2CGPA

Catabolite gene activator protein/dna complex, adenosine-3',5'-cyclic-monophosphate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*TP*CP*AP*CP*AP*TP*TP*AP*AP*T)-3')
total genus 66
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 1997-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgpA01
2DBBA 1G3YA 5JSOA 3M70A 2A3SA 2JPCA 1JGSA 3SCFA 1CAXB 3KP6A 1KQ9A 4FT8A 1KGSA 2R7FA 5KHGA 4Q29A 1YTYA 2ESHA 1SFEA 2DT5A 3SXYA 1WI9A 5BQTA 2Z2SB 1ZREA 3F8FA 2L54A 5FFZA 1RIOH 1Y0UA 3LQQA 1E17A 2FBKA 3HRMA 1R00A 4HX4A 2D2WA 5BMZA 4XFCA 3G73A 5CVIA 4PDKA 2MPFA 4UV8A 3WTTC 3DXJF 3WE3A 4H0EA 4IRHA 1U5TC 2OQRA 2WFPA 2XGXA 3ISPA 3B02A 5KHIA 1FC3A 4HDVA 2Z33A 4I0AA 3BJ6A 3FZVA 1MZBA 2A6EF 5D6FA 1YFWA 1SFXA 2YU3A 5LRSA 5I8TA 1AWCA 2FXAA 4DQ2A 2HQRA 5HDKA 4RB2C 1YW8A 5E20A 1IF1A 2GIVA 5DCFA 2P5KA 4MQ9F 2CG4A 3FJSA 1K7AA 5I91A 2P5VA 2V1UA 1EY2A 1QZZA 1SAXA 4ENMA 5JVTA 3RKYA 5JAXA 5J6XA 3JTGA 3M7GA 4ZZLA 2ELHA 4OMYA 3FX3A 3EBRA 3U10A 1UIJA 2A61A 3G7DA 5FPZA 2P6SA 3GF2A 1U8RA 2UYBA 3ABUA 1S7AA 5J8CA 1ZZCA 2FSWA 2KXLA 2IXJA 2KKOA 1XE7A 3ES4A 4F7ZA 4Q0SA 4ONUA 4DINB 1FLIA 2IJLA 1JUHA 1OI6A 1U78A 1ZYRF 2XHKA 1U12A 1O57A 1XD7A 4ZZDA 3NRVA 3TDUC 3TNQA 2ETEA 2DO7A 1I27A 4ORFA 1Z05A 2D5FA 4G9YA 4AD9A 1XMKA 2MLKA 2V1DA 4Q0PA 4N9IA 2A07F 3DQVC 3WTZA 2PHLA 3VODA 3NQOA 1T38A 3S2WA 3WW3A 3I71A 1NXMA 2PEXA 2FNAA 3QU3A 3MDPA 4L9TA 2A5YB 3KP7A 2CSOA 3VOEA 3ZMTA 4HX8A 4OIPF 4RGXA 2VOOA 4QGLA 2PG4A 3H3UA 4QWQA 3P9IA 3F8MA 1ZRDA 4E2SA 1FSEA 3J7AO 3GFMA 5LHIA 2VPVA 2ADUA 1MJAA 1U6GA 5ICCA 1VTNC 1Z9CA 3IL2A 4Z2YA 4LB5A 1H9TA 3IHUA 1ULYA 3DP7A 4WXHA 3I58A 3RIRA 1SEFA 5L3GA 2BNOA 1STZA 4HF0A 1OKRA 3D5LA 4AIKA 5HVQC 4I3PA 1YUDA 3W6KB 2HR3A 4D7SA 3F8NA 3U0ZA 1FBUA 2RKHA 2QQ9A 2UZKA 3BB6A 3FMSA 3TOBA 5BV6A 5A2QZ 1Z6TA 1ZZ6A 5JR3A 4HVQA 4Z07A 3JSOA 5EFUA 2XASA 2CQKA 2OPKA 2QJVA 2UY8A 4QGNA 2ZKZA 5AONA 1W4MA 2O6GE 3M8FA 4HDUA 1R36A 1PP7U 2I45A 4G6DA 4B09A 4QMAA 4EQQA 1PMIA 2PMHA 2P8TA 4MHGA 1LDDA 3SMHA 1BIBA 4A2UA 1HSTA 2H09A 1H9GA 3WTXC 3L2CA 1O7LA 1IAWA 3I59A 3GFIA 5DD8A 3Q9VA 3MYXA 1HQCA 2XIGA 3M1EA 2QZ8A 3QOPA 4UXAA 1UW8A 4XLNF 2GC0A 1KU3A 4IEPA 4Z82A 3JSPA 1K79A 2HWVA 4IEQA 4OFGA 1K78A 4QM8A 3HHGA 2PAMA 5ILUA 1NE6A 4J1WA 3E5QA 3CJXA 3ZMDA 1FYKA 3RTRA 3GWZA 1KQ0A 3FZ3A 5E17F 2Z9OA 3HT1A 1UFMA 4EJUA 2W24A 4D7TA 1GXQA 3M3IA 4MV2A 1LDKB 3HSFA 3ETQA 5CU1A 1R1TA 2BYVE 2UXNA 3C3WA 3MWMA 1F4KA 1DGWA 2GQQA 4HSLA 2IC1A 4NQWA 2UXXA 2PFWA 2XROA 4UNOA 1SD7A 4ETSA 4AVPA 4ENNA 3GBFA 1GXPA 2Y0MA 4I0BA 1LB2A 3HOTA 2HEOA 2JPBA 2L02A 4U0YA 1ODDA 5K5RA 5I0UA 3KEQA 5HS7A 3KLNA 5TRDA 5HS9A 4G7HF 1SD6A 4ESJA 5H20A 3WTUC 2XKPA 1GVJA 4J1XA 2FMLA 3IC7A 5ICGA 3E6CC 5ERIA 5LEKA 1ZVFA 1XGMA 4LLGF 3I7DA 3QU6A 1CF7B 1TNTA 3BALA 1NZCA 2QNKA 1XDSA 4KIFA 5C8WA 4KICA 2ZJ2A 3J81K 1ON2A 4HMZA 3GXOA 3J81Z 3UKVA 5DD4A 1XCBA 1YYVA 1I1GA 4XFHA 3HTSB 2Q0AA 2TDXA 1CAUB 4ENKA 2L3DA 4G94A 2ZFWA 4GULA 4G8XA 1WLTA 1QNTA 1HSJA 3H1YA 2CO5A 1J2XA 3ZMUA 1WGPA 3E5XA 2IXCA 2RV8A 4L5JA 2BBYA 3MFKA 4KNYA 4YG2F 2CFXA 2WV0A 4ESFA 5HDGA 1BI1A 3E6DA 4AVAA 2Y75A 3EYIA 2K4BA 2HYGD 2HTJA 4WBBA 1J3QA 4I7HA 5LGNA 3BZ6A 1RNLA 4CHUA 2FNPA 4YRDA 2GAUA 3SCHA 4EWAA 5ED4A 4LG0B 4CDGA 4L0YB 2XAHA 4CYDA 2IW5A 1FYLA 1O5UA 3FXUA 2A6HF 3I59B 4HA8A 5H6RA 1SMYF 5E18F 4Q0QA 2FQ3A 4L18B 5E16A 2VT3A 5JSPA 5FLXK 3CJNA 1IPKA 5FLHA 4KWKA 3TQNA 1Z6RA 3QP6A 4JTOA 2RQPA 3GFJA 3L7WA 4O6JA 2ZBKA 1ZZ9A 4K8FA 1KU7A 1ZG3A 2DQLA 4L9NA 2MC3A 2Q2EA 5E8GA 2VN2A 4N9HA 4KN4X 2QM3A 3N4MA 1LEBA 2VXZA 1ZLJA 1ZX5A 3PNAA 4PIZA 1YS7A 3GYHX 2EA2A 2BGCA 3ES1A 2HGCA 2V1XA 1X3UA 4GYIA 2IRFG 1X8MA 1GHCA 3FMQA 4QXKA 2VE8A 5JCTA 3FXRA 2NNYA 4KN7X 4RD7A 4XSZF 1TTYA 3DN7A 3USSA 4KMUX 3REOA 2FOKA 5E8IA 2RN7A 1BM9A 1I1SA 1HKTA 1S3JA 2DPDA 4E2QA 3I64A 2QYOA 1UB9A 3AAFA 5BPXA 2F5CA 3BP8A 2VBXA 1XN7A 2BNMA 3IDBB 1EH8A 5LLQA 2QBYB 3H3ZA 3CLPA 4HLTA 3NJZA 2ZXJA 3BPVA 2GA1A 2FF4A 4ASNA 2ZNZA 1IRGA 1WA4A 5J8FA 1CAUA 4AXOA 1BI2A 4WF2A 2K27A 3IKVA 3H8UA 1C0WA 4BHBA 2DPUA 4OOIA 3ML6A 3U2RA 1XRUA 2QBYA 4Q4ZF 2P4WA 2K4JA 4CO8A 2PYTA 2H27A 1IUYA 5DEQA 2GC2A 1F9NA 1U5TB 4HQEA 4LD5A 2DQRA 1OR7A 1ZHFA 5LGUA 1XGSA 1S6LA 3WGGA 4YIFA 4AVBA 5BUVA 3H92A 1ON1A 4LUMA 3QPHA 1JXSA 4EMSA 5FQ0A 1JE8A 4A0XA 2K02A 3CTAA 1G4DA 2L4AA 1OMIA 4MGYE 1QBJA 2VC1A 3BY6A 1OYYA 2H6BA 4KMFA 1BN5A 3O14A 5FLXZ 1T6SA 2G7HA 3WGHA 5D5UB 4M9XA 4UVAA 3LWFA 3IKTA 3C18A 5CJ9A 3FFQA 4RB1A 1J59A 3RKWA 1Y3TA 2QWWA 3ROUA 2H6CA 1LNWA 1AOYA 3BOQA 3QP5A 1SD5A 3KZYA 4HBLA 4Y15A 4QX5A 1WQ2A 2P5LC 2A69F 2OU2A 2EFQA 2HDCA 4OIOF 2EV6A 3H7JA 1BIAA 2FBHA 4L11A 4XSXF 3SZTA 1SD4A 2ZCWA 4BNCA 4HBNA 2RC4A 4HVRA 4S04A 3KETA 2L4MA 1CAVA 1YFUA 1QPMA 4YFKF 1R5HA 4L9VA 3DPLC 1SFNA 4WVZA 4EJOA 2Q8KA 1YW7A 5T3NA 3COAC 3ZN0A 3LAJA 2ACJA 4U7DA 2ZMEA 1BOAA 4OIRF 1R22A 3DKWA 1YW9A 2PJPA 2V6CA 2PHDA 2YX7A 4A0ZA 4KU7A 5I8YA 3ZPLA 1EPZA 4ON0A 4PJYA 2ZO4A 4I02A 2IA1A 3FM3A 1FY7A 3BWGA 1NHAA 2FEZA 1VP6A 4XFFA 1HBXG 5IT9Z 3RKXA 2VT2A 4L5IA 1U2WA 5L3EA 3IDCB 2G7UA 2ETHA 3T0YA 4A12A 2Q30A 3IBMA 1HXDA 1ZZ8A 3VEPA 1XDUA 3U9GA 4EWEA 3Q5FA 4UHTA 4KU8A 1GQGA 4IEZA 1R1UA 2M30A 5FQ0B 3GVAA 1MJ9A 1EH7A 2K0GA 2X0LA 1U3EM 2NNNA 3U1DA 1BBYA 2JT1A 2OZ6A 4IESA 2OD5A 4XF1A 2B8MA 4YYOA 5ILVA 2EAAA 3EO6A 5C6CA 2FQPA 2HYFA 2EA4A 4S05A 1FOKA 3F72A 5LGTA 2GU9A 4MQVA 1YQAA 4O9EA 1J5YA 1UPIA 4UBGA 4X6RB 4XF9A 4EJTA 3BPXA 1UHWA 3MPBA 5AVPA 2BEOA 5HS8A 2YPRA 4MTDA 3V4GA 2PLYA 3DV8A 2X4HA 3KFWX 3F8BA 1YLFA 2V79A 3WE2A 1YLLA 4HQMA 1CAWA 1O5LA 1RC6A 1CAVB 2VOPA 4HV5A 3T1BA 2VBWA 4MEYF 3TNPB 2FBIA 4WZCA 4Q5SF 5HOOA 2NYXA 5J3UA 5D5VB 1OYIA 2KIUA 3PQKA 2EA7A 4IETA 2B0LA 1I6XA 1QO0D 3I54A 3GFLA 1DUXC 4MZUA 2VONA 3MQ0A 5L3BA 1DZRA 1RI7A 2ZKLA 4HN0A 3TDZC 4A6DA 2STWA 4IHSA 3SHFA 1RGSA 4HSJA 1W7PB 2R3SA 3ELKA 1TQIA 1LRHA 1PP8F 2CGPA 2NS0A 3BROA 1ZH5A 1OYWA 4MNUA 1YFXA 1I5ZA 5BY5A 3EUHA 2HS5A 2VBZA 3B73A 1USSA 1W5SA 2JRTA 5TJJA 4HN1A 2CWEA 4ZU5A 2M8EA 3MAJA 1B4AA 3L00A 1ZZ7A 4IEOA 1IRFA 3WTWC 1RL3A 1K6OA 2IXHA 1CX4A 1XE8A 4Q47A 5I0SA 2GC3A 5AIPA 4KIBA 4Y17A 2XRNA 3MEXA 2QVOA 4PGHA 4RB0A 2JTVA 2BE5F 5FPXA 1O4TA 2DK5A 1DPUA 1BC8C 5CVJA 3WTSC 2QQBA 4HOBA 1Q3EA 4KWLA 5JR7B 2PBIA 3EQEA 3E6BA 4EGYA 1PDNC 2DK8A 3NKTA 3LOIA 3CUOA 1FI2A 2RVCA 4KUMA 1JHFA 3SCGA 5IT3A 3GUDA 1RTVA 2RDPA 2Q1ZB 1J7KA 3KP3A 1XGNA 4OLLA 1FXZA 5HLIA 4OU0A 4M73A 3P7NA 2O3FA 1WSUA 1TQMA 2Q0OA 4G6QA 2CV6A 1T39A 1X7NA 1DDNA 1QWRA 3K69A 2DAOA 3WTYC 3S7EA 3HRSA 2XL7A 2VECA 4PIXA 2XAQA 2ET7A 2QENA 3HUGA 1Q43A 3KLOA 3ECOA 3CDHA 3FF5A 5KBFA 2E7WA 2QVSB 2K86A 1XCVA 5F64A 2XV4S 1QXJA 3SZPA 2RGVA 1KYWA 2ISZA 1R23A 3DL3A 5FLJA 2W57A 2OA2A 1TW3A 2VBYA 4I01A 5KVRA 4XFGA 4K2EA 5AIQA 4WX9A 4RGUA 4HV6A 5DDGA 2K9ZA 3JTHA 4LG0A 2OQGA 3LA3A 4O9GA 1EP0A 3H1WA 5J7MA 3RPQA 2YSRA 1CAXA 2EFOA 4ZU7A 4R8HA 4ESBA 4JK1X 3E3VA 2F4PA 2P7VB 4MGKE 3TO9A 5E1XA 1XSXA 3BJAA 4AQ2A 3G3ZA 4BQAA 1REPC 4R1HA 1P6RA 5KHJA 1UHMA 1FZPB 3E5UA 5LHHA 1A04A 4IEVA 3WW1A 2QLZA 2MH9A 1NYWA 4HZFA 4A5NA 1XB4A 4HX7A 2JSCA 3K1PA 2VODA 4IPAA 1BI3A 1T2KA 2OZJA 2D5HA 4LLOA 3F22A 3BJOA 3GZ5A 3CO7C 5I8SA 1G3TA 3RYRA 4AWXB 3WTVC 5K5QA 2M1BA 1ZARA 2JZYA 3VHRA 2XVCA 4TV7A 3L2HA 4RGSA 3U11A 3FM5A 1W7PD 4E70A 1T98A 4LTAA 1YS6A 5KK1A 5FB2A 3QACA 3DF8A 2J5PA 3EDPA 4IXAA 3V7SA 4ZYDA 3H9AA 1MD0A 1O3SA 4F8AA 2DTRA 1Z1DA 5BPIA 2OYZA 4KDPA 1IPJA 3OF1A 2LF8A 1X82A 4Y13A 2LNBA 4O5VA 2W25A 2HKXA 4M6XA 3H50A 4BHPA 1D8KA 1TBXA 3BPZA 4PCQA 1TNSA 5JHUA 1IXSB 4M72A 2HTSA 3IIAA 2DW4A 3VB2A 1FNNA 4LLNA 2GC1A 4L9JA 1DZTA 1KYZA 3ACLA 1YHFA 4YIIA 2PTMA 3HRUA 3DPTA 1IZ1A 4FBFA 2DLLA 5E1WA 4I2OA 1RUOA 4HW0A 4JQFA 2OBPA 1U5TA 4MX3A 5CYVA 1LR5A 1OFNA 2EB7A 2MBFA 3NSTA 1LQ1A 3C7JA 3WU1B 2ZMEB 1T0FA 3ZMSA 3M8EA 4HLXA 1SMTA 3NVCA 1Q1HA 1ZG5A 3RPUA 2OZUA 4GO1A 1G6NA 3WU0A 1KA8A 1YFHA 5LBQA 2D40A 4KYWA 3MCZA 3I53A 4A0YA 3QPTA 5FLIA 3NEUA 2D1VA 3D0JA 5DCMB 3WGIA 3IWZA 4R52A 2WWYA 4WXCA 4I09A 1YFYA 2B9UA 2E9QA 2VQAA 3O6BB 3FMRA 2CYYA 3KSCA 2P17A 2IXLA 1ZAOA 2IXKA 2HFHA 2KRFA 4JBAA 3F6OA 2ATFA 4G7ZF 1QZYA 3ZMVA 4B29A 4M9SA 3LFKA 1FSHA 2XAJA 1ZRRA 2ET1A 3F21A 2COMA 4KT5C 4MUVA 1FPQA 5HDNA 3OCPA 3ZN1A 4OMZA 3HT2A 3J80Z 3NW4A 3SXWA 2XLAA 4L0ZB 3GEZA 1X8EA 3FXQA 1FBQA 1Y9QA 1LJ9A 1P4AA 4EJVA 3K2ZA 2O1QA 4IEWA 4ENJA 3P9CA 1J58A 1L0OC 5LHGA 2BNNA 4MGZE 2EFNA 1VR3A 2B5HA 4KWJA 2QQAA 4U88A 4FAGA 1FP1D 3PVBB 3CF6E 3T5XA 1UD1A 4GGGA 2DCTA 3OD0A 4IEUA 3R4KA 4M71A 1IXCA 3FWEA 5K1YA 3UKTA 4MTEA 3HTUA 2W84A 3J80K 2W85A 5A2QK 5IT9K 3R60A 3CUQB 1EH6A 4GCVA 5L3CA 2Z99A 2MA3A 4XRFA 2F5EA 3LSTA 1B59A 4EM2A 3E97A 5JSRA 3ZQ7A 2ESNA 2V09A 2M45A 4KIGA 1E2XA 4BHCA 5HI0A 3LA2A 2PQ8A 3WG9A 2P7CB 3IWFA 2O03A 5JI6A 3PLQA 3ULQB 4RAZA 1UCRA 3HIFA 3WW2A 2G9WA 1YIOA 2KJBA 2XKOA 2H94A 3ECHA 1ZGJA 5CVVA 3KP5A 2QDRA 1B9NA 2RNJA 2NRAC 4BYYA 4EJWA 3EQLF 2PAKA 2FMYA 5FD5A 3T8TA 3LQRA 1RZ4A 5D4RA 1IW7F 3R0AA 2PN6A 3FHIB 2XUBA 4XFBA 4M74A 4AQ6A 2IP2A 3E6MA 3ZP5A 5H6QA 3BU7A 4IERA 2CAVA 4HF1A 3HQXA 2QCSB 1G3SA 1BJAA 4FX4A 3T8RA 1SFUA 3PQJA 4B8XA 3IRQA 5JFRA 1EV7A 3UKNA 1B1BA 2P6TA 2MH2A 3ZDSA 2KIFA 3I5UA 5CADA 4BAYA 3EETA 1J3RA 4YNIA 1Z91A 3R0JA 3W6JB 4EV0A 2QUFA 3C1DA 3K9TA 4Q0UA 2XLFA 4IEXA 4LB6B 2YX4A 2XL9A 3R6SA 4CICA 2XAFA 1WRJA 4OINF 3RYPA 2KIMA 1TW2A 2AXLA 3IRRA 4HAMA 2ZNYA 3HSEA 2N7GA 4IHTA 1P4WA 1H1MA 3RJPA 4WCGA 4EWDA 1HW5A 3F8CA 4AIHA 3GLXA 1DP7P 2L01A 2LSOA 5D1IA 3TKYA 4D0PA 1QY4A 1CAWB 1SQ4A 5J48A 1J0RA 2IVMA 4XFAA 2R7DA 1O3QA 1D5VA 4UUVA 2PAEA 1S29A 4IVNA 2DI3A 3V8LA 1V3FA 4PIYA 2WC2A 3D0SA 3TOAA 5F6FA 4IF4A 4HVOA 2K7LA 4AIJA 4XF4A 4XEZA 5I0TA 4U7BA 3ST7A 2EV0A 1MKMA 3SFZA 4LUKA 5E1ZB 2F5FA 4JTNA 5EZWA 4QGMA 4NVPA 3DEUA 1FYMA 4KA4A 4UVBA 4JVAA 1O7FA 4LGWA 1J75A 4ZYEA 2PFBA 4KL1A 2PI0A 2NAZA 2GXBA 3QRFF 4O3MA 4HYEA 1UIKA 1R1VA 4OIQF 3S7IA 2J5OA 4IRIA 3QAHA 5E1RA 5FGMA 2IT0A 2CW0F 3EYYA 3BCWA 2MHFA 4LEJA 1MGTA 5FFXA 5DUKA 2DU9A 1ZRFA 1WWXA 4KFCA 4M6YA 3JAMK 1QQIA 2V9VA 3MZHA 2D45A 3VFZA 3V7CA 2FRHA 1UCXA 2FA5A 5HLGA 1YWKA 1DGRA 1MJBA 4MEXF 1XSDA 1KU2A 1USTA 1R58A 4P55A 1MDMA 3KZZA 4LMYA 2GWRA 5FO5A 5ICEA 1HKSA 4GYGA 5CVRA 5K5OA 1S8NA 2VC0A 2Y0OA 4U0VA 3KEOA 5F1RA 3TGNA 2BV6A 1CGPA 1P4XA 2EK5A 3K0LA 3NL1A 3KGLA 1J3PA 3RZZA 3KE2A 4A5MA 3ERED 3LA7A 1S7OA 5DUIA 4YFNF 1L3LA 3SHRA 3OV8A 5FDBA 5EEHA 2IA2A 3HHHA 2FE3A 5HLHA 3WW4A 3H7YA 3TO7A 3KP4A 1LDJA 4YSFA 3ZMZA 2A68F 1HKQA 5D6EA 4RB3C 2HKOA 5DYMA 2MLGA 6PAXA 4XETA 1K78B 1R5GA 1V4RA 3K1NA 3RYKA 1WKMA 4META 1H0MA 3LAGA 4EVIA 2WTEA 5FD6A 1Z7UA 2OA4A 3S0MA 3Q9SA 3CLOA 4GXOA 5D5WB 1W5TA 1ZGAA 4CZZA 3K1MA 1GQHA 3O3KA 4CXFA 4RAYA 3N97A 1YO5C 3RI4A 3GZ6A 1F1ZA 4LFUA 2GXGA 3CO2A 3HSRA 4YFXF 4P5OA 4N0BA 2DFIA 2AS5F 5BXXA 4LLLA 3KCCA 3RDIA 1ZRCA 4ZH4F 5L3FA 2XAGA 4G7OF 4P9FA 3CO6C 1OPCA 1V70A 4LA3A 4FHTA 2O8XA 1XGOA 4I98B 3F6VA 3F23A 1TQ5A 1LVAA 4CGZA 1PM7A 4RGRA 4ZYHA 4E2GA 1D8JA 5K8SA 2EFPA 3FE5A 4XLPF 1ONVA 2E1CA 4EM0B 2GZWA 1O3TA 5D4SA 1HW2A 4MGIE 2VE9A 3EHKA 2E1NA 3R61A 4LULA 4QLCU 3OTFA 3CL1A 3HYIA 4WK8F 1KU9A 4BXUA 4WXDA 3EJKA 4TLFA 3CUQA 5KHKA 2H0VA 2Q4SA 1MDMB 1QXRA 1P2FA 3C3VA 2F5DA 5I0RA 4A6EA 1JHHA 4LK0F 1O3RA 2C0ZA 1FWZA 2LF7A 2UYAA 1IN5A 3LZZA 1FT9A 4Q0VA 4AVCA 4NB5A 3F3XA 3MZYA 4P9UA 2XLGA 4UV9A 5ILSA 1DPRA 5DV5A 4BH9A 2LKPA 4PZJA 4BIFA 4LJZF 4EROA 2IA0A 1ZN2A 2YR2A 5DCMA 2EFWA 4XF3A 3GW2A 4QM9A 2HJIA 3V8JA 3PFIA 3ELNA 3HRTA 2EV5A 1J1LA 1VJ2A 2F2EA 4LK1F 3D82A 3LAPA 2O8QA 2IXIA 4R79A 2EVXA 1B9MA 1LKNA 1FX7A 1FP2A 1IN8A 1W7PA 3V8KA 1KQ8A 5EEGA 2EJRA 1LEAA 2IPQX 4MH0E 2UY9A 4U0WA 1HW1A 5LEJA 2LDUA 2Y48A 2Z5UA 4XF0A 3OGJA 5KHHA 1CF7A 1XSVA 1D3YA 1RUNA 1P92A 4IRGA 4FX0A 1BI0A 2FU4A 4HLYA 4HF2A 1FBSA 3GYDA 3JZVA 4IJAA 2OAZA 1J9IA 2EWNA 1TQPA 4WWCA 4PGGA 2ISYA 2HQNA 1IN6A 2E7XA 3V7RA 1ZG1A 1NE4A 2HOEA 3CUQC 5D5XB 3CEWA 2CAUA 1R7JA 1EYBA 3KP2A 4ZU4A 4L2NA 4FAHA 3GO5A 2D1HA 1B6AA 4YARA 2Z69A 4P96A 4P9GA 3O2PE 2M87A 1PUEE 5I93A 2GA2A 5D8LB 2STTA 5FCCA 3WODF 4H7LA 1IXRC 5CLSA 3FHZA 4M9ZA 3SQNA 3OOPA 1YG2A 3I4PA 3LWCA 4NHJA 5BS6A 1QGPA 3TO6A 3M9AA 2GH2A 5D8KB 3RNSA 3KGZA 1L3JA 1ZNPA 1G3WA 4IEYA 3DFGA 5BOXA 1H1IA 4ZYGA 5L3DA 4JV4A 3ABTA 2HZTA 2O61A 4UVCA 3H1MA 2KJCA 5CVUA 3L09A 4UXNA 1F5TA 3P9KA 3JAMZ 1OD5A 2PA7A 3GX4X 2MD5A 2D93A 3I0TA 1BC7C 1IN7A 2C6YA 1TLHB 1ZLKA 5BPDA 4XBFA 4EGZA 1Q5OA 2UWMA 1ZZBA 2PQQA 3L9FA 2MNGA 4X6QB 4UBHA 1XMAA 2O0YA 4RS8A 5ICFA 4LA2A 4EM1A 2M5WA 3HOSA 3KMHA 5LRRA 3JW4A 2PMUA 2Z3YA 4Q48A 4XFIA 1IN4A 4DNCA 3BDDA 4MGRA
chains in the Genus database with same CATH superfamily
2DBBA 3C7FA 3TL4X 2E19A 3M70A 2A3SA 2JPCA 3WP3A 2V9KA 1JGSA 2WR9A 2B42B 1KQ9A 2W46A 3JD71 2R7FA 5FFOC 2ESHA 1LKXA 1W8HA 5A7WB 2QTWB 1GZWA 4OUMA 2YXSA 2Z2SB 4X8PA 5CQEA 5FFZA 1E17A 2R93J 3ZFFB 4NR1A 2RS12 4KGGA 1JS9A 1VBC3 3AYCA 5CVIA 2VOXA 5EJ3A 3WTTC 4G12A 3DXJF 2EXIA 4QX0A 2PX9A 2DVGA 2JDUA 2WA3A 3PNTA 1GUIA 1RHI2 1DQ0A 4AVZA 4P14A 4XXPA 1FC3A 1XU2A 1XXNA 4HDVA 1CZTA 2VULA 3I2OA 4W4ZA 2L9SA 3DKQA 4IE4A 4N43C 4EJRA 1SFXA 4OI4A 1L7RA 1OA3A 2PMZA 5E20A 2F48A 2P5KA 5FIXA 1K7AA 2FUG2 2G4IA 1N3PA 1MMNA 2XBO2 1G59A 2JA8J 2XQXA 1QZZA 3K10A 3N35A 4XNFA 2UU8A 1UY2A 4QPYA 5JAXA 2R0FA 4RHV3 4OMYA 3SFIA 1XNCA 3FX3A 3U10A 1UIJA 1C8M2 3ABUA 1S7AA 2FSWA 1IO2A 3KHBA 1JN2P 5L36A 5IK8A 1Q1VA 2NYYA 1XE7A 2YPJA 5LATA 3Q0WA 3E1F1 1RESA 2IJLA 3NNJA 3U07A 1SLIA 2BOIA 1XD7A 2E7QA 5KAFC 1VRH3 4DO0A 4D5FA 3TDUC 2W4SA 1I27A 3AK0A 4UW4A 1Z05A 2PJRB 1GOFA 2Y26A 4FFGA 2D5FA 2VCBA 3H8RA 4AD9A 1XMKA 2ZXHA 3NWSA 4Q0PA 4DZGA 3ZN4A 3WTZA 5T52A 2PHLA 1M4WA 1JHNA 5M5WJ 1F5JA 1VBD1 1NXMA 1B35A 3MDPA 4L9TA 3BPSA 2EINH 3UNPA 2MC4A 2DCJA 5FOJB 3ZMTA 2KZVA 1WI3A 4RGXA 2R7SA 2VOOA 2PHWA 4QGLA 5A80A 2AQEA 2CYFA 1AR73 3P9IA 3F8MA 1ZRDA 5ACA3 3A0BC 1ND2A 4CEYA 2EH3A 3VZNA 2CQQA 1OOPC 1MJAA 2FDJA 5GZFA 1GT0C 1VTNC 3FXJA 4Z2YA 1H9TA 1REEA 1CIYA 1SHWB 2DU1A 1GICA 1PM4A 5D21A 2X09A 5T5OA 5FMCA 1STZA 1OKRA 3LSEA 3MKLA 4AIKA 2LTNA 3LPGA 3AMPA 2HR3A 4D7SA 5HBAA 2RKHA 2QQ9A 4DY3A 4BCUA 4Q2FA 3BB6A 3FMSA 4PBOA 4EN7B 1Z6TA 2NVXJ 2OKXA 4Z07A 3JSOA 2QJVA 2XVLA 4C3IJ 1JOJA 2H8WA 2DFBA 4HKLA 4ZZ5A 4MFDA 4BMEA 2R7ZJ 4HDUA 3WP5A 2P8TA 1F43A 5DZFA 1W03A 2EICA 4AFDA 1W8UA 3NQHA 4FPCA 3L2CA 1BQPA 5GZDA 4XIOA 2AYHA 2EXJA 2XIGA 3M1EA 4UXAA 1KS4A 1UW8A 1POV1 4OHVA 2Z42A 3JSPA 2X05A 1K79A 2VJIA 1JODA 3A2KA 1DZQA 4QM8A 2LROA 4AFCA 1O8PA 4Q4X1 4A3IJ 2PAMA 5ILUA 4J1WA 4M3CA 1K5MC 3CJXA 1OQEA 3ZO0B 2C6SA 5DM7F 5E17F 5E6HA 2Y60A 1MQTB 2W24A 4GFBA 4ITVA 1HQWA 1GXQA 2JEMA 3HSFA 4JQTA 2XF6A 2B46X 1PYVA 2TNFA 1F4KA 1DGWA 3ZFGC 3F95A 2GQQA 4NQWA 3NAPA 2UXXA 1SD7A 3IH2A 4AFBA 2Y0MA 3U75A 2L02A 1W3XA 1OVSA 5I0UA 5HS7A 2BERA 1K5MB 2E6VA 4KH9A 1SD6A 2IGKA 3M3CA 3U1XA 1N75A 3CCVI 2W08A 4AK3A 4E7JA 1W36C 3PTYA 1JH5A 3K46A 5E79C 1VNDA 4LLGF 1AR62 3I7DA 4A3KJ 1CD3G 4BE1A 1W0TA 1TNTA 3BALA 2QNKA 1RR8C 5C8WA 2ZJ2A 3J81K 3UGGA 4MYEA 4HMZA 3GXOA 1IDYA 1I3QJ 3UKVA 3LSGA 1PVEA 5LK5A 1I1GA 1N1YA 4DEQA 4CH7A 2VUAA 2DCYA 4L97A 1CAUB 1WZ2A 4LIVA 2ZKNA 1OR7C 1JBCA 3RZLA 2QCOA 4YG0A 1WLTA 2WO1A 1HSJA 5KR7A 3R0RA 1EAH2 2WLPA 1STMA 3MIHA 3AL5A 4XVHA 3K4ZA 4FPEA 3MFKA 4QDRA 1F8VA 2D3RA 2R072 3IN9A 3ESWB 4ESFA 4JC1A 5HDGA 3G6EI 4AVAA 2A73B 2EPFA 2HYGD 2NS7A 3CD6I 3I4MJ 3SISA 5LGNA 4E7HA 3BZ6A 5FY1A 1ZELA 1J83A 4XORA 3AXDA 3GZAA 4E7LA 2WZR1 2FNPA 2GAUA 1NT0A 1IG3A 5ED4A 3J7LA 4L0YB 1UYXA 3K4NA 3BR1A 4KISA 4K3UA 4XMYA 5H6RA 1QVUA 3SH5A 1W6OB 4R9CA 4Q0QA 4XMIA 2G9ZA 3TBIA 5FLXK 3BOPA 3CJNA 3GTMJ 1YIFA 5FLHA 1ZBA2 3QBQA 4K40A 5FKKA 1ETQA 2RQPA 3VZMA 3CZUA 4DY5A 2ZBKA 2D6KA 1ZG3A 1RMU2 2FCTA 2Q2EA 5A7PA 4RDUA 1WFXA 1NQJA 3H35A 2VTFA 1W8FA 1LEBA 4YM2A 1ZX5A 2NPIA 3PNAA 4YFWA 3GYHX 5DXDA 2HGCA 1UZ0A 5EXOA 2Q8CA 2V1XA 1JZ6A 4CUGA 5C3OA 4XLEA 4GYIA 2IRFG 5FY8A 4LJHA 3IZOA 3S93A 1X8MA 1GHCA 4ZXEA 2CL2A 5JCTA 4GKXA 3C7OA 3FXRA 2VBDA 4KN7X 5IVJA 1AYN2 3OOXA 5JDBA 2EIMH 3HVDA 4CDXB 3SDGA 1SZBA 1S3JA 1HLCA 2M0CA 4XDPA 2W1UA 2DCKA 5BPXA 2X9DA 1POV0 3BP8A 2HWE2 3HJEA 4BQNA 4QPGC 1XN7A 4JGZC 5FZCA 5LLQA 2ZXJA 3BPVA 3IT8A 3VZKA 2XG3A 4N53A 4CU9A 4QQLA 2ZNZA 1CAUA 4MLOA 2W2IA 3SEZA 2WYSA 1BI2A 5HCBA 3HBLA 1XNTA 4OOIA 3U2RA 4UF0A 3MUY1 2K4JA 4CO8A 4BDZA 1ZM1A 2H27A 3UKGA 1IUYA 5J1YA 4FPLA 4E4SA 1MS1A 4M3CF 1HRI3 2DTZA 4AW7A 2QKDA 5FYTA 1OR7A 1X1BA 5IAVA 1VMFA 3I2HA 2GIZA 1ENSA 4LUMA 1JXSA 4NPRA 1JE8A 4MXVA 2K02A 1RHI3 2L4AA 4AFAA 3BKZA 2VC1A 4GWJA 2Y0SN 2FCVA 2IGOA 5FLXZ 3ZMOA 1T6SA 4MADA 3LWFA 3LEIA 5CJ9A 3TWIA 4CEWA 3FFQA 4JOMA 2BHYA 1J59A 5FYIA 1SEUA 3MF6A 4UUSA 4LE4A 4AVSA 4A42A 2VOTA 2H6CA 4P9LA 5FYVA 4CUCA 2XAUA 4Y15A 4PLOA 3G1MA 2OU2A 1R1A1 3MW3A 3VHPA 4A6OA 3CESA 2HDCA 4OIOF 2R16A 3N7LA 1WVRA 4LO7A 5KXCA 3SZTA 2JDKA 2ZCWA 4BNCA 2AUYA 4HVRA 1R1A2 3N9LA 4P1WA 3A02A 5IVFA 3MHZA 5JXIA 1V6LA 2X6YA 4YFKF 1AR82 1R5HA 4CA9A 4E27A 1GYKA 4WVZA 4EJOA 5EF6A 1T6GC 1Z7S3 2EXKA 5CKMA 1JZ3A 4M3EA 3ZN0A 3LAJA 2QQOA 5CIRA 3FXLA 3QCWA 4C90A 1AL23 2FDKA 4LO6B 4RA0A 4OYUA 2DYCA 2PJPA 4KNCA 2PHDA 4A0ZA 4FE7A 2CU7A 4P9XA 1JW6A 3M2MA 3UGHA 4GH4B 4ON0A 2RHPA 4I02A 5FYYA 3I49A 1B35C 3WVJA 5C4WA 2F4MB 3Q8BA 3KYLA 2WY7Q 4W6XA 2FEZA 1VP6A 4XFFA 1HBXG 5IT9Z 3RKXA 4L5IA 3LD8A 3TMOA 4DBQA 3IDCB 2ETHA 3T0YA 1QMJA 4A12A 1JI6A 3IBMA 4WVVA 2W1OA 1QHDA 2E71A 1GQGA 2DUPA 4IEZA 2R7QA 3HNMA 3VYSB 1JU4A 4RGGA 4L0PA 1CN1A 4AQSA 2YV8A 2X0LA 2IS6A 2YUEA 1XYOA 3MFCA 2NNNA 3RWNA 3JBG3 2JT1A 3OGGA 2OZ6A 2JA6J 2E2HJ 1PMJX 1WD3A 1ZBE3 1W0UA 1IV8A 3GZUC 5C6CA 1NCQC 1ENRA 5FP8A 1OF4A 2KFDA 3MD2A 1YQAA 1TNFA 3ZXLA 4EJTA 4XLCA 3BPXA 1C3HA 2WN2A 3MPBA 2ZGTA 3V4GA 5FMDA 3DV8A 2X4HA 3KFWX 2V79A 3ORJA 2LY9A 2X6WA 1OUSA 5DABA 1SFOJ 1ZTRA 1BHGA 2HEYF 3T1BA 1ETXA 3TNPB 4LK7A 2M0MA 2FBIA 3J7NA 2NYXA 4UAPA 2CJJA 3VGIA 5J3UA 1OURA 4AEDC 5D5VB 5A32B 1ALYA 4BM8A 3POIA 5FBZA 2B0LA 2OV7A 1R093 4AGGA 2ECBA 1UWWA 2VONA 3MQ0A 1OBNA 1AL0G 2P4EA 4CU6A 2ARXA 2KT0A 4HN0A 2RS32 2FHRA 3TDZC 4JDOA 1K45A 3GF6A 3VBHA 1W99A 1R4MB 2KQRA 1CZSA 1RGSA 3GTQJ 1V6KA 4HSJA 2R3SA 1Y56A 1YQ8A 3PHMA 1NX9A 5F6KA 3DCQA 1OYWA 4MNUA 4UFIA 3EUHA 2BRTA 1QEXA 5LA2A 1W5SA 1CR7A 3AKTA 2DU0A 4SBVA 5TJJA 3MW4A 3R4DB 1V6IA 3UESA 1VBE3 3FISA 2M8EA 2FDFA 2B7EA 3L00A 1ZZ7A 1HRV1 1IRFA 5JHFA 4FE4A 1CX4A 3GTKJ 4Q47A 2CW7A 3AP7A 5FZOB 3BOWA 2QVOA 2JTVA 2BE5F 2DK5A 3WHBA 1H89C 5CVJA 3WTSC 4NHLA 1MS4A 1GZTA 4JHTA 3GGLA 3E6BA 2O0OA 1PDNC 2N8GA 2DK8A 3VKOA 5JXJA 5IVVA 2RVCA 4PQQA 2LY1A 2M4KA 3SCGA 5IT3A 2D44A 4EN9B 2Q1ZB 3GALA 3ABLH 5HXVA 5EPAA 1W6NB 3MIFA 3PJRA 1J09A 3DGTA 2Q0OA 4GDFA 2CV6A 3KEYA 1T39A 3AL0C 1QWRA 3K69A 1GQPA 5A3OA 2PLV2 3HRSA 2XAQA 3ZXSA 2ET7A 3H5NA 3WF0A 1RJ8A 2ZGLA 2QENA 3HUGA 5FYUA 4DFSA 3KLOA 3ECOA 5GLVA 3ZYFA 2QVSB 1H8TC 2VU9A 4KBBA 3SZPA 5IVCA 2JVHA 2ISZA 3MIEA 3DL3A 2NVQJ 4LBJA 1YXWA 2W57A 2OA2A 1XJAA 1V6MA 1W9SA 4DMIA 4CUAA 4JP0A 4WX9A 3JTHA 3K4MA 4PUSA 1X19A 2DJNA 4A7ZA 3Q8CA 2YSRA 3JRFA 1E57A 1WJFA 2VZ1A 3CIHA 2HU9A 3OIOA 1QNWA 1HXS1 4YWAA 4XCAA 5A7NA 2VW1A 4R1HA 2QGUA 5DQ0A 2WABA 5LHHA 2HVSA 4UFKA 3WW1A 2QLZA 2WV1A 4BISA 4NIHA 4A5NA 1CPMA 1F31A 4GQ7A 4LHKA 1OH3A 4QWNA 4IPAA 3WDVA 2OZJA 2PHRA 1PO22 4GXLA 5F5AA 5I8SA 1G3TA 4AWXB 4H4KC 4LKSA 2M1BA 5GJ6A 4IV3A 2EIJH 1EA3A 3L2HA 1JZ4A 4CA0A 2P3JA 4BK4A 5A1AA 3AG4H 4C3HJ 1DQUA 1YIPA 3H3VK 3O1RA 1WCMJ 4IV3B 3PVOA 4XC9A 4IXAA 3MZ8A 1WHUA 3VZOA 5C5UA 4XOTA 3H9AA 4F8AA 2DTRA 1JOPA 1A3KA 5FZKA 2XHNA 1JYIA 2LF8A 4JKLA 3WQ7A 4Y13A 2LNBA 2ZEWA 2DUQA 3H50A 4M6XA 5B4NA 2RNGA 4PCQA 1NCQA 2VPRA 2HTSA 1XNKA 2ZGNA 2OXBA 3ERMA 3VBSA 2YBPA 3CCYA 2GC1A 1FNNA 1Y8QB 4L9JA 1AR93 3G6JB 3J7HA 3WINE 2VNRA 4QDSA 4K21A 4F92B 1JKQC 1GV5A 4EEFG 5FYZA 1HN1A 4BJ6C 5IY5H 3PJYA 1LR5A 1D1CA 4XLFA 5CFDC 2EB7A 2AO9A 2MBFA 3GHNA 4C9YA 5C44J 5A3UA 3S5QA 1BKZA 2A70A 3TW6A 2HPIA 2XJTA 3M8EA 1X1PA 2UWCA 1SMTA 1E5SA 1W6QA 1RRJA 1ZG5A 1MSEC 4FPFA 2DYRH 1DGLA 4LBQD 4A7YA 4UOJA 2YUSA 2EZLA 3QPTA 3GTLJ 3B9IA 3NEUA 5BNPC 3LKJA 1CWPA 3TN92 1JKRC 5FKCA 3BR2A 3D0JA 2JK3A 3WGIA 4Y1YA 2DA5A 4E7SA 2WWYA 1GP6A 2JE8A 4YGDA 4WXCA 3A4UA 2BOJA 4G6TB 1YFYA 2E9QA 1P7JA 2VQAA 4URTA 3S2HJ 4D6RA 1GWLA 2IXLA 1RUC1 1BJZA 4JBAA 4L8QA 4G7ZF 4B29A 3ASNH 1PK6A 1FSHA 3BODA 2XAJA 5D8AA 2ET1A 1B72B 2COMA 4KT5C 2WFF2 2IZWA 4XUPA 2TUNA 3JR9A 1RUH1 4Q4X3 3PUAA 4OMZA 2KM2A 1DBNA 3OGRA 2XLAA 2XJPA 4L0ZB 3DEWA 1WBLA 3VBUB 1P4AA 3SEEA 1VQ5I 4YGCA 3VBOB 2O1QA 1WCUA 4H3WA 4ENJA 5FP9A 3P9CA 1L0OC 2ZMKA 2EFNA 3A23A 1VR3A 4LHSA 1QVTA 1IQAA 2DFCA 4FAGA 3K6GA 2JDMA 1FP1D 1QJX3 1DLCA 1N3QA 4LT5A 3T5XA 1UD1A 4M4RA 2DCTA 1NUKA 2R49A 3R4KA 4Q26A 2WZ8A 4M71A 1IXCA 3TEWA 1DU6A 3H0OA 5C9AC 4MTEA 2LKSA 2W85A 5A2QK 3RZHA 3FHAA 4D3WA 1EH6A 5CKQA 3J8F1 2W95A 2MA3A 1RB8G 4CCCA 4XRFA 3LSTA 3DKYA 1X50A 4DNYA 1GOHA 3WG3A 3OPWA 4XR6A 5JSRA 1R081 3ZSKA 4IV1C 1S4CA 2V09A 4PFPA 2RQQA 1E2XA 3N36A 2JX9A 2WZR2 2GNTA 3ZSLA 3AMHA 2O03A 4ASMB 4NRQA 1F35A 1UCRA 3WW2A 1IQDC 1SLCA 1ZGJA 5JOZA 4CDXA 3TEXA 1B9NA 1VBB3 2PAKA 3B94A 3T8TA 1IZ3A 1DU0A 5FYHA 2RS52 3FHIB 1Q56A 1OISA 2MEV3 4M74A 1UF2C 1WW5A 4JGZA 2FDIA 1FX5A 4QB2A 3HQXA 4QKNA 4CDWC 4D94A 3Q8FA 3LL7A 3PQJA 1QOOA 5HNFA 1Y4WA 2P6TA 3B5LB 2MH2A 3ZDSA 4MSVA 4Q4Y3 3JCUC 5GPCA 2BU9A 1JJ6C 3EETA 2QZ3A 1VQ7I 3K4AA 3WLUA 2XH6A 4XOPA 2X29A 1W04A 1Z3XA 1HIXA 3FL7A 1WBFA 2QQNA 2L9RA 2IS1A 3HM5A 1ND3C 3W2AA 3BVCA 3GLXA 5JXGA 2L01A 4NAMA 5D1IA 1FJLA 3TKYA 1IS4A 1SQ4A 1ITYA 2IWGB 3M1HA 5J48A 3CC2I 2D98A 3BIEA 4D7YA 5K4LA 2LM3A 4B4RA 1W6MB 1ASJ1 4UUVA 4LIUA 2PAEA 1S29A 4IVNA 2KR2A 2X1DA 2VBBA 3TOAA 3O1PA 5F6FA 4MVTA 4IF4A 2ZEZA 2YY1A 4U7BA 5KXEA 4IHWA 3BCAA 3ST7A 2EV0A 1MKMA 3SFZA 4JTNA 4QGMA 3DEUA 1VQ8I 5AFBA 2ZGUA 3A0NA 4IO9F 2RVAA 1QJFA 3TRSB 2R071 1JUPA 3QAHA 5KC5A 2IT0A 4WM7A 2MHFA 1HX6A 2M9HA 5DUKA 2KRCA 1BVP1 4KFCA 3OYIA 3VBRC 2D45A 4W50A 3VFZA 1GFF2 4GB33 3NV3A 1XSDA 5IOZA 4KMQA 2Y6FA 4YELA 1QNYA 4CZCA 5CKNA 4IL7A 4WM8A 4IE6A 3K77A 2VUDA 4LMYA 1EJ9A 1RXGA 4QQHA 4A69C 5K5OA 1S8NA 2VC0A 5F1RA 3HEIA 3I4IA 4TZDA 1W6PB 3MUZ1 2J1EA 4QKFA 5C8CA 2VG9A 5M0TA 1J3PA 3LA7A 3KLSA 5ISLA 4IQ4A 1B8IA 2V9PA 1L3LA 3J7ZI 1MMSA 1HDDC 1JGGA 3NNLA 2IA2A 3PMSA 5JPMB 5F04A 5HLHA 3QQAA 3WW4A 2JMWA 1RHI1 2BGPA 5GAEJ 1HKQA 4HOOA 2RM21 5JIAA 4YRVA 6PAXA 4BJ5C 1R5GA 3K1NA 3SZGA 5A6ZA 2YGMA 4A41A 2Y64A 3Q8EA 2PJRA 4A3XA 4HKOA 4YG6A 2DVFA 2LVSA 5EV7A 2BW8A 4LO5B 1ZGAA 3K1MA 3HOZJ 1Z3YA 1YO5C 3ZFEB 1NXD1 3V64A 3HSRA 2VMHA 1IHMA 4P5OA 2J22A 3NO8A 5A7OA 4LLLA 3RDIA 1ZRCA 3PVNA 1A8DA 4P9JA 3CO6C 2M2EA 1OPCA 3MLKA 4LA3A 1C4RA 4I98B 3F23A 2BP6A 1LVAA 4CGZA 1PM7A 5C8CB 2EFPA 4XLPF 2I74A 1H6XA 3I55I 1MS0A 4AVVA 2AR6A 1G7YA 1TMF2 4MO3M 3HOVJ 3LIGA 1H8TB 4OZXA 3OD4A 4RS5C 4WK8F 4TLFA 2HDWA 2Q4SA 1MDMB 2MD0A 1TNRA 4A6EA 4LK0F 1O3RA 1FWZA 3BZKA 3JCIA 3U14A 1XYPA 4ZTJA 1NK3P 1EPWA 4Q0VA 4AI8A 3PSFA 4NB5A 1BW6A 3MZYA 4P9UA 3ASIA 3RZGA 4XQDA 5DV5A 2GN3A 2ME6A 5F08A 1I3HA 4PK4A 3KB5A 4EROA 5HPOA 4BXSV 2IA0A 1ZN2A 2YR2A 3OBAA 3FKIJ 2VMGA 3V8JA 3PFIA 5BNPB 3PU3A 2HWF2 3D82A 3FKJA 3LAPA 2O8QA 2KPMA 1B9MA 1IV6A 1F15A 1QJX1 5FZHA 1W7PA 1KQ8A 2Y6LA 2WY8Q 1VQNI 5EEGA 4NE9A 2EJRA 5FR3A 1OOPA 1AXZA 1GZWB 4U0WA 2WDBA 5LEJA 2JG9C 3DTKA 2Z5UA 1MR5A 4XF0A 1CF7A 3HOYJ 1XSVA 1D3YA 4IRGA 3NWKA 1F5FA 2FU4A 3GTOJ 1BLZA 2OAZA 1J9IA 2EWNA 4QU1A 4PJNA 4WWCA 4PGGA 1A8MA 4TWTA 3CUQC 3ZQGA 1QF3A 1S0JA 2HBTA 4AI0A 2AEZA 3UK9A 1H8AC 3J26N 4RQPC 4J01A 1V9U1 1DYOA 3JD72 1Y1VJ 4YARA 5EJZB 4QKBA 4P96A 3O2PE 1EV11 4BBRJ 2M87A 3PUHA 3O1MA 4Q8LA 2K2SA 3WODF 2JG8A 1HQLA 3I4NJ 4H7LA 1VBD2 2D6MA 2TEPA 4PSWA 4XE9A 1YG2A 1R091 3RNSA 3O5SA 4FFHA 2OT7A 1W9YA 4BJ0A 3JU9A 1H88C 1L3JA 3K4BA 3MMYB 1EUTA 3DFGA 5BOXA 2QBXA 3AMNA 3DU5A 1JT0A 1FNYA 4AZZA 1REDA 2HXIA 2RDRA 4JV4A 1OHFA 2O61A 2FZ2A 2VUCA 2KJCA 1OOPB 4COWA 1VAKA 4XBNA 1TP4A 4FCAA 3GX4X 5TISC 3PVEA 1IN7A 2C6YA 4B47A 3H8XA 4AOCA 1TLHB 4OAYA 2QKLB 3MW2A 2HDDA 2UWMA 4NC8A 3WNXA 4TSVA 4MFEA 1PVXA 5B2GB 4LA2A 2BZTA 3CQOA 4NHMA 4DNCA 3FLRA 5CYYA 1RUE2 1MBJA 3AL6A 3S14J 1DGWY 1G3YA 1U8BA 4HKWA 1CAXB 1NLSA 5FKBA 1REFA 4FT8A 3LQCA 1KGSA 5KHGA 4NPMA 1I50J 4Q29A 4XQWA 1SFEA 4KI5M 4ZXKA 5J4VA 1WI9A 5GLZA 3BTYA 1ZREA 5FPVA 1XC5A 4P08A 3Q0UA 2DA1A 4I6ZA 3C2GA 2ADDA 4LXLA 1Y0NA 1Y43B 2FBKA 2HEVF 2Y9YA 4XONA 1R00A 4HX4A 2KISA 2K5CA 4YEJA 2MPFA 2VZOA 2AACA 5BYNA 1PIV2 4FXGB 1CVNA 3PU8A 4E4DX 2NVYJ 1RPWA 3WE3A 1OCTC 4IRHA 5DAXA 5IHRA 2OQRA 5T5LA 3QD6A 4HPQA 3B02A 5KHIA 2VR4A 1LULA 3ZPOA 4I0AA 3BJ6A 3AKRA 5KAIC 1RUF1 4ZKTB 1MZBA 5IVBA 4CDUB 4ASLA 4G9SB 1OUXA 5LRSA 1AWCA 2FXAA 1KRIA 5GP9A 2HQRA 1EUUA 4AM3A 3ZYRA 5HDKA 1WJ5A 5DCFA 5FMOL 3JRHA 4ZC3A 4LKDA 4CPBA 3FJSA 5C3SA 4XKCA 5AC93 1DP3A 1W28A 3UYJA 2LD5A 4ENMA 3NARA 2E26A 3CCRI 2E1MB 3M7GA 3G7DA 5FPZA 2P6SA 1U8RA 5J8CA 2LRPA 1SVLA 4YFZA 2KXLA 4SLIA 2P3YA 1OCPA 4YW2A 2ZZQA 1APLC 1SACA 2VCCA 4YW4A 2PMWB 4IV3C 5BNGA 2VNVA 2PHXA 3AMQA 3IMNA 1RVF2 1YJWI 5KCMA 1D0HA 4TN7A 1QHHD 1LU1A 1FPN1 4FPYA 3ZQCA 1FLIA 2IFRA 1JUHA 1OI6A 2JUGA 4PDWC 1M06G 1H9PA 3MICA 1U12A 2XDVA 3RFRA 3OL3A 3NRVA 1BCXA 2ETEA 2DO7A 2WO3A 4ORFA 1BXHA 1MEC2 1PMHX 1W8OA 4B3NA 3RCOA 3SEQA 3ZXEA 5J1XA 4U87A 2V1DA 4XTPA 3FUOA 4L5EA 3VODA 2R7RA 2QQJA 3S2WA 2R0QC 2YU2A 3WW3A 3HJRA 3J8F3 2D3PA 2FNAA 4K1YA 3QYFA 1NLQA 2CSOA 4NC7A 4RA2A 4LITA 3OY8B 2W1WA 1VMJA 4YGEA 3J7AO 1UYYA 2PHTA 2VPVA 4ATFA 2ADUA 1U6GA 2FCUA 1FEXA 1NCRB 5B66C 3HNYM 3KZIC 3IHUA 3VN4A 2CDOA 3DP7A 1Z77A 2BBAA 1DG6A 3MIBA 1FV3A 5A6QA 2E51A 1QJY3 2OF7A 2BNOA 5JXHA 3D5LA 3FFZA 2CUZA 3F2ZA 4I3PA 1CESA 3W5MA 2UZKA 5IT6A 5J47A 5BV6A 3ZN6B 2XJSA 4FQ4A 3ZKYA 2A05A 1CONA 4QHBA 3O1VA 2XASA 3KYDB 3CJIC 4LOCA 5L9RA 4A3DJ 5JZGA 1TZOA 2R1BA 2ZKZA 2CGOA 2NM1A 3UR3C 1ZQ3P 2AHQA 2K40A 4D0QA 3WNPA 1I39A 1R36A 2I45A 2FDGA 4QMAA 4EQQA 1PMIA 3H5RA 2YU9J 1LDDA 4R4XA 5LY2A 1ETVA 1NK2P 3BG6A 1AXYA 2GALA 3WF4A 1D2SA 1ACIA 4P9IA 2H09A 3AKSA 2EIKH 4Y3OA 1O7LA 2HWE3 2LALA 1IAWA 3Q9VA 3MYXA 2ZX0A 4Y20A 5IK5A 2ZJCA 4NIIA 2WAEA 3RSJA 1TVGA 4RM2A 3CBNA 5FOBB 4OWRB 1UZZA 5FJ8J 4IEQA 2BXYA 4OQ9A 5EQUA 1JTYA 1COV1 1ORKA 5KC6A 1NE6A 3K3OA 1YNAA 3ZMDA 1TC3C 1SANA 3LFUA 4Y4YA 3HT1A 1OFCX 4MV2A 2PHUA 1LDKB 3WNOA 2ADEA 3M8JA 4PI0A 3SH4A 3FLPA 2UXNA 3MWMA 3O0WA 2IC1A 1Z21A 3HAGA 3TB0A 3MKWB 3POEA 4Z1VA 1K4SA 4I0BA 1LB2A 3HOTA 2HEOA 4CDQA 2JPBA 4U0YA 1XNAA 4XILA 3KEQA 4D69A 5TRDA 5T5PA 5HS9A 5H20A 2P81A 4KBZA 1PNGA 2XKPA 3TYJA 3H9GA 4BJTA 1QOTA 3IC7A 1POV3 5ERIA 1GNZA 1JKOC 1ZVFA 4A3LJ 1DQ1A 1NZCA 1V00A 1XDSA 4KIFA 4KICA 1C5IA 2CW8A 5DD4A 1LHOA 2ID3A 3W58A 2BFUL 5K7PA 4COZA 4CCOA 1UG2A 4JHZA 3BZCA 1GANA 4CDWB 4GULA 2XF7A 3JUUA 4PSXA 3HN3A 1WGPA 2ICWG 4CXWA 1K61A 2RV8A 3P3PA 3AB0A 3OS0A 2IS2A 3VBHC 1TWAJ 4KNYA 3TP0A 2CFXA 4PBPA 3LCPA 1LU2A 4Y52J 1RUG1 1SFKA 3T3YA 2HTJA 4Y5Z0 4WBBA 1J3QA 4XICA 1W6NA 3UGFA 3T0BA 4IQPA 2Z1DA 3A22A 1RNLA 4CHUA 1IOAA 2LFBA 4QSHA 2Q5TA 4LG0B 4CDGA 2LKXA 3LFIA 1DIWA 1IS3A 4CE8A 2WNVC 4PCRA 2BJSA 1GKBA 4UW3A 1E5RA 1A6QA 3PURA 1LHNA 4B8EA 5JSPA 1GMMA 2ARAA 5LASA 2WAQA 1Z6RA 2H1KA 3HUGB 4OI2A 4JTOA 2VC9A 5C3RA 4CRQA 4O6JA 1IS6A 4RS5B 1KU7A 4AG4A 2MC3A 2VN2A 1UAIA 2YBSA 3MIDA 1X4OA 3M3YJ 1ZLJA 3CMYA 3CCSI 1R49A 1YS7A 2P6HA 3RSNA 3ES1A 1NG0A 3AX4A 1PZ7A 1WA6X 3M3EA 5FPAA 4XJAA 4BQXA 2DA4A 2OUJA 1ACCA 4XSZF 2HYKA 5CISA 4AI2A 2WL1A 5E8IA 3HN1A 2HYJA 1HKTA 1MQTC 2IEKA 4R9AA 2XQRA 3ILFA 1UX6A 1ZK8A 2LMDA 4A44A 3AC0A 5IK7A 2F5CA 4CVUA 2JG9B 1Y8RB 3CMEI 2BNMA 1WZXA 1EH8A 4UF0B 1FATA 3MBWA 4HLTA 3ZIWA 2R073 1H2NA 4WZFA 2VZQA 4NBQA 4Y24A 2GXAA 3OYDA 1IRGA 1WA4A 1V6NA 4XURA 5J8FA 4C3JJ 3NV4A 4NC6A 4AXOA 1C0WA 1VRBA 4NAOA 3ML6A 2VM9A 1C1FA 2QBYA 2OVUA 2Q2EB 5C4WB 2P4WA 5FWJA 2L5QA 5FLMJ 1HB3A 5DEQA 1Z0HA 3B93A 4ITCA 4HQEA 4BWOA 1D4VB 4K8RB 1LFBA 1XGSA 2WNUB 1S6LA 2ZHNA 1MIJA 1PNFA 4HG6B 3NAUA 3H92A 1D2QA 2FDHA 3F9KA 3G1LA 4EMSA 2QQUA 3M4OJ 4FSJA 4A0XA 3CTAA 5K0UA 3M3OA 1MSFC 1G4DA 1AVBA 1E3PA 1OMIA 4MGYE 4F3QA 4N4OB 1OYYA 2R92J 3URFA 5IP9J 4KMFA 4IHXA 3O14A 2G7HA 3WGHA 1HB1A 4UVAA 1XC6A 3C18A 1YE9A 2ZXQA 1I6HJ 3OYGA 1OKOA 3ZYIB 5FP7A 1EV13 1Y3TA 3N7KA 2PELA 3S15J 4EYUA 3BYWA 5JLXA 1AOYA 4LKFA 4ISRA 3BOQA 3QP5A 1RITA 4HBLA 3RS6A 2HWF1 2A69F 1DGRN 1XB9A 1AXKA 2EFQA 2FBHA 4XSXF 2JDPA 2VMCA 1FOWA 4QX8A 1GWMA 4NOTA 4HBNA 2RC4A 4BIOA 2L4MA 3ME2A 1QPMA 5F0HA 5J37A 1AYN1 3NRUA 2DDUA 1SFNA 2TBVA 4P9YA 1FTZA 3T2TA 4DOZA 1LGNA 4A6SA 5E3MA 4RR3B 5K7HA 3COAC 1H4GA 4HEA2 2ACJA 4U7DA 1OQ1A 4N53C 4LBMA 4GWNA 4HL0A 1QQP1 3OYNA 3RQ0A 3GJBA 4CCJA 2YFZA 1SBFA 1OF3A 2ZHMA 3JB8A 2YX7A 4KU7A 1YX3A 4C2TA 3ZPLA 3OBTA 3WXPA 1HB4A 1ZYBA 4BQ1A 1VQ4I 4PJYA 2ZS6B 2ZO4A 1JYWA 1FY7A 1AYM3 5M5YJ 3BWGA 1CQTA 5FXZA 2VT2A 1UJ8A 5JLWA 2G7UA 3PUQA 2CUFA 1BVVA 4YW1A 4II2A 3VEPA 2NZ9A 4DUXA 2UURA 3T30A 3OY9A 3KYCB 4UHTA 4NWWA 4KU8A 2LK2A 1QXPA 4ABZA 1R1UA 2M30A 4QXCA 1WCQA 1BBYA 4HANA 2HVRA 5JZGB 2DMPA 1Y1WJ 4GMP1 2CSGA 4CYCA 1SBDA 1FOKA 3F72A 4QD2A 1OKQA 3ITQA 3SDBA 1UPIA 4XF9A 3HGYA 2IBDA 1WLWA 2K46A 2WA0A 2BEOA 1W90A 2LUWA 2R7XA 1SLBA 1FOD1 3CCQI 2CV1A 1YLLA 4XIKA 4QXHA 3VL8A 2PMZN 2XB6C 1CAVB 2DCEA 2VOPA 4Q4W2 3NMBA 2VBWA 4MEYF 5DM6F 2R043 4WZCA 2KMUA 5LWBA 1OYIA 3PQKA 1JYNA 3HOWJ 2ZXWH 4MZUA 1AF9A 5L3BA 1DZRA 1RUI3 5J96B 1RI7A 4O7XA 2CDPA 3ASOH 4A6DA 4QXBA 3S2DJ 2ZX4A 3ELKA 2WSVA 1CX1A 1PO21 4V2VA 3PO3J 3I3EA 3ACHA 3SC7X 4F52A 1ZH5A 4M3DA 1YFXA 1I5ZA 2DFEA 1VB4A 5A6XA 2HS5A 2BPA2 1UMIA 3LOBA 3OSFA 1AJKA 2VBZA 3B73A 1USSA 1N47A 2JRTA 1KFUL 3HR9A 4HN1A 4YVWC 2CWEA 3KM5A 3WNMA 4C30A 3GCXA 2LYCA 4D8MA 5FZ8A 3WTWC 4M4PA 2NOJB 3O8GA 2LY2A 1QDOA 2ZAHA 5FZ1A 1GOGA 3MEXA 3K4KA 2CU5A 3P3NA 3OYHA 1R6RA 2XPJA 3Q9OA 1POQA 1Q3EA 1Q8VA 1GUUA 4KWLA 2PBIA 3EQEA 2WINB 3CCUI 3NKTA 3LOIA 3CUOA 2QSGX 1FI2A 1ZBE2 1X1AA 4KUMA 1JHFA 3GUDA 2YU1A 1XGNA 2D6PA 5DAPA 4M73A 4CTEA 2R7VA 1WSUA 5HCAA 1PK6B 4A3EJ 1X7NA 3OR1C 3WTYC 3S7EA 3U4SA 3K2AA 3OUJA 2CRGA 4V2WA 2VECA 2I07B 1Q43A 4C1XA 3CDHA 1HRV3 4GH4C 1LGCA 2L7MP 4YW7A 2R5YB 3S6PA 1XCVA 5F64A 2I5UA 2RGVA 1KYWA 2LREA 1R23A 1ZA7A 3RJ2X 3AZZA 3DEMA 1C57A 3WF2A 5B1BH 1UOBA 5F0CA 5KVRA 4RGUA 5A1FA 4G4FA 4WM8B 4QPQA 2RS33 4LG0A 2OQGA 1TWFJ 2ZMNA 2VIXA 3LA3A 4O9GA 3VV1A 3ZQLA 2WNOA 4HETA 1CAXA 4ZU7A 2E36A 5C9AB 3E3VA 2P7VB 3CDLA 3HQRA 5KHDA 1XSXA 1SC7A 1ODMA 3B00A 2WNVA 1QJU3 2VCMA 4BQAA 1S2KA 2WT2A 5KHJA 1A36A 5FTTC 4IEVA 1G86A 5FZ6A 4IHYA 4PT6A 4HPKA 4ATEA 2X48A 4V1PA 4HZFA 4MG2A 4WM7B 4RMNA 3J9SA 2QA4I 1XB4A 2JSCA 2VODA 5GZCA 4YPJA 5JI9A 4AI1A 3I3MA 5J4YA 1TWHJ 2JZYA 1K3IA 3POYA 1UZWA 3W21A 1W1WE 1W7PD 4E70A 5E88A 4DB5A 3I2GA 4V19K 4LBLA 2W00A 2WWJA 4HG2A 1HA8A 5KK1A 2WJSA 3AJZA 2O7OA 1TME3 2DN0A 2A71A 3CCMI 1QKQA 4Y5TA 4OUSA 4GJYA 1LHVA 2CH0A 3OYEA 4FOVA 2OYZA 4KDPA 1IPJA 3OF1A 5DPNA 1X82A 2DTWA 2VAUA 2GMEA 5FLVA 4YZ1A 1D8KA 3ZFFA 3BPZA 2HWF3 4DRRA 5K0UB 3VUOA 3PL8A 2DW4A 2AREA 3RQIA 2Y2ZA 1GNYA 3FMGA 5CQGA 1VQ9I 2ZGOA 5HCHA 1S0DA 2XBO1 2LW8A 3DPTA 1IZ1A 4FBFA 3QYEA 4I2OA 2NQYA 2DOFA 4KGQA 3T2QA 2V1NA 5CYVA 1OFNA 3SH3A 5EGOA 3ZX7A 1OA4A 4Q8KA 2ZMEB 3ZMSA 3A1YA 4A45A 1Q1HA 1W6MA 4UFJA 2OZUA 2XVGA 4XZUG 3GZEA 4COUA 2UV1A 4EE2A 1YFHA 4YVSC 3I53A 1MPXA 5FROA 3KV5A 2VQHA 2D1VA 3HC7A 2WIIB 5F5CA 2W47A 2QFEA 1W9WA 1US2A 3IWZA 1JJ8C 1LPQA 1X58A 3AKQA 3AM2A 4FETA 4RGKA 2B9UA 4YLZA 2YHJA 5J1RA 4JKKA 3ZYPA 2KRFA 2PLV1 3ZM8A 5HV4A 4CP9B 4ZS2A 2AZ5A 4AUXA 2MGQA 3ZMVA 5FK7A 3POWA 2W94A 3FBYA 4Z92B 1H8TA 3OCPA 4BE2A 4QQ2A 3FXMA 2ZA9A 3OS1A 2OUMA 5FUNA 3GCMA 4AFMA 2A5WA 1OSGA 3CDZB 1DQ5A 3V56A 4QX1A 1LJ9A 5D8AB 2VMIA 2JJ6A 5LHGA 3V0AB 1UY4A 4ZDOA 3DU6A 3PVBB 4AYUA 2JWPA 3VDAA 3LSPA 4IUGA 3KQ4B 2VZSA 2DVBA 1H9WA 4GGGA 3RVHA 2QQMA 2PHFA 3K4DA 3OD0A 4IEUA 1HCRA 3FWEA 2G19A 2W84A 5GAGJ 2J1TA 2AC1A 3EUAA 4GCVA 5L3CA 2ZAAA 2A6TA 4AYBN 1M1EB 2F5EA 1B59A 2C9AA 4NROA 3HZJA 3C7HA 4A3BJ 3IUOA 2BWCA 2L7ZA 4BKXA 1LVKA 4E9KA 4ZY9A 2ESNA 4DS0A 3OUHA 2M45A 1XNBA 5ERLA 3LA2A 3VBFC 2PQ8A 4XDQA 2P7CB 4JCKA 2XVKA 3PLQA 3RI8A 2KJBA 2ZGQA 3CJIA 3ECHA 5CPRB 2MYSA 4BS9A 5CVVA 3KP5A 4BYYA 4EJWA 2V72A 3JBG2 1RKWA 5FO8B 1R9TJ 5H9RA 3LPFA 1RZ4A 2JD9A 3VBUA 2E53A 4OAZA 4XLHA 2PN6A 2YDEA 3PDQA 2OPWA 1S0EA 1LESA 3BU0A 3GLLA 2G0EA 3JBG1 2E5ZA 3R4SA 3ZDVA 1WD4A 3ZP5A 2E31A 2OCCH 4DXZA 1BK0A 1Y9GA 4IERA 2HH9A 1G3SA 5C3PA 1PO12 3ZMNA 4FX4A 1OT5A 4F93B 4B8XA 5JFRA 3UKNA 1Y39A 4NJ4A 5CADA 1V6OA 5L73A 5BNOB 2ECCA 2YBKA 1J3RA 1EAH1 2JB8A 4M3CB 4YNIA 3ZFEC 4C8DA 1D7PM 3C1DA 1SFYA 4YGBA 3VSKA 2XLFA 2NMOA 2OPTA 4EQVA 4LB6B 2QQWA 2YX4A 4B1MA 2E35A 4Z2AA 3C2UA 4CICA 2XAFA 4JYKA 4B3XA 2JDNA 4OINF 5CA6A 2HWD1 2DFHA 3I8TA 1CQ9A 1TW2A 3BTJA 2ZNYA 3HSEA 4IHTA 4N43B 2LRDA 5A3LA 1A6IA 2BFUS 4AIHA 5J98B 3ZSJA 1DP7P 2LSOA 1GV9A 4XCBA 5F3EA 2QE3A 2JG8C 2IVMA 3GM8A 1FOYA 4R4ZA 4LO8A 1QZEA 2R7DA 1D5VA 1QIQA 4UT5A 3V42A 4Y26A 3GNEA 3BG7A 4PIYA 1WW4A 5IUQA 4HVOA 4LR4A 2K7LA 2MABA 5I0TA 3ABKH 3RZKA 1ZBA1 2J42A 2RS31 5HODA 2X5IB 4IW3A 2BQPA 4RBOA 3IIIA 4KA4A 3WQ0A 1OLME 4JVAA 1O7FA 1J75A 2XPVA 2LC2A 1Q8QA 2NAZA 1JYVA 3QRFF 1SBEA 2VZ3A 1GWKA 1RMU3 1R1VA 1XX5A 3S7IA 3J8F2 3JD73 2Y31A 1QJU1 5FZAA 5IW0A 3THDA 4BBSJ 5FGMA 4MGSA 3MO4A 1JZ2A 2RR13 1G9DA 5FY9A 1MGTA 2M3AA 5FFXA 1JZ5A 3UNGC 2CWMA 4XAAA 2X5IA 1SG3A 1JYCA 1UCXA 4OI0A 1YWKA 1JT6A 5F3IA 1KU2A 2W52A 4XJUA 1S7EA 3FHNA 5CZKA 5GALA 5FREA 4DJAA 2GWRA 3KPHA 1HKSA 1KONA 1X33A 2R7WA 2WO2A 4Y33A 5CNAA 3ZQIA 4U0VA 1EV12 4EZHA 3KEOA 1IG7A 4E6KG 1Y7BA 5B3SH 2P3IA 4O65A 1Q8OA 4UUTA 3BC8A 2EK5A 3K0LA 2VW0A 2ZGPA 3KGLA 3RZZA 3O8HA 1O8SA 1NCRA 3M3QA 5DUIA 1UAAA 4YFNF 2VXJA 3SHRA 1QRYA 5FDBA 1K6YA 4IOAF 5DG2A 3BTCA 2R6QA 4K6BA 2ZACA 3HBKA 2A3WA 3ZMZA 1AKHA 3QODA 3AYEA 4U36A 2HKOA 2MLGA 3B01A 1R083 1V4RA 2R7EB 2GMMA 3QPLA 1WKMA 3WUDA 3SEPA 3KT1A 3I2IA 2M4GA 1YC61 4CDUC 4EATA 4P5HA 2NP0A 1TWCJ 2YC2A 4JDNA 3SYTA 3Q9SA 3CLOA 4INDA 2DDAA 3WF1A 3JQWA 5C33A 4CZZA 1S2EA 4UB8C 2X1EA 4CXFA 2NVUB 3GZ6A 1PVC2 5GADJ 3BTXA 1JUSA 5C71A 4QDQA 2E7AA 2DFIA 2AS5F 3LNQA 5H9SA 3WCSA 5BXXA 3B69A 4ZH4F 1VPHA 2WKKA 2XAGA 3PNYA 4G7OF 1IG0A 1TZLA 1P8JA 3WT3A 4FHTA 2O8XA 3EPZA 4PF5A 3F6VA 4C91A 2B9VA 3E1SA 4I99C 4RGRA 4B7EA 5K8SA 1D8JA 5FYCA 1OCRH 3FE5A 2RE9A 4U2AA 1ONVA 3DECA 2E1CA 1UELB 3L2YA 4EM0B 2GZWA 1YEWA 2RM23 5D4SA 4BK5A 1X1DA 1LCLA 2VE9A 3R61A 1Z7LA 4QLCU 3U1KA 4RQPB 5DUXA 1KU9A 4BXUA 2W1SA 3EJKA 3CUQA 2H0VA 1LE8A 5L7OA 1QXRA 5JVGF 2VVFA 5C4XJ 3BR5A 1YQ2A 4RS5A 1YOVB 3LZZA 1FT9A 4AVCA 2L9VA 4UV9A 4XKBA 1DPRA 1BMV1 4BH9A 1FIAA 2LKPA 4WM8C 4BIFA 1WJBA 2AQFA 2EFWA 4KT6A 2WRAA 2EZIA 3RJRA 2GP5A 2MFZA 3HRTA 1J1LA 4M3CE 1W6OA 2CWSA 3ON7A 4V2GA 4XMAA 1FX7A 3VDDA 1FP2A 4WV8A 4K9SA 1IN8A 3V8KA 3J7MA 3G4SI 2JE7A 1FTTA 3OUIA 1LEAA 2SBAA 4MH0E 3E0JB 2VI6A 1HW1A 1S72I 1RR7A 3L2UA 5LA0A 3OGJA 1JYTA 1T08B 3LSJA 3VBRB 1RUNA 3FXOA 5EYXA 4ZZ8A 4BB3A 4HLYA 1MACA 3WNKA 4UW6A 4IJAA 2Y0IA 1AU7A 1QU0A 4QKDA 2E7XA 3V7RA 1KDMA 2RJKA 2ILMA 5D5XB 3CEWA 2CAUA 2BVMA 2HZDA 1GBGA 1RJ7A 3WHTA 3USUA 4ZU4A 4FAHA 1A35A 1G9CA 2D1HA 2E2IJ 1B6AA 1VAMA 2Z69A 4P9GA 1PUEE 1BBT2 5DDJ3 5I93A 5A33B 4FPJA 2STTA 4YVWB 5FCCA 2CNAA 5ACA2 3IP4B 3FHZA 1KXGA 2EIGA 1C8M1 3LWCA 5BS6A 3TO6A 2KD7A 5EHDA 3KGZA 3DBLB 1ND3A 4XJZA 5GLWA 1RVF1 4EN6B 4B1RA 4ANJA 4IEYA 3BQYA 1VQMI 1H1IA 3WG2A 5IYBJ 5L3DA 3ZQFA 3ZXFA 4DYRA 3J7YJ 5F1JA 3EB7A 2DYSH 1KFXL 3N9PA 3JRDA 1F5TA 3P9KA 3OPZA 1OD5A 2PA7A 3KVBA 2D93A 2MD5A 2KLOA 3D3AA 5CAZA 1TME1 2ZGKA 4HT1T 2Y33A 1ZLKA 5FO9B 4EGZA 1FMD3 1Q5OA 5F2SA 5F3CA 1ZZBA 3MN2A 3ACGA 2MNGA 4BQ3A 4UBHA 1FMVA 2O0YA 3ZQQA 5ICFA 5IPAA 3A03A 4Q48A 1LGBA 1NTCA 1IN4A 3AP6A 4M01A 4COVA 3VPRA 4NHYA 3ZYJB 5JSOA 1UKGA 3KP6A 4AC0A 3FK6A 4UB6C 4M00A 4I76A 3N3HA 4LE3A 1VI0A 2DT5A 3SXYA 3HGGA 3OL4A 5BQTA 5FPBA 2J7MA 2L54A 4Q1PA 2W7NA 3LQQA 2YC4A 3PNVA 2E63A 2QQVA 3HRMA 1XSRA 3WNNA 5BMZA 2YG0A 2WQ8A 2MEV2 4BDYA 3MF9A 2WAOA 2WZR3 4C0HA 4H0EA 4HSTA 3L9JT 1U5TC 5JPNB 3DEEA 1UOGA 2WFPA 2XGXA 3ISPA 3L2QA 2RDNA 3POSA 5M5XJ 4UFMA 2Z33A 5C9AA 2HQAA 3FZVA 2A6EF 3TAYA 3KWVA 4HNVA 4AQTA 1VBD3 1TT0A 5FRNA 5SV5A 4H2AA 3VHNA 5IK4A 3MFAA 4KWUA 4DQ2A 3H0DA 2DBIA 4RB2C 1UOJA 2GIVA 2K9MA 3VHOA 1BEV1 2WO7A 4MQ9F 2CG4A 2M8GX 2A6VA 2BY0A 4NIGA 3DTEA 3PUIA 5I91A 2WS91 2JXAA 3WHUA 2P5VA 1UQXA 2V1UA 3NNGA 4Q4Y2 4XKVA 1FAYA 5J6XA 2OQ7A 2ELHA 3EBRA 2HWB1 2A61A 5K7ZA 5A32A 3GF2A 1BA5A 2UYBA 2HNHA 2L7KA 3PO2J 5FY5A 3N9MA 4FQGA 1T0FC 2KKOA 1BR1A 3ES4A 2XR4A 2EZHA 5F9TA 5FPUA 2D43A 4Q0SA 4DINB 2RG4A 1U78A 2ZC2A 2XHKA 1TEIA 1O57A 1KZHA 2B45X 4ZZDA 2WAQN 1MS9A 4AEMA 2YS9A 5FP3A 2C4XA 4FPOB 1WMEA 4E4HA 3C2BA 3AP5A 3H1CA 4N9IA 2A07F 1ETYA 3NQOA 4BL0B 1T38A 5AC91 2Y8KA 3MI8A 2JIGA 3AXEA 4W6YA 2A5YB 2HWC2 4HX8A 2DV9A 5T5JA 2ZEXA 3DPRA 1UL9A 1RUJ3 4QWQA 1D5YA 2WNUA 1UU6A 1FSEA 1WPKA 3GFMA 4CSWA 4CXXA 5ICCA 1U5ZA 1R71A 3OYMA 2DF7A 3CJTB 4YVSB 3O1UA 3Q0VA 1W9FA 4WXHA 2VLAA 4X6AJ 2CY6A 1SEFA 5L3GA 1PX3A 5HVQC 2VJXA 1W2UA 3C7EA 3PSIA 3U0ZA 1FBUA 1VQLI 2VZPA 4FTBA 3GTPJ 1ZZ6A 3IB3A 4HVQA 3CF2A 5EFUA 3B7MA 2CQKA 1X3WB 1VQ6I 4S2FA 1ENHA 2UY8A 1ERDA 1ZR2A 2RAEA 5LZ6A 3BCBA 2WNEA 5IVEA 2V4VA 5AONA 2X85A 1W4MA 2O6GE 1LOEA 4XHBA 5EGOB 3M8FA 5AVAA 3ZFEA 1BZWA 2ARCA 3LEGA 4B09A 2HPMA 3PL0A 4HK8A 2PMHA 2XONA 3ALQA 4XQ4A 4MHGA 4RYDA 4A2UA 5FBJA 1HSTA 1H9GA 1K5MA 1UMHA 3HKZA 4JRAA 4N43A 4FPGA 1G9BA 1HQCA 3CZ6A 2VMDA 2QZ8A 3EUKL 2R042 4XLNF 1KU3A 2QKMB 1RUD2 1T95A 4CYCB 2ZZJA 4OFGA 1K78A 4YIRX 3ZR5A 3W6VA 2IGNA 2EIEA 1U9NA 3HQUA 3RPUD 1KQ0A 1NCRC 1UFMA 3FIWA 4EJUA 2Z4FA 4D7TA 2E33A 2WADA 3ETQA 4FOYA 1R1TA 4LG3A 1A31A 2BYVE 2IFWA 3C3WA 4BE3A 4MGTA 3IDAA 5DUWA 2W9XA 2ZXIA 4ETSA 2IAIA 4AVPA 4ENNA 1WH5A 1ODDA 5K5RA 2Y6KA 1LOFC 5EIYB 3OR2C 4G7HF 1YHQI 2FD8A 2NS8A 3PMEA 4EZ4A 4DZPA 1DCSA 2FMLA 3CQZJ 3E6CC 5LB6A 3H36A 1MVEA 3LOCA 3CKHA 3THTA 1CF7B 2VL8A 3OYKA 2WWSA 4YZ3A 1YJ9I 1ON2A 4CEYC 3OPTA 2JKBA 1XCBA 4A3FJ 2Q0AA 2PXJA 2GN7A 4CPBD 1C8M3 5F3GA 4CP0A 3CCJI 3OYLA 3K4LA 4ENKA 3P5BA 2L3DA 2ZFWA 4QPWA 2M34A 2BY1A 1T8IA 4G8XA 5AFEA 1QNTA 1ZBE1 2VZUA 2QSFX 4XTMA 4M6VA 2CO5A 1J2XA 4NQWB 3D5OA 3O7OA 3E5XA 2IXCA 2Z79A 4QPIA 2FJ1A 5FZ4A 4L5JA 3W2WA 2K9QA 4JGYC 2HWD2 4BACA 3ETPA 2JVGA 3DBRB 2WV0A 3G1OA 1SLAA 2VKEA 2Y75A 1SCSA 4I7HA 1VMHA 4XPVA 3HPHA 3OBRA 4YRDA 3SCHA 1PGSA 1QJU2 1H2MA 1R4NB 1UXZA 3IV5A 4AGRA 2WBMA 2XAHA 2BZDA 2IW5A 3P1IA 1FYUA 1FYLA 3VDDB 3OYFA 2XUMA 2JN6A 2A6HF 4YVSA 4HA8A 5C70A 1KGYA 1YYNA 2FQ3A 1HKDA 1VBE2 2VT3A 2VO5A 3TN91 3OG2A 4LK6A 1VAVA 1NA1B 3ZSEA 3QP6A 2VOWA 3Q3SA 3GFJA 3L7WA 4LLFA 1W05A 1A78A 4BQ5A 3CC7I 1QJY1 1ZZ9A 4K8FA 2WN3A 2DQLA 4L9NA 2W5FA 5E8GA 2VD7A 3DPRB 3RGBA 4CCKA 4N9HA 4KN4X 3J7AY 2DTYA 1R5ID 1D1BA 1Z67A 2VXZA 1H1AA 1UU5A 3RWKX 4AHZA 3DTIA 4CDQC 2E7TA 2IXSA 1X3UA 1A5JA 3T08A 3CZJA 4GWIA 3EXUA 4QX2A 3LSIA 3FMQA 4QXKA 4JZRA 5F7UA 2NNYA 4RD7A 3ZXJA 1S0IA 3VBFA 1TTYA 2BDRA 3DN7A 4UFHA 3USSA 4KMUX 1VBA1 2FOKA 3APBA 1BM9A 1I1SA 2DA3A 4N90A 2CFOA 2DPDA 2XJQA 2A75A 2QYOA 4HFSA 3I2JA 5F6LB 1B35B 3FBIB 2VBXA 2B39A 2QBYB 3CLPA 3H3ZA 1RMU1 3WF3A 2Y69H 2JA5J 3BUCA 3EYPA 4HRIA 1VRH2 4ZS3A 1W6PA 2K27A 1JZ8A 4BHBA 1YQ6A 1JMUB 1XRUA 2GDFA 3LDBA 3M4FA 4Q4ZF 5H9QA 3SNMA 4XOGA 2PYTA 3AP4A 3GZNB 4A7KA 4LOTA 1MZ5A 1R082 3RMYA 1F9NA 5TSWA 2ZHLA 1U5TB 2DA2A 4JX0A 4LD5A 5J3LA 1AX0A 3ZXGA 1ZHFA 5LGUA 3WGGA 4E7IA 1PZ8A 2R1DA 3A7QA 4QPIB 4IGQA 3OY8A 1ON1A 2CV0A 3BR0A 2V4JC 2DDBA 2KDZA 4Q27A 1ODNA 4S2HA 1BBT1 2E2JJ 3CNAA 3BY6A 3S16J 4DZJA 2H6BA 2XB0X 5A7WA 4AEDA 4XL9A 5D5UB 1HJGA 2JA2A 1VQKI 1G2HA 1LTEA 1UZYA 3RKWA 3BTIA 2I10A 3ZXKA 3HNBM 3ROUA 3BTAA 1LNWA 3RZMA 2ZABA 1SD5A 3KZYA 1WQ2A 2P5LC 3MV11 5T54A 1XPXA 3U37A 3OS2A 4AF9A 2FD5A 1BJQA 1W3VA 4L11A 4BLJA 3OGVA 3ZIXA 2HYXA 3I3BA 3KETA 2QQKA 1YFUA 4CXYA 5APAA 1MW7A 3MEPA 3HD8B 2E1OA 1RUH2 3WZ1A 1FPN3 3USUB 4D5CA 2Q8KA 1YW7A 2XSJC 2W82A 1LODA 5T3NA 1NQDA 4AAXA 4KITB 5LK7B 1KD7A 1FMWA 2ZMEA 4B7KA 4OIRF 1NLRA 1YW9A 2FMDA 3WDXA 1OLQA 3LSDA 5I8YA 4BDVB 1X2NA 2Q1MA 2L0KA 3D8CA 4F83A 4JGZB 1NHAA 1XS9A 5G04L 3ZR6A 2DBNA 1NCQB 1BK1A 4OHXA 3IH3A 1L7LA 4DQAA 4XUQA 3IAQA 1HXDA 3G71I 1ZZ8A 4NIDA 3U9GA 3KD4A 2M7AA 3FLTA 3POJA 2Y38A 2KDOA 5FQ0B 2DVDA 1MJ9A 4DBRA 1U3EM 5ANQA 1QOSA 4FPHA 3U1DA 3NJYA 2JIJA 4IESA 2E60A 1GLHA 4CP1A 2OD5A 1H0BA 4RL7A 4YYOA 4OHYA 2EAAA 3EO6A 3H42B 4BQ4A 2FQPA 4S05A 2J1SA 5LGTA 2GU9A 5KXDA 1J5YA 4UBGA 2BY3A 4O61A 3BIWE 1ZRIA 5AVPA 2CMPA 5HS8A 4MTDA 1A34A 3F8BA 1YLFA 1CAWA 1O5LA 1X4PA 2JSPA 5L9BA 4XRMA 5C4WC 2DOAA 4HV5A 5J09A 2RS51 1ULPA 1BEV3 2HWE1 3NNFA 3GXUA 4B43A 5HOOA 2WS93 2Y6JA 4DPNA 2EA7A 3AFGA 1T56A 1I6XA 2Q1FA 2PN5A 3VDBA 4LOSA 3U21A 3I54A 3GFLA 1MBEA 4JRLA 3R4UA 1F36A 2LBFA 4DUVA 3I3LA 5DMYA 2STWA 5DDJ1 4IHSA 2K9LA 3SHFA 1LOGA 2VH9A 4CCMA 4NMIA 1TQIA 2NS0A 3BROA 2VQGA 5BY5A 3DPUA 2WB1N 3C2HA 4LBOA 1GU3A 1FOD3 2VJ4A 3IMMA 1GLNA 1FOXA 2DUOA 2EF6A 1VB2A 4ZU5A 3KVAA 2R5YA 1B4AA 4IEOA 1RL3A 2A6XA 2F4OB 4JX6A 4LBKA 5I0SA 2GC3A 2DFFA 1W8ZA 5AIPA 4DW6A 4Y17A 2XRNA 4PGHA 4NIAA 1QDCA 3DCFA 3AKZA 3VBOA 3A0HC 3AG2H 2F6CA 3FC0A 1DF0A 2QQBA 4QPGA 1HXS3 4HOBA 3HDDA 1EKEA 5JR7B 4EGYA 3UJQA 2JB4A 3FHQA 2RDPA 2A7AA 4OLLA 1FXZA 2V4AA 2O3FA 3CP8A 1X2MA 2V5YA 2DMTA 2XJUA 4FI9A 4G6QA 4XM3A 2WFF3