2CG7A

Second and third fibronectin type i module pair (crystal form ii).
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Solution and Crystal Structures of a Module Pair from the Staphylococcus Aureus-Binding Site of Human Fibronectin-A Tale with a Twist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2cg7A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2cg7A02
4B2SA 3MQLA 1HFIA 5HYUB 2A55A 2RKZA 4IGDA 3L89M 4LOSA 1VVCA 4ONTD 2IZ3A 3GXEA 1GKGA 5FO8C 4KKDA 5JPMG 1E8BA 3INBC 2JGXA 1ZJKA 4AYIA 1GHQB 1HCCA 3ZRZA 3SW0X 2XRDA 4AYMA 3OP8A 2KRIA 1OJYA 3KXVA 4DJZA 1TPGA 1G4GA 2MCZA 2XWJI 1G4FA 1QUBA 4JHSA 3R62A 4PZ5A 1SRZA 4LOTA 4FXGG 3IX0A 3OXUD 1QO6A 1OJWA 2CG6A 4CSYA 1H2PP 2B5ID 2O39C 1CKLA 2CKUA 1E5GA 2KMSA 4J38B 3OEDC 1C1ZA 5HYPA 2JGWA 1E88A 3M7PA 5HYTB 5HZPB 2LOJA 1QGBA 2MCYA 1SS2A 2IZ4A 2JRAA 4MUCA 1Q3XA 2YRAA 2XRBA 4YNXA 2ERJA 2CG7A 1HFHA 3TVJA 1GPZA 1ELVA 1U5MA 1OK9A 2EHFA 1FBRA 5I0QB 4K12A 4B2RA 2EC3A 1TPNA 2XWBF 1NWVA 1GKNA 3ZD1A 2RLQA 3EJHA 4AYDA 1Z92B 2RKYA 1PPQA 4AYEA 1VVDA 1H04P 1H2QP 2W81A 4F4OC 3NFPI 3T5OA 1TPMA 2RL0A 2WIIC 3ZD2A 1UOTP 2V8EA 1H03P 1OJVA 2G7IA 3ERBA 3GOVA 4C16A 1MD8A 4ZH1D 2BZMA 1OK3A 2XQWC 2YBYA 2RLPA 1OK1A 3IU3I 2QY0A 2W80A 1O9AA 1MD7A 3RJ3D 1LY2A 1OK2A 3CALA 4WJG2 3KZJA 3O8EB 2UWNA 4A5WB
chains in the Genus database with same CATH superfamily
1RLHA 3MQLA 1HFIA 4B2SA 5HYUB 2A55A 4PO7A 3WSYA 2RKZA 4IGDA 3L89M 3ZLDA 4LOSA 1VVCA 4ONTD 2IZ3A 3GXEA 1GKGA 3FGTA 5FO8C 4KKDA 5JPMG 1E8BA 3INBC 2JGXA 1ZJKA 4AYIA 1GHQB 1HCCA 3ZRZA 3SW0X 2XRDA 4AYMA 3ZLEA 3OP8A 2KRIA 3F6KA 1OJYA 3KXVA 4DJZA 1TPGA 1G4GA 2MCZA 2XWJI 5DN4A 1G4FA 1QUBA 4JHSA 3R62A 4PZ5A 1SRZA 4LOTA 4FXGG 3IX0A 3OXUD 1QO6A 1OJWA 2CG6A 4CSYA 1H2PP 2B5ID 2O39C 3CI0J 1CKLA 2CKUA 3FGRA 1E5GA 2KMSA 2ZYCA 4J38B 2Y8TA 3OEDC 1C1ZA 2Y8SA 5HYPA 2JGWA 1E88A 4MSLA 3M7PA 5HYTB 4N7EA 2LOJA 1QGBA 5HZPB 2MCYA 1SS2A 2IZ4A 4APLA 2JRAA 4MUCA 2I2LA 1Q3XA 2YRAA 2XRBA 3K3TA 4YNXA 2ERJA 2CG7A 1HFHA 3TVJA 1GPZA 2X2ZA 1ELVA 1U5MA 2Y8RA 3VWOA 1OK9A 2EHFA 3NJAA 3WSXA 1FBRA 5I0QB 4K12A 4B2RA 2EC3A 4BWCA 1TPNA 2XWBF 1NWVA 1GKNA 3ZD1A 2RLQA 3EJHA 4AYDA 1Z92B 2RKYA 1PPQA 4AYEA 1VVDA 1H04P 1H2QP 2W81A 4F4OC 3NFPI 3T5OA 1TPMA 2RL0A 2WIIC 3ZD2A 1UOTP 2V8EA 1H03P 1OJVA 2G7IA 3ERBA 5DN5A 3GOVA 4C16A 1MD8A 4ZH1D 2BZMA 1OK3A 2XQWC 2YBYA 2RLPA 1OK1A 3IU3I 2QY0A 2W80A 1O9AA 1MD7A 3RJ3D 1LY2A 1OK2A 3CALA 4WJG2 3KZJA 4YIZA 3O8EB 2UWNA 4A5WB
chains in the Genus database with same CATH topology
4B2SA 3MQLA 1HFIA 5HYUB 2A55A 2RKZA 4IGDA 3L89M 4LOSA 1VVCA 4ONTD 2IZ3A 3GXEA 1GKGA 5FO8C 4KKDA 5JPMG 1E8BA 3INBC 2JGXA 1ZJKA 4AYIA 1GHQB 1HCCA 3ZRZA 3SW0X 2XRDA 4AYMA 3OP8A 2KRIA 1OJYA 3KXVA 4DJZA 1TPGA 1G4GA 2MCZA 2XWJI 1G4FA 1QUBA 4JHSA 3R62A 4PZ5A 1SRZA 4LOTA 4FXGG 3IX0A 3OXUD 1QO6A 1OJWA 2CG6A 4CSYA 1H2PP 2B5ID 2O39C 1CKLA 2CKUA 1E5GA 2KMSA 4J38B 3OEDC 1C1ZA 5HYPA 2JGWA 1E88A 3M7PA 5HYTB 5HZPB 2LOJA 1QGBA 2MCYA 1SS2A 2IZ4A 2JRAA 4MUCA 1Q3XA 2YRAA 2XRBA 4YNXA 2ERJA 2CG7A 1HFHA 3TVJA 1GPZA 1ELVA 1U5MA 1OK9A 2EHFA 1FBRA 5I0QB 4K12A 4B2RA 2EC3A 1TPNA 2XWBF 1NWVA 1GKNA 3ZD1A 2RLQA 3EJHA 4AYDA 1Z92B 2RKYA 1PPQA 4AYEA 1VVDA 1H04P 1H2QP 2W81A 4F4OC 3NFPI 3T5OA 1TPMA 2RL0A 2WIIC 3ZD2A 1UOTP 2V8EA 1H03P 1OJVA 2G7IA 3ERBA 3GOVA 4C16A 1MD8A 4ZH1D 2BZMA 1OK3A 2XQWC 2YBYA 2RLPA 1OK1A 3IU3I 2QY0A 2W80A 1O9AA 1MD7A 3RJ3D 1LY2A 1OK2A 3CALA 4WJG2 3KZJA 3O8EB 2UWNA 4A5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2S A;  3MQL A;  1HFI A;  5HYU B;  2A55 A;  2RKZ A;  4IGD A;  3L89 M;  4LOS A;  1VVC A;  4ONT D;  2IZ3 A;  3GXE A;  1GKG A;  5FO8 C;  4KKD A;  5JPM G;  1E8B A;  3INB C;  2JGX A;  1ZJK A;  4AYI A;  1GHQ B;  1HCC A;  3ZRZ A;  3SW0 X;  2XRD A;  4AYM A;  3OP8 A;  2KRI A;  1OJY A;  3KXV A;  4DJZ A;  1TPG A;  1G4G A;  2MCZ A;  2XWJ I;  1G4F A;  1QUB A;  4JHS A;  3R62 A;  4PZ5 A;  1SRZ A;  4LOT A;  4FXG G;  3IX0 A;  3OXU D;  1QO6 A;  1OJW A;  2CG6 A;  4CSY A;  1H2P P;  2B5I D;  2O39 C;  1CKL A;  2CKU A;  1E5G A;  2KMS A;  4J38 B;  3OED C;  1C1Z A;  5HYP A;  2JGW A;  1E88 A;  3M7P A;  5HYT B;  5HZP B;  2LOJ A;  1QGB A;  2MCY A;  1SS2 A;  2IZ4 A;  2JRA A;  4MUC A;  1Q3X A;  2YRA A;  2XRB A;  4YNX A;  2ERJ A;  2CG7 A;  1HFH A;  3TVJ A;  1GPZ A;  1ELV A;  1U5M A;  1OK9 A;  2EHF A;  1FBR A;  5I0Q B;  4K12 A;  4B2R A;  2EC3 A;  1TPN A;  2XWB F;  1NWV A;  1GKN A;  3ZD1 A;  2RLQ A;  3EJH A;  4AYD A;  1Z92 B;  2RKY A;  1PPQ A;  4AYE A;  1VVD A;  1H04 P;  1H2Q P;  2W81 A;  4F4O C;  3NFP I;  3T5O A;  1TPM A;  2RL0 A;  2WII C;  3ZD2 A;  1UOT P;  2V8E A;  1H03 P;  1OJV A;  2G7I A;  3ERB A;  3GOV A;  4C16 A;  1MD8 A;  4ZH1 D;  2BZM A;  1OK3 A;  2XQW C;  2YBY A;  2RLP A;  1OK1 A;  3IU3 I;  2QY0 A;  2W80 A;  1O9A A;  1MD7 A;  3RJ3 D;  1LY2 A;  1OK2 A;  3CAL A;  4WJG 2;  3KZJ A;  3O8E B;  2UWN A;  4A5W B; 
#chains in the Genus database with same CATH topology
 1RLH A;  3MQL A;  1HFI A;  4B2S A;  5HYU B;  2A55 A;  4PO7 A;  3WSY A;  2RKZ A;  4IGD A;  3L89 M;  3ZLD A;  4LOS A;  1VVC A;  4ONT D;  2IZ3 A;  3GXE A;  1GKG A;  3FGT A;  5FO8 C;  4KKD A;  5JPM G;  1E8B A;  3INB C;  2JGX A;  1ZJK A;  4AYI A;  1GHQ B;  1HCC A;  3ZRZ A;  3SW0 X;  2XRD A;  4AYM A;  3ZLE A;  3OP8 A;  2KRI A;  3F6K A;  1OJY A;  3KXV A;  4DJZ A;  1TPG A;  1G4G A;  2MCZ A;  2XWJ I;  5DN4 A;  1G4F A;  1QUB A;  4JHS A;  3R62 A;  4PZ5 A;  1SRZ A;  4LOT A;  4FXG G;  3IX0 A;  3OXU D;  1QO6 A;  1OJW A;  2CG6 A;  4CSY A;  1H2P P;  2B5I D;  2O39 C;  3CI0 J;  1CKL A;  2CKU A;  3FGR A;  1E5G A;  2KMS A;  2ZYC A;  4J38 B;  2Y8T A;  3OED C;  1C1Z A;  2Y8S A;  5HYP A;  2JGW A;  1E88 A;  4MSL A;  3M7P A;  5HYT B;  4N7E A;  2LOJ A;  1QGB A;  5HZP B;  2MCY A;  1SS2 A;  2IZ4 A;  4APL A;  2JRA A;  4MUC A;  2I2L A;  1Q3X A;  2YRA A;  2XRB A;  3K3T A;  4YNX A;  2ERJ A;  2CG7 A;  1HFH A;  3TVJ A;  1GPZ A;  2X2Z A;  1ELV A;  1U5M A;  2Y8R A;  3VWO A;  1OK9 A;  2EHF A;  3NJA A;  3WSX A;  1FBR A;  5I0Q B;  4K12 A;  4B2R A;  2EC3 A;  4BWC A;  1TPN A;  2XWB F;  1NWV A;  1GKN A;  3ZD1 A;  2RLQ A;  3EJH A;  4AYD A;  1Z92 B;  2RKY A;  1PPQ A;  4AYE A;  1VVD A;  1H04 P;  1H2Q P;  2W81 A;  4F4O C;  3NFP I;  3T5O A;  1TPM A;  2RL0 A;  2WII C;  3ZD2 A;  1UOT P;  2V8E A;  1H03 P;  1OJV A;  2G7I A;  3ERB A;  5DN5 A;  3GOV A;  4C16 A;  1MD8 A;  4ZH1 D;  2BZM A;  1OK3 A;  2XQW C;  2YBY A;  2RLP A;  1OK1 A;  3IU3 I;  2QY0 A;  2W80 A;  1O9A A;  1MD7 A;  3RJ3 D;  1LY2 A;  1OK2 A;  3CAL A;  4WJG 2;  3KZJ A;  4YIZ A;  3O8E B;  2UWN A;  4A5W B; 
#chains in the Genus database with same CATH homology
 4B2S A;  3MQL A;  1HFI A;  5HYU B;  2A55 A;  2RKZ A;  4IGD A;  3L89 M;  4LOS A;  1VVC A;  4ONT D;  2IZ3 A;  3GXE A;  1GKG A;  5FO8 C;  4KKD A;  5JPM G;  1E8B A;  3INB C;  2JGX A;  1ZJK A;  4AYI A;  1GHQ B;  1HCC A;  3ZRZ A;  3SW0 X;  2XRD A;  4AYM A;  3OP8 A;  2KRI A;  1OJY A;  3KXV A;  4DJZ A;  1TPG A;  1G4G A;  2MCZ A;  2XWJ I;  1G4F A;  1QUB A;  4JHS A;  3R62 A;  4PZ5 A;  1SRZ A;  4LOT A;  4FXG G;  3IX0 A;  3OXU D;  1QO6 A;  1OJW A;  2CG6 A;  4CSY A;  1H2P P;  2B5I D;  2O39 C;  1CKL A;  2CKU A;  1E5G A;  2KMS A;  4J38 B;  3OED C;  1C1Z A;  5HYP A;  2JGW A;  1E88 A;  3M7P A;  5HYT B;  5HZP B;  2LOJ A;  1QGB A;  2MCY A;  1SS2 A;  2IZ4 A;  2JRA A;  4MUC A;  1Q3X A;  2YRA A;  2XRB A;  4YNX A;  2ERJ A;  2CG7 A;  1HFH A;  3TVJ A;  1GPZ A;  1ELV A;  1U5M A;  1OK9 A;  2EHF A;  1FBR A;  5I0Q B;  4K12 A;  4B2R A;  2EC3 A;  1TPN A;  2XWB F;  1NWV A;  1GKN A;  3ZD1 A;  2RLQ A;  3EJH A;  4AYD A;  1Z92 B;  2RKY A;  1PPQ A;  4AYE A;  1VVD A;  1H04 P;  1H2Q P;  2W81 A;  4F4O C;  3NFP I;  3T5O A;  1TPM A;  2RL0 A;  2WII C;  3ZD2 A;  1UOT P;  2V8E A;  1H03 P;  1OJV A;  2G7I A;  3ERB A;  3GOV A;  4C16 A;  1MD8 A;  4ZH1 D;  2BZM A;  1OK3 A;  2XQW C;  2YBY A;  2RLP A;  1OK1 A;  3IU3 I;  2QY0 A;  2W80 A;  1O9A A;  1MD7 A;  3RJ3 D;  1LY2 A;  1OK2 A;  3CAL A;  4WJG 2;  3KZJ A;  3O8E B;  2UWN A;  4A5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...