 2HK7A 3JSAA 3TJRA 2WD8A 3GEGA 1QRRA 4LSMA 1BTOA 3HNPA 2EW2A 4TKMA 4ZQEA 5JDCC 1PJ2A 1NQAO 2YJZA 3ZI0A 3W4JA 3JQ8A 3PWKA 2PD3A 5HRUA 3EDMA 1LLCA 3GNQA 2LDBA 5KVQA 4BGIA 3DOOA 4GL4A 1D1TA 1X14A 2VCYA 3ROPA 4FCCA 3QA9A 4OIMA 1T2EA 4PG7A 3Q1LA 4CR8A 4JCOA 1WLYA 3GN1A 4FFPA 1KC1A 3NV9A 5JMPA 1N9GB 1FK8A 5AOVA 3WSVA 1BXGA 2O3TA 4CMKA 2VRCA 4K28A 1BVRA 3FWNA 1PR3A 5AXBA 3CIFA 2ZTLA 1WW8A 1I2BA 1KYQA 3C7AA 4HKTA 3MJTA 2EWMA 1MFZA 4FPXA 1EZ4A 2X7HA 5JYDA 2VUTA 4KWHA 4AJNA 3ULKA 2Y05A 3MOGA 2VUSA 2XXBA 4FFLA 4IJKA 5EQFA 1BVUA 2WYWA 4BOYA 2GRAA 2UV8A 2ZKLA 3RC7A 3RUIA 2Z1NA 2PNFA 1CERA 2VYVD 4P4GA 3NTRA 3PEFA 1IUKA 1HZJA 4IIVA 4J6FA 1ISMA 2B69A 4RF2A 1LC0A 2AA3A 1I3KA 2Q50A 5A1TA 1DC3A 3QWAA 1KIFA 4HFRA 2HAEA 5C7IO 3TPCA 4U6SA 3L6EA 3PJGA 4QXMA 1XKQA 3FNEA 2BFOA 4YQZA 5JO9A 1P0FA 2ZB3A 3A4VA 3KSUA 2BHLA 1P77A 1J49A 1NVMB 2AE2A 2Y66A 1CJCA 4PCVA 4UAGA 3LC2O 3OJ0A 3NJ4A 4OXNA 1LC3A 4GAEA 3DBLB 1UUFA 1IYZA 5COAA 1VRWA 2IXAA 3ENKA 1RKXA 3LU1A 4PG6A 3E9MA 5G0UA 1OI7A 1YQGA
chains in the Genus database with same CATH superfamily
3QFSA 4XYEA 4DLXA 4BZWA 4RXUA 1J1UA 2NPOA 3RRJA 2FWIA 3C3YA 4K1LA 4WKPA 2P9YA 4J3NA 3WLTA 2AR7A 4E5PA 3T3NA 4PGFA 1GUFA 1JHZA 1QCDA 5ALPA 5AVJA 1Y8CA 3K4HA 3V2GA 4MLZA 3OHPA 4KITB 2JCYA 1QK3A 3AZOA 1IN4A 1RJ9B 2IUEA 1VIDA 1B0ZA 3LXMA 1S2OA 2CFRA 1TNDA 2ZM5A 1SMKA 2WUFA 1Z15A 3JVDA 4FX5A 2GXQA 3NYRA 1SCUB 4P3XA 3T0GA 3ASZA 1N3YA 4IAOA 5EZ5A 1RCFA 3LDHA 5A9TA 3ZEAA 5HJ5A 3GHHA 3HCEA 3K09A 1KNQA 1OX4A 2PSDA 3AM3A 3R3ZA 3TLGA 1KRHA 4GC5A 2VPYA 2TMYA 2OUKA 2OPHA 3HJAA 4DDTA 5ICCA 5BSWA 5K4AA 4FOOA 3WBJA 2F55A 4B80A 1R9JA 2ZUSA 3FSGD 3WGJA 1Z38A 4Q16A 4JS0A 1H2RS 4AS3A 2EP5A 3ZU6A 3M1AA 3K0SA 1K6EA 3BTOA 3KLMX 2B20A 5ITVA 2IV3A 1BDJA 3KBOA 3R5SA 3NTVA 3EXAA 4IIJF 3HCCA 5J23A 1M0WA 2WDZA 5IUJC 2EIHA 1YBAA 2QS9A 1D2MA 1II0A 2ZRBA 4BPRA 1EFLA 3PHGA 1MJFA 4PO9A 4QJ5A 4P5PA 3KJXA 2AJ8A 5T4EA 2R96A 2B1JA 3Q88A 3AVVA 1HRDA 1N7IA 1I9GA 3H1EA 4OYHA 5CFZA 3KB6A 4BUJA 3I01A 2FQXA 1YZYA 3HJBA 3PJRA 3EQ7A 2VP5A 2BP7A 2GYYA 2N75A 1I0IA 4DR5B 4KR9A 4EKYA 1KNXA 3WQSB 4B3FX 4JP3A 4JLKA 4YLEA 4H15A 4G9EA 1SBQA 5CM2Z 1LPSA 4JB3A 1W2GA 5B53A 1CIPA 1DXQA 3SAJA 1T2NA 1U9ZA 1G8HA 4GPEA 2R5NA 2WHEA 4M54A 4ENSA 3EX7C 1N36B 4ER3A 3DLIA 1TO1E 4IS2A 2XDWA 3H2IA 3W2TA 4RMJA 1U8FO 3L8FA 2VQEB 1N2OA 3C3PA 3NGXA 4I1RA 5I7RA 4YJGB 2PMEA 1G64A 2HSZA 5TPZD 4MVJE 3MSCA 3GEBA 5J5CA 3M81A 5C7YA 1R18A 2QYOA 4IJ6A 3KQUA 4NEHB 1T3SA 5CX4A 3B8HA 5FB3A 2HQRA 1WM1A 4JP1A 2YYAA 3EFBA 3TVTA 2ZJ2A 1MAVA 2R2GA 3C6XA 1G3RA 3RS7A 3UA3A 3K9BA 1NQTA 4N12A 2BP7B 4OLAA 4PYIA 3JXEA 1LSOA 1R6AA 2DQZA 3D8RA 3TLZA 4YHBA 5D3ZA 1GTL1 1T9DA 1E79D 1R8YA 4CIDA 2PRSA 4P84A 3M5DA 1R4MB 2WR8A 1R0BA 3KDSE 2OO7A 4GC9A 4OLJA 4PQGA 2QA5A 3O38A 5K0ZA 2J4CA 1W94A 5AKXA 1A2QA 3OWOA 5JAHA 3O9ZA 1EM8A 1ZIPA 1O4WA 1JNYA 2QD3A 4KKVA 3EMVA 1AQ6A 2ZOSA 3CW9A 4Q3AA 4IMIB 5DCLA 1GCUA 4JJEA 3F8SA 2DHCA 3BQNB 3DZBA 5IC5A 2L17A 4JL6A 1MABA 1GPUA 3JQ8B 4U7FA 1G3MA 3LX8A 3IHLA 1GGHA 3UZUA 3GLIE 1UZUA 2JGAA 1H6DA 3PNQA 4MV1A 4OX9Y 2C94A 4WL0A 1QVVA 1UXIA 2INGX 2OV1A 2D59A 2QHXA 3ASUA 3WYEA 2ECQA 5M34A 3WK7A 4BHTA 5UKDA 2P5SA 1D1PA 3QWFA 4GVXA 1I2CA 1Z88A 4PCUA 1JIJA 2NO9A 3GJYA 2EZ8A 3QHAA 1I6WA 4J3JA 5ALUA 3WB2A 1SPXA 1U1DA 3C8ZA 1US8B 4OO3A 1Y37A 3WXMA 1R4MA 1W75A 4RHUA 2YUIA 3T38A 1YDHA 2UYQA 3GLHB 4US1R 5E7QA 3TZLA 1MZVA 1KZ6A 1XQ1A 4DM4A 2E5FA 3VZBA 1WMFA 1Z4LA 3D4IA 3ZCQA 4O4JF 1C41A 2NVWA 3FCYA 4ENPA 5LUAA 3G0HA 2Y1DA 1DAOA 5JTTA 3H2YA 5CVVA 5FA6A 3T35A 1C7EA 5BWNA 4LBZA 1TK3A 2R85A 1IK6A 1OA1A 1E7MA 4FMBB 5EXSA 3L8ZA 5TEVA 4UTPA 4JSRA 2GB4A 2P3LA 4YY3B 2DULA 3AVYA 4DIDA 4JKOA 4TGLA 2FJPA 1G19A 2J31A 4LDZA 3IVRA 4JLNA 4WJLA 3SYNA 1KO7A 2DPLA 4FGSA 4WESA 4DLLA 1OH7A 1COZA 4WKOA 2GTIA 3SM3A 2DZDA 3W8FA 4GDMA 2H08A 1Q44A 3GP3A 1XZEA 3GAMA 3NIGB 4QPJC 4OQXA 3FPBA 3BBPA 1RE1A 2BTQB 5JT1A 3JQRA 3V7YA 4EB3A 2WDPA 3M34A 1DEAA 3I9V1 2V7EA 1QQ6A 2Q8NA 1YK0A 1PUXA 1Q15A 5G41A 4CIXA 4MHSA 3RSOA 3N53A 1X94A 4KP7A 1U6JA 2YQ5A 2QZPA 2QTRA 4N5LA 4TMTA 5KWIA 2GH1A 5H70A 2D4HA 1G8GA 2Y71A 3FR8A 4O4JB 1QHYA 3I2FA 1J8DA 3H86A 5IYZF 1F4LA 1D5WA 2XAUA 3N2GB 3Q7EA 3BHNA 4MGEA 1K7YA 2WU0A 4NBUA 1JIXA 4AUEA 4IXWA 2I78A 1NVAA 3CF4A 2UVQA 2CHEA 3RVBA 2QD2A 3NNDA 3Q3HA 2R44A 4ZYZA 3QLTA 4D41A 3TIGA 3P19A 2XRMA 3EHDA 4ZGWA 4EEXA 2F62A 3VR6H 1F51E 3LQ2A 5J9FA 3CGWA 5EQDA 1PX0A 1VJ5A 4X54A 4F38A 2FPGA 4KC0A 4IDNA 3TO5A 4AQDA 4Y6RA 2QM7A 4LE0A 2JFBA 2OXIA 4DCNA 1CJUC 1G18A 1Y6RA 2R86A 3ZUPA 1C1XB 1EFKA 1THGA 4V03A 1KDYA 2V0GA 2WW8A 2GFQA 4L15A 2NPFA 2CCKA 1SVIA 4BKPA 3LBFA 3SFVA 3RT1A 5I7VA 1L7XA 1U80A 1EBUA 2QZJA 3JQBA 1Z6XA 3IIMA 3KUUA 5FPHA 4XYMA 3RJTA 3M3HA 3ANXA 5D6NA 4QDXA 1UPTA 3DR3A 3CZ5A 1TQ8A 2DMRA 3RUAA 4XYLA 4JQSA 4O2LA 2O2XA 4MROA 1T6ZA 2AZDA 5B7GA 1COWA 4KUEA 4F4CA 2Q2QA 3RKRA 2B1QA 3COSA 5DBOA 3DNMA 5HM6A 4HV4A 2VXCA 2JZCA 3FHOA 4R1PA 4CMCA 2IXEA 3KYDA 1DFHA 2EFGA 1ADYA 1M34B 4QVKA 1SULA 3JQAB 3R20A 2DQSA 3UK7A 4CTJA 1KEEB 3LYHA 2OQRA 4JL8A 5BN3B 1ZA1A 4IYRA 4M60A 1HG1A 4IX1A 2OBYA 4EHJA 1AUOA 1G6HA 2OG2A 2C54A 1BVYF 2FRXA 3E1SA 4A82A 3JZAA 4XSHA 5GONF 4UDYX 1KSHA 1ZN2A 3HUUA 1C1XA 2WTMA 1LNSA 2Q1TA 4GYJA 4L73A 5ITWA 3L0CA 1JHRA 1H0RA 4GOXA 3E9CA 1ZJJA 1FX1A 3FMPB 4Q9NA 4Q4AA 4PSUA 3ZYCA 4AL4A 4BFLA 4DVGA 3W78A 3MVEA 1FJGB 1KJJA 4IHKA 2MIIA 2C9MA 3AUSA 3JALB 2NXJA 3KHSA 4TROA 3ROTA 1XTKA 3QKSB 1W9HA 5CDSA 3GT4A 1RZVA 1UKZA 5JWRA 1NLZA 2DVMA 1IB0A 4XB2A 1R0XA 1P45A 1PR9A 2M9MA 2EX1A 3IAAA 1VE6A 3RVDA 1SK9A 1W5BA 4HWKA 1NDUA 4CTMA 1ZSNA 3LLVA 3E8SA 2O0MA 2AG6A 2VR1A 1QJCA 4YO7A 5FLKA 1V26A 1XKLA 3F8TA 2NTVA 3B48A 4LHYA 5K3BA 1EFRD 1U7ZA 1KEEA 4KR2A 2Y0BA 3HCRA 3HWX1 4JIGA 5EZYB 4ICIA 4ZQBA 3OBIA 4GFDA 4KO8A 3TRFA 1B41A 3UOWA 3WKCA 4M9CA 4FC6A 2GN8A 3I2GA 3FROA 1GXSB 1FUEA 2HK8A 4O4HB 4OK5A 1Y9JA 5E7JA 4UMEA 5EIEA 1MUUA 4H6PA 3LS2A 4RA6B 1ZSYA 3D02A 3C8UA 5EVJA 4UFOA 1AK9A 1T5OA 3E5MA 5FTJA 4TN5A 4E2XA 1YJ5A 1W8DA 2QUKA 3RIMA 1ECJA 4JA2A 3AETB 3FBTA 2WHQA 3LW8A 1OBFO 2XGOA 3QPUA 4JNCA 5CP8A 1Z4PX 3SBXA 1SOMA 5C7OO 3M33A 2BYTA 3IQFA 2DC1A 3GYBA 4Q9KA 2QTCA 4NH4A 1JIVA 1RRKA 4DRZA 4KFSA 4R9RA 3CISA 1X42A 4QAQA 3SZUA 4F72A 2F4VB 1C30B 4LJKA 1R12A 4INPA 1JYFA 2HX1A 2JVKA 4BN4A 4EHKA 1OX6A 2Q99A 3T0FA 4MAFA 1Z4JA 5I9IA 4ZZ2A 1FMLA 4MS1A 1K92A 2BF4A 3FPEA 4MUBA 3CZ4A 5A2GA 4M0MA 4B84A 2ECPA 2H52A 1ZMTA 1WVMA 1BWSA 3Q4GA 4LXTA 5AJZA 5FIUA 4B47A 1X7WB 3Q9UA 3MD9A 1UZMA 1C3VA 1GFSA 1YWGO 4ND4A 3TLJA 3T5CA 2BGTA 3PUJA 1WP9A 1GGKA 3KFVA 3O7MA 2W0SA 3OEYA 2P41A 5KCZA 2AF4C 3TW0A 4BBPA 2HCBA 3HU1A 3R75A 1L5YA 3EOAI 5U9CA 3ORRA 3A9UA 4MULA 3UJHA 4DMMA 4U2CA 5A5DA 2FI1A 3DL2A 5BW5A 1E2QA 2H8GA 3BHIA 5C0OE 6YASA 1YIAA 2D1YA 2ZCVA 5CLHA 4NBRA 2GLUA 4YJFA 4MI3A 1DJOA 1HT2E 2IXFA 2PYZA 4NOMA 4ZXPA 1WV0A 5GJCA 1UP6A 4G0VA 2COEA 2XDAA 4H31A 4BFUA 3TLYA 1KHHA 1Q1QA 3MOIA 2Z3VA 1K97A 2H3HA 4CEJA 2C1EA 3LMKA 3PICA 1P4SA 4FCTA 3KZMA 4JL5A 4ZEOA 3FWYA 5HM8A 2X13A 4E3ZA 1M6EX 3ESZA 1HFEL 2X4DA 4EMSA 4EYGA 3PVZA 4FHCA 3ZE1B 4TMVA 1N2EA 2YN2A 1SXQA 2KW5A 4UDNA 3VUEA 4EWLA 4RDXA 4KHPB 3WIBA 1CQIB 5ES3A 3WLKX 1Y7PA 1VHTA 3JASB 1ISRA 4MS4A 4C4TA 2BHRA 2I55A 2MSWA 4CFSA 3AR8A 1DPFA 3KSBC 5J2UB 1S9HA 2AFVA 2IIQA 2OCDA 1UK9A 2PX3A 2AQHA 2VK2A 3IAS6 3ITKA 3MTGA 2F3UA 2V98A 1Q7TA 2R8RA 3R0JA 1SC3A 1FTWA 3SC3A 5B4VA 5HUJA 4OQQA 2OFOA 1OQAA 1BXKA 5DYWA 4B40A 3TEFA 2PUEA 1Z0AA 4MP3A 3W0LB 2ZW9A 2H8KA 3MCTA 3Q72A 1E3IA 1SH7A 4KR0A 1O9BA 4R2MA 1Y0BA 4LZOA 4TKUB 3ZU5A 1HTTA 4PC6A 1GKLA 1G8JA 2WM2A 4LSWA 1LJUA 6ABPA 2GM3A 3TSOA 2XUIA 3DDUA 1B42A 3EEIA 4XCVA 3TNYA 1NVXQ 3MK31 2JLUA 2QTZA 2ZYVX 2OBXA 3GNLA 1F2TB 3IBFA 3OQIB 5JXJA 5JBQA 2VNKA 4WZAB 3MMXA 3KS9A 1OVGA 4QPDA 4NKRA 4ARUA 3ZNPA 2JIZD 5JD6A 5MF6A 3AYZB 2V74B 1T13A 2A5GA 1CZNA 3DBIA 4LZAA 4ZVKA 2AC2A 1Y1KE 2HHCA 3A3KA 3DOJA 3HJUA 1KE2A 3RTEA 1IEWA 1T8RA 5JEEA 1PP4A 3OIFA 1L7DA 1M1NA 1Q16A 3B1FA 2B4QA 3CKYA 4QBTA 5F7ZA 1UWVA 3SICE 5ICSA 3ANMA 1RAFA 3HR8A 3BN3A 2UUAB 2H6EA 5AXAA 1WW2A 4A8TA 1JPVA 1YQTA 3BE4A 4XWAA 3SZLA 5FUQA 3VM6A 2XEXA 3HV2A 5A4DA 4J8PA 1ZMRA 4YJHB 4ZVQA 4CL8A 1DAFA 3I8OA 4IH4A 4AXXA 4U4AA 1SXPA 3DMHA 1DNPA 2CKMA 4MDYA 4YONB 4D79A 4ZP1A 5A5GA 2AN4A 3JPYA 4M1WA 1TU0A 2QTVB 4IIGA 5CFPA 2TYSB 4A0QA 4J3FA 3UW3A 2JEYA 2MSEB 1IBRA 2DT5A 1CUZA 3UAYA 2G0AA 5LQKA 3DL7A 3T1HB 1TT5B 2ZVDA 2GZDA 3O4GA 4QQKA 1V9CA 4NV1A 4WOJA 3W7VA 2R7AA 3JQBC 2WF5A 2FQ1A 1QF9A 1QE3A 4XPZA 2CUNA 1M1NB 1YDFA 4MRNA 1SVSA 5KDOA 1XTSA 3GD7A 3VR6A 3PEEA 2JD2A 3VVLA 1IUPA 1W88A 2ZJ8A 1T1RA 5JSYA 3UK0A 3LXXA 4CJXA 4C7MA 5JJLA 1AG9A 2FW9A 1RTKA 3L0ZA 4CM6A 2QSUA 2YJTD 3ZQ4A 5E3HA 4UJ3A 4FZJA 2ZBGA 1LFAA 4XH9B 5IZCA 4HRVA 4LWQA 1EUDA 2I6GA 2YW9A 4MQEB 4W5NA 2WC1A 4YRJA 2GPNA 3QUAA 1FL9A 1LV8A 3NIDB 3BH0A 4BQQA 3RU7A 2GM4A 4UPVA 3V7WA 1N33B 2VZEA 1U02A 4W1RA 3CURA 3CG0A 1FCJA 2D62A 4OXYA 1KRWA 3WBFA 3UA4A 3QUSA 2QTVA 4I81A 4Q7LA 2SCUA 3JYPA 4N9QA 1U7PA 3RYHA 4CKCA 1ZWKA 2OHXA 4XVCA 2G76A 4LSZA 3KKZA 4XUGB 3TSCA 1CZOA 3VPFA 3EVNA 3KZ1E 4YEDA 3SEFA 1W47A 2ENWA 4LY9A 3GCGA 3W7BA 3TLMA 3QFRA 5LLDA 1A8IA 3PK0A 2VNSA 3O5AA 3EPJA 4MR7A 3FVQA 5K05A 2O06A 3H5LA 1NOIA 4RYDA 4GI5A 2PR7A 4GZMA 3GNTA 2FWMX 5BN4B 3RSSA 5BWBA 4TWIA 4Y8VA 1IIRA 3PQ5A 4UUBA 2G1AA 3DXFA 3V6LA 4C0LA 1YCDA 5BQ3A 4M0EA 3OZGA 4YLGA 4I55F 2F8TA 1A9YA 2CXQA 2V6FA 2VH1A 1G5PA 3HCAA 4LKOA 4MKZA 4OMCA 4Q21A 3FLAA 4U2FA 3WK9A 5B2FA 2PCJA 4MVJD 1WZUA 1JN0A 3ANSA 2HRQA 4XJTA 1ZMBA 3QYPA 1PSDA 1SCNE 3C8MA 3E23A 3HRKA 4DG8A 5CXUA 1VCMA 4OD0A 5TNXA 5LQCA 4R8KA 2UUBB 4OLBA 4EUEA 5EYPA 1A9RA 4JYCA 1AGYA 2RI6A 4NBNA 4KQ6A 3Q8MA 3BHJA 4RE5A 1NTRA 2P67A 1X13A 2ADFA 4F2WA 1ZKDA 3N2ZB 3QE4A 4EW1A 3YASA 1W36B 1RHMA 2XBUA 3PLNA 1Y1TA 3GRPA 4WOKA 1FQOA 3AV3A 3L7YA 2B4RO 1UK6A 4MR7B 1PN3A 1QG6A 4MYRA 1MC1A 2EBUA 4G5FA 2UXDB 2IHYA 3NUQA 3GOQA 1A8QA 1MG5A 3HXLA 4DZZA 5BN4A 1G8YA 4DV4B 5AJTA 4EGCB 3VKFA 2R8XA 1K6MA 4GYYA 1A2BA 4ZVSA 5B6JA 4DSOA 4UCQA 3ZLJA 3U3KA 2QX8A 3AINA 3AG6A 1JVSA 1R64A 5I9MA 2LCQA 1W85B 3LUGA 2WEKA 2DY1A 1DBWA 2O2JA 2VKQA 3B8EA 4I14A 3JRNA 3O90A 4HGOA 3IJ5A 1ICEA 2EC5A 4ARCA 4E5NA 1FTYA 1ZHOA 1BROA 4GO1A 4RZQA 2AXPA 2HIMA 3UN1A 1IC6A 1EUQA 2C96A 4CV3A 1DARA 4BDTA 2O3JA 4BO4A 1BN7A 2WJIA 3UV3A 1OXBB 1WE2A 4EUKA 1S8OA 3IUMA 4AZSA 4Q82A 2QR2A 4MDHA 4F5YA 1PLJA 2HF2A 1X1EA 1EWVA 5BORA 2OM2A 3ZWOA 3M70A 4J1TA 4ZCMA 1M6NA 4NBVA 4OL0A 5DYTA 2IYFA 4RWZA 4N5IX 5DEIA 5JJKA 3TMKA 1U0FA 5TT0A 3RGGA 3OCCA 5HZKA 3GXOA 3BGVA 4MKRA 3W4IA 5JD5A 1O57A 3JR7A 1EVKA 1XYVA 3ZE0B 5BT8A 3F9RA 3SQXA 4ARAA 5B3JA 1GTMA 2OV8A 4ZTBA 1IUOA 4IX9A 5ADWA 2DBVO 1U4NA 1ZU5A 3N2EA 4MRSA 1CRWG 2X0RA 2PZLA 3DYBA 1OIWA 3L4KA 2NP6A 1FQKA 1Q3KA 3JCZA 3SC2B 1KP9A 1YZLA 1M2EA 1SFRA 3P2OA 3OLCX 2A92A 4Z3KA 3AY3A 5E1MA 2ZRHA 3OLYA 2ZXEA 3BFVA 4ZT7A 3ACCA 3LO5A 3C87A 1I7PA 1AV7A 2Q3FA 3IQGX 3UO8B 5JAUA 1F60A 1Z2EA 1E58A 2DUMA 3CZMA 5DWDA 5DGTA 4HWGA 4IUDS 3H9QA 1M54A 2Q6LA 1USUA 2QDXA 1E1MA 1P9RA 3LPAA 1JJIA 1YBVA 1GNSA 1M2VB 1FRQA 3RSQA 1JBQA 3OKFA 1NM5A 2J67A 1I3NA 1TZMA 1PWEA 4XYGA 1NE7A 1KU6A 3D2AA 4XWOA 1L2TA 3C3XA 2FRDC 1QQBA 4H0NA 3BE5A 3PKIA 3IEXA 2O7QA 1J25A 4HTAA 4QATA 8ADHA 2ZJ0A 1E3LA 4J03A 3MJRA 1XVIA 5EWLB 2Y67A 2XIJA 4KSBA 4BB0A 3J7TA 2Q3JA 1ECCA 1FLVA 4R3UC 1O08A 2XTZA 1DXOA 1I30A 1TA9A 2CBXA 4HLQB 1I7QB 4UDXX 4B2PA 1RKQA 1LA2A 1GDHA 2WJGA 3MEQA 3RC8A 1G2QA 3FYSA 4HAIA 3ZVRA 1ABFA 1NUSA 4KSCA 2ZJ1A 3P45A 4KQHA 4WUTA 5J63A 4YT4A 2AOVA 2P2DA 1AOXA 2EF1A 2JF0A 3HEAA 4XW2A 2NVUA 3PQFA 3QVMA 4EF5A 1JSLA 3D0OA 3AJ8A 1ZVMA 2WVAA 2REXB 5IAAA 2FPLA 2BRUA 3O95A 1LD3A 4HYTA 4MYTA 3CKKA 2N46A 1TM4E 5D1HA 1UKAA 2EYQA 3C8HA 2IHBA 2X9QA 3ELDA 3JD1A 3EW7A 4Z9FA 4WXRA 5C3UA 1DOHA 3HZHA 2QEQA 4MA4A 3U9SA 5CR9A 2O1EA 4PYRA 1F3LA 3DTNA 3M82A 4QJ3A 5LKAA 5LMZA 3M1IA 4P9NA 4KO4S 2JGMA 2ZIEA 3GGPA 1MGOA 3GWZA 3A9TA 4KN6A 4MR9B 1E2FA 4TUYF 3MWDA 1EQUA 2CY0A 5ITZB 4YCLA 1NYTA 3U48A 3PFBA 3T6KA 2BGNA 5CCBA 3A7DA 1XZGA 4Q6WA 1XZDA 3M9XA 1I1NA 1PNTA 2HPAA 3NNSA 4BQPA 4ARIA 1GUYA 3EGXB 3F7TA 1G8MA 2VJQA 2HBRA 2X19A 2O50A 2Q0SA 4JJZA 4Y2XA 5EXDA 2PNJA 1R5OA 5BQXA 4IJ5A 1BVHA 5A0VA 2QJWA 1P3DA 1SXJE 1PJCA 1WRBA 2JAQA 4WY2A 2RJNA 4QWMA 2VAMA 2ZYWX 3FKQA 4G0YA 1RBMA 4JZKA 3WGLA 2VYFA 3FTFA 3V4SA 4DVJA 1RQLA 2XAAA 3SP1A 1SXGA 2PXXA 1X1TA 1P5RA 2R68A 1GR0A 2WF6A 2WSYB 3DV0B 3N05A 4LSGA 5TF0A 3ZHBA 3ZXUB 3TMAA 1UM9B 3GG2A 3QNUA 2K4MA 2F4NA 3PRJA 4P82A 2ZRPA 3UWMA 2JLYA 1CY0A 1U65A 4NC9A 5BSEA 1THMA 2CLIB 3EZNA 4LEIA 4HFMA 5JSFA 1GGNA 1JQLB 1ZISA 2VS1A 3KQNA 1MABB 4H7HA 4HDAA 4RXTA 1VJ1A 1U2EA 2W6JA 4NJMB 2PO5A 1BCSA 4JY7A 5JLAA 4EG0A 2VSYA 4MQLA 5CB8A 3U3ZA 1TEZA 2X22A 3B5JA 4BLQA 4GX2A 4QLBA 3FCCA 3TSZA 1ID1A 3VNVA 1R5JA 2IITA 1TEVA 1LDNA 1MPTA 2ISSD 3EGCA 3EGXA 5HR5A 2B98A 4C7JA 1CR2A 1QH1A 4E0BA 4UBLA 1BCRB 1CRQA 4B4KA 5KOHA 4PPFA 3FTCA 1RAHA 2ODWA 1LKZA 2A5YB 3C48A 4YRBA 1NUAA 3I9KA 2VYNA 3IDZA 5DN9A 4Z5XA 1DE0A 4ETMA 3PXXA 2PMFA 3BTUA 2PU5A 4E1VA 3HVUA 3O4RA 1OROA 3I2YX 2X42A 3BH7A 4H1HA 1BJKA 2V4ZA 4MV0A 3GLHA 2IBTA 1TUBB 4OQMA 3HJNA 2I1LA 3NDRA 1JI3A 1UM9A 2Q5IA 2X1LA 5DBIA 1N6LA 3TBFA 4O1IA 3DD1A 1SG6A 1NVVR 3PCTA 5TQ0A 2VG8A 3IMCA 4DB2A 1S2LA 2GZRA 3I1YA 1AV6A 5BSUA 2W22A 3ZBPA 1R88A 1RKUA 3FYUA 1SVLA 2NG1A 2Q4DA 4KFTA 2G04A 3FW1A 1QIFA 4C0SA 1AT1A 2DWUA 2AX3A 1MJGM 5ALGA 4WK2B 4BNLA 1QH8B 2XNCA 2QI9C 3SDBA 3UKJA 1QBKC 2XD4A 2ZBRA 4RC9A 1D8TA 3OZDA 4PC2A 5KHAA 2YASA 4WESB 3I5XA 3Q41A 2JIZA 5DCUA 3VHXB 4X60A 1U3WA 3G88A 3LOPA 2A0UA 1MB0A 5AHWA 3WMWA 4WASA 4U39A 1KFCB 4PG5A 1JEYA 1PT7A 3C5CA 1RSZA 2PH3A 4OBWA 4LV8B 4YP5A 2CDAA 1W52X 3K0FB 1ZRMA 3OA0A 3W5HA 2RHHA 4J4BA 1YZQA 2P30A 3ITDA 3PE4A 4L16A 5G0SA 2YXDA 1JFLA 1BKYA 4ZZ3A 4D7AA 3AHGA 4G8DA 1X0XA 1TC1A 2E4AA 2H2GA 4DPKA 4RTMA 1Q1ZA 5J4VA 1QP4A 2OL4A 4ID3A 4KDEA 1YQUA 5EIAA 1A77A 1EGAA 3OQBA 5E6UB 4F8YA 3OE7D 4UQOA 3LUBA 5LXTA 1O96B 2GK7A 2EP8A 2GTHA 3EMKA 1LVGA 1DKPA 2X58A 4K6HA 3GO4A 3NWJA 5JI2E 1JA9A 3QWBA 1KK1A 4UHEA 3WQRA 3ZJ4A 3EHEA 5ELLA 4QIHA 3S29A 2JFZA 1Z3IX 2WUDA 3O8LA 4LYEA 5G4KB 2XHZA 4OEHA 3EZ7A 3LPDA 4V2UA 2P3QA 4MB2A 5C80A 2GEDA 2QTGA 4R5HA 4DLZA 4DIKA 2BWJA 2X5KO 4IEIA 3QWIA 1SBNE 1MT0A 1N8TA 3PL5A 3C8DA 1JEYB 1PV4A 2E2WA 1YGPA 3KXLA 3PBKA 3ESRA 1D09A 1I1QB 5AKYA 4B7AA 4M87A 1EVZA 5L9AA 3K0FA 4L3VA 1VJ0A 1AUVA 1Z6GA 3NWEA 3WSTA 1DRVA 1W5FA 3B1XA 1J07A 1YOVB 4GGPA 4B3IA 3H2SA 4CKWA 1TCCA 5FPKA 3ELBA 4KXNA 2C4KA 3SC4A 3RTCA 5CK4A 2I2DA 3NHRA 4AZVA 2ONZA 3CH7A 3H2ZA 3IBSA 3K5PA 3OH8A 5E7MA 4U5XA 3SD7A 2IHKA 5KYUA 4BGUA 4NRDA 3WGIA 2XCIA 5CFMA 3G2OA 3NC0C 3PWTA 1A7KA 3FMVA 3IMKA 4G56A 4GBGA 5AW2A 2OHHA 2P77A 3GJQA 4R6XA 2I3DA 3FZEA 4P80A 4YJ3F 1YJXA 5LB2A 1WVGA 2V03A 2ZROA 4J07A 4DV5B 4HNGA 4F71A 4LHEA 4D99A 1I7SB 4CHGA 4YRZA 2D1FA 3Q2OA 4O1MA 4DXAA 3WISA 2BE7A 4HDOB 4QGGA 3VOTA 4G1CA 3QGMA 5CFRA 1MA3A 3INNA 1I9CA 1TZCA 4W1SA 5LIRA 1L4KA 2PL3A 2JFQA 3BA1A 3FUXA 2AGVA 2J0VA 4NHEA 1KH2A 4LY0A 4M1YA 2D2XA 2CF5A 2IYEA 3I6BA 3OTQA 4JEIA 2VZ0A 4B75A 2ZUEA 2Q4BA 2O2SA 1Y6GA 2WAAA 4RHFA 1KO5A 3HN2A 1HXHA 1YOVA 5CDUA 5HX7A 4XQ9A 4A0FA 1ZIOA 2XJ4A 4FSDA 2B78A 2NGRA 4KG7A 3QKSA 4YGXB 4XUDA 1KJIA 5AT1A 4B4UA 4TKVA 3IQIX 1XALA 1BYIA 4E2YA 3K9WA 5HCUA 1YVUA 3OETA 2I9PA 1GUBA 2CFCA 3QVWA 2VNHA 3BB4A 1S7CA 3A58B 1O87A 4MKIA 1Q21A 2HMTA 4QYXA 2FRDA 1UBNA 2PRZA 3DXXA 2O2HA 3RFFA 7AT1A 1YUNA 3RG2A 1XWFA 3ITEA 1V48A 2XUOA 4DSTA 1G5IA 5EJIA 3VGJA 4ZQGA 2PS9A 1NXOA 2C5LA 7REQA 3IVXA 2VHUA 4NDZA 5AD1A 1PR1A 2WJZB 1D2RA 1AE1A 4L76A 4XGKA 4NMMA 1WBDA 4WJKB 5FP0A 1GXSA 1QYXA 2GUWA 2WJPA 1EHYA 2EFEB 3E9EA 2IVZA 3LH5A 4KLNA 4ZO6A 3LY5A 3FYTA 4QXQA 2OO5C 3EZ9A 1YVDA 1E5VA 2J87A 3TR0A 3ZK7A 1J39A 5ERGB 5AMXA 1L7BA 1P5ZB 1MX3A 3PFFA 4RZHA 4URUR 4DIMA 3GH3A 4DQXA 4DJFC 1SD2A 4YMSA 2B1RA 4BKMA 4JGBA 4P31A 3VX3A 3KLOA 1Z5VA 3U4MA 3H04A 4C43A 3C74A 3LI2A 3G1UA 4TKVB 1T15A 1H4TA 4I7EA 4KFUA 2OV3A 4R84A 4MW4A 3UMCA 3ZE7A 1NI4B 4CQNA 2ANBA 2KLBA 5DP1A 3INGA 1UC4B 4Y1FA 5K0SA 4IFEA 3KFLA 3B89A 1C30A 1U31A 1UWCA 3MTAA 3N8NA 4MINA 4RVNA 1C9YA 3DNFA 1NBWB 1FFBA 1P80A 1N9KA 2VPWA 2VNJA 3R09A 4U00A 4ZVVA 3W8DA 4BAGA 3RIYA 5B58T 4GPD1 2HWUA 2ZRQA 3PE3A 1RC0A 4TLCA 1ZHHA 4UHKA 1SKYB 4B9EA 2AN3A 4HGYA 4N6GA 4YWHA 4JB2A 1NBHA 2QZZA 3CKLA 3AI7A 1WLSA 5ALKA 2I2AA 2X2OA 2QGFA 1IVNA 2GJKA 3KE9A 2ZWMA 3GLTA 2ZBVA 4RK6A 1ARZA 1RHRA 1XQ9A 4F45A 5IN4A 4RVHA 2X9LA 3QLJA 1FZTA 3OPQA 2BTOA 4QPNA 5DCWA 3SF8A 4XRGA 3W05A 1N5OX 2C0CA 3UMBA 1G9SA 1Q7BA 1TZBA 2JCVA 5B5SA 5IG2A 5ILGA 3SX2A 2OY0A 1PYDA 5DK6A 1H1LA 4ZJYA 1V6CA 1Q5PA 1MQ8B 4AJEA 1M5UA 1I94B 4XA8A 2W70A 3CW8X 4EUFA 3BJEA 3KUXA 4WW0A 1Z34A 4EVIA 1EK2A 5DNUA 1EX6A 4I4CA 4UHDA 4AG6A 1XRQA 2XGMA 2G25A 2P4EA 5B1SA 4NULA 1B26A 5THKA 3F7MA 3GLKA 4L4SA 4DYVA 4EKNB 3AIKA 4UHCA 3SFZA 1IHUA 3BCHA 2WVJA 3PR1A 1EE2A 3CNOA 5EUCA 3H17A 3WOVA 1MXFA 3NVDA 2RHOA 3NBFA 3LXRA 4OGKA 4RAQA 5CIQA 3DFFA 2OCGA 3ABQB 5ALWA 3PP8A 1DRJA 2QVGA 1J5EB 4B3GA 5HKOA 1CQIA 2QRVB 3S4YA 3LLSA 3JASA 3SF8B 4OI2A 1GN9A 2JBWA 1PG0A 2FR8A 1TAGA 3N3BC 2XT9A 5FWXA 1U8EA 2WOOA 1EK6A 4XJSA 3L8DA 1NWHA 4MS3A 4RK5A 1XDBA 4MJLA 2PZAA 2O3RA 3ROQA 4ZFNA 3FSJX 4EDHA 4CBVA 1SHUX 2GBCA 3W3ZB 1WXGA 3T7SA 4S0XA 4MVWA 4Z4HA 4ARZA 3HXOA 3ELWA 5T4HA 3CH6A 1U5BB 3UMJA 4OGWA 3HDJA 5BV8A 5JW6A 2NU8B 4ATNA 5FV7A 1H5QA 2IWHA 1NM5C 3WRVA 2EYUA 5JH7A 1L7PA 1XAIA 3KU1A 3NHYA 4KAXA 4ARSA 1A9ZA 1YI8A 2BEUB 2IYOA 3HBAA 4PO3X 3QW4B 3FCSB 1LDBA 2FF5A 4MEBA 3B82A 1T5SA 4D46A 3DWFA 3D2CA 4NCXA 2J5QA 3L0DA 3L0SA 3MAGA 5IN5A 1ODJA 4O2AA 1A69A 4KX3A 2GZ3A 2ZYAA 3DAGA 5J4LA 3KETA 3V8MA 4E6EA 2P11A 1W5AA 4IHJF 4TV8F 4U9UA 3EARA 3AF3A 3RT9A 1I1OA 1PJ4A 1FP4B 4Q03A 2R7MA 5FWXB 1PZXA 4QPPA 3BG5A 5BP7A 3OZAA 1VKHA 4W7HA 4R31A 2HRCA 4W8GA 1NXTA 5IEJA 4V1CA 1S3IA 1JKFA 1XYGA 2H31A 1ZVKA 1YI1A 2PX0A 4FEGA 1DVRA 4KVFA 3RJ5A 1J8VA 2XXAB 2J6IA 2Y1KA 1CUFA 4Y2HA 5J1TB 3E5HA 3W5VA 4BKUA 1U5BA 5CB4F 1CHDA 1V9SA 3FX2A 3U62A 1HT1E 4JIMA 4K2AA 1F8GA 3IHTA 1TJ3A 2PUWA 3R5XA 1TM3E 4R8MA 1ST3A 1INLA 4GMKA 3BKXA 3X1ZA 4D3YA 1MQ9A 5EI5A 4BATA 4D3XA 2C58A 4DMHA 2DLDA 2PAAA 4J0CA 4L72A 4DUZB 1Y3AA 2B35A 1SU4A 1XD9A 2HJWA 3THWB 2F1JA 3NHBA 4LJYA 3FPLA 4NV3A 4TT8A 1HMYA 1L8OA 2XB4A 3QVLA 5LXTF 3B9QA 4Q48A 4RD4A 1FP4A 2A35A 4RBNA 1B3BA 2OHIA 3FDJA 4P35A 4MWGA 3UWPA 1N5RA 3K92A 5HCIA 3UXYA 4BE9A 4F8EA 2HT1A 3DPUA 1R6XA 3H11A 2O2EA 3D7KA 2LKDA 2QZSA 2DFLA 2CMKA 4QUIA 2QRGA 4QHSA 4PPYA 4WLFA 4NE9A 4MGHA 1VPWA 1ZBDA 4N48A 1FS4A 2AMFA 1NXSA 4B5LA 4L6IA 5BNTA 4DA6A 1HZZA 1EUDB 4ZXFA 4GPTA 1WDMA 4AQ7A 1H9AA 4Y2SA 5DNDA 2GJAA 3Q0TA 2CVZA 4C7XA 5ALFA 1LZLA 4WNYA 1FUUA 2JIMA 2JRLA 3CCFA 1EWQA 1SA0B 1R6BX 3BCUA 1MO2A 2X0JA 3R7BA 3RS5A 2WHXA 1T8UA 2ZXFA 3DG9A 2XA2A 4BUCA 3FTDA 4YCCA 7ABPA 1Q22A 2WM3A 3DFIA 1LGYA 2V7XA 2IPXA 1O6FA 3CE6A 2PKQO 2VAWA 3PNBA 4X8OA 2WAOA 4B34A 5JXWA 1B93A 2R7NA 4JMLA 1ND5A 2PU7A 2AW3A 2Y1GA 2Q9UA 4AZ3A 3NEJA 5BNIA 3PGVA 3C1OA 3QXXA 4AF8A 1LPNA 5EP3A 4C89A 4LY3A 3COJA 2Y76A 3KO8A 3EF3A 1O94A 3KKNA 3TJMA 4AX4A 3EXHA 4R1TA 1YQ9A 1XPUA 2APJA 1AXGA 3GLUA 1PVOA 1N6NA 2B37A 2V7QD 3KELA 1YZVA 4FCWA 2A57A 2XYRA 4Z86A 5FULA 4Q4HA 1K7XB 2D2FA 3OJFA 1FU7A 3PGLA 1NURA 1P7WA 2HJHA 3CX6A 4IXDA 4WT7A 3WMEA 4D96A 4DIOA 4DM7A 1Z22A 1E2PA 2OENG 3FKSA 2Q28A 3GJ0A 1EGVB 1FMJA 1DWQA 1AO3A 1L8XA 2E4WA 3AC0A 4WK6A 3QVUA 3U56A 4NENA 4ZVOA 3GHYA 2ODNA 2X76A 1M67A 1NN5A 3K73O 1G1AA 1V8FA 1CZLA 3MRTA 3PGXA 4HN9A 4NAVA 5A3RA 1YS1X 1T9CA 4KRXA 5EWMB 5GWXA 2YZNA 2IOFA 3L5OA 2NUBA 5JMOA 1MW8X 2JLAA 3UF0A 5JRDS 5HQ3A 3PA8A 2IY7A 2OFFA 4NCAA 3DFMA 2I6TA 1K5GA 3ITNA 2WYUA 4NPAA 3FSRA 3DQZA 3G2NA 3JQGB 1E9FA 1CUXA 1W35A 1HLPA 3IS3A 2B8TA 3GBVA 3UFXB 2CC2A 2YMMA 3EXHB 4DWOA 4LNAA 4TQGA 1QS0B 2H7YA 2VF4X 2XUQA 2R25B 3AY6A 2UYOA 2IYRA 3AY7A 3VBCA 1G59A 4A0RA 2P9TA 2G6TA 1C0EA 3HHEA 1WPQA 1VJRA 3SJ7A 3ZWDA 2AOUA 1FRFS 4LTNA 5LDDC 1XTPA 3F4KA 3MXTA 2YV4A 4CDGA 1E3EA 3AP3A 2JIBA 2GJ8A 2WT4A 1ZDMA 2XWJI 2PRJA 3EVFA 4FDMA 3FAKA 4Y2JA 1ISGA 2RBKA 1MDBA 3JATB 3T5DA 3V4ZA 4D0NA 3ER8A 1NC1A 1SCUA 5K0CA 1G7RA 1P9LA 2IZ5A 1KQOA 4N18A 4YP9A 5IM5A 1Y9AA 4HB0A 1TW3A 1JSRA 3BS4A 4D56A 3VA7A 1SBTA 1J24A 3I5AA 1QHXA 8OHMA 5JADA 3NKLA 3GZJA 4U6QA 2GA9A 2QUJA 4OFBA 4PYJA 2DWOA 4YP6A 4CMEA 1ZJ5A 1ZM2A 2PUGA 4YAEA 2YL2A 1PEKE 4KQCA 1KO1A 1PQ4A 3QIAA 3WKEA 4I9NA 1F20A 1YL7A 4PZPA 1WV1A 1FVOA 4GI1A 4P38A 3UFXA 2I76A 4IIBA 2BFMA 3AEKB 2V4MA 5L4NA 3RUPA 2IE0A 3MSXA 2VTBA 3OX1A 1SD1A 2CE7A 3IA7A 1W0KA 1NI3A 3TNDA 2XKKA 1SCKA 1VMDA 2OCIA 3C98A 3HABA 1JE0A 2VQSA 2RHWA 5EJ7A 4UBKA 1AF7A