2CGPA

Catabolite gene activator protein/dna complex, adenosine-3',5'-cyclic-monophosphate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer.
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*TP*CP*AP*CP*AP*TP*TP*AP*AP*T)-3')
molecule tags Transcription/dna
total genus 66
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 1997-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgpA01
2FEZA 3E97A 3E6BA 1K78B 5I8SA 4LB5A 4UV9A 2FBHA 4O9GA 4XLNF 1P92A 2B5HA 4ZZDA 2ET7A 3NL1A 3I0TA 1D5VA 4LLOA 2MBFA 4EWDA 3F23A 1NZCA 2O03A 3PQKA 1ON1A 2W84A 4XEZA 4YARA 3NSTA 1YFWA 3LAGA 1MGTA 2VBYA 2HWVA 4IERA 4FAHA 2CYYA 1EPZA 3HOTA 4XFHA 3RKXA 1KQ0A 5D6EA 4A5MA 3MQ0A 4NVPA 2NAZA 4MQ9F 3IHUA 5D5WB 1CAXB 2O6GE 1F5TA 1O5UA 4L11A 2QVOA 5J3UA 5EEHA 4YG2F 2IC1A 1ODDA 4YIIA 2DAOA 4A5NA 2YX4A 4HF0A 4R79A 3WU0A 3WGHA 3T0YA 3QPHA 1DDNA 4AIHA 1U2WA 2Y75A 3FXUA 2DW4A 3HSEA 5D4RA 2FMLA 3J80K 4TLFA 3BJOA 1XDUA 4HVOA 5I91A 1B6AA 2FBIA 1J3QA 2LKPA 4OLLA 1OPCA 3HRSA 4I01A 2YU3A 3FZ3A 1R1TA 4GGGA 1PDNC 2Z33A 2GC3A 1C0WA 2Z69A 1T39A 2OA4A 3RTRA 1USSA 3P9KA 2H09A 5ILUA 3R6SA 4OOIA 4EJVA 3GYDA 2K02A 1B9MA 3QU6A 3N4MA 2VC1A 4MEYF 5JR3A 3H7JA 3O6BB 1YS7A 3WG9A 2RNJA 4RD7A 1S3JA 2QVSB 1UIKA 3NJZA 5K5RA 3F6VA 1S8NA 1IN8A 1YFXA 1STZA 1MJAA 2LF7A 2ZMEB 4ETSA 4HDUA 2EWNA 2D45A 5AIQA 4MTEA 1PM7A 3EYIA 4Z82A 1G6NA 5J7MA 3GX4X 1AOYA 2FNPA 1Z9CA 5E1RA 4PIYA 2OU2A 3HOSA 1FP1D 3BU7A 1O5LA 2D5FA 3K1MA 4N0BA 3GYHX 2XL9A 3KP6A 4FBFA 1F9NA 3MCZA 1KU2A 4DINB 5KHKA 3FX3A 3DF8A 4QM9A 4M9ZA 4R1HA 4XF9A 4YFXF 5DDGA 4IETA 3I59B 2P7CB 3HT1A 1Z05A 1CGPA 4LK1F 3PNAA 3ES4A 2R3SA 3KP7A 2LSOA 1J0RA 1Z6TA 3HIFA 1DUXC 4JVAA 4K8FA 5L3GA 2HZTA 2QDRA 4MHGA 5LHGA 2KIUA 4Y15A 4HLXA 1HSJA 3H8UA 1R23A 1J59A 3QP5A 2IA1A 2GA2A 5LEKA 3TO9A 1QZZA 3RYKA 1ZLKA 2JPCA 3TDZC 1R7JA 5AONA 1K78A 2ESHA 4HMZA 3HRUA 4EJUA 4UNOA 3LA7A 4D7SA 1WRJA 1R1UA 4ZYGA 2MPFA 2M30A 3EDPA 2IA2A 2QENA 2VQAA 1HW1A 4MV2A 4WCGA 3ETQA 5CYVA 3S2WA 2EFOA 3MDPA 5DUKA 1YFUA 4A6DA 2M8EA 4E2GA 4WX9A 3NW4A 4LG0B 3QRFF 2H0VA 1QNTA 3KEQA 1XSXA 5FFXA 4AIKA 3IKVA 2AS5F 2XAHA 1R5HA 1SD6A 1R1VA 4EWAA 2ZXJA 3BALA 1ZRDA 1PP8F 2FF4A 3KLNA 4J1XA 5E1ZB 2CO5A 3CDHA 5H6RA 4ENJA 2A3SA 1Q43A 1KU3A 2WFPA 1ZRRA 3TGNA 2A6EF 2Q4SA 3I53A 3M9AA 4KWKA 5FCCA 4HBLA 5IT3A 4BHCA 2D40A 5KVRA 4ONUA 2VE8A 4IEPA 5HS9A 1S29A 3NVCA 2VOOA 2QBYB 1R22A 5DD4A 4L9JA 1UD1A 4IVNA 1TQIA 4BQAA 2HJIA 2XV4S 3LSTA 5HDKA 1FPQA 2PAMA 2UY9A 5E8GA 5BPDA 4HF1A 4A0ZA 1J5YA 4L0ZB 2HGCA 3GZ5A 2V09A 4BXUA 4CDGA 1K7AA 2N7GA 3L09A 4HX7A 4A0YA 4IPAA 1H0MA 2BEOA 5CVRA 3PLQA 5E16A 1BM9A 5I93A 3N97A 3VODA 1GQGA 1KYWA 4PIZA 4HN1A 3UKNA 4MGRA 4HVQA 4KMUX 4HF2A 2QQAA 1IUYA 1QGPA 1B1BA 2CGPA 4UV8A 1QO0D 2GAUA 2H94A 1I6XA 4E2QA 1SMYF 3FWEA 4EM0B 4Q0VA 4MX3A 1SD5A 4Z07A 4AVPA 1V4RA 1ZZ9A 4L2NA 1YLFA 4MNUA 3P9CA 3I59A 2ZBKA 1YWKA 1BBYA 5HS7A 1IXRC 1SEFA 4M6YA 5JVTA 5L3EA 3F8FA 3ZMDA 3LFKA 2PAEA 3ZDSA 4O5VA 4EM2A 5HOOA 3COAC 3GLXA 1GXPA 4YYOA 4QXKA 1MDMB 2QNKA 3RZZA 1O3RA 3QPTA 2FXAA 3SCFA 3AAFA 3LA2A 2JTVA 2STTA 2JT1A 3ZMTA 3CUQB 2CAVA 2O8XA 4I2OA 1HKQA 2RVCA 4LK0F 4Q5SF 2DTRA 4F7ZA 1Q3EA 3ZMSA 4FAGA 2EFNA 2W85A 2L3DA 2IA0A 4ZU4A 2X4HA 4HLTA 5HLHA 3OOPA 2DK8A 2H6BA 3TDUC 2KIFA 2L54A 1Z6RA 5D6FA 1FBSA 1LEBA 3U9GA 3HUGA 4WWCA 3FZVA 3OF1A 5E18F 3F3XA 4QGMA 4OIRF 3SZPA 1LDJA 4LUMA 4FX4A 4A2UA 1QQIA 1E2XA 1MJBA 4Z2YA 3F6OA 5I0RA 4UXAA 4KFCA 3OGJA 5ICEA 3F8NA 2DU9A 3ULQB 3M70A 4G94A 4XETA 2ETHA 5BMZA 2Q0OA 4RGRA 2OZUA 2UXXA 1BI1A 4LUKA 1XRUA 4QX5A 1RI7A 2X0LA 3O14A 2IW5A 4LMYA 4JBAA 2A69F 4BIFA 3FHIB 3E5QA 3FXRA 4LB6B 1ZVFA 1UW8A 1H9TA 2F5FA 4HQMA 2QQBA 2QBYA 3FF5A 2UYAA 1QY4A 1KU9A 2Q2EA 3OV8A 4LGWA 4P96A 5BY5A 4IEYA 2RQPA 3D0JA 5FPZA 1YG2A 2BNMA 2EFPA 3V8JA 3JW4A 4YNIA 1OFNA 4I02A 4O6JA 3WTVC 3S7IA 5ICGA 5ICCA 2QUFA 3ZP5A 2KJBA 2E7WA 3L00A 4Q4ZF 1J3PA 3GBFA 4WXCA 1DZRA 4OU0A 1FXZA 3ERED 4B8XA 3KSCA 2EA4A 4KIBA 3WTTC 4AQ6A 1XMKA 1YHFA 1BI0A 3BPVA 2MNGA 1P4XA 1B9NA 2Y0OA 1TQPA 3TO7A 5E1WA 3IRRA 1BC7C 4AWXB 1BIBA 3GZ6A 3CL1A 4Q29A 2FQ3A 2GZWA 4P5OA 3FM5A 2ZJ2A 4E2SA 2K27A 2XRNA 5KHGA 1KYZA 2J5PA 2BYVE 2XKPA 2QWWA 4M71A 1S6LA 4QGLA 1YW8A 4OIPF 4AD9A 4ZYEA 4QM8A 3D82A 1FX7A 4JTOA 2NNYA 3SXWA 5IT9K 2LDUA 5F6FA 1RTVA 3HTUA 5HLIA 4ESFA 3BY6A 4HX4A 2VE9A 4MUVA 1ON2A 2ADUA 2LF8A 3WW4A 2GQQA 2XLFA 3LA3A 2ATFA 1J2XA 4AQ2A 4CICA 2FBKA 2MC3A 1BOAA 3F8MA 2K4JA 5FLXZ 1ZN2A 2HOEA 3QAHA 2QZ8A 2HTSA 1U6GA 5FLJA 2Q0AA 2XROA 1RZ4A 1KQ9A 4H7LA 4M6XA 1F4KA 1NE4A 4N9IA 2Z9OA 5C8WA 1U5TC 4MH0E 3MPBA 3RDIA 4BH9A 2MLGA 3GFLA 2IRFG 1ZZCA 1RUNA 3JTGA 2EAAA 4KT5C 2E7XA 1JUHA 3KZZA 2B0LA 3DL3A 3WGGA 2YR2A 1HSTA 4HOBA 1SFUA 5HS8A 2XHKA 1YQAA 1WLTA 1FYLA 3G73A 3V7CA 6PAXA 3I54A 2CAUA 5A2QZ 4X6QB 2LNBA 3DP7A 1OI6A 4IESA 4U88A 4WZCA 1DPRA 2PA7A 5AIPA 1YFHA 1HKSA 2EVXA 4LEJA 2L4AA 1OD5A 4HSLA 2MLKA 1RUOA 4NQWA 4IHTA 5I8YA 4KN7X 1LEAA 3RI4A 3KMHA 1IRGA 5K1YA 2PQQA 2UYBA 1QXRA 3ABTA 5L3DA 1U78A 1W7PA 3EYYA 2IP2A 3CTAA 1FLIA 4WF2A 3T8TA 2XAJA 5H6QA 4I0BA 1U8RA 1O7FA 3GEZA 2MD5A 4ZZLA 1PP7U 3F72A 4KU8A 3TNQA 1IXCA 4ESJA 4WXDA 2HS5A 2HKOA 2MH2A 3O2PE 5K5QA 2M1BA 4YRDA 3JSOA 2BBYA 4TV7A 2EFQA 2Y0MA 2W25A 3DXJF 3Q9VA 5FD5A 1FY7A 3J7AO 1T6SA 1ZRCA 3IDBB 4WVZA 5F64A 1EYBA 5J48A 3RPUA 3K2ZA 1P4WA 2DFIA 3K69A 1G4DA 5HDGA 1FYMA 2PLYA 1G3SA 5BPXA 3I64A 3L7WA 2YX7A 5CJ9A 4CYDA 5CVIA 1SD4A 3Q9SA 3GVAA 2NRAC 1TBXA 1D8JA 3C3WA 2F2EA 3L2HA 3WW3A 2ZNYA 2V1DA 3TO6A 5LGNA 5ILVA 1EY2A 1D8KA 3BOQA 2OBPA 4FX0A 1U5TA 4ASNA 1XSVA 5EEGA 4A0XA 1J9IA 3SZTA 5L3BA 2ELHA 3H7YA 4HW0A 4BHBA 3WE2A 4MGIE 5CU1A 1KA8A 3ABUA 4OIOF 1WQ2A 2BE5F 3DQVC 4KU7A 1S7OA 2ZFWA 4HV6A 2OPKA 4GO1A 3BWGA 3ZMZA 3BB6A 4E70A 3WTYC 4RB3C 4MGZE 3W6KB 2FE3A 5JI6A 2FU4A 1SD7A 1YS6A 4U7DA 2GA1A 4Q47A 1IPJA 2PFWA 1DGRA 2IJLA 1A04A 1Y3TA 3H92A 1BN5A 1YW7A 4IRGA 3GFIA 3E6DA 3V8LA 2P6SA 3UKVA 4YIFA 4U0VA 5DEQA 1Q5OA 1WI9A 4G6DA 1ONVA 1HBXG 2J5OA 1CAWA 5LBQA 1WWXA 2OQGA 1EP0A 3BPZA 1FYKA 1EH7A 4RGXA 3CLOA 4I98B 1QPMA 2C0ZA 5LRRA 2A6HF 5CVUA 4A12A 4R8HA 3CLPA 3UKTA 5E1XA 3GO5A 1IF1A 1SFNA 5CVJA 2VOPA 2CWEA 5J6XA 2O61A 1H1MA 4ESBA 1TNTA 4FT8A 4P55A 2IXCA 1KQ8A 3ACLA 3BJ6A 5KK1A 1Q1HA 2PTMA 3WE3A 3FMQA 2M45A 2XAGA 3KP2A 1WKMA 1CF7A 3SHRA 1FNNA 3DPLC 1ZG3A 2A68F 4PGHA 4LLGF 1J58A 4EVIA 1MD0A 1TNSA 3EQEA 4XF3A 4XFAA 1CAUA 2HDCA 4EV0A 4GYIA 5FPXA 1XGOA 1XSDA 2OZJA 1OYIA 3GFJA 3F8CA 1B59A 1X7NA 3ST7A 3K1NA 3WTWC 4KN4X 2A07F 4I7HA 5JSPA 4KICA 3SMHA 1NXMA 3RPQA 4BNCA 4EJOA 3EETA 1K6OA 1Y9QA 2W57A 4J1WA 1I1SA 2Z2SB 1X82A 3KGZA 3PQJA 1ZX5A 1OYYA 3M7GA 3EHKA 3IBMA 4BYYA 3R0JA 1BI3A 2D1HA 4LD5A 2PQ8A 3LZZA 2IXKA 3RKWA 5J8FA 5FFZA 5FLXK 3NRVA 4OMYA 1ZZ7A 2M5WA 2G7UA 2RGVA 2RV8A 1LB2A 4CO8A 2PHDA 2COMA 2ACJA 2VT3A 3GWZA 3H1MA 2QLZA 2IXHA 1O7LA 1G3TA 1TTYA 3NKTA 1X3UA 3DV8A 1LNWA 4EGZA 1XCVA 4X6RB 1VR3A 4RGUA 1HKTA 2PMHA 1O57A 3HYIA 1H1IA 4P9UA 4S05A 5FQ0A 4HX8A 2UXNA 3EBRA 1W5SA 2PYTA 3FFQA 4ON0A 5A2QK 3E6CC 4LTAA 2DO7A 1FZPB 3ZN1A 1FC3A 1DGWA 2DLLA 4RAZA 2PMUA 1TLHB 3LQQA 1EV7A 2P4WA 5FB2A 1IPKA 2WC2A 4G7HF 4L9NA 2Q1ZB 5FO5A 2DCTA 1LRHA 4WXHA 5D5VB 2F5CA 2DT5A 2FSWA 3H1YA 1UCRA 3HHHA 1YUDA 3VOEA 3K0LA 1W4MA 4KMFA 1ZYRF 1IAWA 4L5JA 3TQNA 2STWA 5C6CA 4M72A 5DCFA 4XBFA 2GH2A 1V70A 3EUHA 1ZREA 4KNYA 4IJAA 4XRFA 3H50A 3H3UA 2YSRA 3Q5FA 2OA2A 4LJZF 3L2CA 2K7LA 3G7DA 3FMRA 1OKRA 4U0WA 3H1WA 3IIAA 2QYOA 3S0MA 1CAVA 1JXSA 5ED4A 4LFUA 4KWLA 2NYXA 4L9VA 3LOIA 1XB4A 2FQPA 2OQRA 1BC8C 3RNSA 1W7PB 2TDXA 2PEXA 4MZUA 1TQ5A 3K1PA 4P9GA 5DUIA 1I27A 1FBQA 1XGSA 2WWYA 2V9VA 3MAJA 1ZH5A 2KIMA 2V79A 4L18B 3I4PA 3V8KA 1GVJA 3H3ZA 2G7HA 1LDKB 3WW2A 3WGIA 5BPIA 3ZPLA 4JV4A 5KHJA 4GCVA 3MEXA 3FJSA 4Q48A 1QBJA 2HYGD 3CO6C 4G6QA 1ZZBA 4Q0PA 1Z1DA 2RDPA 3GUDA 3M3IA 3QP6A 3LWCA 4EQQA 1KGSA 4A6EA 5BS6A 5DCMA 3CJNA 2O8QA 4META 3HT2A 5HDNA 1IN5A 5BV6A 1SAXA 3U2RA 4H0EA 3KP3A 3R4KA 1XCBA 1ZZ6A 3USSA 4I3PA 3JAMZ 4HDVA 5CADA 4XF4A 2HYFA 4IEZA 1WGPA 4G7OF 3FHZA 3OD0A 2QJVA 1GXQA 3IWZA 1U5TB 2XGXA 1RIOH 4KWJA 1LDDA 4UBGA 4XFCA 2H6CA 1YFYA 2A5YB 3RYPA 3HQXA 5E8IA 2NS0A 1LVAA 5LGUA 4MEXF 1XE7A 3KP4A 2VECA 1O3QA 4RB1A 3RJPA 1VTNC 3WU1B 3QACA 1HQCA 1L0OC 4RS8A 4MQVA 1D3YA 1ZG1A 2V1UA 1W7PD 2VPVA 3LWFA 3WODF 4G7ZF 4IRIA 5K8SA 5EZWA 5L3FA 4HN0A 2EA2A 2HFHA 3IL2A 4IHSA 3M1EA 1RL3A 4GULA 4ZYDA 1ZGAA 1X8EA 4EJWA 1FT9A 5JSRA 1CAWB 3ZQ7A 5HLGA 1ZARA 4CGZA 1OR7A 3KLOA 4EJTA 1UFMA 2Z3YA 1PMIA 4RB0A 2K0GA 1YIOA 4UVCA 1NE6A 3DPTA 4IXAA 3MFKA 2H27A 5H20A 4UXNA 5CLSA 1NHAA 2W24A 1RNLA 4MGYE 5DV5A 1RC6A 3DEUA 3B73A 3QOPA 2ET1A 2E9QA 1T38A 2CV6A 1VJ2A 2VBXA 5ERIA 5JAXA 2EB7A 2XAQA 1JHHA 3DKWA 3F8BA 2XASA 2MH9A 3KE2A 4ZYHA 1LJ9A 3CUOA 1KU7A 2PAKA 4K2EA 4BHPA 2IVMA 1IW7F 2HTJA 3GFMA 1CF7B 1XN7A 1Y0UA 2P5KA 2R7DA 3MWMA 4QMAA 1SFEA 4ORFA 3C18A 1W5TA 2RKHA 1FI2A 1DZTA 1CAUB 4XFGA 2F5EA 4ZU7A 3CO2A 1SMTA 3M8EA 4UBHA 5D8KB 2DK5A 1JE8A 4CXFA 2FA5A 1QXJA 2P8TA 3BDDA 5BOXA 3SQNA 2PJPA 3JZVA 1ZAOA 3T1BA 2B8MA 3DFGA 5I0TA 2XKOA 2BNOA 5BXXA 4EWEA 4BAYA 3IRQA 1WSUA 4D0PA 1T98A 3M8FA 1DPUA 4YSFA 4KYWA 1ZZ8A 3VFZA 3GF2A 2XLAA 2ZO4A 2VBWA 3F22A 2UZKA 2HQRA 3HSRA 5HVQC 5LHIA 3SXYA 2ZNZA 3G3ZA 1XD7A 3CJXA 2KRFA 2EA7A 1XE8A 1MKMA 1XGMA 2XUBA 5E17F 2DQLA 3R0AA 2FOKA 1AWCA 2KJCA 2DQRA 3KFWX 3L9FA 2K4BA 5L3CA 2EK5A 3WTXC 5D4SA 3OTFA 2P7VB 5FD6A 5D5UB 4AVAA 1TQMA 1R58A 3KZYA 1G3WA 3I7DA 2FRHA 4HAMA 2XVCA 3O3KA 4F8AA 3GW2A 3TOBA 5BUVA 5LGTA 1O4TA 5JR7B 3VB2A 4IF4A 3ML6A 5ILSA 5FQ0B 3LQRA 4IEOA 2L01A 4KA4A 3FMSA 2Z5UA 4JTNA 1FWZA 4DQ2A 2OYZA 5AVPA 1V3FA 3EQLF 2D2WA 1YTYA 2JZYA 3W6JB 3WTZA 5TRDA 1HW2A 2VODA 5K5OA 3J81Z 1EH6A 1QZYA 2BGCA 2XIGA 4ZH4F 1H9GA 2G9WA 3LAPA 3NQOA 1UPIA 4MTDA 2VXZA 1MZBA 1LKNA 4UVAA 1R00A 2QM3A 2KXLA 4R52A 1CX4A 3K9TA 4IEQA 2K9ZA 4S04A 4HZFA 4I09A 4HV5A 1L3LA 5T3NA 1REPC 1YW9A 3IKTA 1JHFA 3P9IA 4XFBA 3HRMA 4ENMA 1BJAA 1J75A 3V7SA 2XLGA 3I71A 5JCTA 1SFXA 1T0FA 2L02A 2HQNA 4EM1A 3RYRA 2ISYA 2QQ9A 2QCSB 2K86A 2GXBA 4IEVA 2RN7A 3HSFA 2VC0A 5IT9Z 3HHGA 2ISZA 2HKXA 2D5HA 3P7NA 5E20A 2VT2A 1CAXA 4M9XA 5I0UA 4QGNA 4OINF 2CG4A 1UHMA 1ULYA 2GC0A 1UCXA 1NYWA 2JPBA 1CAVB 2O1QA 4AXOA 2F4PA 4XSXF 1HW5A 4QWQA 2I45A 3WTUC 2IXJA 1E17A 4B29A 4DNCA 5JHUA 3IWFA 3T8RA 2PFBA 4OMZA 1IN7A 2DI3A 2Z99A 1I5ZA 4B09A 3BJAA 3ZMVA 4CZZA 5D8LB 2AXLA 3IDCB 4XSZF 2IXLA 3ISPA 4XFFA 4KUMA 3JAMK 4Q0QA 2Q30A 3BROA 4HLYA 4L5IA 4I0AA 4PDKA 4UUVA 1QWRA 4G9YA 4M73A 3FM3A 2V6CA 3I5UA 2EV6A 1F1ZA 4EROA 4M9SA 2V1XA 5KBFA 3ES1A 1PUEE 3HTSB 2VN2A 5I8TA 2XAFA 2ZKLA 2JRTA 4PZJA 2GC1A 2HR3A 1P6RA 4G8XA 3REOA 3D0SA 4Y13A 4ENKA 4HSJA 4NB5A 2IXIA 3ZN0A 3NEUA 2CW0F 3DN7A 4L0YB 3EO6A 1OMIA 4PGGA 5DCMB 4KIFA 3C7JA 3HRTA 4ENNA 3CEWA 2ZMEA 4CHUA 2WV0A 3BCWA 5FLIA 2EV5A 3E3VA 4MGKE 4Q0SA 1GQHA 5J8CA 2E1NA 2B9UA 3J80Z 5JSOA 2BV6A 5HI0A 4LULA 1ZGJA 1J7KA 4RAYA 4IEUA 3KP5A 4QLCU 1B4AA 1UIJA 4O9EA 5LLQA 2DPDA 3TOAA 3T5XA 1LQ1A 1LR5A 1IN4A 1YLLA 3VHRA 1IN6A 2O3FA 3FXQA 3SCHA 4PJYA 1GHCA 2DBBA 2OAZA 4RGSA 2ZKZA 1J1LA 4EGYA 2MHFA 2FMYA 3GXOA 4Y17A 2OD5A 1USTA 3ECOA 5FGMA 5DD8A 1U3EM 2CFXA 3JTHA 4O3MA 2FNAA 4U0YA 1ZRFA 2F5DA 1FSHA 3C3VA 1T2KA 3MZYA 2OZ6A 5DYMA 5FDBA 1I1GA 1XMAA 2UY8A 3U1DA 4OFGA 2EJRA 4AVCA 1DP7P 1TW2A 2M87A 5LHHA 3ECHA 4HA8A 2O0YA 2Y48A 1ZHFA 2EFWA 3ELNA 3V7RA 3D5LA 1L3JA 1S7AA 2IPQX 2XL7A 1RGSA 2HEOA 5BQTA 4XF1A 1XDSA 2GXGA 2JSCA 3BZ6A 2PBIA 1SQ4A 1O3TA 3BPXA 1Z7UA 4IEWA 3ELKA 4NHJA 1IZ1A 3E5UA 2P5LC 1R5GA 2VONA 4RB2C 4LA2A 1HXDA 4GYGA 4P9FA 2UWMA 1BI2A 2Q8KA 1BIAA 2GU9A 3V4GA 4L9TA 3MYXA 4LG0A 3OCPA 3CF6E 2PHLA 2C6YA 3KCCA 1P2FA 3ZMUA 3PFIA 4XLPF 1FOKA 2GC2A 3B02A 3S7EA 2MA3A 1OYWA 3CUQC 2PI0A 4JK1X 2PG4A 4GXOA 1ZG5A 1ZLJA 3JSPA 4AVBA 1UHWA 1TW3A 2P5VA 2CQKA 5FLHA 1U12A 5KHIA 2ETEA 1J3RA 2NNNA 1Z91A 3BP8A 3SHFA 5EFUA 2ZCWA 2EV0A 3WTSC 3R61A 3TKYA 1JGSA 2GWRA 2D1VA 2D93A 4PCQA 3U0ZA 4UVBA 4LA3A 2P6TA 3VEPA 1YO5C 1MJ9A 3FE5A 2RC4A 1EH8A 4XF0A 3RKYA 1R36A 3CO7C 1FP2A 3I58A 4XFIA 4HQEA 4Q0UA 4YFNF 3SFZA 5I0SA 4UHTA 5TJJA 2IT0A 5KHHA 4N9HA 3E6MA 1YYVA 5ICFA 3SCGA 4HVRA 2ESNA 1XGNA 3ROUA 2YPRA 3J81K 1VP6A 4HYEA 4LLNA 2L4MA 5F1RA 1X8MA 2KKOA 3F21A 1WA4A 4M74A 4PIXA 4OIQF 4FHTA 1O3SA 3WW1A 3QU3A 2VBZA 4EMSA 5JFRA 4WBBA 2E1CA 2GIVA 1FSEA 1G3YA 4ZU5A 1FBUA 2WTEA 3IC7A 3E5XA 1ZNPA 4D7TA 1IXSB 4KDPA 2CSOA 4YFKF 3MZHA 4KIGA 2R7FA 2PN6A 5D5XB 1IRFA 3KETA 2A61A 4IRHA 4AIJA 5LRSA 3H9AA 3R60A 4IEXA 1K79A 1P4AA 3LAJA 3KGLA 3TNPB 3U10A 3RIRA 5LEJA 3PVBB 3C1DA 1MDMA 3U11A 4HBNA 4JQFA 5CVVA 4WK8F 3EJKA 2DPUA 1UB9A 3CUQA 4KL1A 5D1IA 4U7BA 2BNNA 2P17A 4LLLA 3KEOA
chains in the Genus database with same CATH superfamily
2W1SA 2FEZA 1X9TA 1R49A 3E97A 3WCRA 1K78B 5I8SA 4QAWA 3KV4A 2FBHA 5FRNA 1NQJA 1NY72 3U37A 4JGZB 5A3LA 4ZZDA 3LOBA 3AG4H 4Z6YA 4DXTA 4EWDA 1ON1A 2W84A 2E26A 2ZJPF 3RZDJ 5L73A 4HRIA 5IOYA 4FPCA 3POFA 2HWVA 2J1RA 3POEA 4IERA 1W6MA 1VQOI 1RB8G 4XFHA 5D6EA 4NVPA 4ISRA 4A3IJ 1GZTA 3OYLA 3ONQA 1S2BA 1G9FA 2OCCH 3S2HJ 4W4ZA 3O1MA 4C91A 5EEHA 4YIIA 4LQRA 2VZOA 4GMP1 4CCJA 1S72I 1XU2A 2WWJA 3ZYFA 4AUXA 3FUQA 4LO4B 2Y75A 3FXUA 1ZA4A 4QT6A 4ASLA 2DW4A 3G71I 3BKZA 4XKWA 1VBD3 4YEJA 3KF5A 1XDUA 2XB0X 3S5AA 2CQQA 2L7MP 3HRSA 3MEPA 4N4NB 1U0JA 2BJSA 2W08A 5IVYA 1ORKA 3FZ3A 1R1TA 5EPAA 4XURA 2GC3A 5BNOA 4A3GJ 4XJUA 1USSA 4OAZA 3BG6A 1CQ9A 4FP2A 2H09A 3NJYA 4N43A 3R6SA 5I0DA 1X9PA 2BUKA 4BUPA 2VOVA 1ASJ1 3QU6A 1D4M2 5FYZA 3WG9A 2RNJA 2QVSB 4QPGA 2UWBA 3QYBA 2E60A 1REFA 5FP8A 1S8NA 3BTAA 3THCA 4UYBA 3MV11 2LF7A 4HDUA 2E51A 4M6VA 1W28A 4JGYA 1G6NA 5J7MA 1NCQB 5CB7A 4PIYA 4BE1A 1SC7A 1H8AC 1XBFA 3BU7A 1O5LA 4FOWA 4KITB 2D5FA 3JRAA 3SH3A 3LIGA 2XL9A 3KP6A 3D5SC 1DQ1A 1WMEA 1SBEA 4RHV3 4CU6A 3MCZA 4BQXA 3FX3A 4M9ZA 2P7CB 4D6RA 3HT1A 1CGPA 3NKGA 3KP7A 2DCKA 2WAQA 1Z6TA 4NIAA 3CC4I 2W95A 5L3GA 1L7LA 1QGLA 3VBRB 2LBFB 4CRQA 3A0HC 3QP5A 5LEKA 4NC8A 1C8NA 1F43A 2JMWA 4YG6A 2WL1A 1TZLA 5AONA 1IV6A 2DVGA 1K78A 1AA7A 3BODA 2P0WA 4IO9F 4UNOA 3SH5A 2EZHA 4D9JA 1K5MC 4H14A 2R7WA 4Q4X1 2V72A 2DYRH 4XUNA 2VQAA 4DYQA 1QOSA 4MV2A 1POGA 1UY4A 2G0EA 5DUKA 2QQPA 4AQTA 5A7WB 2M8EA 4ZONA 4AEMA 1X2MA 1TWHJ 1QNTA 4B44A 5T55A 4F91B 1HJGA 3CCSI 2VW2A 3MW4A 2ZXJA 3BALA 1PP8F 2FF4A 4J1XA 1FOD1 4YM0A 2K85A 2HQAA 3ZOIA 1EA3A 4OQ9A 1Q43A 4R9CA 2JRMA 1PO22 5LZ6A 5BNNC 1OQYA 3S30A 4QHOA 4KWKA 4AR2A 2ZJRF 3N3HA 5FCCA 4HBLA 1D1CA 1COV2 2ZA9A 5F3GA 1JOJA 2HEYF 2RDQA 4QU1A 2WO2A 5A3MA 3NVCA 1G9CA 2Z42A 1ERDA 4DZJA 3T1LA 1MBHA 3P3PA 2YU9J 3QWLA 3M3CA 5T52A 4XOTA 3KLSA 5A33A 1SFKA 1X1AA 2ADEA 2HJIA 2RG4A 1PVC3 3LSTA 4C3HJ 1QJY2 4O61A 2PAMA 4BDZA 1CJDA 3FLTA 3VL8A 5C8CA 5E8GA 1NQDA 3EUHC 3AYAA 1DQ2A 3C7HA 1MS8A 4PJMA 1JJ8C 1MS5A 5FKCA 1BR1A 4JHZA 2V09A 3E1F1 5FZMA 1BA5A 2KR2A 2VUJA 4Q4W1 3FK6A 4XLAA 2JDAA 4IPAA 1GNZA 1H0MA 1HXS2 2BEOA 5CFCA 3TBDA 3T2PA 3GM8A 5I93A 3MIEA 1FJLA 2L2OA 4HN1A 4LO6B 4V2VA 1AR92 4MGRA 4K3UA 2R073 3NAPB 2A05A 1B1BA 4UV8A 2AREA 4QX8A 2WT2A 3X29B 5DM6F 2GAUA 3UJOA 1I6XA 4B8EA 4E2QA 3GTPJ 4LNVA 3A4UA 1WPKA 4MX3A 5GKAC 1AYM2 1OF3A 4AVPA 1V4RA 3ACIA 3IB3A 1RUI3 1JOPA 4FPHA 5IVJA 4YGBA 2X6XA 1YWKA 4LHLA 4GRIA 4AGRA 2R92J 1W2AX 4YFZA 2PMZN 3ZMDA 5H9QA 3COAC 5HOOA 2CRGA 1GXPA 4YYOA 1M1EB 5C71A 1GWKA 5EJZB 2LBFA 2XJVA 1JZ8A 3N7LA 2K9LA 1MDMB 2FXAA 3L2UA 5FZ8A 1GLHA 3KM5A 1PIV3 1SEUA 3ZXEA 2P3JA 2JT1A 3AP7A 3CUQB 1RXGA 2O8XA 2ICWG 3IZOA 5GAEJ 3IV5A 3USUB 4Q5SF 1XE0A 1GSLA 1Q3EA 4N8MA 3ZIWA 2L3DA 4ZU4A 3OOPA 2VXRA 2H6BA 1W99A 4L0PA 2X5IA 3TDUC 1VMHA 2L54A 1GLNA 1C4RA 2DYSH 4DO0A 5D6FA 5EF6A 4PFPA 1UAAA 4WWCA 1W6QA 3FZVA 2JSPA 2TEPA 1QRYA 2BOJA 4NWWA 3SZPA 1LDJA 1JKRC 4LUMA 1QQIA 2JQ7A 1E2XA 2F4MB 4Z2YA 4RN5A 3F6OA 3OGJA 5L19A 3F8NA 4L92A 1ZBE1 4G94A 3J7ZI 3ZQQA 1YO8A 4B48A 4B4RA 1KS4A 2VVDA 2XH6A 2UXXA 2VTFA 1VBE3 4LBKA 3O14A 2IW5A 3AKPA 1FV2A 5FYVA 1D0GA 2CV0A 2XPUA 4AQSA 3FHIB 5CFDA 2XVLA 1H9TA 4XNFA 1MS1A 3ZFGC 3WINE 3VYSB 1ZTRA 3FXMA 3AL5A 1IJWC 3BZCA 3OV8A 2E53A 4P96A 3L2WA 4ZZ5A 3D0JA 1G9BA 4BLIA 5FP4A 2C9AA 2EFPA 3PVNA 3V8JA 2IGNA 3V42A 5FAXA 1OFNA 2WO3A 5F5IA 1H89C 3S7IA 4Q8LA 2R7XA 2E7WA 3L00A 1J3PA 3ZSKA 3GBFA 4WXCA 3V0AA 2EXIA 2ZHLA 2Y2ZA 5JXGA 4KIBA 4S2FA 4K9SA 1BI0A 5F0HA 4D0QA 1B9NA 1TQPA 3TO7A 1NLRA 5E1WA 1IC8A 2LW8A 2D6LX 1TNRA 2HWF2 4UF0B 3GZ6A 1UWWA 2GZWA 4XBQA 3FM5A 1UZZA 4FPJA 4Y52J 4E2SA 2OV7A 4CCLA 5KHGA 4D6SA 1HN1A 5TISC 3PUQA 2WWSA 3AMHA 2XKPA 2QWWA 3A02A 2B42B 4MFDA 4BB3A 1YJNI 4NHLA 4CDUA 4RM2A 3WDWA 3S5QA 4M3CA 5HCFA 2JB8A 4FPEA 1VQPI 1O4ZA 2ADUA 2LF8A 2Y26A 1E3HA 1C8M3 2GQQA 3GNEA 1KRIA 1AR63 4AQ2A 5JZGC 3F8MA 3LFMA 4FISA 3VKMA 3QAHA 1IGNA 4IGOA 3W6VA 1U6GA 4Q2FA 5FLJA 2ZC2A 2RQQA 2Q0AA 2XROA 3FHAA 2OVUA 1NE4A 3HAGA 2JA8J 1VBD2 4XLHA 3RQ0A 2L9NA 1NUKA 1U5TC 4BWOA 3MPBA 4W6YA 3O1VA 2GN7A 1ZZCA 1JYVA 2EAAA 1UMZA 2WZ8A 4ES9A 3WGGA 4AL9A 1SFUA 1POV3 3POJA 2JG9B 1WLTA 2ZEZA 4RGKA 3V7CA 2CQXA 5A2QZ 4X6QB 1JW6A 1PMHX 1OI6A 4PF5A 4XJWA 3VYRB 1NH3A 1HKSA 2EVXA 4BQ3A 4LEJA 3WQBA 2MLKA 1RUOA 4NQWA 1VI0A 3VDDB 3L2RA 5LATA 2PQQA 1CJPA 3RQ4A 5L3DA 5LFAA 2IP2A 3CTAA 4Y24A 5GLUA 1FOXA 2XAJA 2LOOA 5C33A 5C5TA 4BXSV 3UETA 2KDZA 1O7FA 3GEZA 1J09A 2UUZA 4RHV2 4QPOA 1VBA3 1UHSA 2AO9A 3DCFA 1IXCA 1I6HJ 4RM3A 1BVVA 1W2OA 3M1HA 4CCMA 3CCJI 2Y0IA 1RKTA 4CDQA 4YZ2A 4YRDA 3JSOA 2Y0MA 4Q4Y3 2YC2A 2W25A 2MC4A 2W91A 3ZQHA 3Q9VA 4IQ4A 4P9YA 3OYFA 1FY7A 2SLIA 4KI5M 2LG4A 4JCKA 5EV7A 1OJLA 4AWDA 1H88C 1EYBA 1FMD2 3OBTA 2A6XA 4UFHA 1XQNA 3CMYA 5K4LA 3JBG3 3PJQA 4Y4RA 4RL7A 1H8TB 5JLWA 5CJ9A 2CGOA 4WM7A 2VM9A 1WZ2A 4UFIA 1N3OA 2F2EA 3DBLB 3AFGA 2V1DA 5LGNA 2AEYA 4XDQA 4R4ZA 2A5ZA 2XVKA 4P9XA 3JU9A 5FPBA 1R5ID 3H7YA 3W2VA 3Q9OA 3ATGA 2EF6A 4IHVA 3DECA 1TWCJ 5FY9A 3ILRA 2FQ4A 3SLIA 3LIHA 3CCQI 3DQVC 3HWJA 1VALA 2ZFWA 1BCXA 1B72B 2GP3A 4QQHA 4MGQA 4ABZA 2PLV1 1BR4A 2KRCA 4NHMA 4FPLA 1AXKA 2QSGX 5JI6A 5SV8A 4A3CJ 4U7DA 3VBOC 3JB4C 2IJLA 1HRV3 1A04A 3PIOF 5DAPA 3GFIA 3KCXA 2ZHMA 3UKVA 3OBZA 1IO2A 3KS7A 2ZHKA 1M4WA 3HC7A 3POSA 4G6DA 1FYKA 3Q8CA 4UUSB 3ZYIB 1EH7A 2DMUA 3CLOA 3K75B 3LSEA 5JPNB 2GALA 2X8KA 5IK4A 2C0ZA 2XONA 1PVC2 5APAA 4Z8BA 1LOBA 3FL7A 4GKYA 3I3DA 2E71A 5E1XA 1H2LA 1IF1A 4FFFA 4W6WA 1T2XA 2ZXIA 2ZAHA 5L9BA 2CWEA 5J6XA 2O61A 2EZLA 2LY2A 4ESBA 3B93A 3QYEA 1FATA 3HL2A 5T5LA 4P55A 5KK1A 5FMOS 2X48A 1MEC1 2E1MB 2PTMA 1DFQA 3FMQA 3JUUA 1A35A 2M45A 1NG6A 5CNAA 2L9LA 2Q8DA 4CA0A 1ZKGA 2R072 4XXPA 2A68F 4PGHA 1JT0A 3H9QA 4LLGF 2ARCA 4EVIA 1QKQA 2EBIA 2JA2A 4XF3A 4H4KC 1CAUA 2HDCA 2CMPA 3LSDA 4GYIA 5FPXA 5EJ1B 3D5OA 3F8CA 1X7NA 3DYOA 3ST7A 4ZC3A 1RUI2 1SVMA 3G6JB 2R7UA 5LA0A 2A07F 3RRDA 2WAEA 1B09A 1WJEA 3H8XA 4EJOA 2ZSIB 3EETA 1K6OA 5M0TA 2W57A 2Z2SB 2Y0SA 2XXZA 1X82A 3BTLA 5HCHA 1ZX5A 3M7GA 2UURA 1MZFA 4BYYA 1QVUA 1FEXA 2VTXJ 1Y43B 1W3XA 3WP6A 1PIV2 4PHZA 4A3LJ 3BR2A 5J8FA 1DGRN 5FFZA 2WNUB 1AL0G 1FX5A 5FLXK 1Y1VJ 2BBAA 5A6QA 2M5WA 2ZZQA 2RV8A 3AYDA 3ZYGA 2PHDA 3SEZA 2QLZA 4X6AJ 1X3UA 3ZSEA 2A7AA 2JJ6A 4FOQA 3I3EA 1OCZH 1HOMA 4XJZA 4EGZA 3ITQA 1VR3A 2KZVA 2IS2A 5JI7A 1UELB 4QQLA 1X36A 2B45X 2WZEA 1R1A1 2VZRA 5FQ0A 5KXBA 4YZ1A 5EDNA 4AI2A 1W5SA 2HOSA 4ON0A 1A3KA 3PM1A 2W1OA 3CIHA 4A6OA 3EMRA 1SFYA 1F4HA 1KS5A 3CCMI 2NXNB 4XLEA 2K46A 1GANA 3LF7A 1AYM1 1VBE2 1WJAA 4XAEA 3DTIA 2PMUA 2ZGSA 3BOPA 1YRZA 1DLCA 2M3AA 1IPKA 2WC2A 1Y9MA 4L9NA 2Q1ZB 1G7YA 4YW3A 3U14A 4XLFA 1LRHA 4DYCA 3NAUA 1KFUL 2F5CA 1ULOA 2YC0A 2FSWA 3H1YA 2QQIA 1UCRA 3HHHA 1YUDA 3K0LA 4IGQA 1W36D 4IE6A 4XN0A 4BJTA 4PLMA 2WAAA 1PO12 1YI9A 4YVSC 3TQNA 4BS9A 3GZUC 3DYMA 2STWA 1VQLI 2AH2A 1A6CA 2O0OA 1D5YA 1ULEA 1ZREA 4FCAA 3GHNA 3O12A 3H3UA 1QDOA 1V6JA 2YSRA 3Q5FA 4LJZF 4YM1A 4FE4A 1XSQA 1OKRA 1T56A 3HNMA 1XNCA 2PHWA 5FUNA 4L8QA 5J1RA 5B4NA 3BC8A 1CAVA 3OGSA 4OHWA 4KWLA 3T30A 3T0BA 2OQRA 3ZX7A 1OH3A 2H8RA 4OAYA 2OQ6A 3K4AA 4MZUA 3AMQA 1JUMA 4P9GA 1EV13 1XGSA 4C1WA 3M3OA 1W5CC 1ZH5A 2FDHA 4ITVA 5GLVA 2WB1A 2BOIA 3V8KA 2VZUA 2G7HA 2JJ7A 5K0UA 2FD8A 2WT1A 2VW0A 3ZPLA 1DGRM 5LK5A 5KHJA 1KDMA 2R0FA 4LMFA 4Q48A 1PX4A 2Z79A 2VXJA 3OPWA 1FTZA 4QHBA 4G6QA 2WN2A 4GIQA 1C8M2 1E5IA 3UR3C 3GUDA 4XLCA 1SDWA 1AR62 3VBUC 1KGSA 3A22A 4ZPIA 4HPKB 2FOWA 2JICA 5FUPA 3CJNA 2O8QA 3KV5A 3HT2A 1NCRB 3GCMA 5IFPA 3U2RA 5IY5H 5K7HA 2M2EA 2CUFA 3JAMZ 5D21A 1JUSA 4XF4A 5CADA 3HKZN 1AR73 1WGPA 3TOJA 1HC8A 3OD0A 3FHZA 2LM3A 2W00A 1GXQA 1R71A 1RIOH 2I07B 4KWJA 4BQ5A 4XFCA 3ZSLA 2A5YB 3RYPA 1ND2B 2ZGOA 1Q8PA 1XE7A 2VKEA 2VJIA 2XQXA 4I76A 4K1YA 4F3QA 2WS93 3QACA 5IWFA 1Z3YA 1L0OC 4FPFA 4JKMA 1X1BA 1AKHB 3OIPA 4WV8A 3LWFA 2JUCA 2LP0A 5EZWA 1YYNA 1QJEA 4HN0A 1VAVA 4IHSA 3LSPA 3M1EA 4JRAA 4ZYDA 2LRPA 1O6UA 2FCTA 1HV0A 1B35B 3AXEA 1FT9A 4IQJA 1DP3A 4P9JA 3ZQ7A 5HLGA 4CCDA 3KLOA 1I3HA 4X0GA 4EJTA 1UFMA 1NT0A 3B7MA 2XMLA 4RB0A 3PVOA 2K0GA 4UVCA 3DPTA 1VBA2 3H0GJ 3MFKA 1Q56A 4CEYA 4Y20B 2ZB9A 5H20A 3ZFFA 1NHAA 3VDXA 1HX6A 4IHYA 2DN0A 1P9QC 3B73A 4ASKA 3KV6A 4YW2A 4Q4Y2 2ET1A 4IOAF 2E9QA 1VJ2A 4OI0A 1S1AA 5EYRA 3X2QH 3F8BA 3I2HA 2MH9A 2YYOA 3ZMNA 2VI6A 3KE2A 4ZYHA 3NWSA 3TRSB 1MBGA 3CUOA 5IVVA 4CP0A 4K2EA 2ID4A 5D2AA 1W2UA 1IW7F 1CF7B 4NMIA 4PBPA 1XN7A 1Y0UA 4BK4A 1BL0A 2P5KA 3JBG2 3MWMA 4QMAA 1SFEA 3ASNH 1W5TA 5AFEA 1QQP3 5KC5A 2VQHA 2BXYA 1SVOA 3CO2A 5B1AH 3TEWA 3FXKA 5J37A 1JE8A 5JDBA 1HJFA 3W58A 3ZM8A 5A1FA 3SQNA 3JZVA 2WA0A 2VULA 1ULFA 3VSLA 4LO8A 3I3LA 2BNOA 4EWEA 4IQPA 2YUEA 4ET7A 3CF2A 4YSFA 4KYWA 1YJLA 2R042 3LE0A 5L36A 1RUC3 2XLAA 2ZO4A 3CLQA 3NNGA 3HSRA 1LHVA 2A6ZA 4Y33A 3M8JA 3CJXA 5FMOL 1X1DA 1XE8A 1MKMA 2XUBA 3ZYHA 1HRV2 5JXIA 2ADDA 3T0AA 1FPN3 2X6OA 5L3CA 1BBT3 5LA9A 3WTXC 5CIRA 5D4SA 3KYDB 3WHCA 4WM8B 1ZBA1 2RJ2A 3KZYA 2BFUS 2XVCA 1RINA 1YJWI 1O4TA 2FZ2A 3VD7A 1FMD1 3OEAA 5H9SA 2WRAA 5EYYA 5FMCA 4AI9A 4ZKTB 1UXXX 4BACA 4OHYA 3AYCA 3VLBB 2Z5UA 2Y6FA 2J7MA 4LO5B 3TN92 1WJ5A 4MFEA 1V3FA 4CU7A 1G8XA 2V9PA 4KG8A 3EQLF 2CW8A 1ULGA 1RVF3 3N9LA 2BGCA 2JB4A 2BPA2 1RUD3 3LAPA 1UPIA 3PL0A 3K48A 1RUE3 1R00A 5CPRB 3ZKYA 1AZDA 3K9TA 4A6SA 1V6IA 4I09A 5T3NA 5FZ0A 4XFBA 2LYCA 2WNVC 4F92B 2D43A 3HRMA 1Q1VA 1BJAA 1J75A 1JKOC 4RGAA 2WBMA 1JI8A 2B7EA 4IV3A 4L97A 1UY3A 1K61A 3LPFA 5ABJB 1R083 5JCTA 2DA3A 1SFXA 2HQNA 1RHI1 2QQ9A 2A71A 2V4AA 2QCSB 4IEVA 2RN7A 5F6KA 1X3WB 3HHGA 1GP4A 2RV9A 2R7RA 2GNBA 3OYHA 1SMVA 1N78A 1ULYA 2GC0A 2O1QA 4YM3A 2CH0A 5A1AA 2F4PA 1HW5A 1OCPA 1ACIA 3WTUC 1PZ8A 5CQGA 4B29A 3DF0A 4C90A 5CAZA 3IWFA 5F3IA 1DYOA 2VMGA 3A23A 5FJHA 5F6LB 2EPFA 3H9GA 2Z99A 5DUWA 4XQFA 2AXLA 3IDCB 4XSZF 4S2DA 1NOVA 2A70A 4Q0QA 4XUQA 3W3CA 4RAGA 2VMIA 1DLLA 3OEBA 4UUVA 4PDKA 1RYYA 2WINB 4M73A 2NOJB 4H55A 1NA1B 2LKXA 2W4SA 4AGVA 2XPWA 1W8UA 1VQ8I 4HG2A 4EROA 4XBLA 1EUUA 2V1XA 4XXAA 4BE0A 3ES1A 4NJ4A 5IYBJ 2FX0A 5I8TA 1UN1A 2DTZA 4PZJA 3W2WA 4MG2A 1JZ7A 2ZKNA 1X33A 3S14J 3D0SA 5EJCA 2BTVC 3CMAI 4NB5A 2IXIA 3WVJA 3DPRC 3ZN0A 2CW0F 3DN7A 5DCMB 4PGGA 2FCVA 4II2A 4KIFA 3C7JA 1W0OA 3CEWA 2ZMEA 3BCWA 5FLIA 2DFEA 2EV5A 4NWVA 3E3VA 3ILNA 3K46A 2G19A 1AHSA 1FOWA 4RAYA 1D1BA 4BXFA 4V2WA 1KDKA 4QLCU 3PL8A 2CL2A 3PSIA 4BQWA 4CDWB 1LOCA 3CJIA 1Z3XA 2DPDA 4A3EJ 3VBHC 3SC7X 1MS3A 3ALQA 4DOUA 4EN6B 1IN6A 2CUJA 2O3FA 1LEDA 2HVSA 4PJYA 2WWUA 1W90A 3WT3A 2DBBA 4QD2A 5DUVA 2FDGA 3GXOA 4AFBA 4Y17A 3ECOA 5FGMA 5LBCA 1U3EM 2CFXA 3JTHA 5C9AB 3H1CA 5CISA 1ZRFA 1RUJ3 1W8NA 1WUVA 4XE9A 3WG7H 3WNKA 4LKFA 1XMAA 4U36A 3A01A 5D8AA 2YPDA 4AVCA 3MN2A 3WNOA 2V5DA 4HA8A 2O0YA 2Y48A 4N4OB 1HA8A 2RAEA 1H2KA 1CZSA 1LHUA 5C4JJ 4LK7A 1W8WA 1NLSA 4OMCA 1ETXA 2OPTA 2HEOA 2JSCA 1O3TA 1AXZA 3BPXA 3ELKA 1EKEA 4Q1RA 3I2IA 3E5UA 1WCDJ 1SVLA 4RB2C 4GYGA 4P9FA 5FZBA 2UWMA 1N1YA 2JDMA 1BI2A 2VOTA 3MYXA 4GH4C 3OCPA 2C6YA 3KZIC 3FXJA 1S0BA 1WJBA 4YRVA 1FOKA 1MQTA 2GC2A 1AVBA 2MA3A 3PO2J 2PG4A 4GXOA 4XIDA 3U78A 1PO11 1UHWA 1JU3A 2CQKA 1VBC1 3QH6A 1OT5A 1RJ7A 4JQTA 2TRTA 1J3RA 1MBEA 2ZCWA 4GALA 1VPHA 1JGSA 2DA1A 4QQPA 3MD2A 2CDPA 1NA1A 3Q3SA 3U0ZA 3TAYA 1MMAA 4XJAA 1UZCA 5A80A 2W92A 3ABZA 3S57A 2KZGA 3JRFA 3N36A 3HG9A 1DGLA 4HNVA 1FP2A 2EIMH 4AU7A 2ERFA 5TJJA 2WS92 1TP4A 5KWRA 3BR5A 2PJRB 3SCGA 1P7JA 2ZAAA 2K9SA 4CDXA 4D94A 2MEV3 4HYEA 2L4MA 4U87A 4NPMA 3ZXFA 2H0BA 5F8PA 4M74A 4PIXA 2P3IA 3IM0A 1O3SA 1OFSA 3WW1A 1U0AA 4FTEA 5FKNA 4WBBA 3JRDA 1MZ6A 1FBUA 2X6YA 4D7TA 5BNOC 2QBXA 2XPJA 4XQ4A 2D6PA 3MMYB 5F7UA 4N43C 1Y8QB 3S3OA 2J22A 2E1OA 2JE8A 1W0TA 1VQNI 4AI0A 1RMU3 3PVEA 2Y6LA 3RIRA 3PVBB 3C1DA 2QSHX 3MIGA 4YZ3A 2ZGNA 1EAH3 2R061 3BI3A 1KD7A 1HRI1 4XRMA 3BG3A 1H4GA 1JJ6C 5D1IA 2WAOA 4U7BA 1XNDA 2P17A 3S1MJ 1NCRC 5KHDA 4LLLA 2WA4A 2W46A 3C7GA 1UZWA 1T8IA 2ELKA 3E6BA 2DJIA 4LB5A 1CZTA 4O9GA 1NKGA 1P92A 2YUSA 2B5HA 1QQP2 1UU4A 3NV3A 4LLOA 3K77A 2ID6A 5FP3A 1YFWA 1MBJA 1W9SA 2BFUL 1ND2C 2FDFA 2VBYA 4M3EA 4FAHA 5E8AA 2HZDA 1A31A 1X50A 3KVBA 4MQ9F 5D5WB 2O6GE 4FI9A 4L11A 5J3UA 2DFCA 1RUC2 2J1VA 2DAOA 4A5NA 2YX4A 5IUQA 4ARYA 3WU0A 3T09A 3WGHA 1RESA 2W5FA 3AP4A 5JVVA 1F36A 1W6PA 4AIHA 1U2WA 5JLVA 1CPMA 3P3NA 3HSEA 4ASMB 1YC61 1BBT2 4N53B 5IVBA 2J1SA 2IEKA 2XDVA 2RDSA 2FBIA 3OYWA 1V6KA 4GMP3 4OLLA 1W6OB 4H3WA 2VU9A 1OOPB 5AVAA 3CCUI 3I4MJ 4PQQA 3N35A 3M8LA 2DXIA 2YU3A 2DVAA 2TBVA 2BP6A 2CV2A 2VMFA 2Z69A 2OA4A 2XOMA 1GZCA 1PUFB 3HPHA 2WO1A 1ZGWA 3A7QA 3ZQLA 3H5NA 3M3EA 1QPIA 2KMUA 4OOIA 1S7EA 1GOGA 3AP9A 2K02A 1B9MA 3THTA 5JR3A 1YS7A 3K4CA 4JP0A 1UIKA 3N9OA 3NJZA 3DBRB 1PK6B 1BMV2 1IN8A 1STZA 1ENHA 1HIXA 4ANJA 5FXWA 2D45A 5AIQA 1RUD2 3EYIA 4Z82A 5FZEA 3GX4X 2J1UA 5E1RA 1RUE2 1Y8RB 3WNMA 1ASJ3 1FP1D 3RJ2X 2DA4A 5IVFA 4YW6A 1X58A 4FPYA 2JG8A 5GZEA 2DDUA 3K1MA 5JWPA 2R041 3CDZB 5C8CC 3CMGA 1MIJA 4LKEA 3HR9A 3WOGA 4XF9A 4YFXF 4CPBA 4IETA 3I59B 1R082 4JDOA 2LY9A 1VIWB 4GKXA 3OB8A 2R3SA 2WAFA 2LSOA 1LOFA 3HIFA 4K8FA 3PU3A 4LPLA 5CFCC 1S5LC 2HZTA 2QDRA 3R0RA 2NVYJ 4XKVA 4Y15A 1AF9A 4HLXA 1MH4A 2DFFA 5FO8B 3TO9A 3INAA 3RJRA 4Q8KA 2P34A 1C1LA 1Y1WJ 2JPCA 3PMEA 4LBNA 3TDZC 1R7JA 3HRUA 4EJUA 1A78A 4OUEA 1FIPA 3LA7A 4ZDOA 4XMAA 3OBRA 3HZJA 2IA2A 2NVQJ 1D0ZA 4HSTA 2DV9A 3TN91 3K7AJ 5LY2A 1ULPA 2TNFA 1WMDA 2ECBA 2PMZA 4FCYA 4E2GA 3NW4A 4LG0B 3QRFF 2H0VA 3KEQA 5FYIA 1TE1B 5CBLA 4Q4X3 5FFXA 4AVZA 3IKVA 2XAHA 1R5HA 2YG0A 5TGTA 4Y22A 2XHNA 4EWAA 4YFWA 3RZJA 3CNAA 4QWNA 5E1ZB 2VR4A 3VBSB 4PDWB 3GBGA 5H6RA 4GWNA 4HK9A 4LORA 4XW3A 4AYBN 3F2ZA 4K6BA 3TGNA 2A6EF 2Q4SA 3I53A 3M9AA 2X5IC 4YVWA 1S2EA 3MKWB 4BKXA 5L7OB 2VE8A 1S55A 5HS9A 3ZYRA 1FOD3 3MGUA 4IVNA 1F8VA 4Y26A 1FPQA 4E8CA 5ABJC 1JZ4A 5FRMA 2R5YA 2RNGA 4A0ZA 4BXUA 2VBPA 4CDGA 3AJZA 3D8CA 4W50A 5FPLA 3L09A 5GP9A 3PUAA 1KONA 4D7NA 1IUFA 3VKLA 1RUJ2 3I97A 1PK6A 3AJYA 1H6XA 3PMSA 3PLQA 5E16A 5CFDC 4AEDA 3ZKUA 1KYWA 3T08A 1KXGA 1FIAA 2TCTA 1A36A 4HF2A 1IUYA 2QQ8A 2CGPA 4IHXA 4Q4W3 4EM0B 3ZYBA 4Q0VA 1SD5A 3I55I 3HQRA 3OMYA 2W48A 1ZZ9A 4CEWB 4MNUA 1QOTA 3I59A 1Z0HA 2ZBKA 5FFOC 3KIOA 4JQRA 5HS7A 1KJLA 1SEFA 1RUF2 1JHJA 5JVTA 2VZ3A 5DZGA 4PLOA 3WU2C 3LFKA 2PAEA 2FDJA 4O5VA 2ZTNA 1ULDA 3QBQA 3DU6A 3OGGA 3PIJA 4LE3A 3TBIA 2DUQA 2QNKA 3J26N 1O3RA 3QPTA 3BQZA 2ME0A 4FQ4A 2YY1A 2K9QA 3V64A 2NQYA 4XBNA 1JTYA 1UYZA 4PK4A 1HKQA 5KXCA 3SKJE 3BZKA 3GJBA 2CS3A 4PJJA 2W85A 3THPA 2LFBA 4HLTA 4ZS2A 2DK8A 1BJQA 2OJED 4FFHA 2R5ZB 2KIFA 4A3ZA 2ORZA 4NR1A 2CWSA 3MIBA 4CH7A 4R9BA 3WP4A 1FBSA 2Y9YA 2ZSHB 1LEBA 3U9GA 3MLJA 4CDUC 1JYTA 3GHMA 4NROA 3HUGA 3F3XA 1WJDA 2MD0A 4CP9A 2Y6GA 3VYUB 4FX4A 3B01A 1MJBA 2QGUA 1QHDA 4XMYA 4UXAA 5BNPB 4B1LA 4K8RB 4UFLA 4AGGA 5BMZA 5A3UA 2OZUA 1BI1A 5F32A 4LUKA 3TP3A 4QX5A 2R6QA 4LMYA 3THDA 2KL4A 3CU7A 4E7ZA 2MEV2 3OY8B 3MZ8A 2HEVF 4D7YA 5J3LA 4HQMA 2QQBA 4M3GA 5J36A 1ZBE3 3JRCA 4FP3A 5JIUA 2LK2A 3I2GA 1QY4A 1QH7A 3W21A 1F9KA 1OCRH 5E79C 2AEZA 4DXSA 4XCAA 2RQPA 3ZQCA 2FD5A 2JDKA 4ZS3A 1YG2A 3GTKJ 2YXSA 4AVVA 4DNYA 4YNIA 1H2MA 4I02A 2LKSA 5LW9A 4O6JA 3WTVC 1VQ9I 2CQNA 2IAIA 2KJBA 5FKBA 1RMU2 4M3DA 1DU3D 4BBSJ 1DZRA 1DQ0A 2F5VA 4OU0A 4ES8A 3N7KA 4BY7J 1LHWA 1EAH2 2MNGA 4G6TB 2F6CA 5LA1A 3BTJA 1F5FA 1BIBA 2X51A 3CL1A 3OYEA 3G1MA 2AC1A 5FPUA 2FQ3A 2NVTJ 1GFF2 2JIGA 3ZFEB 2K27A 3JCUC 3ZXJA 4RDUA 3FXLA 2XRNA 3WF2A 4MGTA 1KYZA 1S9HA 2J5PA 1S6LA 4M4RA 4OIPF 2P37A 1SCSA 3J9SA 4QM8A 4GQ7A 1FX7A 4ZZ8A 3KQRA 4CDQC 3LEIA 4BQ2A 2EZKA 1B8IB 4BJ5C 5FK7A 5F6FA 4YW1A 2WYFA 1R6RA 3VD3A 3C2BA 1WJFA 1W2TA 4WVMA 4EQVA 2QQJA 2C5DA 5A7OA 2ATFA 2FBKA 2DUPA 2Y31A 2WV1A 5FLXZ 2UU8A 3LSMA 1HCRA 4WM7C 3W5MA 1RPWA 4A3FJ 3IPVA 1KITA 4N9IA 5ANQA 1E3OC 4BH9A 4EYUA 2OT7A 2IRFG 1RUNA 1TT0A 3JTGA 4KT5C 1IZ3A 3S8PA 3DL3A 1U5XA 2GNDA 1HSTA 1MMDA 3DPUA 4YM2A 3H35A 1YQAA 2VL8A 2CAUA 5FY5A 1QJX1 3M07A 2LNBA 3DP7A 3U07A 3N7JA 4U88A 2YS9A 3KT1A 5AIPA 2GXAA 4D69A 4CU9A 4L9BA 4IHTA 4Q4V2 1CQTA 2JE7A 4KN7X 2R32A 3FBIB 3OUHA 3RI4A 3KMHA 3ON7A 1U78A 2GSYA 4IOCF 4I99C 2IGKA 5JHFA 1IG7A 1UMHA 1CWPA 1IRXA 2M34A 3N7MA 1X2NA 2MD5A 1PP7U 3AFHA 3F72A 5B1BH 4CZSA 2AZ5A 4ESJA 2A75A 1W3VA 3Q8BA 2HS5A 3O2PE 1SPPB 2M1BA 4TV7A 4UB6C 3VV1A 3HBLA 3PFYA 4RQPA 3L9JT 1PZ9A 2FDKA 4UAPA 1V55H 4M0NA 1ZRCA 3K4NA 3FBYA 5IYYA 3IDBB 3V0BB 5F64A 3RPUA 2J1AA 3K2ZA 3MF6A 1GYKA 1G4DA 1DHKB 1ONAA 1FYMA 5GJ6A 2PLYA 1GR3A 2YX7A 1CR7A 4YW4A 1WW4A 3UT0A 1QNYA 4DEQA 3GVAA 1TBXA 3L2HA 2ZNYA 1K5MB 3TO6A 3CJTB 4KMQA 5JPMB 2O5RA 4FX0A 1H8VA 1XSVA 4A0XA 5C5UA 1C1FA 2ELHA 4CVUA 4BHBA 2D3PA 4MGIE 4OIOF 4H7MA 2ZEYA 2BW3A 4IDZA 3VBFB 4Q4X2 5T5JA 4XHBA 2LMDA 1D0HA 1LGNA 4HV6A 2OPKA 3BB6A 2KQRA 4RB3C 4MGZE 2FE3A 3ORJA 1O8PA 2WLQA 1SD7A 1YS6A 3MFCA 1W9FA 1F4AA 3OG2A 1DGRA 2ZGRA 3K3OA 1YW7A 3WF0A 1VQ7I 3V8LA 1E5RA 2P6SA 1YQ5A 5F0FA 4DFSA 3OWTA 2EIBA 4MXWB 3AP5A 5BNNB 5DEQA 1Q5OA 1QU3A 2PLV3 1ONVA 4HT1T 2J5OA 1CAWA 1ODNA 3ZN6B 3LKJA 3ZVXA 1FOD2 4GDFA 2WO7A 3WY6A 4RGXA 1RXFA 1POQA 3BTYA 3IMNA 1DQUA 3OIQA 4DZGA 2V1NA 3MW2A 2IUWA 4R8HA 3CLPA 5BYNA 2E31A 2W7NA 3A1YA 2H8WA 2ZX0A 4NPLA 3DCQA 2IXCA 5EG0A 1KQ8A 3SDGA 3ACLA 3BJ6A 3VHOA 4NC7A 1YCIA 1N47A 3WE3A 1PZ7A 5FIXA 4MYEA 4INDA 4RBOA 3BOWA 3SH4A 3NJVA 4EN0A 1ZG3A 3GLLA 3OUJA 5FZ6A 3E1SA 1J58A 1Q8OA 3H42B 3EQEA 2Q2EB 4Q4W2 1AR81 1N1TA 1XGOA 1MEC3 3GFJA 3S3MA 1B59A 5DN2A 3K1NA 2VUAA 4QKDA 1UKGA 3WQ0A 2CY6A 3DWLE 4G12A 4KN4X 2XF5A 1J1TA 3PUFA 4I7HA 1PNFA 3FKIJ 3ETPA 3RPQA 3AZYA 4IGPA 2ORXA 3Q0VA 1HB3A 5A7PA 4EATA 3S15J 2F6BA 3IBMA 3OD4A 3V0BA 3R0JA 2ME6A 3OPZA 5J4VA 4LD5A 3MICA 2BY1A 1H4HA 1GT0C 1G9DA 3RGBA 1QJZA 2YFUA 1LB2A 2COMA 1PGW1 5L7OC 3H1MA 2IXHA 3N9QA 2QQWA 1O7LA 3AMNA 4NUBA 1LNWA 5K0UC 2DOEA 2I10A 4FETA 5FRAA 3NNJA 2IWGB 2BVVA 2GH8A 1H1IA 4RA0A 5J40A 2L5QA 2PYTA 3FFQA 4RGGA 4Y1XA 2VQGA 2LALA 1VBB2 5AC91 2DO7A 1FZPB 3ZN1A 3L2YA 3PUHA 1FC3A 1TMF1 2R7OA 2YU1A 5IOZA 4LE4A 4BISA 2RMU1 2OTLI 2VNOA 1R1A3 4NBQA 5IHRA 4MHRA 2P4WA 4MXWA 4QXHA 4KWUA 3RSJA 5DMYA 3BT9A 1LU2A 2AQFA 3HKZA 1RUF1 3ZFGB 2COBA 4BK5A 2Y64A 1ZBE2 4WXHA 1JXNA 3OYDA 2DT5A 1ETKA 1W03A 2HBTA 4D5CA 1W4MA 2XVGA 1AYM3 4CEWC 3OGRA 4L5JA 2J1TA 5E3OA 5C6CA 4M72A 5DCFA 1W0PA 4FXGB 1QEXA 3N9MA 3EUHA 3NV2A 1VQ6I 2DTYA 4IJAA 4XTMA 4EEFG 3G7DA 3H5AA 2PHRA 1SHWB 3VZLA 2RS51 3M4OJ 4B4CA 1A34A 3H1WA 3IIAA 3S0MA 3SEPA 1IG0A 4XZUG 1DCSA 1LGBA 3UK9A 5ED4A 1NTCA 4LFUA 4L9VA 4CXXA 3LOIA 2IFRA 2DUOA 3DXTA 1W7PB 2TDXA 2PEXA 5DG1A 3E0JB 4MGSA 1TQ5A 4P08A 3K1PA 1GNHA 5DUIA 5C7GA 4QPIA 4COYA 5B2GB 2WWYA 1V6MA 4C0BA 4JX6A 1GVJA 4CEYC 4AHXA 3FMGA 1YITI 3ZFFC 5BPIA 2OS2A 2VOXA 2ZEXA 3MEXA 5BNPC 2HYGD 2W68A 1YJ9I 2ZPXA 5B3SH 2JD4A 2D6NA 2VTXA 4OWRB 3M3IA 3H8OA 5F5AA 4A6EA 4QDRA 3EUKL 4D7MA 1OUXA 5DDJ1 5JZGB 1LCLA 4META 1QVTA 5HDNA 4E7IA 1IN5A 5BV6A 4H0EA 3KP3A 1ZZ6A 2XJUA 3OGVA 4NHXA 4I3PA 3DEWA 1IOAA 4IEZA 2L0KA 4GJYA 2BVBA 2QJVA 1R9TJ 2JENA 4FTSA 3IUOA 3IWZA 3I8TA 1U5TB 1LDDA 1PGL1 2H6CA 1YFYA 4XYXA 4ATFA 3VGIA 2NS0A 5LGUA 4MEXF 2RM21 1VFCA 3KP4A 2VECA 3VN4A 2EH3A 1F2NA 5E3LA 4YW7A 3WHUA 2B4KA 3RJPA 2V5YA 3WU1B 2UWAA 1UQXA 4IX7A 1IHMA 1HQCA 1PX3A 1WLDA 4RS8A 4MQVA 2XF7A 3S17J 3AVSA 5JMCA 1ND3A 5A3WA 2DT7B 4RS5A 3AKZA 4NRPA 3BCAA 3ZXLA 3HOUJ 1F5JA 3ZXSA 3QPLA 4GULA 4G4FA 2XWBB 5GZGA 3ZFGA 2VJXA 3IAPA 3KB5A 2JVGA 1CESA 4OI4A 2XJPA 3KV9A 3ZFEC 5JSRA 4FOYA 2EZIA 3VSKA 1ZARA 2DCZA 3RZMA 3HQUA 1OR7A 4DB5A 1LECA 2OQ7A 1D0YA 2Z3YA 2GOXB 1ZA7A 3R05A 1YIJI 5KAFC 1OA3A 4UXNA 4MGYE 1RC6A 3DEUA 2F4LA 2YBPA 3VZMA 1T38A 2VBXA 5ERIA 5JAXA 1U5ZA 3OL3A 2EB7A 2QKLB 3CZUA 2EIJH 1TT5B 3DKWA 4HOOA 4QQOA 1LJ9A 1WH5A 4QDSA 4E6KG 2KA3A 2IVMA 2E7QA 2WBKA 9ANTA 2LREA 3C18A 3ZN5A 3WNLA 1FI2A 1DZTA 3GTGJ 4LBJA 3EUAA 4XFGA 1GP6A 4IV3C 2WA3A 5CKQA 3M8EA 4D6QA 2HOTA 1SANA 1YQ2A 3K6GA 4UW4A 3WCSA 1QJFA 2EAKA 3SEEA 3CP2A 2VZ1A 3T1BA 1V9U1 5I0TA 4Q4V1 5FREA 4LBQA 4BPZA 5KNLA 3B9CA 3IRQA 3C2HA 3PNTA 2W82A 4MO3M 1I9RA 5M5XJ 3F9KA 5LY1A 3HN3A 4IL7A 3VFZA 3GF2A 2HQRA 2ZABA 3SXYA 2ZNZA 1IS6A 1LE8B 2EA7A 4QKBA 2DQLA 3K4DA 3VBOB 3EXUA 2FOKA 1LTEA 1W9YA 1ENQA 5FZOA 2KJCA 1H2NA 3WQ1A 3LSGA 1K6YA 3L9FA 2WZPP 2R4GA 3GXUA 5GLZA 2EK5A 2ZJCA 5C4WB 3OTFA 2PLV2 2P7VB 3M3QA 2AHQA 2OW4A 4AVAA 2ZEWA 5A3OA 1TQMA 1R58A 1BK1A 3CESA 2BV4A 3I49A 2FRHA 4OHVA 1JH5A 2ZGTA 2W1UA 5BUVA 5LGTA 1HDPA 5IATA 4IF4A 3TEXA 3HM5A 3I2JA 2EINH 2DA5A 3LQRA 1SAUA 2L01A 3A0BC 3LFUA 2VOKA 3FMSA 4V19K 2HWB2 5T5PA 4JTNA 2HVQA 1ZBA3 2OYZA 5F04A 4C2UA 1BKZA 4QXBA 4BBRJ 3O0VA 4CXYA 2ZMEC 2D98A 1HW2A 5C70A 1EH6A 1QZYA 2XIGA 4GXLA 3KT7A 1FMD3 1MH3A 4RAFA 2VXZA 1MZBA 1LKNA 2I5UA 2QM3A 4JYKA 2KXLA 3CJIC 1DQ5A 1W8OA 2BOLA 5LASA 1L3LA 4SLIA 3IKTA 1AX2A 3P9IA 3ENRA 4JGZA 3AC0A 4ENMA 2IS6A 1LHOA 5T54A 1R091 1MEC2 2XLGA 2Y69H 1XS9A 4EM1A 1T6BX 4K7JA 1UOGA 1MSFC 2D97A 2K86A 4NC6A 2GXBA 3VBFC 3T0DA 5IT9Z 2K2SA 5A6XA 1MNDA 2HKXA 1H9PA 4Y5TA 5D8AC 4OINF 5C3PA 3MHZA 1UCXA 2VQLA 5FMDA 4OULA 4C2MJ 2I45A 3PO3J 3AG2H 4DNCA 3T8RA 1RHI3 5FMBA 2PFBA 2DI3A 2Z1DA 1I5ZA 4XN3A 3BJAA 3G4SI 4CZZA 4AW7A 5D8LB 4D1QA 2DF7A 3TWIA 1RUH1 1POV0 2HWC1 2D6OX 5M3MJ 5EEAA 3D3AA 4W65A 5A32B 5ERLA 3FM3A 3I5UA 3RCOA 4HNUA 1F1ZA 2P2KA 5K7PA 4RLFA 5L9VA 2VN2A 2ZKLA 5F1JA 2HR3A 1MQTC 2KD7A 4CCNA 1MZ5A 1R64A 4GJZA 4OMDA 4RR3B 3REOA 2E2IJ 4ENKA 4HSJA 5HODA 3CC2I 2RE9A 5FZHA 3NEUA 4L0YB 4XC9A 1OMIA 2MFZA 2EIKH 4ENNA 1XYOA 2PXJA 4CHUA 3E7LA 4MGKE 1R1A2 4Q0SA 2QE3A 2B9UA 1NCQA 4LULA 5HBAA 5HI0A 1J7KA 1W1WE 2E36A 2RREA 4IEUA 2LY1A 2B7YA 1B4AA 2QEXI 1TZOA 5LLQA 3TOAA 4C3IJ 1LQ1A 5FZFA 3H0DA 1LU1A 3CQOA 1FV3A 1IN4A 1OQ1A 2VZPA 2YMZA 4YVSB 1FNYA 1TNFA 2VLAA 3SCHA 3FDYA 4QIWN 1GHCA 2KHMA 3UJQA 2OAZA 1UMQA 2ZKZA 4BQQA 2MHFA 1TWGJ 3AYEA 1U8BA 2OD5A 1USTA 5DAXA 4E4ZA 4BQYA 3EB7A 2BRTA 2ZXWH 3HOVJ 4U0YA 3VD4A 1FSHA 3C3VA 4GD4A 4AI1A 3VPRA 1OLRA 4M3CE 4CDXC 3MZYA 3VBRA 1REDA 1I1GA 2YU2A 2R16A 2Y60A 4OFGA 1GOHA 2X29A 1DP7P 3KCYA 5LBEA 4ZJZA 1ZHFA 1IDYA 1OCCH 3V7RA 1L3JA 1Z7LA 5CKMA 3PUIA 3CD6I 2A6YA 3BZ6A 4PFOA 3ACGA 2HDDA 4IEWA 2JA5J 4NHJA 2P5LC 2EQRA 1VBB1 4LA2A 4BCUA 5F2WA 5A7WA 2Q8KA 4NIDA 2GU9A 3HEIA 1N1SA 3FHNA 1P2FA 1V5GA 3ZMUA 4NE9A 4XLPF 3OY9A 1RIRA 1IRZA 3S7EA 4IV1B 2WIIB 2PI0A 1SDDB 1WI3A 1ZLJA 2K9MA 1M06G 2QQLA 4AVBA 1Z7S2 5CG9A 3VBUB 1TW3A 1W8TA 2IVIB 3N9NA 4XJ8A 5KHIA 3IIIA 3NO8A 2ETEA 1WBFA 3SHFA 1FMWA 2O7OA 3R61A 1ALYA 5A32A 5ANNA 4A3BJ 2VMCA 4D3WA 3MUY1 3FE5A 4QKNA 1PO13 5FZGA 1VBC3 1U5YA 3CO7C 1SLTA 3MW3A 4E4DX 2JN6A 3I58A 2IFWA 4E7JA 4J01A 2ZX4A 5B66C 4UHTA 4ZXEA 3AXDA 3LDBA 1BJZA 5KHHA 5DG2A 3AKRA 3E6MA 4HVRA 2WABA 3K4KA 3ZN4A 4E27A 3PJRA 3M7AA 2ESNA 1KGYA 3ROUA 3FBMA 2DODA 3J81K 3B9IA 4JX0A 4A45A 3NAPA 2L9RA 5DUUA 4DRVA 4E7HA 1XSRA 3KYCB 2LVSA 4X1EA 1G3YA 2WTEA 1TME1 4PUSA 4KDPA 4PJ0C 2ZGKA 3OYIA 2JA7J 2OUMA 1UYYA 3MZHA 2OC6A 1WMXA 2R7FA 2PN6A 5D5XB 3KETA 2A61A 4I3GA 2VOWA 5GPCA 5LRSA 3H9AA 1E3PA 2XGDA 2XRLA 4GAZA 5BNQA 3BIEA 3MFAA 1K79A 1WKYA 1YNAA 3LAJA 5LEJA 4DZPA 1EF4A 2VVEA 1MDMA 3U11A 1Y56A 3T1MA 2HEWF 3C7FA 5FXVA 1T33A 1MS4A 1JUPA 4LIVA 3CUQA 4V2FA 5GAGJ 2NPIA 4KL1A 2R7QA 3ZXGA 1VB4A 5FOJB 3USUA 3KEOA 4A3KJ 5IP7J 3S16J 1D2QA 2JG8C 4UV9A 2A1XA 1PJRA 2NVXJ 4XLNF 5FZLA 1OH4A 2DDBA 2R063 3NL1A 3I0TA 1YHQI 1D5VA 3F23A 1HRI3 2O03A 1NZCA 5FYTA 3PQKA 3KYLA 4YARA 4XEZA 3NSTA 3SEQA 4HEA2 4BU2A 3LAGA 3OUIA 2QUOA 1UZ0A 1LOFC 3HOTA 1KQ0A 4FFGA 2BHYA 2NAZA 3JQXA 5J1UA 4CCEA 2DA2A 1CAXB 3J7NA 4OCTA 4DOZA 3D6EA 4TN7A 1F5TA 1O5UA 1S0IA 5F3CA 4AEKA 4HKWA 1YI2I 2IC1A 1ODDA 5LWBA 3CMEI 4PI0A 4HF0A 4KBBA 1YJKA 3CKHA 2LC2A 3AL0C 2EALA 4ITCA 1IKQA 1JZ3A 1W39A 4EE2A 5EGOB 5D4RA 2FMLA 2FMDA 4LBMA 5J98B 5F0CA 4TLFA 3VYTB 3ZXDA 3WNXA 2QDNA 3JB8A 4HVOA 2W94A 2LS6A 5FPAA 1J3QA 2VNVA 1EPWA 2LKPA 1OPCA 3JR9A 4DUXA 3S2DJ 4QX2A 4I01A 3DUIA 2H1LA 5E3MA 5A6YA 1SBFA 3QODA 2BXZA 5HCAA 4MXVA 5IP9J 1PDNC 2Z33A 1YIPA 3KD4A 2V6EA 3OS1A 4XIKA 3P9KA 3BVCA 1X4OA 3Q0UA 2WFF1 1IV8A 2MSYA 2I2SA 5FZ4A 3GYDA 2VC1A 1ZBA2 3H7JA 2YROA 5IVEA 1S3JA 4IW3A 2VKDA 3T4HB 5K5RA 1YFXA 4AYBA 1MJAA 3PNYA 4RFT0 4KGQA 2VPLA 2EWNA 1PM7A 4URTA 3TEYA 3WG3A 1V6NA 1E57A 4UF0A 3BIWE 2FNPA 1Z9CA 3J8F2 2P81A 1GU3A 3HOSA 1O4XA 2A3YA 1BW5A 2VMEA 2HI3A 3POIA 4N0BA 2XB5A 3GYHX 4FBFA 2WNVB 2YFZA 5FP7A 4F55A 2VCAA 4QM9A 2WZR1 4R1HA 5DDGA 1O8SA 4A3XA 3GF6A 1WCQA 1JMUB 4K40A 3DXUA 1UZYA 3ES4A 2AYHA 1J0RA 4BGDA 3SKVA 3G1LA 1WZXA 1DUXC 4JVAA 2DT6A 2LTPA 3ASIA 2NOGA 4ZTJA 2R043 4MHGA 1DP0A 4UFJA 1LGCA 2JDZA 4AEDC 1HDKA 1HSJA 1XNTA 5DTDA 1SLLA 2IA1A 2GA2A 2AGSA 4CP1A 4Z2WA 2P5BA 2C26A 4Q5OA 1RHI2 4XK4A 4S2GA 4II3A 2OPWA 2XF6A 1Y7BA 3I3BA 3PTYA 4D7SA 1WRJA 1MACA 1R1UA 4ZYGA 4BY1J 2M30A 2FBEA 2MPFA 4OHZA 5C4WC 4Z92B 2HWB1 2QENA 1HW1A 1IG3A 4WCGA 3ETQA 3ZO0B 3S2WA 3MDPA 5J96B 3S1QJ 3F0CA 4A6DA 4J00A 3TEDA 5FY7A 4TYSA 1Y0NA 4JKKA 2W9XA 4AK3A 3NJXA 2ZMKA 4FPGA 1XSXA 2JG9A 4BA6A 4AIKA 2V26A 4S0HB 5KXEA 2BDRA 5HPOA 4EN8B 1ZRDA 3TN93 4GA9A 3KLNA 3A2KA 3ILFA 2CO5A 3CDHA 5F39A 1LEMA 3BYWA 3PUSA 4X8PA 2RDRA 2A3SA 2XSJC 2Y8KA 1KU3A 3DPRB 3POBA 2WFPA 2EXKA 5GADJ 1WA6X 1ZRRA 3VDDA 3I2OA 2V7FA 1ZRIA 2NM1A 1YRNB 4E9KA 3S6PA 4Y5SA 2X6WA 1VQ5I 2A3WA 1GVDA 5IT3A 2XPVA 4ONUA 2R1BA 3WD5A 4IEPA 5JMOA 3POYA 1GUIA 3SITA 1S29A 2VOOA 4LG3A 4XL9A 3BLYA 1R22A 5DD4A 4L9JA 4Y7NJ 1UD1A 3ZPYA 2DA6A 5HDKA 2LTNA 2UY9A 5CZKA 3VBHB 1XTAA 3DEMA 2CFOA 3CCLI 5BPDA 5J09A 5LK7B 3GZ5A 2DTWA 3BG9A 3VDBA 2NP0A 2N7GA 1TL8A 1LNSA 5IJRA 4A0YA 2XBO1 2J42A 1BM9A 3UKNA 2F4OB 3I4NJ 1O4YA 4KMUX 2XGEA 3VD5A 1H8TA 1O91A 1W05A 4JKLA 5T50A 3CDIA 2GDFA 5DS9A 4Z07A 4L2NA 1YLFA 3P9CA 5DPNA 2VQCA 1BBYA 3BN6A 1IXRC 1HB2A 2PX9A 1OA4A 5FXXA 3GZNB 1NG7A 4FVVA 2HWD1 4Y1UA 3GLXA 4GH4B 5FV3A 1GNYA 3LQCA 2B63J 4QXKA 1B72A 2QQKA 4RR3C 3LMMA 1KZHA 3RZZA 4FE7A 3SCFA 3AAFA 1QNWA 2JTVA 4CTEA 4A44A 3ZMTA 1LFPA 2RVCA 1JHNA 5JLXA 3ZMSA 4NAOA 2X4HA 1L7RA 2YPJA 5FZKA 1MVEA 2E2HJ 3AZZA 1Z6RA 3PU8A 2LR8A 3OYGA 1QH6A 4UUSA 2R30A 2OUJA 3ACFA 3OF1A 3DKXA 1VBC2 1H1AA 1W6MB 1HF0A 5DM7F 4A2UA 2B39A 4B43A 4KFCA 4IHWA 5ICEA 2DU9A 3ULQB 1JN2P 2C6SA 3M70A 5F27A 2HNHA 1BLZA 2Q0OA 4RGRA 2P6HA 3BQYA 4C2TA 2X0LA 2G1MA 2XR4A 3AKQA 2WSVA 3WXPA 3FHQA 1YX5A 4HL0A 3GTJJ 4LB6B 1UW8A 2GLOA 2F5FA 1HLVA 4NAMA 3VZNA 3MBWA 2GMPA 2CNAA 2Q8OA 2BW8A 1W0NA 1SLIA 3KWVA 3ZIXA 1C28A 2ZX1A 5FPZA 2OTJI 3N9PA 3CJRB 3RSNA 2BNMA 5BNOB 3CQZJ 1VRH1 1JODA 3JW4A 2P3YA 5FZ1A 1Z7S1 4N43B 5IW0A 5ICCA 2QUFA 1NK3P 3PNVA 1VMFA 1GUUA 2N8GA 3SJMA 3B69A 1FXZA 3KSCA 4IV1C 3WTTC 3KVAA 4AQ6A 3BPVA 3WNPA 5GALA 2L7FP 2Y0OA 3LSRA 2BWAA 4JGYB 1NK2P 2PHTA 2WNUA 1MMNA 1OUSA 3U75A 1Q8VA 1SLBA 1G2HA 1AYN2 3BTIA 3GGLA 2BY2A 4P5OA 1YXWA 1K45A 4AOCA 3PUBA 1AJOA 3ZMOA 2V73A 1VQKI 3J4UH 3NWKA 2JVHA 4KG0A 2BYVE 1XXNA 2R0HA 4QGLA 4COZA 2R062 5M5WJ 1HRI2 4UT5A 4ZYEA 3U4XA 2XJQA 3LSJA 4CYCB 5HLIA 5FYHA 3K2AA 3ZXAC 5HLTA 4UFKA 4IKFA 2VE9A 1ON2A 4QPQA 1GDTA 1QHHD 4UW3A 2I8DA 1TWAJ 2Q8CA 1OCTC 2Z5WA 3HJEA 5K9YA 3LA3A 5DABA 4QX1A 5E88A 4YZ5A 1J2XA 1DYPA 2XJTA 3TW6A 3CCRI 1VRBA 2GOMA 2FUG2 2MC3A 1ZN2A 2HOEA 4YELA 3ZOBA 3IDAA 4B1RA 1RZ4A 2VQUA 4H7LA 4UI9L 2W39A 4I0WB 1WW6A 4MH0E 5KC6A 3GTLJ 3MV01 4Q27A 2PHFA 1XYPA 1UYPA 3KZZA 1JOBA 3LSKA 2WKKA 4N90A 1GQPA 3WUCA 1ODMA 4QTRA 3MO4A 2YR2A 2DVFA 1TG7A 2E6VA 2XHKA 1FYLA 3G73A 2ZHNA 6PAXA 1WCUA 3I54A 4DY3A 4IESA 2FDIA 4WZCA 3K4LA 1YFHA 2G9GA 2VD7A 1IGOA 4OI2A 2L4AA 2VCCA 4F3JA 4LLFA 3LFIA 2NLRA 1OVSA 3A03A 2A5WA 4PBOA 1LEAA 4BZ4A 1J83A 3BTXA 1FLIA 1QJX3 4WF2A 1JYNA 1MR5A 2D6MA 2DURA 4NIIA 5H6QA 4P00B 4QX7A 4I0BA 2Z4FA 2VIXA 5A33B 4PSXA 5C44J 4ZZLA 3SZGA 3P5BA 2C4XA 5C8CB 1I5PA 1WJCA 1X19A 5FLVA 1T0FC 1OLQA 2HKOA 2MH2A 2E5ZA 2BBYA 2FJ1A 2TUNA 4FO9A 4B4QA 3DXJF 3ZDVA 4Y3OA 3K4ZA 5CFCB 2VUDA 3J7AO 2R7TA 4WVZA 5F3EA 5J48A 1MMGA 4HPKA 3CCYA 3K69A 3CF5F 5HDGA 1NCRA 1E5HA 3TP0A 5A3TA 2BU9A 3BG5A 1BEV1 4CYDA 4GFBA 1SD4A 3Q9SA 2VKHA 2NRAC 1D8JA 5LA2A 4ZYAA 1EY2A 1RRJA 4XAAA 2OBPA 4ASNA 3OYJA 4CYCA 2DMQA 1J9IA 3AK0A 5L3BA 2XWJB 3JRGA 1N1VA 1ND2A 4UOJA 4UUTA 4HW0A 2HPIA 4LR4A 1KA8A 2F48A 3ABUA 3G6EI 1BXHA 1WQ2A 3GJAA 3NQHA 2BE5F 1XU1A 1S0CA 4KU7A 3J8F1 3BWGA 4B1MA 3WTYC 4AG4A 4XJ9A 3W6KB 4ARXA 1AKHA 3UYJA 2FU4A 4J25A 5H9PA 1ULCA 1IPJA 4Q47A 5JXJA 3PIGA 3BUCA 4PF1A 3DLAA 4IRGA 1GZWB 2P4EA 3E6DA 4BQ1A 2M9HA 3B6AA 4YIFA 5FKKA 3S1RJ 1B35A 2X5IB 1HBXG 5FXZA 5FPVA 1EP0A 1TC3C 2RS32 3BPZA 2R7VA 1QJU1 4CE8A 1GICA 2ZMLA 1T08B 3VKOA 1W6QB 1QPMA 1IQAA 4AYUA 5LRRA 2NZ9A 2A6HF 5CVUA 4A12A 4G9SB 4Y20A 3GO5A 5FZDA 1SFNA 4RLQA 1H1MA 3LOCA 1JZ2A 2O8KA 3M1CA