2CGPA

Catabolite gene activator protein/dna complex, adenosine-3',5'-cyclic-monophosphate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*CP*AP*CP*AP*TP*TP*AP*AP*T)-3')
publication title The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 66
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 1997-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgpA01
4RB2C 4H7LA 3F8MA 4L11A 2DK5A 1W7PD 1QXJA 3H7YA 3I54A 5D4SA 2DT5A 4FBFA 5DV5A 4U0VA 1STZA 4HYEA 2PFWA 4Q4ZF 4L9TA 1K78A 3GO5A 1ONVA 4OMZA 1J5YA 4MGKE 1GQHA 3V7RA 2M45A 2J5OA 5D5VB 5E18F 4HDUA 5FLJA 1KU9A 3QAHA 4GXOA 4A0YA 5ICCA 4META 4MV2A 3MWMA 5HLIA 2QQBA 4ETSA 1IN7A 2I45A 2O61A 3BDDA 5CU1A 5A2QZ 4EWEA 3B73A 2EFPA 1BI0A 1Z7UA 2ET1A 5FD5A 4IHTA 4MZUA 1JUHA 5CLSA 1RGSA 4JTOA 3IWFA 4NHJA 1U3EM 5LEKA 4Q0QA 1LEAA 3TQNA 2QM3A 5L3EA 2D1VA 1BI1A 1RI7A 5I93A 4U7DA 5E1ZB 4EJWA 5I0SA 1U5TC 5D5WB 2DPUA 1ZG3A 4XFFA 1TTYA 3UKVA 4HX8A 1YIOA 1YFHA 2Z5UA 3IWZA 2EK5A 4LA3A 1FBQA 2FMYA 5FGMA 4HSJA 1KQ8A 4OOIA 2VT3A 3D0SA 1V70A 2VBWA 5JAXA 2W85A 3FM3A 3LAPA 1CX4A 1XMAA 3HHGA 3LAJA 1TW3A 2XUBA 4KDPA 4KIGA 4HMZA 4JQFA 1QY4A 2OA4A 5L3BA 1EV7A 2F2EA 2N7GA 4ENKA 1S6LA 3Q9VA 4BAYA 5KHHA 4MHGA 3LFKA 3O6BB 2P5LC 1FZPB 1SFEA 4R52A 4D7SA 2BNNA 1W5SA 2F5EA 1D8JA 3J7AO 3M9AA 3TNQA 2UY9A 1ZH5A 2RC4A 3ZP5A 4B09A 5BPDA 1J2XA 1X8MA 2WV0A 4P5OA 1XGSA 2V79A 3NKTA 2D2WA 3RNSA 2KRFA 4YYOA 2Z33A 3KCCA 5LHGA 4X6RB 3F3XA 2EWNA 1R1VA 1O57A 4LA2A 2LF7A 3MPBA 3T0YA 3OTFA 4QLCU 4M73A 1OYIA 1YS6A 1MZBA 1T98A 2J5PA 2GQQA 4IEPA 1FY7A 4LGWA 4BYYA 4OINF 5FFXA 5K5OA 2PEXA 4ZZDA 2ZO4A 4Y17A 4R1HA 3F6VA 3KLOA 4IVNA 1Z6TA 5I8YA 3LA3A 3SQNA 1UCXA 1FNNA 2R3SA 1O5UA 3HSEA 2VXZA 3MYXA 5CADA 4WF2A 1OFNA 3ES4A 1MDMA 1ZZCA 3DKWA 3HSFA 1UIJA 4WBBA 4GCVA 3FX3A 5BS6A 2E7XA 2QBYB 5J8CA 3IL2A 3WTUC 3E5QA 4QGNA 1B9MA 3V4GA 2D45A 3D82A 4XSXF 2OPKA 3E97A 4GO1A 5CVRA 5ILUA 1SD6A 3PQJA 4XETA 4AVCA 1XGOA 2JPBA 2EA2A 2P5KA 5CVVA 1FOKA 4L2NA 2UYBA 1CAWB 5DEQA 2CAVA 5E8GA 4XSZF 4L9JA 1XN7A 5HVQC 5DD4A 3ML6A 2JTVA 2NYXA 4IHSA 2QLZA 1NHAA 3QP5A 5EZWA 3SZTA 2LDUA 1TQ5A 4PIYA 2E7WA 4EJUA 1Z91A 3T8RA 1MKMA 5DUKA 1ZZ6A 4LD5A 2XLAA 5ILSA 2DAOA 3JSOA 2HTJA 2DFIA 2PMUA 3FXUA 1XMKA 1XGMA 3I59A 3FZVA 2ADUA 4YG2F 2K02A 1OI6A 3KP4A 3WW3A 3MQ0A 2OAZA 1J3PA 2W57A 3IDCB 1K6OA 2R7FA 2Z3YA 3E3VA 3GWZA 2NNNA 1YG2A 2EV5A 2Y75A 5J8FA 3E6MA 4UBGA 4F8AA 1RZ4A 4U0YA 1E2XA 2MC3A 3U1DA 2K7LA 5I0UA 2XV4S 4QXKA 3VOEA 3DN7A 1XCBA 3H50A 1VR3A 4QM9A 2R7DA 4OIQF 1ZNPA 1EP0A 1B59A 3ST7A 2B9UA 1JHFA 4NB5A 2IP2A 3CL1A 3I58A 1YQAA 4CGZA 5FPZA 3MAJA 4YFNF 4I98B 2EJRA 2Y0OA 3KZZA 1J59A 4GGGA 2XAJA 5CYVA 3KZYA 4HW0A 4LLLA 4RD7A 3R61A 3F23A 5D1IA 3H8UA 4EWAA 1PM7A 4I09A 3C1DA 1LRHA 3ZN0A 3ACLA 5JSRA 3JAMK 3ZMUA 1JXSA 2LNBA 4AD9A 1X82A 4HSLA 1QBJA 3EQLF 4EJVA 2TDXA 3BROA 4OIRF 2CV6A 2WC2A 1TQIA 5F1RA 1V4RA 1CF7A 3I4PA 3BB6A 4PGHA 1XGNA 3R60A 1ODDA 5BV6A 4G6DA 2Z69A 2G9WA 2PQQA 3TNPB 1GHCA 5I0TA 3WE2A 3WU1B 4UXAA 1G3SA 1QZYA 2D93A 5ICGA 2EVXA 2XASA 4J1XA 3RTRA 4ZU7A 3HOTA 4ENJA 5JR3A 3PVBB 1C0WA 2V1XA 2VC1A 2OU2A 3SCHA 4UUVA 2OA2A 3BPVA 1USSA 2Z9OA 3GYDA 2XL9A 2HQNA 1SEFA 3LAGA 2V1DA 3MDPA 3WE3A 1HBXG 1P4AA 3S2WA 3I59B 3ELNA 1TNTA 2EFOA 4MTEA 5FFZA 4L5JA 3I7DA 1R7JA 1IZ1A 2E1CA 2L01A 4MH0E 4MQVA 2GH2A 3HRSA 2XLGA 5BMZA 4O5VA 3O3KA 3TO7A 5HDNA 1R00A 2IC1A 2O3FA 4QGMA 3KE2A 3ZMVA 1XE7A 4UBHA 3V8LA 2P17A 2XAFA 3OCPA 5FQ0B 2ETHA 3BWGA 5E1XA 2RKHA 3E5UA 2XAQA 4F7ZA 2X0LA 4HLYA 2Q8KA 4I0BA 1RUNA 2Y48A 5I8TA 1SFXA 2QJVA 4UVCA 4HLTA 4R79A 2VE9A 2Z99A 1DDNA 1Z6RA 4Z2YA 2O8QA 4LK0F 2FNPA 5HLGA 3HIFA 3DPLC 3MFKA 1T0FA 3CUQA 1ZREA 2G7UA 2YX7A 1FSEA 4KU8A 1Q1HA 4ESFA 4XFCA 3ECHA 3IBMA 5FPXA 4Q0SA 2UXNA 2BGCA 5I0RA 5KHIA 2IXJA 5D8LB 1T39A 4IJAA 3PLQA 1W5TA 3FXQA 5HI0A 3ELKA 2B5HA 1Q3EA 3KSCA 1QWRA 4EWDA 2XVCA 2H0VA 2M30A 1P2FA 4A6EA 4P9GA 3NSTA 2KIFA 1QQIA 2ZKZA 3BOQA 4UV8A 2F5CA 2W84A 2PAMA 2O8XA 4ZU4A 1V3FA 4IEUA 4A12A 2CWEA 2EFWA 3KETA 2E9QA 2GXBA 1IPKA 4A2UA 3NEUA 1R1UA 3J81Z 3SCFA 5HDGA 3Q5FA 3G73A 4I2OA 2ATFA 1D8KA 1YW8A 4N9IA 4JV4A 2YR2A 4LMYA 3GX4X 3ZMZA 4DQ2A 4EMSA 3VHRA 5KHGA 3HYIA 1P4WA 3EYYA 4LTAA 4HQMA 1TBXA 3TGNA 1WGPA 1T2KA 3JTGA 4HDVA 1CAXA 4IEQA 2V6CA 3ULQB 3RDIA 2PA7A 2QNKA 4MGYE 2CYYA 2A3SA 3HUGA 1KYWA 4TV7A 3KGLA 1U5TA 1ZZ9A 1LEBA 1HKTA 3LWFA 4MGIE 1IUYA 3TDUC 1OKRA 1LDJA 4KT5C 1I6XA 3WGHA 2FRHA 4ENMA 3KFWX 2GC0A 1IXSB 1PMIA 1BJAA 1FI2A 4OLLA 1FWZA 1WKMA 3P9KA 4RS8A 3VODA 5IT3A 5D8KB 1UD1A 4E2QA 3WG9A 3SHRA 2FQ3A 5KHJA 2HR3A 2MD5A 2KKOA 2FXAA 4FX0A 2NRAC 3CO6C 3R4KA 4P96A 4HV5A 4WZCA 1ON2A 5AVPA 2L4AA 5DYMA 4AQ6A 3T1BA 2JRTA 2K9ZA 3HHHA 3R0JA 3ES1A 1G3WA 1SD7A 4YFKF 3JTHA 4EM0B 4RAYA 1X8EA 4H0EA 2UWMA 4CDGA 3KEQA 2Q0OA 1PP8F 3U2RA 3QP6A 4LLGF 4K2EA 2L54A 2K4BA 1BI3A 3COAC 3MZYA 4MNUA 2VBXA 2MLKA 3FFQA 1YYVA 5AIQA 2A5YB 1T38A 1ZRFA 1ZAOA 1PP7U 1UW8A 1VP6A 4I02A 1WA4A 2QCSB 3L2HA 5FLHA 1GQGA 3ZPLA 2BV6A 2VODA 1ZVFA 3LWCA 5AONA 3QU3A 4O6JA 2XROA 3RPQA 3RKXA 3M8FA 1RUOA 4OIOF 2QVSB 5K8SA 4IERA 4A0XA 1DGWA 4QWQA 2DBBA 3W6JB 3CDHA 2AXLA 5J48A 2MNGA 3IDBB 5ICEA 2Q0AA 2G7HA 4D7TA 4IEYA 1UB9A 4KN4X 4U88A 2XIGA 2M5WA 1IN5A 4L18B 2D5FA 1IAWA 3WU0A 1FX7A 2YU3A 1WWXA 2P6SA 4J1WA 1YWKA 2WFPA 4LULA 5DCMA 5FDBA 2FBKA 3ISPA 3SXYA 3IKTA 5HS9A 2OQGA 1YFWA 2FEZA 5JFRA 1D5VA 4UXNA 5LLQA 1HKQA 1RTVA 1P92A 2OBPA 4I7HA 4GYIA 1F9NA 2A68F 1BOAA 2A6EF 3JAMZ 1I1SA 2CFXA 2FMLA 4N0BA 3U10A 4HBNA 1BC7C 2IW5A 1U8RA 1L0OC 3MCZA 3FZ3A 2K86A 1HW5A 2Q2EA 4LK1F 4L9NA 3G7DA 2HTSA 1WI9A 3B02A 1MGTA 3ZMSA 2FA5A 1S3JA 3HRUA 1K78B 2HGCA 1OYWA 3BPZA 1B4AA 5CVJA 2VBYA 4NQWA 1Z05A 1KU2A 3J81K 2H6BA 3HT2A 4M72A 4HVOA 2STWA 4PDKA 1S7OA 3W6KB 5D5XB 2LKPA 1DPUA 4CYDA 5D4RA 2WTEA 4CXFA 2DU9A 3L2CA 1GXPA 1ZLJA 3GXOA 4IRIA 2X4HA 4HOBA 2Y0MA 3F6OA 3WGIA 4AVBA 5K5QA 4LJZF 1QGPA 4IRHA 2A69F 4KNYA 1UPIA 3FXRA 3FMQA 1DPRA 3K0LA 2ZJ2A 1FPQA 1KQ9A 3QPHA 3WTVC 4RB3C 2VN2A 5L3FA 4UNOA 1RIOH 3LA7A 3RYPA 2Z2SB 2GC3A 2VPVA 4AVPA 2ET7A 2HJIA 1REPC 3RZZA 5I8SA 1W7PA 2O03A 3ZN1A 2B0LA 3E5XA 1FBUA 2OYZA 1XB4A 1IF1A 2H09A 3L9FA 4UVAA 1G3YA 4RGXA 1OYYA 3EETA 3JZVA 4D0PA 4OU0A 1EH6A 2ZFWA 3GZ6A 2OZ6A 1Q5OA 2ETEA 2ZKLA 5LGUA 4XF4A 3H7JA 1FP1D 3NL1A 3K69A 5F64A 2PN6A 2PAKA 3MEXA 4HQEA 4R8HA 4HV6A 3H3ZA 5L3CA 2MPFA 4JBAA 2LSOA 4HA8A 1J3QA 1USTA 1Y0UA 3D0JA 2Q4SA 2VOPA 1OPCA 4FT8A 2FBIA 1MJBA 2GWRA 3D5LA 4ESBA 3V8JA 3I64A 3L7WA 4YSFA 2BE5F 1NE4A 2EFQA 1KQ0A 1R58A 3NQOA 2L02A 1FP2A 4PIXA 5D5UB 3FE5A 4JK1X 1ZHFA 4QMAA 5ED4A 3FJSA 1YHFA 2CW0F 1O3RA 3DL3A 4Z82A 2CAUA 5CVIA 1E17A 4BHBA 3O2PE 2D1HA 1EY2A 1XE8A 3KGZA 2DW4A 2NS0A 2EV6A 4AIHA 3TOBA 3H1WA 3EDPA 2FNAA 2ACJA 4KMFA 4YIFA 5ILVA 5LGTA 1O7LA 3WTTC 3CEWA 2IA1A 3BCWA 5KBFA 1B6AA 3GEZA 2VC0A 1MDMB 1LJ9A 2ZNYA 1CAVA 1YUDA 3DQVC 1XRUA 4M9SA 4ZZLA 4KUMA 2DI3A 1J58A 3ERED 3EQEA 2PJPA 3CUOA 1BIAA 5EFUA 3BZ6A 5LRRA 1QO0D 1CAUA 4M9ZA 3FF5A 4PIZA 3F8NA 1YS7A 2EB7A 1YTYA 2PMHA 5J6XA 1T6SA 2FF4A 3DXJF 4IEOA 3U0ZA 2ZMEA 2FBHA 3V8KA 4PJYA 4G9YA 1PDNC 2E1NA 4U0WA 3KLNA 1ZX5A 4M9XA 1SMTA 3HRMA 2D40A 5C8WA 2OD5A 2HYFA 4LG0A 4B29A 2JSCA 4HZFA 1ZRDA 1I5ZA 2O0YA 3KMHA 2DLLA 1DP7P 1P4XA 4E2GA 1YW7A 3QU6A 5JR7B 2RNJA 3H1YA 3EO6A 4KYWA 3CO2A 3F8BA 1L3LA 5CJ9A 3KP3A 1H0MA 3E6BA 1IW7F 3HTSB 3LSTA 3I53A 1ZG1A 4Y15A 3WTZA 1A04A 1BC8C 1BM9A 1IPJA 1RNLA 1ULYA 3P7NA 4HF0A 1B9NA 2IVMA 4ZU5A 3UKTA 2H27A 5K1YA 1ON1A 1IXCA 3J80Z 3TOAA 2M8EA 2BNMA 2IXCA 4A6DA 3F8CA 4KL1A 5BOXA 5JSPA 4QX5A 3M7GA 5TJJA 2PTMA 2ESHA 3K1NA 4I3PA 5FCCA 2PBIA 4OFGA 2MBFA 2XL7A 3HSRA 3WODF 1I1GA 4CO8A 1ZZBA 3L00A 2RDPA 5JHUA 4I01A 2GAUA 2DQRA 2IPQX 2P6TA 2P8TA 3ROUA 4RB1A 4G6QA 3ETQA 2GU9A 2JZYA 1I27A 5E16A 1QPMA 2XKPA 4BHPA 1FYLA 5J3UA 3BP8A 2V9VA 1AWCA 2QVOA 3GVAA 3K2ZA 4KIBA 1FT9A 1TQMA 1MJ9A 4BHCA 1F4KA 4MEXF 2FQPA 3DEUA 4CICA 2MA3A 4AIKA 3TDZC 1CF7B 1VJ2A 2A61A 2COMA 2MH2A 4G7OF 1RL3A 4ZYGA 3QRFF 2A07F 4BNCA 5BXXA 4PCQA 4YFXF 3ABTA 3BY6A 1K7AA 4WXHA 4IXAA 5FB2A 4Q0VA 2PI0A 1YW9A 2L4MA 5DD8A 3ZMTA 4LUKA 1R5GA 4B8XA 3QOPA 5H6QA 4KMUX 5H20A 5LRSA 4XFIA 4HX7A 1FXZA 1EYBA 4KWKA 1ZZ8A 5DCFA 4ENNA 3VEPA 4WK8F 1SQ4A 1J1LA 2DCTA 1HW2A 5LGNA 1LDDA 2B8MA 4HLXA 1NE6A 2QZ8A 4LLNA 1ZGJA 4I0AA 5CVUA 2KXLA 1O3SA 1BIBA 3P9IA 1VTNC 2VT2A 3M3IA 2V1UA 3VFZA 4Q0PA 1F5TA 2STTA 1F1ZA 2FU4A 5BPIA 3RI4A 4XRFA 4TLFA 5D6EA 4LLOA 1FYKA 2EA4A 4LB5A 4KU7A 4X6QB 1NYWA 2DO7A 1W4MA 1IXRC 2QQAA 3REOA 3WTYC 1XSDA 3NW4A 4UV9A 4O9GA 4IEWA 4MX3A 3U11A 1X7NA 2YX4A 1ZN2A 3JW4A 3ZQ7A 4HVRA 4GYGA 2ZXJA 3SFZA 2OZJA 1O4TA 1S29A 4L0ZB 4MGRA 1KU3A 4L9VA 5HOOA 2MH9A 4RGUA 4S04A 4IF4A 1ZRRA 1ZG5A 1JGSA 4K8FA 1GVJA 4M74A 2QWWA 3CJNA 1ZZ7A 2W24A 2YSRA 1IRGA 4XF9A 2RGVA 3KP5A 1IN4A 5IT9Z 3CUQB 2C6YA 4AWXB 1BI2A 1FYMA 1JE8A 3PFIA 4EVIA 2VQAA 2QQ9A 5FLIA 3BPXA 3LZZA 3WW4A 4MQ9F 1YO5C 1H1MA 3M8EA 1P6RA 3GFIA 1FC3A 5LHIA 2ISYA 3TKYA 3BJ6A 5L3GA 1D3YA 5E1RA 3EJKA 2HS5A 4EJOA 1QNTA 1BN5A 2EAAA 2K27A 2LF8A 1OR7A 3I5UA 4YNIA 1R36A 4L5IA 5ICFA 1TQPA 1H1IA 3EHKA 2FOKA 3J80K 1WRJA 3P9CA 3RYRA 3Q9SA 2XRNA 5LHHA 4HBLA 4QM8A 1Z1DA 4PZJA 1IRFA 2H6CA 2KIMA 1Y3TA 2HWVA 4HN0A 2GIVA 1CGPA 4HF2A 5BPXA 2EFNA 2KJCA 1LDKB 2IA0A 3RPUA 4WVZA 5LBQA 4A5NA 2IXKA 4XF0A 4ZYHA 4O9EA 4G94A 5ERIA 3QACA 3ABUA 3GW2A 4M71A 1QXRA 3ZMDA 2P4WA 3H3UA 3V7SA 2QBYA 4G8XA 4FHTA 2M87A 1O3TA 6PAXA 4YIIA 4IETA 5HS8A 2P7CB 5DUIA 1CAXB 4HN1A 4AIJA 3RIRA 1B1BA 2YPRA 5E1WA 1HSJA 3PQKA 1YFYA 1O7FA 5JVTA 4FAHA 2C0ZA 1HQCA 4IPAA 1SFUA 3IC7A 1U5TB 5H6RA 4KN7X 2HFHA 1RC6A 2JPCA 3KP6A 1G6NA 1CAWA 2IJLA 3OD0A 2F5DA 3CO7C 3DP7A 4EGYA 1X3UA 1FBSA 1GXQA 3QPTA 5DDGA 4YARA 1U6GA 4NVPA 3GLXA 4IESA 1L3JA 1ZGAA 4XLNF 1ZRCA 1R22A 1HKSA 4WWCA 4BIFA 2CO5A 3FMSA 4Q47A 4FX4A 2V09A 1Y9QA 2O6GE 2RV8A 1YFUA 3FM5A 5FLXK 3EUHA 4M6YA 3CF6E 3LQQA 4Q5SF 3C7JA 5KHKA 5D6FA 5BY5A 3RYKA 3RKWA 1J9IA 3R6SA 2PAEA 3DF8A 1U12A 1JHHA 2CQKA 1WSUA 5EEGA 4EQQA 1G3TA 1S8NA 4WX9A 5JCTA 2MLGA 2QUFA 3F72A 2H94A 3GZ5A 5AIPA 3WW2A 1LVAA 3F8FA 2XAHA 2HKOA 3C3WA 3HTUA 3SMHA 1H9GA 4BH9A 1DZRA 4EGZA 3CLOA 4WCGA 1KYZA 2PQ8A 4A0ZA 2DQLA 2EV0A 2RN7A 4KIFA 3GFLA 3KP7A 2WWYA 1MD0A 4ON0A 3S7IA 3FHIB 4JTNA 2FE3A 2VBZA 1DUXC 2VOOA 4LEJA 3OV8A 5IT9K 2QDRA 3LA2A 1SAXA 3CJXA 4RB0A 1KGSA 5DCMB 5FD6A 2IA2A 1FLIA 3R0AA 1UHWA 4P9FA 4U7BA 2AS5F 1TLHB 1SMYF 5K5RA 5FO5A 3M70A 3HRTA 3BJOA 4AQ2A 2A6HF 4MTDA 4BQAA 4P55A 1DZTA 1SD5A 1MJAA 4KFCA 3OOPA 2CG4A 3NJZA 3WTWC 4EM1A 1UIKA 3GBFA 2GC2A 2K4JA 4XFAA 1U78A 2Q1ZB 4LUMA 3HT1A 4WXCA 1O3QA 3WTSC 3I71A 3H9AA 4RAZA 3AAFA 3F22A 2IXLA 3N97A 3USSA 1PUEE 1TW2A 4HX4A 3NVCA 5A2QK 3CLPA 2MHFA 5BQTA 1LQ1A 2UXXA 2HZTA 4ZYEA 4FAGA 2HDCA 1NXMA 2P7VB 2HOEA 4IEXA 2PYTA 1XDSA 4DINB 5KK1A 4JVAA 4A5MA 4M6XA 4XEZA 2XLFA 5FQ0A 4DNCA 3VB2A 1KA8A 3GYHX 4AXOA 1UHMA 1OMIA 1KU7A 3ECOA 2P5VA 4PGGA 2FSWA 3K1PA 4XF1A 1J0RA 4E2SA 2UYAA 5HS7A 5KVRA 5E20A 2DPDA 3C18A 4EV0A 1WLTA 3ZDSA 4IRGA 3TO9A 3U9GA 4EROA 2XAGA 1W7PB 1J75A 4P9UA 4ZH4F 2HKXA 2GA1A 3IIAA 1EH7A 4OIPF 1XCVA 3IRQA 2NAZA 1HW1A 3LOIA 3L09A 2DK8A 5T3NA 2ZNZA 1YFXA 3H1MA 4O3MA 2BNOA 4XFHA 4UHTA 3T5XA 2IT0A 3GUDA 4XFGA 3JSPA 1DGRA 3GF2A 5E8IA 2OZUA 4WXDA 1ZYRF 2GC1A 4Z07A 4BXUA 1HSTA 1UCRA 2M1BA 4KWJA 4Q29A 1IN6A 2HEOA 5JSOA 4HF1A 4ZYDA 4Q0UA 4N9HA 2XKOA 4MUVA 4MGZE 4CZZA 4Y13A 4HVQA 5HDKA 2ZCWA 2PHLA 1FSHA 3UKNA 2F5FA 1R1TA 2OQRA 1SFNA 3WW1A 3OGJA 3K9TA 3M1EA 3RJPA 5F6FA 3LQRA 1YLLA 2JT1A 1R5HA 5L3DA 2UY8A 2RVCA 2PG4A 4HAMA 2ZBKA 4LB6B 3MZHA 2IRFG 2Q30A 2GXGA 2L3DA 2QYOA 4LFUA 1AOYA 3BALA 3FHZA 4L0YB 3KP2A 3WTXC 2VONA 4UVBA 2EA7A 4OMYA 1Q43A 3SZPA 1IN8A 2QENA 3KEOA 4IEVA 4YRDA 3S7EA 1R23A 1ZARA 3TO6A 5JI6A 2K0GA 1EH8A 1WQ2A 2GA2A 1ZLKA 2BBYA 2VECA 2HYGD 1UFMA 1U2WA 3CTAA 3SHFA 3FMRA 1CAVB 3SXWA 1QZZA 2D5HA 2CGPA 3F21A 1S7AA 4IEZA 2NNYA 3GFJA 4E70A 1EPZA 4XBFA 3N4MA 2PHDA 4ONUA 4AVAA 2W25A 2ISZA 1CAUB 2PFBA 4ASNA 3C3VA 4KA4A 3EYIA 5E17F 3PNAA 1XSVA 1J7KA 1LNWA 1NZCA 2ZMEB 2XGXA 5HLHA 3IRRA 4G7HF 2DTRA 5C6CA 3T8TA 2BEOA 4EJTA 1Z9CA 4Q48A 3HOSA 3O14A 4XF3A 1SD4A 3WGGA 1LB2A 4XFBA 1G4DA 4MEYF 5BUVA 5EEHA 5FLXZ 2VE8A 4LG0B 1BBYA 2IXIA 4QGLA 3DV8A 4ESJA 2KJBA 3RKYA 3S0MA 1XSXA 3V7CA 2ELHA 4KICA 2KIUA 3E6DA 3BJAA 3G3ZA 3K1MA 1XD7A 3H92A 1O5LA 5I91A 3HQXA 2ESNA 3IHUA 4RGSA 3OF1A 4GULA 2F4PA 3GFMA 1OD5A 3DPTA 1HXDA 4CHUA 4EM2A 2CSOA 1LKNA 3E6CC 5LEJA 3IKVA 5TRDA 2O1QA 1J3RA 2BYVE 2GZWA 1H9TA 1YLFA 3SCGA 3DFGA 1K79A 4RGRA 1LR5A 3CUQC 2RQPA 3I0TA 3NRVA 2IXHA 2PLYA 4XLPF 4S05A 3BU7A 4KWLA 2XHKA 3EBRA 2HQRA 2UZKA 4G7ZF 1TNSA 5J7MA 4ORFA 3FWEA 1XDUA
chains in the Genus database with same CATH superfamily
1I6HJ 3ZSEA 4H7LA 4L11A 1QXJA 1PZ8A 2VL8A 2GDFA 2HWB1 3I54A 5D4SA 4FTSA 4MFEA 2JDAA 5DV5A 1UU5A 3DXUA 4NHMA 3I2OA 3PUBA 4HONA 4CDXC 4MGKE 4IHYA 1GQHA 3V7RA 5IYCJ 1UOFA 5E18F 4RAGA 2VW0A 3QAHA 4GXOA 1D7PM 4LBKA 2A3WA 4Y3OA 2YDEA 1W8UA 1UZVA 2DA7A 3WUCA 5HLIA 5BNOB 2QQBA 4NRPA 1IN7A 1H8TB 1ZBA3 2ZGTA 4GD4A 1BHGA 3MEPA 1JUHA 4JTOA 3VBRC 4Q0QA 3AG4H 5L3EA 1RUI2 2D1VA 1BI1A 4HPQA 1H6YA 1WMDA 1UZYA 4E7HA 4EZ4A 1ZG3A 4H7MA 2VM9A 3FXOA 2E7TA 4FXGB 1B8IB 3S17J 1ZKGA 4IE4A 4UF0B 3ZQQA 4UY8I 3HXLA 2PN5A 3FBNB 1SHWB 1K6YA 1Z7LA 3QLQA 4YM2A 1GT0C 1FBQA 2W47A 2DOAA 5FGMA 4HSJA 1E5RA 1KQ8A 4II3A 4G4FA 3D0SA 3H1CA 5LFAA 2VBWA 1ZBE3 4QHOA 4AYUA 1JU4A 3FM3A 4Q4W1 4QB6A 1CX4A 4YVSB 3HHGA 3CD6I 2VMCA 3VBUC 1J83A 2E2IJ 4KIGA 2QQWA 4HMZA 2QQNA 2MEV2 3J7LA 2PLV1 4RDUA 2XSJC 2B9SA 4E7ZA 3O1MA 4ENKA 4FO9A 3L2WA 3SEPA 3G6EI 4CU9A 3Q9VA 2WA0A 4XKVA 4BAYA 5KHHA 2K9SA 3GALA 1ULGA 2HWC2 1IRXA 5IY5H 1AXZA 1R64A 4YG6A 1FZPB 3KF3A 3R4UA 4HK9A 2WO1A 3J7AO 3M9AA 2WZR2 3ZP5A 1J2XA 1X8MA 4NPMA 2V79A 2KRFA 2VZUA 4W6XA 4QHBA 3BQYA 1R1ZA 5A3LA 3RCOA 4LA2A 2LF7A 3OTFA 4QLCU 1Y8QB 2VY0A 4AIDA 2GQQA 1K45A 4IEPA 4OINF 1TWFJ 3T2OA 3HBLA 4LO6B 2ZC2A 4MFDA 2W91A 3AXEA 4R1HA 4XQWA 4PT6A 4UI9L 1D4VB 3FLPA 1Z6TA 1UYZA 5I8YA 3SQNA 1O5UA 1JZ3A 1SDWA 5DUXA 5ANQA 1OFNA 5A6XA 3MF6A 1ZZCA 3I2GA 2HOAA 4LO7A 3WOGA 4WBBA 3POSA 4MADA 1NK3P 5A6YA 2W92A 3WCSA 3IL2A 4BEHB 3MIHA 1LE8A 4AE2A 2WO3A 4HEA2 2E63A 2D45A 1QGLA 1UZWA 3QD6A 5BNPA 1ODNA 1LEMA 1UAIA 2OPKA 3A01A 1GU3A 2J1SA 1MNMC 2JPBA 2EA2A 5B4XA 3HPGA 1FOKA 3HKZA 5CFDB 1CAWB 1TNRA 2VZRA 1HB1A 2CAVA 4UAPA 4YG0A 3I3QA 4Y1VA 4XSZF 4XRMA 3ML6A 1FMD3 1FNYA 4AYBN 3N9LA 1Z91A 2VVEA 5C9AC 4W65A 3T8RA 2ZA9A 4XOPA 1WCDJ 5ILSA 2VXDA 2HTJA 2DFIA 1JUSA 1A8DA 3I59A 2CDPA 4CA9A 3ZPYA 2CV0A 1W6OA 2ADUA 2K02A 3UJOA 2Y30A 4YZ1A 3ZXLA 1O4XA 2W46A 2Z3YA 2R5ZA 2LKXA 3GWZA 3DECA 3NAPB 3A0NA 3TEDA 3WDYA 4IO9F 3AYDA 4CP0A 2EV5A 4IGQA 4UBGA 5B5EC 4F8AA 1RZ4A 1GKBA 4AI0A 4YM3A 4HT1T 2MC3A 2CSGA 2QCOA 4XAEA 2WWUA 5BNGA 2XV4S 4UUSA 4QXKA 4BS9A 2XVLA 1UY4A 4QM9A 3BTAA 1WMEA 1ZNPA 4BDVB 1EP0A 4LO4B 3LPFA 4MVTA 2B9UA 2LYCA 4D7NA 2LBFA 3A03A 1REFA 4CGZA 1TME1 2C24A 2LW8A 5FPZA 1OCCH 3KYCB 1RB8G 3ZFEA 3HOVJ 3KLSA 4LLLA 2ADEA 3R61A 3W6VA 3FBMA 2KZGA 2P81A 3TN93 4FI9A 2R073 1PM7A 3VV1A 3AZZA 1VRH2 3JAMK 3UR3C 3ZMUA 2CFOA 4BM8A 1RPWA 1X82A 2R1BA 4XC9A 4JRLA 2CV6A 1D4M1 1CF7A 3ZXAC 4F52A 1R093 4YW7A 2VZ3A 1FPN3 2Z69A 4RS5C 2G9WA 3LSEA 3TNPB 2A6WA 2M8GX 5DDJ2 3WU1B 1W2TA 2FDFA 1UYXA 1QZYA 2LOOA 2D93A 3RMXA 4Z2WA 4ENJA 2DMUA 4XXPA 4C0BA 1UJ8A 3CCVI 3Q0UA 1RYYA 4CCMA 4FVVA 2OU2A 5FO7B 4UUVA 1PMHX 2Z9OA 3GYDA 5A70A 1SEFA 3MDPA 2DYSH 3J4UH 3I59B 2WZEA 2EFOA 2A6XA 3ZPOA 5FFZA 3BT9A 4L5JA 3J8F2 4RGGA 1GZWA 2GM4A 1VMJA 3WQBA 2GH2A 5FZMA 2XLGA 4UW5A 1BZWA 4O5VA 2RQQA 3TO7A 1SFOJ 3Q8CA 5HDNA 3WQ0A 3HPNA 3WCRA 1VI0A 3MIBA 2DA3A 1XE7A 2XJQA 2VUDA 3BR5A 2J22A 2RKHA 2XF6A 4UUSB 4V2FA 2X0LA 2DYRH 4I0BA 2UU8A 1SG3A 2DDBA 2LBFB 1SFXA 4YGBA 4UVCA 4R79A 2Z99A 4Z2YA 2O8QA 3POEA 4XABA 2LY2A 3ZOIA 1T0FA 2B7EA 3CJIA 1FSEA 3GLLA 5H2FC 4A3LJ 4ESFA 4XFCA 1R083 3ECHA 1PNGA 5J37A 3ZMNA 1K5MB 4KBZA 4Q0SA 1RITA 3DU5A 4RR3C 1W5TA 3FXQA 5GP9A 1H89C 3N36A 4JP0A 3ZFGB 1QWRA 1OCRH 2H0VA 1N3OA 3HWJA 5ABJC 1R9TJ 4P9GA 3UK9A 4Y4YA 3NSTA 1XJAA 3AYCA 2VBBA 2Y6HA 2ZKZA 3FFZA 3BOQA 5M5XJ 4BL0B 2HYXA 4ZU4A 3PHMA 2A6TA 3N9NA 1CJPA 5L36A 3AMMA 1ZELA 1Y6IA 1KXGA 1GR3A 2HLEA 1O4YA 2VQGA 1X36A 2JDPA 3G73A 5FZFA 2KLOA 1QJU2 4I2OA 1D8KA 4FOYA 2EZHA 2ZGUA 4LMYA 3ZMZA 4DQ2A 4EMSA 3IH4A 2GP3A 1P4WA 3EYYA 1XNBA 2O5RA 4AEDB 5LBEA 5FZCA 1QQP1 4HQMA 3PUSA 2OCEA 4IX7A 1T95A 5F5IA 3VDDA 3JTGA 4HDVA 3HAGA 4IEQA 4DBQA 2WLQA 4C2UA 2QNKA 3MIDA 3ORJA 2VZPA 3SFIA 2JWPA 1JOPA 1HRI3 1CD3G 2E35A 4IGPA 2VJ4A 1LEBA 3LWFA 4YGDA 4PLNA 3TDUC 2ID4A 4BQWA 1YJLA 5DG2A 1IXSB 4CYCB 1NY72 3S3NA 1UG2A 2ORZA 2VBDA 1WKMA 5EZHA 2ZX3A 4DZPA 3GJBA 3N9QA 2VQLA 5A7QA 2FXAA 4FX0A 1N78A 3CO6C 3ZSLA 4P96A 4WZCA 2GH8A 2VJIA 3AG3H 2BGOA 4AQ6A 3T1BA 2XXZA 2JRTA 5IFPA 4G9SB 3HHHA 3ES1A 4A41A 1AYN2 1SD7A 4YFKF 3JTHA 4LG3A 3KT7A 3B6AA 4EM0B 2B42B 1SEUA 5L9BA 1VBD3 2F4IA 1ULPA 5FY5A 1AL22 4DBRA 4CDGA 3KEQA 1UU4A 4KQ7A 1JS9A 4ITCA 3BCAA 2OJED 4ABZA 4LLGF 4K2EA 2X1DA 2L54A 2K4BA 1BI3A 3MZYA 2DUPA 4MNUA 3FFQA 1XC5A 1YYVA 3VBHA 1VP6A 3JBG2 3GCMA 1WA4A 3ZPLA 1JKOC 1GFF2 2VODA 3LWCA 4ISQA 5AONA 1LPQA 4W1UA 3RKXA 2ZHMA 3JRCA 2QVSB 5K8SA 4IERA 4A3ZA 2VJJA 4QWQA 4TXWA 4XQFA 3OYHA 2BERA 2DBBA 1IC8A 3CDHA 5J48A 2XJVA 2Q0AA 2J1RA 5DAVA 4QX3A 5K7PA 4UB6C 1OCZH 4X8PA 2XIGA 2M5WA 4L18B 1FX7A 1MMSA 2LVSA 2YU3A 4MXWA 3JQWA 1Z7S2 3L2YA 2FDKA 1EUTA 1EJ9A 2VQUA 1FV2A 2FBKA 3P1IA 1YFWA 2FEZA 3DTIA 1D5VA 1X1DA 4UXNA 5FZIA 5LLQA 4FXKB 2OBPA 2Y2ZA 3TYJA 3T0AA 2A68F 2FMLA 4N0BA 1XPWA 4AC0A 1RJ8A 3J7HA 2ZSIB 4ZPIA 1N1SA 2VKHA 2Q2EA 4DW6A 2RHPA 2D98A 2DA5A 4LKFA 2IS4A 1NH3A 1WI9A 2OPTA 2A70A 2X09A 4DXRA 2YGLA 5FY9A 5IATA 2ZJRF 2O8OA 3ZMSA 3HRUA 2XONA 1C57A 3DBHB 2ZX0A 1X1CA 4A7ZA 3G1LA 2JN6A 1S7OA 4WV8A 3NWTA 2LKPA 3URFA 1RUF2 3ILFA 5D4RA 4IGOA 2WTEA 1ZLJA 1VNDA 2K3PA 2PHTA 1JKQC 2X4HA 1Z21A 3WGIA 4AVBA 2X85A 5K5QA 3WNPA 3LFMA 4B4CA 4KNYA 4TN7A 1UOJA 3FDYA 3K0LA 1H8AC 3WTVC 5L3FA 4D69A 1ENXA 3LA7A 4AVPA 1IV8A 2HJIA 4XKCA 4F83A 4OHXA 3IMNA 2LKSA 3RZZA 1W7PA 2O03A 3E5XA 1FBUA 2X05A 1PK6A 1IF1A 4DMIA 4PSXA 3Q0VA 2H09A 1G3YA 1OYYA 4MXWB 1RUH3 4D0PA 2PHXA 3JRIA 2OZ6A 1JBCA 4XLFA 3G2BA 3CMGA 2PN6A 4HQEA 1T33A 4R8HA 4M3GA 3H3ZA 3BTCA 2JXAA 1A3KA 3MV01 4LORA 4AI2A 2LREA 1USTA 2AENA 2VOPA 5FXWA 2C6SA 2QQVA 4MOAA 3L7WA 2X1CA 3AP4A 4BLIA 1G2HA 2JG9B 1SACA 4XLEA 4CH7A 3DYMA 2YUEA 3CZUA 5D5UB 1APNA 1NA1B 1G8XA 4ZC3A 3KM5A 4E8DA 2A5ZA 2JD4A 5C4WC 1SBDA 1Q8VA 1O3RA 2CAUA 5CVIA 3NWSA 1W8OA 1EY2A 2Y9YA 2DJNA 3KGZA 1B35C 3VKLA 2NS0A 2GP5A 2EV6A 1MBEA 4AIHA 3TOBA 2BXZA 3E0JB 2BDRA 4YIFA 2ZMNA 1O7LA 2IGKA 3N3HA 2IA1A 3BCWA 1MDMB 2ZNYA 1E0EA 2QKMB 1EAH1 4CDUC 1AHDP 1NCRC 5IVJA 2GBYA 4ZZLA 2Y26A 3ASIA 2DTZA 1V6JA 4KWUA 1GICA 1BBT2 4GMP1 3PO3J 2F4OB 3FF5A 4M00A 4N43B 2Y6KA 2ZEYA 2EB7A 3KVAA 1LU2A 5EV7A 5J6XA 2KDOA 1RR8C 3B69A 1WFXA 1T6SA 2FF4A 2RMU3 2ZMEA 4XIDA 1CN1A 4S2GA 2FBHA 5G05L 1AR73 2BZDA 2K46A 4G9YA 2HWF1 3HB9A 2JVGA 1PDNC 2X9DA 3T1MA 2X6WA 2IGMA 4M9XA 1H4GA 2VMFA 2D40A 1MBFA 2B46X 3AMHA 5A33A 4B29A 5IK8A 4XJ9A 2O0YA 2A3XA 4LBQD 4WVMA 2P5BA 3VGIA 1YW7A 5JR7B 3GXUA 3DYOA 4PI2A 3CO2A 1IS6A 4COWA 1YJWI 3NWKA 1IW7F 2UWCA 3K4NA 3LSTA 3I53A 1W0UA 3DKQA 3I2JA 3RZDJ 5CPRB 1VBA2 3GZNB 4QXHA 5JVGF 1YRNA 3AKSA 5HNHA 4GWJA 1W39A 4V19K 2M8EA 5FLVA 2BNMA 2BV4A 4A6DA 5GM0A 1WLCA 3QYBA 3ZQLA 1VPHA 1X4PA 2RM21 3B93A 4ZXKA 4RA2A 4F55A 3HSRA 3J7AY 1BMV2 2Q1MA 5DM7F 2QSFX 1OVSA 3J26N 5IYYA 2BFUS 3ABMH 1ACIA 2DQRA 2P8TA 5DUVA 3AFHA 2L7KA 2F6BA 1S0GA 5E3MA 1QNWA 2GU9A 1R5ID 2JZYA 3OS2A 2K2SA 2XKPA 1NKGA 4BHPA 5J3UA 2W82A 5EZGA 5FLMJ 5JZGA 1QJX3 1F4KA 4MEXF 1SVLA 1SBFA 2GXAA 1VJ2A 2JKBA 2A61A 2COMA 1RL3A 3OIPA 2HVQA 4YFXF 2WNVC 3GBGA 2CYFA 4IXAA 5FB2A 2M9HA 2TEPA 1TG7A 2L4MA 5DD8A 1R5GA 3OEBA 5H6QA 5KXEA 4F3JA 4KMUX 5LRSA 5B1AH 4HX7A 1FXZA 3VSKA 4D94A 2WQZC 4WK8F 3ZQCA 4D5CA 3VPRA 3AFGA 3ZR6A 1CZVA 4LLNA 2ZX4A 3C2GA 4LBLA 1WKYA 1C8M3 1F5TA 3OY8A 3AP6A 3FXJA 5BPIA 1YQ8A 4DOUA 2PXJA 2GLOA 4FISA 1YI2I 2EA4A 2EH3A 1UX6A 2YY1A 4PQQA 4B4RA 1NYWA 1W4MA 2E7QA 4B48A 1K12A 3VBOB 3QBQA 4AQTA 2CW7A 5A6QA 1YRNB 3WZ1A 2DMQA 2AUYA 1REDA 2BBAA 1ZN2A 2DFFA 5FP7A 4GYGA 2W3JA 2ZXJA 2WFF2 4J01A 5IWFA 1WCKA 2R7XA 2VCAA 3CDLA 2R7OA 1PVXA 4AEKA 4BOWA 3V0BB 3OWTA 3JRAA 1KEXA 1Y9GA 4L9VA 2MH9A 4B1RA 4IF4A 1ZG5A 1GVJA 4PCRA 3NAUA 4LLFA 3DYPA 1OLMA 3PUAA 1E57A 4B8EA 2SBAA 4XF9A 3WNOA 2OV7A 1IN4A 5IT9Z 5L9RA 4OQ8A 5JLXA 5FYCA 1NAEA 4EN7B 2WAQA 3ACGA 9ANTA 1RUC3 1OOPB 3S16J 3PFIA 4BE2A 1GBGA 2ZGQA 1YO5C 3FK6A 5CFCC 3F95A 1OISA 1I1EA 1P6RA 2X6OA 1FC3A 5J1YA 1S72I 2KPMA 2OUHA 5FRNA 2HS5A 2WRAA 2EAAA 3EXUA 2J1AA 4XURA 2CQNA 5IAXA 2P3JA 1H1IA 2RR11 2JG8B 3P9CA 4QQOA 4GH4A 4AAPA 3A21A 2WB1N 3BZKA 5E89A 3ZIXA 1Y3TA 4UFLA 1GDTA 4P9YA 4M3BA 4PUSA 3RPUA 3PSIA 2R7ZJ 2HBTA 4XYXA 4K6BA 4EEFG 3ABUA 1QXRA 3ZMDA 3VWBA 2R16A 4YVSC 2QBYA 4G8XA 4XZPA 1IDZA 1V5GA 2R7WA 3V65A 4XONA 4LBMA 5EHDA 1CJDA 1UQXA 1VE0A 5SV8A 2YPRA 5E1WA 1XMXA 3BYWA 4FAHA 3MF9A 3ZX7A 2RS31 1HQCA 4IPAA 1SPPA 3B01A 2D6LX 1Q56A 4DEVA 5H6RA 4KN7X 2HFHA 2EZKA 4LR4A 2JPCA 4JGZA 4O7XA 2C26A 2AR6A 2J1EA 1JODA 1X3UA 5DDGA 5EQUA 4YARA 3OGSA 4COUA 1L3JA 2EXIA 4XLNF 4UFJA 4FPHA 4FCAA 3ZLIA 1HKSA 1GLHA 3AZYA 4FX4A 2W7NA 1Y9QA 1WMFA 1RUE1 3BTZA 3FM5A 5F6LB 5FJHA 1OH4A 2ECBA 3C7JA 2ZJCA 4M0HA 2AGSA 4NC7A 1Z77A 2EIMH 4UUTA 4CCJA 3PO2J 1RUJ3 2PAEA 3BTLA 4E6KG 4XKWA 1WSUA 4A69C 2H0BA 4EQQA 1TL8A 2Q8CA 1S8NA 4A45A 3M3OA 2MLGA 1ETYA 4Q4W2 3F72A 5AIPA 3SMHA 1H9GA 4BH9A 4BCUA 3VDBA 4EGZA 2PLV2 2ZMKA 5FBJA 2Z4FA 3H5RA 1IGOA 1OQEA 2PQ8A 3S15J 1W04A 4C1XA 3H36A 3UKGA 5IP6A 4PJ0C 4KIFA 4XIKA 4NWVA 2IBDA 2WABA 4UFMA 1XTAA 4ZHNA 3ZXGA 1HB2A 3AMQA 3NJYA 1JYIA 4H14A 2IA2A 4P9FA 3VDAA 1TLHB 1SMYF 3M70A 1VQ9I 3BJOA 2VNOA 4IW3A 1DZTA 1PNFA 1SD5A 3LSKA 4Y5SA 4KFCA 1MH4A 1PO13 5BNNB 5DN2A 1P7IA 2X29A 2CG4A 2VMDA 2WLPA 3S2DJ 1RMU3 2D6OX 2E60A 1HLCA 3AB0A 4EM1A 2DURA 1ASJ3 3N35A 1UIKA 4UFHA 1X3WB 4CPBD 3NNJA 4WM7B 1R4MB 4KJZA 3S8PA 2IXLA 3VZOA 3H35A 1AJKA 1PUEE 4HX4A 1N3QA 2MHFA 5BQTA 1LQ1A 4W50A 2BP6A 1OLRA 1ENQA 2LTPA 3RQIA 2HZTA 3QOEA 1GZTA 2P7VB 2HPIA 1RXFA 2HOEA 1R6RA 4DINB 2EIBA 4KGGA 1S0IA 4DNCA 2DTYA 3SEQA 2WT1A 4QPIA 1OMIA 5BNPC 4DY5A 4QXCA 3PNVA 4XF1A 1J0RA 3APBA 4CP9A 4P00B 2DPDA 1WUVA 1I3HA 4FOQA 3TO9A 2PJRA 4ISRA 2XAGA 1J75A 3W9AA 2QKDA 2HKXA 2GA1A 3IIAA 3LOIA 1W8FA 2DK8A 2GSYA 2ZNZA 3MUZ1 5EEAA 1XNAA 2W1OA 3H1MA 4I6ZA 4UHTA 3T5XA 3GUDA 1D2QA 1DGWX 4L92A 4XFGA 3GF2A 3HQUA 1YCIA 1E5HA 2JIJA 2EIJH 2XJRA 2GC1A 4XXAA 1NLSA 1HSTA 4BXUA 4Q29A 2XJUA 5JSOA 4HF1A 3VDCA 2XKOA 4FPOB 3ZMOA 4CXXA 1KRIA 5KAIC 1TME2 3W59A 2OQRA 3RZHA 2QQMA 1ND2A 4IE7A 3M1EA 5C5TA 1US2A 1ZBA1 4KG0A 5F6FA 2ZGNA 1YLLA 1MMNA 1LOFA 2NS7A 4HXCA 3T0BA 4HAMA 2ZBKA 2DVFA 2IRFG 1ACCA 1SLBA 5F3IA 4LFUA 5CKQA 3FHZA 3KP2A 2P3KA 2QZ2A 3WTXC 2EA7A 4YW6A 4Q27A 3MW4A 1U5XA 3SZPA 5C8CB 3EMRA 1D4M2 4YRDA 4B47A 2XGCA 4F93B 3SC7X 3I97A 5JI6A 2NQYA 1TMF3 1EH8A 2Q5TA 1K5MC 2VECA 4RLQA 3FLTA 3SNMA 4G6TB 1ZBE1 1PJRA 3F21A 3IN9A 1VMFA 3G71I 4Y1XA 2QZ3A 3N4MA 4BJ5C 4BK4A 2W25A 3VBSB 4IV3A 1DU6A 1UY1A 3Q8BA 2PFBA 2N8GA 3C3VA 5HV0A 1S2BA 4C90A 2FD5A 4D7MA 4DEQA 4ANJA 4A3JJ 3AVRA 2R30A 3AFKA 1ZGWA 4RMNA 4Q1RA 4QDRA 3A0HC 4XVHA 5T5PA 5HLHA 2Y64A 4CPBA 3RKQA 4LKDA 4Q48A 3IB3A 4QTRA 3HOSA 1SD4A 3POWA 4XFBA 4E7SA 1S0BA 5BUVA 2BWAA 4IL7A 2K3FA 3CMEI 1V54H 1S9HA 3ZR5A 5C3OA 1SLAA 2P1BA 3K7AJ 3O1OA 3BJAA 1MEC3 4A6OA 2HVRA 3JUUA 1X50A 1QMJA 1VRH3 5FKCA 4DZGA 3OF1A 2E26A 2VMIA 2X8KA 2WQ8A 5CISA 1W6MB 2QF7A 3PMSA 4M01A 3MFAA 4JCKA 3DPTA 1JYXA 4ZONA 3ERMA 2CU5A 3BIWE 1YQCA 1XG1A 3F9KA 4EN8B 1LTEA 1NCQB 3DEMA 2MFZA 5FZ1A 1X1AA 2VO5A 2O1QA 2BY0A 3TRSB 3BZCA 4DUVA 1YLFA 3SCGA 4O65A 2DV9A 3OYBA 4CU6A 1ZYBA 2EIDA 1T0FC 2XBO3 3CJIC 4M4PA 3E1F1 2YROA 3T09A 5APAA 1FOD3 2WT2A 2XC7A 5DZGA 4XLPF 1QRYA 4KWLA 3NV1A 1SCRA 1X1PA 4OMCA 1BW5A 1W6PA 3WR0A 1YI9A 1U5IA 1VBE3 2DFCA 5A1AA 1OA3A 2DCZA 3RQ4A 4NROA 4YZ5A 2JDZA 3VZLA 5F08A 1RUI1 2DT5A 4FBFA 4Y4RA 1HRV3 1CZSA 5T54A 1X33A 5A80A 3KYLA 4L9TA 1QQP2 3RI8A 3ZR8X 1K78A 1ZM1A 1ONVA 3O0XA 5F6KA 3S1RJ 2L7MP 1OA4A 2M45A 2R0QC 3AL5A 3OGGA 5FRMA 2B9VA 4A0YA 5ICCA 3A23A 2LTNA 4AHZA 3ME2A 4X6AJ 4EJRA 3FBYA 4OAZA 4LKSA 1OH3A 2I45A 4QAWA 5CU1A 2GNTA 1W2NA 3VDDC 2VOTA 2MEV1 2EFPA 2ET1A 4BDZA 1IKPA 1UL9A 1O59A 5LEKA 5LZ6A 3TQNA 2VCBA 4QWNA 5JHFA 4Q2FA 4U7DA 1X3ZB 1MIJA 5I0SA 4FFHA 4XFFA 1E3HA 1TTYA 1XB9A 3IPVB 3O1RA 1K3IA 4M0NA 3FBIB 4HX8A 1YIOA 1YFHA 4E4DX 3QYEA 5FYVA 2Z5UA 1W8TA 4LA3A 4CRQA 5FZEA 4YFWA 3CF2A 2XDVA 4OOIA 3TN91 5IVVA 3H0DA 4GB33 2R071 2VT3A 1W6NA 2B45X 2DDUA 3VYTB 4PJJA 2DFBA 1V70A 2PHWA 1X2NA 4XJUA 2A6VA 4DUXA 1H4HA 3POFA 2X6YA 4KDPA 4N7UA 5DS9A 1FPN1 1U8BA 3GCXA 3C7OA 2OA4A 2BOIA 1Z3YA 1EUUA 1UXXX 4N53B 2F2EA 1S6LA 4BXXJ 1RRJA 1K4TA 2B63J 2EZIA 2JECA 1H2LA 4LIVA 1GZCA 2EF6A 1SFEA 4L97A 5FZ3A 5EXOA 3VBHC 2ZHLA 4GWIA 4C2MJ 1VIWB 1WJ5A 2XG3A 4YWAA 1OBNA 5FFOC 5BPDA 4GWMA 1XGSA 2VZQA 3NKTA 5J4VA 4QQHA 4YYOA 1S0JA 5LHGA 2WN3A 3AM2A 3PL8A 1UOBA 4LQRA 1O57A 1LVKA 3MPBA 4GFBA 3WDTA 1OYIA 1LOCA 1X9PA 4FASD 1AR63 2J5PA 4LGWA 2YZ4A 4BYYA 2M0MA 2PEXA 5CB7A 5JMOA 5JIUA 4ZZDA 2ZO4A 2VXJA 4AFAA 5FUNA 2DVGA 3UGGA 1FNNA 3PUFA 5CADA 5LCWL 4WF2A 4HKWA 3VZJA 4JDMA 1UIJA 1NT0A 4A6SA 4QPYA 1C28A 2QE3A 3MW3A 2DCJA 2L2OA 5JVVA 1DYKA 3E5QA 1VBC3 4BY7J 1NTCA 4J19A 3DEWA 2ZZJA 1O8PA 1VAVA 2PX9A 5ILUA 4KISA 1XYOA 5FYZA 3LKJA 4XETA 4AVCA 3OD4A 2KA3A 1W6NB 2P5KA 2RG4A 5IP9J 5CVVA 3D1NI 5B1BH 3CJRB 3RWKX 1BR1A 3IH2A 4B44A 4FOWA 1Y43B 5DEQA 2ARCA 4L9JA 5HVQC 2JTVA 1HN0A 4IHSA 1EKEA 2QLZA 1NHAA 2M2EA 2M3AA 3SZTA 2LDUA 1TQ5A 3K4CA 4EJUA 1GP4A 1MKMA 1ZZ6A 2V4JC 2GALA 2IGOA 5IHRA 1ZR4A 1PVEA 3ZXSA 2PMUA 2G4IA 1XMKA 1XGMA 5F3EA 4NC6A 4ASLA 2QGUA 3FZVA 4XOGA 1PUFB 4YG2F 3MQ0A 2OAZA 3M4FA 4BMBA 2EQRA 2R7FA 2BW3A 3PSFA 5E3LA 2XPWA 2X53S 2NNNA 1YG2A 3FXLA 3OS1A 3WP4A 3QODA 1H88C 3AL0C 4U0YA 3O7OA 5FZOA 1R1A3 3VZNA 2ZGKA 1E2XA 3U1DA 2K7LA 3CMAI 2ID3A 5I0UA 4Q4V1 3LF7A 1XCBA 2AYHA 3ETPA 2Y0SN 2GNMA 4XCAA 1PK6C 2RS11 4NB5A 1UY0A 3CL1A 4ET7A 3I58A 2YG0A 1AJOA 2WUHA 3MAJA 5JI9A 4YFNF 4ZDLA 4I98B 2EJRA 4IOCF 2Y0OA 1SLLA 3NNGA 4EN0A 2R7RA 1MQTA 5LBBA 3UT0A 2XAJA 1T6GC 1PGL1 5CYVA 3CMMA 4RD7A 1W0OA 3O1SA 3EUKL 3LL7A 1VQLI 4OWRB 5AC93 4HG6B 1SMVA 5D1IA 1HQLA 3V56A 4GIQA 4FTHA 3ACLA 5JSRA 5GLTA 1JXSA 3BTIA 2TDXA 3BROA 3HL2A 4AFCA 2LLKA 1V4RA 3BB6A 4PGHA 1XGNA 5T55A 3WUDA 2ES3A 5BV6A 3PJYA 2PQQA 1GHCA 3HZJA 2HI3A 5I0TA 4UXAA 1U5YA 3KPHA 3HOUJ 1UX7A 2ZPXA 2DFHA 5JR3A 2WY7Q 1F4HA 3U37A 3ZN6B 1C0WA 3OG2A 1HX6A 2V1XA 1EAH2 1MSEC 2E32A 2VC1A 1W03A 2V5YA 4RR3A 3AVSA 1VQ6I 4K40A 2R92J 4MIMA 3WE3A 1P4AA 3S2WA 1IRZA 4MTEA 3JB4C 5A32A 1R7JA 1IZ1A 4RL7A 3IAM2 2L01A 3K70C 4XUPA 2W68A 4MQVA 4LOCA 1QOTA 4ZS3A 1JI6A 2D6NA 5ACA3 1R00A 5DABA 4Z92B 2O3FA 2RVAA 2HWF2 3D5SC 1R71A 4JX4A 2P17A 3OCPA 5FQ0B 3GCWA 4ZDPA 5E1XA 3EYPA 4B7KA 1VQKI 3B94A 4HLYA 2Q8KA 2R0FA 1WJDA 5KCMA 2GNBA 1RUNA 3JU9A 5I8TA 2HEVF 2ZMEC 2VE9A 3JD73 3DLLF 1DDNA 2V9KA 2ZXIA 3M1CA 1YJNI 2FNPA 3HIFA 5J96B 1OF4A 2JK3A 3MFKA 3CUQA 2G7UA 4KU8A 1K42A 2VJXA 2VTXA 1NLQA 3RWNA 4KNCA 3USUA 5FPXA 5I0RA 5EGOB 3TEYA 2BPA2 3HOZJ 1FJLA 4Q4Y3 4Y1ZA 5CNAA 1Q3EA 4EWDA 2XVCA 1MS3A 1WCSA 2RM22 4XIOA 2PMZA 4R9AA 2M30A 4A6EA 2IGNA 5M3MJ 2KIFA 1O91A 5FIXA 2YFZA 5K9YA 2VUCA 1UAAA 2E2HJ 1GUIA 2O8XA 2CS3A 2VR4A 1RC9A 3Q9OA 4NUBA 3KETA 2HOSA 1PGW1 2HWE3 4A2UA 3SCFA 4OI1A 4XAAA 4C2TA 3CCRI 1F8VA 2VUAA 2FDIA 4N9IA 2ICWG 4JV4A 5JLWA 2W1SA 3U4XA 1FTTA 1W05A 2ZEXA 3TGNA 1TBXA 2ZGPA 5H9SA 4OHYA 3VL9A 3K4AA 4MGYE 1AL21 1WH7A 2A3SA 3HUGA 1KYWA 2DT7B 1PO23 5IP7J 5JR2A 2B7YA 3I4IA 1DU3D 1U5TA 1RUH1 5JZGC 1QU3A 2LR8A 1LUJB 3H8RA 1OKRA 4KT5C 2P6CA 5CQEA 1A31A 1PMIA 1BJAA 4BA6A 3GDBA 1FI2A 4YW4A 1Q8OA 4RS8A 1UD1A 3SHRA 2FQ3A 3N7LA 2MD5A 2NRAC 2YFUA 4NE9A 4BWOA 3J7NA 5DYMA 1AZDA 3RZOJ 3R0JA 4XR6A 1UZCA 4K3UA 1H8VA 1T6BX 3JQXA 2Q0OA 1OA2A 1MZEA 1UMIA 3J7MA 2Y9ZA 1QOOA 3IZOA 2D3SA 4FE7A 2MLKA 3S6PA 1ZRFA 3L2HA 3CDZB 1GQGA 3BTYA 2RDSA 1ZVFA 4JKKA 1ETOA 3DBLB 3VBFB 3ZKUA 2VE1A 1RUOA 4OIOF 3ZOBA 4P9WA 1DGWA 4FPFA 2AXLA 4I3GA 2MNGA 2BY3A 5ICEA 4AK3A 1JGGA 2KHMA 2G7HA 2DVDA 3AZWA 1IN5A 1HJGA 1IAWA 3WU0A 4MGQA 1E3PA 1US3A 4F3QA 3M8LA 2D6KA 2MC4A 4LULA 5CA6A 2KRHA 3U21A 2E6VA 3ISPA 3SXYA 2OQGA 5F5CA 2ARBA 2RMU1 5JFRA 3BG7A 3CKHA 1IZ3A 2RR12 3EUAA 1HKQA 2DN0A 1RTVA 4Y20A 1P92A 3OPZA 1GMMA 2ZX1A 1BOAA 1I1SA 4EZHA 2CFXA 2QUOA 1XS9A 4AU7A 3U10A 3FC0A 4EN6B 1BC7C 4LBQB 3HC7A 3WF3A 3A4CA 3FZ3A 3IDAA 3ZSMA 2QDNA 2K86A 3WQ1A 4XOTA 1F31A 4L9NA 5GAEJ 3CMYA 5C3RA 3G7DA 3U14A 4YRVA 2HTSA 1H2KA 2AC1A 2FA5A 1YO8A 1S3JA 4RQPA 4GH4C 3BPZA 5CVJA 4NQWA 1Z05A 3J81K 2H6BA 2LY9A 2STWA 3W6KB 5D5XB 1FX5A 2L9SA 1DPUA 4Q4X3 5K7HA 1JOBA 2RS32 1RKTA 4CYDA 1S1AA 5K0UA 1ONAA 2ID6A 2NVYJ 1HQNA 1C3HA 4EE2A 1NOVA 4FFIA 2VUMJ 4LK7A 4WM8A 5DAXA 2LC2A 3PFYA 1REEA 1OFCX 1QGPA 2A69F 4BQXA 3U1XA 3IH3A 1UPIA 2AH2A 3FMQA 3D5OA 3ZFFB 4RB3C 4ASKA 1RUE2 2WNEA 1A6QA 3OPTA 4JGZC 2Z2SB 2GC3A 2C5DA 4QT6A 4I99C 5EG0A 5I8SA 3ZN1A 2O7OA 4ES9A 2OYZA 2W52A 1JI8A 3L9FA 4UVAA 4DJAA 2J1UA 3RFRA 5GJ6A 3CCUI 1NG7A 5D8AA 1QJY3 3JZVA 1RXGA 4QX2A 2RJLA 1QJX1 2MABA 3MGUA 4TZDA 2TUNA 3GF6A 1TEIA 4CDUA 2ZKLA 5D2AA 3FISA 1RVF3 2C4XA 2CL2A 1RUG3 3OYJA 3ON7A 3JCUC 2MPFA 2LROA 2ZB9A 4NHXA 2LSOA 2HWB3 1C4RA 2CWMA 3GNEA 5FYSA 2Q4SA 1UNBA 1UZZA 4GXLA 4NR1A 1MJBA 3J7ZI 2KFDA 1OD3A 2R063 2ARXA 2WA4A 4K8RB 3I64A 4P9JA 4W6WA 4QDSA 4YSFA 1NE4A 5JIAA 4AEMA 1V9U1 2V73A 4PIXA 1C8M1 2FDJA 2QSHX 3H0GJ 4XHBA 2CH0A 1JJ8C 1STMA 4DO0A 1V5FA 3ZYPA 1ZHFA 1X1BA 4D6SA 4Z82A 3O2PE 2D1HA 3ZYJB 4C91A 5K0UB 1J09A 1JJ6C 1Z0XA 2VOKA 3PUHA 2WNUA 1W8WA 1MH3A 3EDPA 4KMFA 3CQOA 2BOLA 3WTTC 2YC0A 1B6AA 2PMZN 2VC0A 1CAVA 1YUDA 1V55H 3DQVC 4M9SA 1RIRA 3SJMA 1J58A 1YIFA 3ERED 3M7AA 3CUOA 1DCSA 2AEZA 3PVOA 2RE9A 2ME0A 5EFUA 5LRRA 1QO0D 1CAUA 1YC61 3F8NA 1JH5A 1YS7A 4NAMA 1IO2A 3EB7A 4FP3A 4YZ4A 4LHKA 4PJNA 1GANA 3ACIA 2PMHA 2M4KA 2VQCA 4XDOA 3DXJF 3ZXEA 4S2HA 3NV2A 4HKOA 5FZAA 3V8KA 4NRQA 1RUC1 2I8DA 5CBLA 4FQ4A 2BQPA 3AP7A 3AJZA 4EATA 3HRMA 4II2A 3I4NJ 4FP2A 2HYFA 4LITA 1OURA 4LG0A 3HBZA 3ILRA 2JSCA 1VQPI 2WR9A 1BMV1 2W2IA 3KMHA 2FCTA 2Q8EA 2SLIA 2DLLA 1QDOA 1DP7P 3QU6A 2W87A 3PJRA 3A0BC 2F5VA 3F8BA 4XL9A 1QKQA 2BWCA 3OYEA 1Q8QA 3SH3A 2NLRA 1A04A 3A4UA 1BC8C 1BM9A 1IPJA 4CCEA 1ULYA 4QPIC 2H27A 5K1YA 2HQAA 4N7IA 2Z79A 4NHYA 1JUIA 4E8CA 1OQDA 4QPGA 1TWAJ 3ATGA 3B3QE 3QQAA 5JSPA 2JWTA 4AVTA 3IAQA 4AYBA 1TVGA 1W0NA 3OSFA 3K1NA 3LSIA 4I3PA 2BUKA 1JYCA 2P3YA 2MBFA 1J1TA 2UURA 1I1GA 1MBGA 1EV11 4BJ6C 2K5CA 1ZZBA 1BK1A 3AL6A 4I01A 1FMVA 1BCXA 1YX5A 4RB1A 2DFEA 1DF0A 2BTVC 5F7UA 1I27A 4IE6A 1ZBA2 1Z78A 3O0WA 1OJLA 4DYQA 1I9RA 3NRUA 3BP8A 1AXYA 2A05A 2V9VA 1BQPA 1AKHB 5F3GA 1FT9A 4BHCA 5KAFC 3DEUA 1JW6A 5GKAC 5J4YA 3TDZC 1FNZA 2MH2A 2V9PA 2A07F 1X4OA 2X5IA 1YIPA 3ABTA 5CEHA 1K7AA 4WXHA 1ND2C 4JGYA 3CLQA 2PI0A 2JE9A 5FPLA 1N3PA 3DLAA 1RUJ1 3QOPA 3FKJA 3BR1A 1LOFC 3HJEA 5H20A 4XFIA 5IW0A 2FZ2A 3NARA 3KQRA 5GLZA 4LOTA 5AFBA 5DCFA 4ENNA 4CDWA 4BQNA 2AQFA 1HW2A 2AXTC 1VQOI 2V72A 5LGNA 2ZEZA 2ECCA 3NO8A 4DY3A 1ZBE2 4X8NA 5BNOA 2ZACA 1O3SA 4P08A 1H8TA 2LH9A 4YELA 3P9IA 2E1MC 1VTNC 3VFZA 2Y6GA 1ND3A 2XHNA 3TP3A 1VB2A 3A22A 4XRFA 4LLOA 1FYKA 5JXGA 2WO7A 2NYYA 2HPMA 3JB8A 4IQJA 2JA8J 3MIFA 2VJ5A 2O14A 4YFZA 3QWLA 4O9GA 4IEWA 4BQOA 1B8IA 4MX3A 1X7NA 2ILMA 4UF0A 4Y26A 2PMWB 4Z6YA 1D1AA 3F0CA 1LKXA 4NNJA 2OZJA 4PDWB 1O4TA 5FPBA 5IVYA 2Y6LA 1S29A 2XWBB 4L0ZB 1W5CC 5HOOA 3KZIC 2ZJPF 1ZRRA 1JGSA 2VOWA 1DIWA 4YVSA 3CJNA 1ZZ7A 2H8WA 4AHYA 5H9QA 2W24A 2YSRA 1IRGA 1B09A 3SISA 4CCKA 1XPXA 3BG5A 4FOVA 1PO11 4AWXB 3QCWA 1DG6A 3POYA 2W08A 4P9LA 4RSUA 1DZQA 3S5AA 2PQSA 1RMU1 4S2DA 2YBKA 1BI2A 1TT0A 3H5NA 1JE8A 1ASJ1 2VQAA 2QQ9A 5FLIA 2WZ8A 3WW4A 2P2KA 2FOWA 1MS5A 3WHUA 2YC2A 1D3YA 2X5IB 5E1RA 4JYKA 2A75A 2XJPA 3EJKA 4JGYB 3UGHA 2RS53 3WHCA 2BVVA 2LM3A 4IE5A 1COV3 4YNIA 4PF1A 3EHKA 1IUFA 1WRJA 1LGNA 3RYRA 4CDWB 1V5EA 3KF5A 5LHHA 4QM8A 3B7MA 4IV1A 1G59A 4CDXB 2GIVA 1CGPA 4HF2A 5BPXA 2EFNA 5HPOA 1LDKB 4WVZA 5LBQA 2EIEA 3H8XA 4A5NA 1ND3B 1FMD2 4XF0A 1YXWA 4G94A 4O9EA 1ZR2A 5CG9A 2AACA 3MV11 3H3UA 3CP8A 1VQ4I 4QX8A 3V7SA 4AF9A 4BEHA 2RDRA 4IETA 4E4ZA 1CAXB 4HN1A 1BW6A 1GP5A 2WAFA 1W3XA 3DPRB 3RIRA 1B1BA 3B9CA 3VBRB 1XYPA 3PQKA 1YFYA 1W36C 1JZ4A 2R7UA 2JX9A 3LDRA 1SFUA 3IC7A 3K6GA 4D1QA 5FOBB 3KVBA 4P5HA 1SFPA 3T2QA 5A3NA 5FYBA 3I3EA 3LFUA 2VZSA 5CFDA 1CAWA 2IJLA 3OD0A 2F5DA 1GXQA 3QPTA 3GZAA 1U6GA 1RUD1 4IESA 3LSGA 4AW7A 1LHVA 4FPCA 2LP0A 5L9VA 1ZGAA 1NG6A 4XUNA 1ZRCA 2DA4A 1R22A 1IV6A 1HXS3 2CO5A 3FMSA 3DTEA 4UWDA 2V09A 1YFUA 3OJBA 3VBUB 3EUHA 4M6YA 1CQTA 3A7QA 1GV5A 3LQQA 5G04L 1FOYA 3LDKA 1JUMA 2WS93 5D6FA 4DQAA 1RINA 5BY5A 3MKZA 2WJSA 1FYUA 1J9IA 3THCA 2AZ5A 3DF8A 3UETA 1UWWA 2CMPA 2CQKA 4BB3A 1WCUA 5EPAA 3L9JT 2GOMA 1S2EA 2ZKNA 3NAPA 3TN92 4KI5M 1Z3XA 5EEGA 4XCBA 2R072 2CGOA 3KWVA 2WAEA 4LNVA 3ENRA 4WX9A 5JCTA 2H94A 3WW2A 1LVAA 1JHJA 1N47A 1FOXA 3F8FA 3HTUA 2ZXQA 4XRSG 1W2AX 3OYIA 1R092 3BG9A 1FPN2 2RREA 1SZBA 4P02B 4IV1B 1KYZA 1TMF1 3VD4A 2DVAA 4XORA 1AR91 2VNGA 2RNGA 3MVPA 5IVBA 1UYPA 1SLTA 4A3MJ 2DQLA 1V6NA 1OFSA 3AKQA 2VVFA 2H1KA 4YGEA 2CU7A 4GRIA 3GFLA 3KP7A 1YJ9I 3NV4A 1N1TA 2WWYA 1MD0A 4ON0A 3Q0WA 3S7IA 4JTNA 2VBZA 3HD8B 3OV8A 2QDRA 3LA2A 1SAXA 4BE3A 5DCMB 5FD6A 1WW5A 1FLIA 3WVJA 4U7BA 4XZUG 3SDGA 1BJQA 5K5RA 2PELA 2QQJA 5LWBA 2HXOA 3ALQA 2A6HF 5F0HA 1QHGA 3V0AB 3NNLA 4P55A 1S0FA 2VZ1A 2BU9A 3CCQI 4YLZA 1SAUA 4AI8A 2HVSA 1G9FA 3N7MA 4BY1J 1YIJI 4JC1A 2DBIA 2K40A 1FV3A 3I2KA 4UFIA 1CZTA 5CZKA 2K4JA 2Q1ZB 1U78A 4LUMA 3ECQA 1HN1A 4CUBA 3RQ0A 1ULOA 3BN6A 4NAOA 3H9AA 4RAZA 4QKFA 3N97A 3H0OA 3NVCA 3LOBA 4CCCA 5C9AB 3S30A 3CLPA 4HPKB 2NM1A 1R082 3T2TA 4ZYEA 3LSHA 3THTA 2HDCA 1NXMA 1N77A 1JMUB 1IG0A 5KK1A 5M0TA 4JVAA 3CQZJ 4XEZA 4BK5A 3VUOA 2LMDA 3ONQA 4IHVA 4M3CF 4M3FA 1UHMA 1JHNA 2DT6A 2XBO1 1A6IA 3C2HA 2RDNA 1FOD1 2UYAA 3G4SI 1OPOA 2EBIA 2JDNA 1VQNI 1LOAA 3WDWA 3KV4A 3C18A 4ASMB 4G3YC 2PHUA 1LCLA 4GKXA 2CUZA 3OYAA 1BVVA 1AXKA 5A7OA 1VBE1 1EH7A 4OIPF 2ZHKA 4JKMA 1XCVA 3IRQA 2NAZA 5T3NA 1K5MA 4O3MA 1HRV1 4QB2A 4CCNA 1OPMA 3VD5A 3BOWA 3VHNA 3ZFGA 3F2ZA 1L7QA 5JOZA 1M06G 2JUGA 1W9FA 4Z07A 3LGRA 1CIYA 4Q4V2 3S3OA 4ZYDA 4Q0UA 4MUVA 3RZLA 3L2UA 4CZZA 1QH7A 3M3CA 2RS12 5A7SA 2ZCWA 1HRI2 3UKNA 1YEWA 1SFNA 3D4KA 3WW1A 3O5SA 1TNFA 3OGJA 4RS5B 1XBFA 3K9TA 4OMDA 2R7QA 1URXA 1PIV3 3WY6A 3OIQA 1W9SA 1PGL2 1B72B 2JT1A 1R5HA 1XX5A 5L3DA 2EAKA 1A8MA 3KV5A 4J25A 4A3DJ 4LB6B 3MZHA 1QIQA 2GXGA 2L3DA 2QYOA 3BALA 4ZDOA 4XN0A 4FTEA 2VONA 3D5RC 4UVBA 4OMYA 3KT4A 4W6YA 2ZGSA 1F2NA 4AEDA 4URAA 4XUOA 2QENA 3KEOA 4IEVA 2M0CA 1POGA 1MQTC 3S1NJ 5L19A 4HSTA 3G1MA 2HOTA 5LASA 1UHSA 3KHCA 1WQ2A 2BBYA 3GTPJ 4GB31 5FP8A 3FMRA 3SXWA 1QZZA 2DCYA 1MZFA 5F3CA 2NNYA 1I3AA 5C3PA 2JB4A 2VG9A 4XBFA 4CYCA 3ILNA 4ONUA 4AVAA 5IFTA 3OL3A 2ZABA 1WD4A 3BR3A 2A73B 3LMMA 5E17F 4NIDA 1SVOA 1XSVA 5FWEA 1LNWA 1NZCA 1GQPA 4RHV3 2XGXA 4UW6A 5GZEA 3IRRA 2VB6A 3CCEI 5C6CA 2BEOA 2RJKA 4EJTA 4NWWA 4AL9A 1G86A 2O9LA 1G4DA 3HQRA 1QVUA 5EEHA 2VE8A 3N9PA 1SLCA 4QGLA 2OTJI 4U36A 3RKYA 3S0MA 4XLHA 2ELHA 4KICA 1OT5A 2DUQA 5HODA 1UPSA 4I0WB 1S7EA 2KIUA 3KHBA 3VD9A 1AR61 3ASNH 4LO8A 5C4XJ 1XD7A 3H92A 5I91A 1E5IA 2ESNA 5IPAA 4BBRJ 4KH9A 4D7YA 4FTBA 3W2WA 1OD5A 1QJFA 4CHUA 5FZKA 1PVC3 4EM2A 1ZTRA 1LKNA 2IVIB 4FETA 4YGCA 2DCEA 4C3HJ 2XB6C 3I3BA 2ZSHB 3HNBM 2D3RA 2NMNA 2E34A 2IS6A 1WJFA 2GZWA 3NQHA 4JDOA 1VBC1 5K7ZA 4AQSA 3S57A 3CUQC 2RQPA 2Z1DA 1POV0 3DKXA 1AUYA 2HEYF 3NRVA 4S05A 2IUWA 3EBRA 2HQRA 3ASOH 1TNSA 3O1VA 1YI7A 1PGW2 4LJHA 5T5JA 4ORFA 4ZTJA 2DU1A 1XDUA 3ZYGA 4RB2C 3F8MA 3OY9A 2A3YA 3I2IA 2WO2A 1W7PD 4UW4A 1D5YA 3OOXA 5FMDA 1DGLA 1V6IA 1T56A 4GQ7A 2JVHA 1STZA 4HYEA 1AL0G 4L99A 4AI3A 3PVNA 4A7YA 4OMZA 1J5YA 3NV3A 5C71A 5J47A 1V6MA 1MACA 3I2FA 2A1XA 2RDQA 3I55I 5D5VB 4HDUA 1KU9A 4NIHA 1BA5A 4META 4CU7A 4L0PA 4CP2A 1MVEA 3MWMA 4AVVA 1RUH2 2M7AA 2P34A 4U2AA 5M5WJ 1BEV3 1NG0A 5L7OB 2XUEA 4ETSA 3OSGA 2O61A 1R1A1 1A35A 5A2QZ 2HWD3 4EWEA 4M3CB 3WG1A 3SH4A 1JT6A 1BI0A 1Z7UA 2V7FA 3WHBA 4N90A 3LOCA 3BCBA 5CLSA 3IWFA 2VMEA 1XNCA 4EQVA 4NHJA 3OYWB 2R4GA 1DQ6A 4J00A 2CDOA 3CZ6A 1KGYA 1DQ4A 1P7JA 4BBSJ 1O6UA 1U5TC 5D5WB 4YVWB 2DPUA 5HCAA 3K2AA 2L7FP 4D9JA 3UKVA 2BGPA 2WV1A 2G9FA 4D0QA 5KR7A 2NVTJ 1VQ8I 1OLTA 2FMYA 5AC91 2Y8KA 1DP0A 3RZKA 1G9DA 3RG0A 2ELKA 2VKEA 5JAXA 3SEZA 3K70D 2J1TA 1JZ2A 1W9YA 3K4ZA 4IE0A 3BR0A 3LAPA 2TNFA 4XDQA 3LAJA 4CDQA 1TW3A 2XUBA 1XC6A 1VAMA 4ZZ5A 3PTRB 3WP5A 3HEFA 5JXHA 1EV7A 2N7GA 2VZTA 2ZGOA 1LOEA 4MHGA 3LFKA 3N7KA 1CVNA 4K9SA 2BNNA 2F5EA 3AYEA 4D3WA 1VQ7I 5EIYB 1ZH5A 1KDKA 3LD8A 2RC4A 3PM1A 3S1MJ 3PVEA 4M3DA 2JG9A 2QA4I 1LOGA 1QPIA 1AA7A 5EWSA 2D2WA 3PIGA 1NA1A 4SBVA 3KCCA 4X6RB 2EWNA 4BJ0A 4QXBA 3T0YA 4QKBA 2JDUA 4M73A 4EN9B 1YS6A 1MZBA 2RMU2 1AR83 5K5OA 5FFXA 1AR72 4Y17A 3KLOA 4IVNA 4H3WA 4UW3A 4ZS2A 3LA3A 2R3SA 3ZYBA 2FHRA 3PL0A 5J1XA 5JDBA 3UV9A 1MDMA 2XH6A 3S3MA 2VAUA 3DKWA 1N1YA 4BMEA 1JKRC 3HSFA 3HG9A 2HDDA 3FX3A 2BW8A 5BS6A 2E7XA 5J8CA 1WJCA 5KHDA 3JD71 3WINE 4B1MA 4QGNA 1B9MA 3FUOA 1ODMA 4N43A 4XSXF 3E97A 4GO1A 5CVRA 5LY1A 1H9PA 3FL7A 3OYFA 4LHNA 2CJJA 4OUMA 2WB1A 4L2NA 4Q4Y1 5E8GA 4CDQB 2CQXA 5GZDA 1XN7A 4RQPC 5LATA 2W9XA 1YQ2A 2Q1FA 4FPJA 1VBB3 3M8JA 1GP6A 3QP5A 5FP4A 2DMTA 1MMAA 4URTA 5DM6F 2W1WA 1W90A 5GLWA 2FMDA 5LA9A 1OKOA 5K0UC 1WI3A 3JSOA 1W3VA 3FXUA 1GV9A 3TW7A 2HWE1 3R05A 1OI6A 2QQOA 3KP4A 3WXPA 2KZVA 4WM8C 5A7NA 3K46A 1K6OA 1WGXA 3MW2A 1QHHD 2EZLA 1NUKA 4F91B 2WWJA 4M4RA 3IAS2 1QJX2 1YNAA 1AU7A 2XJTA 3E6MA 3OGVA 4DOZA 4RYDA 1PX3A 4COVA 4CCDA 3PNYA 3WEZA 2ZZQA 3H50A 1VR3A 2R7DA 3WV6A 4OIQF 3TBIA 3ST7A 1JHFA 2P4EA 4RM2A 5C4WB 1PO21 4K1ZA 4BKXA 1YQAA 5D8AC 2W00A 1B35B 4BXSV 2XR4A 3MLLA 4H4KC 3BTXA 5LK5A 3KZYA 4HW0A 3BIEA 4UB8C 3F23A 4DXZA 1V9U2 2HYJA 1C8M2 4HNVA 4EWAA 4I09A 3C1DA 1LRHA 3ZN0A 2EINH 2DA1A 3HOXJ 1NCRB 1TZLA 4XTMA 4AVZA 3GJAA 4XICA 2LNBA 3GZTB 4AD9A 4HSLA 4R9CA 1QBJA 4RAFA 4EJVA 4OUEA 2WC2A 1JZ8A 1TQIA 3PNTA 5F1RA 5FK8A 3I4PA 3MKWB 1OUXA 3R60A 5GLUA 1ODDA 4XPVA 4RBOA 4G6DA 5JOWA 1LHWA 1QH6A 1LGCA 1UXZA 5DPNA 2EVXA 5IVFA 3RTRA 4HKLA 4ZU7A 3HOTA 4QQPA 3PVBB 4RGKA 1WMXA 1J84A 3LEIA 3SCHA 2OA2A 3BPVA 1USSA 2UUZA 5AFEA 3JREA 2BBVA 3VSLA 2I74A 4QB1A 1QXPA 2Y33A 1TNTA 2WNUC 5FJKA 4AUXA 5LD2C 4Y22B 1XXNA 4YPJA 1ETVA 5BMZA 3TP0A 3CCSI 2JDMA 1W9TA 3VBOA 5CKTA 1ZA7A 4XBLA 2EXJA 2IC1A 1RUC2 3KE2A 2M4GA 2KT0A 1LODA 3WX5A 2XAFA 3TWIA 1HOMA 3CU7A 1O4ZA 3V0BA 3E5UA 2XAQA 1GUUA 1DBNA 1JOJA 3RPUD 1F36A 1TWHJ 2A71A 5GADJ 3D8CA 1POQA 2W94A 2Y48A 2ZGLA 4YM0A 2OX0A 3K48A 2BVLA 4AEJA 1Z6RA 1I50J 3WT3A 4LK0F 1RHI3 3DPLC 1NQJA 4UOJA 4Y52J 2FQ4A 2YX7A 1Q1HA 2QQLA 2NVUB 4P9XA 5DTDA 3MFCA 2BGCA 2R6QA 5KHIA 2IXJA 2DA6A 3ZN5A 5D8LB 1EPWA 2COBA 1OOPA 5C7GA 2KMUA 5HI0A 3ELKA 2B5HA 4CTEA 3TBDA 5FO8B 3EPZA 1P2FA 4C0HA 2ADDA 3TOJA 5GLVA 2MD0A 4UV8A 4BZ4A 2PAMA 4X0GA 4XKBA 1EV12 1V3FA 4Q4X1 4IEUA 2EFWA 1S55A 2JG8A 3SEEA 1VQ5I 5IOYA 2E9QA 1ETXA 4HNUA 4P5YA 4QPGC 1XU2A 1MVQA 2WNVB 2Z42A 2VZVA 3J81Z 4CUAA 3G6JB 1YW8A 4A93J 2XPVA 2WDBA 1QJZA 2R043 5J40A 2YR2A 1OC1A 3GX4X 1DDLA 2R7SA 5KHGA 2W1QA 5H9PA 5ERLA 3T2PA 1T2KA 4UFKA 1UKGA 1IS5A 3RDIA 2PA7A 3GTLJ 1MBKA 1W6QB 2E31A 1XNKA 3MZ8A 2CYYA 4HRIA 5GTIC 3FN9A 1RUJ2 2Z16A 3KGLA 2R7TA 1QJY1 2OIIA 1HKTA 4LBOA 1MBJA 4BQ2A 1YRZA 3JCIA 1LDJA 1I6XA 3Q8EA 1HIXA 5FXZA 3RGBA 3CHXA 3ZSKA 1XNDA 2GC0A 3WDUA 1RVF1 1RUG1 3DPUA 3X2QH 1FWZA 3P9KA 3VODA 1GNHA 2X5IC 5IT3A 5A3TA 4E2QA 3WG9A 4JGYC 2KKOA 3CCYA 3R4KA 5GZFA 1MS0A 1ON2A 3VKFC 4Q26A 2JJ6A 2L4AA 5F2WA 3WU2C 4CDWC 3RSJA 4H2AA 1G3WA 2R061 3ZCOA 4LHLA 5BNOC 3C7GA 3V42A 1H8TC 4U87A 2UWMA 1ND3C 4AHWA 3P5BA 3U2RA 4XK4A 2D6MA 1W28A 3QP6A 4CU8A 1QU0A 3COAC 5JMCA 2RV9A 1WBLA 2CHHA 3DKYA 5AIQA 2A5YB 1T38A 4IHWA 1ZAOA 2GN3A 2XAUA 3NKGA 4CUCA 2BV6A 1X2MA 5CFCB 3DPRC 2XROA 3RPQA 5EJ3A 4GALA 5DMYA 2VBPA 2VU9A 3UNGC 1GOFA 1V0AA 3PUQA 3K3OA 4HSRA 3H3LA 4AI1A 4A0XA 1PO12 1GSLA 3IM0A 4K21A 3POBA 1D0XA 1RMU2 5IVCA 3CIHA 3V64A 3CJTB 1ASJ2 4IEYA 2E71A 4KN4X 2WSVA 4U88A 3JRHA 2D5FA 1M1EB 4CSWA 5FY1A 2VMGA 4HG2A 3FIWA 1WWXA 5B2GB 2P6SA 3ZDVA 4J1WA 1YWKA 2WFPA 3U1KA 3IKTA 5HS9A 1A34A 2OVUA 5C3SA 4D6QA 5FYYA 4MYEA 1NQDA 3ZXJA 3AMPA 1LOBA 3FKIJ 1LHNA 4MO3M 3N9OA 4I7HA 3WP6A 2A6EF 4ATFA 3PDQA 1JYTA 1X19A 5BNNA 4QKNA 4FPYA 3BU0A 2CV1A 2QKLB 2FZ1A 4CCLA 1SC7A 1L0OC 1A5JA 4LK1F 3N7JA 2XVKA 1AYM3 3FXKA 3B02A 4A7KA 4WM7A 1H1AA 2JJ7A 1E3OC 5FYHA 2FCVA 4UYBA 4X1EA 1B4AA 4IV1C 2VBYA 1H2NA 4GJYA 3LDBA 4L9BA 3SKVA 1KU2A 4CEWA 4KT6A 2CUFA 3WF2A 4OUSA 3OR1C 2DMPA 4BACA 4BU2A 2TCTA 3I9V2 4IZZA 3L2CA 1GXPA 3ZVXA 3GXOA 1XOYA 4IRIA 4LIUA 1Y1VJ 4HOBA 3C8XA 3F6OA 1RUD2 4W97A 4LJZF 1OVPA 1QZEA 3FXRA 1UY3A 1QNYA 3IAPA 3MLKA 1FPQA 3QPHA 3MKYB 4B3NA 5FPAA 3D6EA 3RYPA 3B9IA 2VPVA 4TYSA 1UMHA 2IXSA 5CFDC 1WWYA 3HNYM 3KQ4B 5DAPA 1REPC 2B0LA 2JE8A 3O1TA 4TLGA 3FK7A 2KDZA 3HR9A 3VDXA 4E7KA 1Y7BA 3L2QA 4RGXA 2R93J 4OU0A 3HN1A 5FPUA 2ETEA 3DUIA 4LHSA 5LGUA 1FP1D 3K69A 3AKTA 2PAKA