2CGPA

Catabolite gene activator protein/dna complex, adenosine-3',5'-cyclic-monophosphate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*TP*CP*AP*CP*AP*TP*TP*AP*AP*T)-3')
total genus 66
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 1997-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgpA01
4PGGA 4I02A 2ACJA 1TQMA 4KA4A 1BBYA 1EY2A 2ZBKA 4IETA 4ONUA 1LDJA 2GA2A 1K6OA 4PZJA 5T3NA 3EETA 5HDNA 2X4HA 1BC8C 1C0WA 4OMYA 1VJ2A 3HTUA 3I59B 1IRGA 1CAUB 3FFQA 2PMHA 4XBFA 5FPXA 3ZQ7A 1TQIA 3MQ0A 2DLLA 2XKOA 1XE8A 1RGSA 3QPHA 2IXHA 4YYOA 1ONVA 2EB7A 4EWAA 2FOKA 4LA2A 3WTXC 5E8IA 5TRDA 2O8QA 2P8TA 3QAHA 1KA8A 4CO8A 5FPZA 3KE2A 1G6NA 5ICFA 3GLXA 4I3PA 4ESJA 1PUEE 5CJ9A 4EGZA 1HBXG 1QBJA 3H1YA 4X6RB 2G9WA 1H9GA 1K78B 2J5OA 1FXZA 2XROA 4HX7A 1U3EM 2D2WA 3F8CA 5CVVA 1I1GA 4AWXB 5BS6A 2YU3A 1G3YA 2R7FA 3FMRA 3QRFF 1HW5A 2FBKA 2HEOA 1UB9A 5BQTA 1ZG1A 3F72A 1PP8F 2UXNA 1L0OC 1TBXA 2P17A 3HTSB 4TLFA 3NQOA 2Z9OA 1YIOA 1ZGAA 2F2EA 3TO9A 2VXZA 3FZVA 1FY7A 3P9IA 1XDUA 4EV0A 5FLJA 1LVAA 1JHFA 1U2WA 3IDBB 2ZMEB 5BY5A 4HLXA 3WODF 4LTAA 1IN5A 5ED4A 3V8JA 2L54A 3IHUA 5FGMA 3RTRA 4IEYA 1Z7UA 3EUHA 1ZG3A 2VC0A 4EROA 1R36A 4JK1X 1IAWA 4Q48A 4LLNA 1FP1D 1CF7A 4L18B 2OD5A 1J1LA 5LRSA 4HYEA 3UKTA 2QVSB 2OZUA 1R5GA 3F8NA 4OOIA 2LF8A 5HLGA 1S7OA 5LGNA 2WTEA 3E5XA 1UD1A 4IRIA 2M8EA 3WTZA 3EQEA 2VE8A 2F5DA 3OOPA 2PFBA 2VBWA 3LOIA 4XETA 3FJSA 4LK1F 3U10A 4UXNA 1OPCA 2I45A 4WXCA 5K5RA 2WFPA 2XGXA 1CX4A 2PN6A 5K1YA 3ZP5A 3V8KA 4WZCA 4MQVA 2ISYA 4Z82A 4XF1A 3LA7A 1SD4A 2QQ9A 1NYWA 3IWFA 1YFWA 1DPRA 4Q4ZF 4RGRA 1JUHA 3BCWA 3CF6E 3WTSC 2GH2A 3SCHA 4D7SA 2DW4A 1BIBA 4O9EA 4IEQA 1U78A 2HKXA 3NEUA 2XKPA 2QENA 3J80K 2IW5A 2N7GA 1F1ZA 4B09A 2VC1A 3GWZA 4IVNA 4WXDA 4HF1A 4PIZA 3HSEA 4GO1A 3WE3A 1R22A 4BNCA 2CAUA 2QJVA 3VHRA 3Q9SA 3K1MA 3U9GA 1STZA 2P5LC 4BQAA 5LEJA 2HGCA 1ZGJA 5H20A 4PDKA 2P6SA 2DO7A 3E5QA 4AVCA 3GW2A 4CHUA 3S7IA 3ISPA 3RDIA 1J5YA 3LZZA 2BNOA 1KYZA 2VONA 3N4MA 1YFUA 1LKNA 1WA4A 1NE6A 4MTDA 4YIFA 1X8MA 2E7XA 3T1BA 5DCMA 1OYYA 3OGJA 3TNQA 2OZJA 3QP6A 5KHIA 3HHGA 4U0WA 3U0ZA 3VB2A 4L11A 2FMLA 3IC7A 5ERIA 1CAWA 3NVCA 1FOKA 1VP6A 2F5EA 5JSOA 3WG9A 4PIYA 4ESBA 1J7KA 5L3DA 2YR2A 4G94A 3FMSA 4ENNA 4I0AA 4AVAA 5DD4A 3FZ3A 1YW8A 2STTA 5FLHA 2K4JA 3PQKA 4A5MA 4MGYE 2O61A 2D40A 1J3PA 3O2PE 4MV2A 4IHSA 2MC3A 2IA0A 2KIFA 1D5VA 3HYIA 3JAMZ 3P9KA 1DGRA 3HQXA 6PAXA 1F4KA 3J81K 5HS8A 2Y48A 4Y15A 1R1VA 4G6DA 1FYMA 3S0MA 1OYWA 1W5SA 2ZNYA 1VR3A 1S6LA 3M8FA 3N97A 4HVRA 4XF4A 3CUQA 5HLIA 1K79A 4LULA 1S7AA 1PP7U 3ROUA 5ICGA 2M30A 1YS7A 3DPTA 3T0YA 3SZPA 2Q30A 2V09A 3DEUA 2DT5A 1ZRFA 4MGIE 2A6EF 1O7LA 1GQHA 1GVJA 5I0SA 2MLKA 2CQKA 3ECOA 3SQNA 5A2QK 2GWRA 3EBRA 2W57A 3MYXA 5LLQA 2GC0A 4UHTA 5AONA 1R1TA 4CDGA 2ET1A 1MGTA 2EA2A 1HXDA 2M87A 1ZZ8A 4QXKA 1SMTA 4QLCU 3I0TA 4TV7A 2XAFA 4OINF 2Q1ZB 3LSTA 3VOEA 1LB2A 3C1DA 2XLAA 4CZZA 2HZTA 1ZRCA 3M9AA 5FD6A 1R23A 2DU9A 1MDMB 4FT8A 3GZ6A 2XRNA 5L3GA 4L9JA 4LUMA 1W7PD 2A6HF 4ASNA 1E2XA 1ZRDA 1QXRA 5J48A 4KNYA 4A6EA 1LQ1A 3TDUC 3O6BB 1MD0A 1Q1HA 1XSDA 3RYPA 4KMUX 4P9GA 2MH9A 3KGZA 3FM3A 3DF8A 2RQPA 2EJRA 3KEOA 3SMHA 3K1NA 1FYKA 4AQ6A 3TDZC 3G3ZA 3ZMTA 4ZH4F 3RPQA 1CAUA 4PGHA 1NXMA 5I91A 4P9FA 1U12A 1FBQA 5D6EA 2KRFA 3OCPA 3LQRA 4FHTA 4EVIA 1YW7A 1KQ8A 4LLGF 2YX7A 4ZYEA 5D5VB 4L5JA 3OV8A 4AD9A 4LD5A 1BIAA 2FNAA 4N9HA 4KWKA 2FBHA 3KFWX 4A12A 2JPBA 4BXUA 1XE7A 3KP3A 3GO5A 3CJNA 3H3UA 4HLTA 5F1RA 3ABTA 3KZZA 4BIFA 1QO0D 4A2UA 2QLZA 4ZYHA 3RZZA 3BU7A 1SFNA 4O6JA 1W5TA 5HOOA 4N9IA 2HS5A 4HN1A 4XLPF 1PM7A 1FNNA 3HRSA 4I0BA 3NKTA 3BZ6A 3TOAA 3GYDA 3M70A 1LJ9A 3DV8A 2FF4A 5FLIA 5DUKA 1TTYA 3VEPA 5DEQA 1LR5A 1XGMA 1YHFA 4ENKA 5JAXA 3F8BA 1XN7A 3BB6A 2EFWA 5DCMB 4HN0A 5BUVA 2IJLA 4A5NA 5JR7B 4RB3C 4IEUA 1FSHA 2FSWA 3HT2A 1RUNA 2L4MA 3LWFA 2HFHA 1HSJA 2HTSA 5FQ0A 4XSZF 3LFKA 1ULYA 4RGUA 1YWKA 3ZPLA 1REPC 3PNAA 3H1MA 1CF7B 3JTHA 2DBBA 2NAZA 3I5UA 4HA8A 2V1UA 4A0ZA 3CO6C 1G3SA 4EGYA 5CLSA 3K69A 2Q8KA 1B9NA 1SMYF 3ES4A 2Z99A 2Q0OA 1DPUA 2Y0MA 3KP4A 2Y75A 2QM3A 4LJZF 3T5XA 2PMUA 3V4GA 4MZUA 5ICCA 2D1HA 4Q0SA 4LLLA 1SQ4A 4MGKE 1YQAA 2P5VA 3H1WA 3OTFA 2EAAA 1B6AA 4WX9A 4IEWA 2OBPA 5I8TA 2B8MA 1PDNC 4GYGA 5DCFA 1A04A 2P7VB 4OFGA 3O14A 2K27A 3GFMA 2UY9A 4LLOA 2FNPA 4KL1A 5JVTA 1T0FA 1HQCA 2ZO4A 5FLXZ 2IRFG 5TJJA 3ES1A 2KKOA 4LK0F 4Y13A 1O5UA 3I64A 3P9CA 5CVUA 4L9TA 2DCTA 5HLHA 1ZX5A 3E5UA 1IZ1A 5AIQA 1GHCA 3SCFA 5ILSA 2VBYA 3TNPB 4AXOA 1V3FA 3QU3A 3B73A 1O57A 2ZMEA 1QZZA 3ERED 5KHJA 4FBFA 1ZAOA 3F23A 1YS6A 4IESA 5E8GA 4S04A 1ZZBA 3LAGA 4YRDA 2H6BA 1YO5C 2FXAA 3H3ZA 3TOBA 4ON0A 4ETSA 3ST7A 5K5OA 4HQMA 1SEFA 5LGUA 1HKSA 2YX4A 4R52A 5ICEA 1AOYA 4GULA 2A68F 2VOPA 2XAHA 2PLYA 3GFIA 1O7FA 3CL1A 4RD7A 1XMKA 2FQPA 2H09A 4WVZA 4HVQA 5I8YA 5FB2A 5EEGA 4AVBA 1ON1A 4XFAA 3ZN1A 1O5LA 1S29A 2EVXA 1Y9QA 4O5VA 3WW4A 3ELKA 1EP0A 4PIXA 1J0RA 3HHHA 2ZKLA 3JSPA 4LGWA 2L3DA 3FX3A 2DK5A 3K0LA 3L9FA 5E1XA 2WC2A 3WU0A 1D3YA 3V7SA 3NRVA 4ZYDA 3QU6A 5EZWA 1WSUA 2XLGA 4P96A 4LG0B 3C7JA 1S3JA 4QGMA 3WU1B 1P2FA 3KZYA 1IXCA 1UCRA 1K78A 4CXFA 2Z33A 1TNTA 5I0UA 5E1ZB 2VODA 4I2OA 4QM8A 3MFKA 2B5HA 3QOPA 4X6QB 1X3UA 4LG0A 4OIOF 1O4TA 2K0GA 5E20A 4XF9A 5H6RA 2E1CA 1EH6A 2DFIA 4E2GA 2D5FA 5C6CA 3BROA 3RYKA 1IXRC 4EJTA 3IDCB 3KEQA 1KU9A 1U8RA 5K8SA 3E6CC 2ET7A 1Z6RA 3KP6A 5KVRA 5L3EA 3COAC 1JGSA 4YNIA 2MH2A 3FXQA 3LA3A 4K2EA 3HSRA 2KJBA 1P4WA 5E1WA 1WI9A 3ULQB 4XF3A 4YG2F 4OLLA 3GVAA 3D0JA 1IW7F 1DDNA 4Z07A 3V7CA 4JBAA 4L5IA 4RAZA 1X82A 4YFKF 2ZJ2A 2AXLA 3E6BA 3H9AA 2CYYA 2QQAA 1Q43A 1XSXA 3ZMUA 2Y0OA 4IEXA 1OMIA 3BOQA 4NB5A 3GUDA 2PAMA 5KHKA 2A3SA 4OIRF 4G7OF 3CEWA 4UV9A 2VQAA 4MGRA 1AWCA 2IXLA 2EK5A 5CVRA 3H8UA 4ZZDA 2M5WA 1QY4A 2ZFWA 1EV7A 3R60A 3NJZA 3VFZA 5JSPA 4F7ZA 2RN7A 1LNWA 4XFCA 3JZVA 2BV6A 4M71A 1I1SA 5HS7A 4MUVA 4HBLA 5BOXA 1Z9CA 1NHAA 3GFLA 1XGOA 4K8FA 4HQEA 5LRRA 5JSRA 2CV6A 1BOAA 1D8KA 3FHZA 5E1RA 2RGVA 1FT9A 2RKHA 4MTEA 3BJ6A 3REOA 1YUDA 5DD8A 2PEXA 3Q5FA 3O3KA 5E18F 3IKVA 3JTGA 1MJBA 2GZWA 1QZYA 2M45A 2KIUA 1X7NA 4AIJA 4A6DA 3S2WA 2BNNA 3CUQB 2XIGA 3QACA 4QMAA 5J3UA 4RB2C 1HKTA 2PI0A 4Q47A 3H7YA 4UVCA 2COMA 3M1EA 4HBNA 4CYDA 1EYBA 4JTOA 2IA1A 4KUMA 2Z3YA 3BP8A 3EYYA 3KLOA 3MZHA 1IPKA 1UFMA 1WGPA 2WWYA 4R79A 4MEYF 2MBFA 1Z1DA 3W6JB 3G73A 2D93A 4O9GA 2DQRA 1ZNPA 2XAGA 2JPCA 4HF2A 3P7NA 2PG4A 2ETHA 3E97A 2LNBA 3F22A 2DPDA 2PJPA 1LRHA 4HSJA 5I8SA 2MHFA 1SD7A 3BY6A 3HSFA 1CAXB 3T8RA 1FBUA 4KU7A 2PHLA 3CTAA 4HDUA 4ZU5A 4BHPA 4MH0E 3GX4X 1DZRA 3EQLF 2O8XA 1MDMA 3GXOA 1FP2A 2JSCA 2FBIA 2QWWA 4U0VA 1WKMA 2UYAA 2V79A 3U2RA 1SD5A 2PQ8A 3DPLC 1P92A 3L2HA 4RB0A 1J75A 1U5TA 2DAOA 4LMYA 2IC1A 2W25A 2EWNA 3SHFA 4D0PA 1KU3A 1CAWB 1EPZA 4HMZA 2MPFA 1BJAA 2EV6A 2OZ6A 2L4AA 3RI4A 2GXBA 1SFEA 4M9XA 4P5OA 1U5TB 2ZXJA 1BI0A 4I98B 3I53A 2EFOA 5D6FA 4QWQA 4KFCA 3RKYA 4WK8F 3I4PA 1NE4A 3F6OA 3ZN0A 3H7JA 1ZH5A 3WW1A 4D7TA 1D8JA 4ZU4A 3V7RA 5FO5A 2Z5UA 3BPZA 3WE2A 1V70A 4ENJA 1UCXA 1ZARA 4XFGA 3FM5A 2WV0A 3WGGA 3JW4A 4E70A 1ZRRA 2ETEA 3DQVC 3WTWC 3WTYC 1IF1A 3VODA 1FBSA 4LA3A 3SFZA 2ESNA 2LSOA 2GA1A 2A61A 3GF2A 5LHGA 1ZREA 4BYYA 3EDPA 1SFXA 1ZLKA 1Y0UA 4RS8A 3W6KB 3L00A 1OFNA 4U7DA 4KT5C 3HRTA 4E2SA 1WLTA 5DV5A 1HSTA 5DDGA 2QCSB 4XFHA 2YSRA 1UW8A 4PCQA 5HDGA 5I0TA 1FI2A 1Z91A 3ACLA 2AS5F 5C8WA 4EJOA 4PJYA 2VBXA 1EH8A 4UVAA 2QZ8A 3F6VA 3BDDA 3IRRA 3R0JA 4GGGA 3MZYA 4OU0A 3IWZA 1FSEA 1WRJA 3CO2A 3UKNA 3I58A 2VBZA 3B02A 2QYOA 3RNSA 4R8HA 3CLOA 2DI3A 4WBBA 4KDPA 2VN2A 4UBGA 2QQBA 1Z6TA 1ZZ7A 3EHKA 1UPIA 2W84A 2NS0A 3RIRA 1XGNA 3H92A 4KIBA 3FF5A 2FU4A 4XSXF 3QP5A 5CYVA 1F5TA 2BNMA 4MHGA 2QVOA 5IT9K 2XUBA 2VT2A 3WW3A 1BI2A 2K4BA 2ISZA 2PYTA 2PAEA 2PAKA 4ESFA 4L9VA 2CW0F 5D4SA 2IXCA 3EJKA 1G3TA 3MDPA 3DKWA 3MWMA 1B4AA 4OMZA 1FYLA 3RKWA 4META 3WGHA 4P9UA 4IEPA 2FA5A 4RGSA 2A5YB 3R4KA 4NVPA 2X0LA 2HJIA 1ZN2A 5IT9Z 3PVBB 4HLYA 3MPBA 3GZ5A 3MCZA 3FXRA 2FRHA 2FQ3A 1U6GA 1ZZCA 5F64A 5FFZA 1ZZ6A 1KU2A 2IA2A 4S05A 2Q0AA 3KP5A 4J1WA 1RZ4A 1TW3A 4IEOA 1OD5A 4HF0A 2JT1A 4XFIA 4GXOA 1TLHB 3HRUA 2Z69A 2DPUA 2G7UA 1B9MA 4XF0A 2O0YA 4Y17A 1JHHA 1YLFA 1T38A 4KIGA 1T98A 3E6MA 3LAPA 5AIPA 4Z2YA 3FE5A 1UIKA 2CGPA 1FZPB 1GXQA 2CAVA 2RV8A 3QPTA 1BN5A 4JTNA 1I6XA 3I7DA 1S8NA 3G7DA 4MQ9F 3ZMSA 5EEHA 2NYXA 2A07F 2G7HA 1IN7A 4M73A 1H0MA 2UZKA 1CAXA 1CGPA 2H0VA 3MEXA 3M8EA 4ORFA 1LEBA 1IN6A 3TO7A 4JVAA 5FCCA 5CVJA 4BHBA 4RGXA 1RTVA 4JV4A 2W85A 2H6CA 2XLFA 4WWCA 2QUFA 2Q2EA 4AVPA 4HV5A 1QXJA 1P4XA 3PQJA 2HKOA 2HDCA 1P6RA 1QQIA 4H7LA 4UXAA 5D5WB 1H1IA 5E16A 3LQQA 2E7WA 5HVQC 4EQQA 1R58A 1HKQA 2P6TA 2V6CA 3M3IA 3LAJA 2IPQX 5L3CA 2W24A 1O3QA 4HSLA 4XLNF 2EV5A 2NNYA 5BXXA 2OA2A 2H94A 2QBYB 3R0AA 4G7HF 1ODDA 4IXAA 5E17F 4EM0B 4M6YA 3WTTC 4E2QA 3M7GA 1G3WA 2BBYA 5H6QA 2XAQA 2PTMA 4YSFA 3HOTA 1KGSA 3KMHA 5LHHA 2GC2A 1EH7A 3LA2A 4JQFA 4M9ZA 4DNCA 2BEOA 1V4RA 5CVIA 4G8XA 3D82A 1Y3TA 2JRTA 1DP7P 2CFXA 2CWEA 4WXHA 2EFNA 3SHRA 1K7AA 5LGTA 2ZNZA 3ETQA 1GQGA 3I71A 2UY8A 4YFNF 2XV4S 3C18A 2UYBA 1ZG5A 1LEAA 1QPMA 1OI6A 2A69F 2Q4SA 1Q5OA 4MEXF 2JZYA 2DQLA 2LF7A 2ESHA 3ABUA 4UBHA 5BPIA 2D45A 3WTVC 3EYIA 1U5TC 4I7HA 1O3RA 5JCTA 1TQPA 5AVPA 2MA3A 3ML6A 3KETA 2FE3A 2RVCA 3K2ZA 3FHIB 4LEJA 2V1XA 5CU1A 1R7JA 4KN4X 2XVCA 3TQNA 4U7BA 4IRHA 1FPQA 1XCBA 2ATFA 3IL2A 5DYMA 3NL1A 4J1XA 3EO6A 1USTA 1OR7A 1IRFA 5KK1A 1J9IA 4Q0VA 4WCGA 4NHJA 5ILVA 4U88A 4AIHA 4MGZE 2R3SA 1B59A 2EA4A 2UXXA 4EJWA 1TW2A 4G7ZF 3NSTA 4BHCA 2EFPA 2XAJA 3ECHA 4EWEA 5ILUA 1YTYA 4DINB 5J6XA 1DGWA 2KXLA 1E17A 4Q0QA 4EM2A 5D5XB 3TGNA 5L3FA 1LDKB 2MD5A 3T8TA 1GXPA 2XL9A 2OPKA 1W7PA 4EWDA 4H0EA 3BPXA 4LB5A 1HW1A 5D5UB 2K7LA 2ADUA 2FMYA 1G4DA 1NZCA 3BJAA 4G9YA 3I59A 4KMFA 4GCVA 1WQ2A 2GIVA 3SXYA 3CUQC 1Q3EA 2B0LA 3NW4A 4HW0A 1W7PB 3PFIA 4U0YA 1JE8A 2NRAC 2K02A 4L0YB 5KBFA 2O03A 2OU2A 1XSVA 2MLGA 3KLNA 1O3SA 2TDXA 4M72A 4L9NA 4M74A 4MNUA 2HQNA 2XASA 2F5FA 3OF1A 2OYZA 3BALA 1TNSA 1XDSA 2C0ZA 5IT3A 4XFFA 3U11A 2BYVE 2STWA 5JFRA 1IPJA 5D8KB 3GEZA 1XCVA 1I5ZA 4KYWA 1LDDA 1ZZ9A 1QGPA 1DZTA 4FX0A 2VECA 1R1UA 5EFUA 2R7DA 2OQGA 4KN7X 3CUOA 5BMZA 2O1QA 4B8XA 5D4RA 1UHMA 5DUIA 3FWEA 3SZTA 5D8LB 3TO6A 3KCCA 1L3LA 4IRGA 1H9TA 1SAXA 1TQ5A 3HUGA 1KQ9A 1F9NA 3SXWA 2BGCA 4Q0PA 1W4MA 4OIQF 1RC6A 2HTJA 4UUVA 5KHHA 1YFHA 4QGNA 2EV0A 3H50A 4FX4A 2VT3A 1ZLJA 3S7EA 3F3XA 3GBFA 3ZDSA 4HOBA 2XL7A 2OAZA 1SD6A 2LKPA 2DTRA 1R5HA 3F8FA 3CDHA 4L2NA 1J3QA 1ZVFA 2KJCA 4R1HA 4B29A 2O6GE 2P4WA 1QWRA 5A2QZ 5J8FA 5HS9A 2PHDA 3PLQA 3KSCA 4RB1A 1XGSA 3C3WA 3TKYA 3U1DA 5K5QA 4ZYGA 3KP7A 3AAFA 3IRQA 3IKTA 5I93A 2HYFA 2IXJA 3ZMZA 2XHKA 1PMIA 3HOSA 2VE9A 5JI6A 4EM1A 1B1BA 3ZMVA 3WGIA 3GYHX 3D0SA 5FQ0B 1FC3A 4IPAA 2QBYA 1RNLA 1R00A 2RDPA 2PQQA 1CAVA 3DFGA 5D1IA 1OYIA 4F8AA 4LUKA 4YIIA 4I01A 4LFUA 4BH9A 1YFXA 4G6QA 4IJAA 2HYGD 4DQ2A 2H27A 4O3MA 4UVBA 3WW2A 2L01A 3F21A 4HVOA 4KU8A 4KICA 5I0RA 1VTNC 3FXUA 3J80Z 4OIPF 3DN7A 2DK8A 2IXIA 4UV8A 4A0YA 4BAYA 3CO7C 1YG2A 3LWCA 2Z2SB 5LBQA 1IN4A 3BPVA 4XFBA 2PBIA 4IEVA 1J59A 4Q29A 3K9TA 2YPRA 2QDRA 2OA4A 1RI7A 4ZZLA 2O3FA 2VOOA 4FAGA 2RC4A 1KYWA 2HWVA 3WTUC 4N0BA 2CSOA 2M1BA 4HX8A 4EJUA 1L3JA 2E9QA 3F8MA 4I09A 2LDUA 3K1PA 3L2CA 4HAMA 4IERA 4HZFA 1QNTA 3D5LA 3HRMA 4IHTA 3V8LA 2PFWA 4EJVA 1WWXA 2GC1A 2IVMA 1KQ0A 3RKXA 4UNOA 1FLIA 2NNNA 2E1NA 1IN8A 4M9SA 3DL3A 1DUXC 3J7AO 1FWZA 3JSOA 2QNKA 3L7WA 3MAJA 5LEKA 5FDBA 5FD5A 2FEZA 2PA7A 1T6SA 1BC7C 3ELNA 2EFQA 2C6YA 3OD0A 3KGLA 4FAHA 2P7CB 4AQ2A 1SFUA 3IBMA 1ZYRF 5LHIA 2P5KA 1IUYA 1ON2A 3IIAA 5KHGA 3RYRA 4QGLA 1T2KA 1YYVA 2GAUA 1UIJA 2GC3A 1O3TA 3BJOA 1MJ9A 2GU9A 4QM9A 1P4AA 3R6SA 3CJXA 3J81Z 2ZKZA 2V1DA 2F4PA 5J7MA 4WF2A 1XMAA 3GFJA 4IF4A 1MKMA 4EMSA 4ZU7A 1JXSA 2ELHA 1J2XA 3UKVA 5F6FA 4KIFA 4ENMA 1ZHFA 3C3VA 1XB4A 3DP7A 4A0XA 4AIKA 3E3VA 2GQQA 5BV6A 4IEZA 1Z05A 4NQWA 2J5PA 1XD7A 4Q5SF 3HIFA 2L02A 4P55A 3E6DA 1BI3A 4KWLA 3Q9VA 2KIMA 3L09A 3CLPA 1MZBA 3HT1A 5JHUA 4RAYA 2EA7A 4MX3A 2BE5F 5JR3A 1RIOH 3SCGA 4HDVA 2UWMA 3RPUA 1T39A 4M6XA 5HI0A 3FMQA 3I54A 1H1MA 2V9VA 2IP2A 3RJPA 5L3BA 2IT0A 4KWJA 4YFXF 2D5HA 1USSA 4YARA 5FLXK 1HW2A 4XRFA 1YFYA 3USSA 1FX7A 4GYIA 4XEZA 2MNGA 2K86A 2RNJA 5CADA 1RUOA 3ZMDA 1YLLA 4Q0UA 1I27A 4HV6A 2CG4A 5FFXA 1RL3A 1YW9A 2HQRA 4QX5A 2HOEA 2D1VA 5BPXA 1XRUA 3KP2A 4HX4A 1MJAA 4CGZA 2F5CA 1J3RA 1J58A 2ZCWA 2OQRA 3DXJF 1IXSB 4CICA 2IXKA 1UHWA 1X8EA 2HR3A 4L0ZB 4LB6B 3BWGA 2K9ZA 5HDKA 2CO5A 1CAVB 3R61A 2B9UA 3JAMK 2VPVA 1KU7A 5J8CA 2GXGA 5BPDA 1BI1A 1OKRA 2JTVA 1BM9A
chains in the Genus database with same CATH superfamily
4L5EA 2DTYA 4LT5A 2IGMA 2NOJB 3B93A 2ZSHB 2DMTA 1TQMA 2OTJI 1LDJA 1K6OA 5JPNB 1RUD2 1TEIA 2I74A 3PSFA 1ND3C 4UY8I 4OHYA 5EP9A 1C0WA 5A1AA 2W5FA 4Q1RA 1VRH2 3IP4B 1MMNA 1NH3A 2PMHA 1GVDA 3MQ0A 4YYOA 2IXHA 2EB7A 2FOKA 4LA2A 4QB2A 1QRYA 4BIOA 5E8IA 5TRDA 2R7SA 4FTSA 3KE2A 5ICFA 2MG4A 4I3PA 1BVVA 1N3PA 3U07A 2HOSA 5G04L 1HBXG 4DXTA 4OZOA 3AKZA 3KB5A 4QD2A 2Z1DA 1REEA 3T2QA 3HC7A 2BBVA 3K51A 3OUHA 5CA6A 3J7LA 3VB9A 1QDCA 3SEPA 5CVVA 3VYSB 1XSQA 3NV2A 3I2GA 3VBHB 4LXLA 1AL23 1HW5A 3G71I 1SLTA 1UB9A 4ARXA 2FQ4A 1R092 4XPVA 2P17A 4DUWA 3HTSB 2VCBA 1GDTA 5CFDA 1VQ7I 4FTEA 3THDA 4DEQA 3FZVA 4RGGA 3P9IA 5LA9A 2P34A 3A4CA 2PN5A 3BTCA 3IDBB 4LTAA 4MADA 2VVEA 2L54A 5A7NA 3J9SA 3IHUA 2MD0A 5L9RA 3U4XA 1TVGA 1M06G 5FGMA 4MFDA 3RTRA 1Z7UA 5A7OA 2VC0A 3I3MA 4CU8A 3RWKX 1ETYA 4JK1X 1UMZA 1IAWA 4R4ZA 4Q48A 3WCRA 3WCSA 4K7JA 1CF7A 3WHTA 3VYUB 5LRSA 4HYEA 4WM7B 2QVSB 3ZFGC 2OZUA 5LGNA 1XBFA 3LF7A 3E5XA 4AEDA 4FETA 2WWSA 1OUSA 3EQEA 2VE8A 1WD3A 2PFBA 2XJRA 4CDXA 4IE4A 4XUQA 4RAGA 4Y4RA 4XETA 2LY1A 3H5RA 4W6YA 4CH7A 3U10A 3AL0C 2WFPA 2JECA 2XGXA 4FQGA 3C7FA 4P9LA 4P9XA 4WZCA 4XF1A 1NYWA 2R7WA 4XHXA 3JREA 1MS8A 1DPRA 2DDUA 4RGRA 2DTWA 4ISQA 3BCWA 4Q4X2 4LITA 2CDOA 5IP9J 2IZWA 4RA2A 3PU8A 1WVRA 3LSRA 4IEQA 1U78A 4AIDA 1X36A 4DRVA 2BVBA 1SLAA 1Z7S3 2XKPA 1B35C 3J80K 2J7MA 2ZJRF 2N7GA 1F1ZA 2VC1A 3POWA 3WD5A 5ERLA 4QDRA 2X5IC 3N7KA 2M0MA 2Q8OA 4AYBN 2K3FA 1HLVA 1H4GA 3K3OA 2XC7A 3HSEA 1R22A 2CAUA 1XXNA 4IGQA 3BTZA 3SLIA 4BE2A 3K1MA 3U9GA 1STZA 4YZ2A 2HYKA 4BQAA 2Q8DA 2ZC2A 3TW7A 3A03A 3E5QA 3GW2A 4CHUA 3ISPA 1LJ7A 3LZZA 3N7LA 1UOGA 3PSIA 2O5RA 2BZDA 3A0HC 2TUNA 4GRIA 2EBIA 1WA4A 3L9JT 4FFGA 4YIFA 1X8MA 2E7XA 4UAPA 3T1BA 2VBBA 1OYYA 3OGJA 3TNQA 3K3NA 2BWCA 2DODA 4U0WA 3U0ZA 3O1VA 1MPXA 2R0QC 4IO9F 1Q8QA 1RUE1 4M3EA 3ZXDA 1Z78A 1YYNA 5ERIA 1CAWA 3UL2A 4N53A 1VP6A 5JSOA 3WG9A 1RUG3 5ISLA 4ESBA 1UOFA 2E71A 5L3DA 1R49A 1BL0A 2YR2A 5FZEA 4XOPA 2YMZA 1OCOH 1YW8A 1A34A 4AI1A 2R063 4IV1C 3N9LA 5B3SH 2VUCA 4A5MA 2VZPA 2VXDA 3NNFA 4Y26A 4LO6B 5DZEA 4MGYE 4BE1A 4Y1UA 3HBLA 4MV2A 1LHNA 4XLAA 2RS12 2IA0A 4F3QA 4Q4W3 4FTBA 5KXDA 4YVSB 4QXHA 2Y60A 1T95A 1RHI3 1O8SA 1YJ9I 3S3OA 1AYN3 4G6DA 3OYKA 3S0MA 3VGIA 4NOTA 1DQ4A 4OMCA 4N43B 1VR3A 2XB6C 4HVRA 4XF4A 3AMMA 1VNDA 2NM1A 4LULA 1PP7U 3VD3A 1OA4A 3SZPA 1KFXL 4IL7A 1MZEA 1ZRFA 2J22A 3OYNA 2JKBA 3RI9A 4FE4A 3ZQFA 1PVC2 3RPUD 2W1UA 4DPNA 5I0SA 4HNVA 2NN8A 1W6PB 1MSEC 2UV1A 4YZ3A 3WP4A 2X48A 3GGLA 5CIRA 2VKVA 5AONA 5FXZA 4LBOA 4BXXJ 1UXXX 2ET1A 5EZHA 4QLCU 1OH4A 4DY3A 4EYUA 1C8M2 2X6WA 3ZQIA 2WBKA 1PVC1 2HQ5A 4LR4A 2HWD2 2WNUB 2IGNA 3GZ6A 4LUMA 3GALA 1QXRA 1UYPA 1E2XA 1E5HA 2DA7A 4GB31 3OPWA 1XE0A 2GNTA 5JDBA 5F2SA 3OIPA 3B3QE 1Q1HA 4W4ZA 4XURA 3CP8A 3HBZA 3RYPA 2K3PA 1O6UA 2CJJA 1DQ0A 4P1WA 3CDZB 2RQPA 4D0QA 3WY6A 2QQKA 4LPLA 2HWC3 2YG0A 2EJRA 3MW3A 3SMHA 3K1NA 4AQ6A 4Z1VA 3G3ZA 3ZXKA 2VNGA 1PZ7A 4P9FA 1U12A 1A78A 5D6EA 5CG9A 3OCPA 3NWKA 4FHTA 4E9KA 2DUPA 2Y8KA 4EVIA 1YW7A 3HN3A 1WLDA 3GZEA 3W59A 1S5LC 3WG3A 1VQNI 1IDYA 4ZYEA 3PDQA 5BNOB 5D5VB 4QPOA 4AW7A 2JD9A 4LJHA 1XNDA 4M3CF 5EF6A 3E0JB 3KYLA 5EHDA 4HONA 5BNPC 3B94A 2DTZA 1ZA7A 1V9U3 5K7HA 2GNMA 3OWTA 2ORZA 1VB4A 3ZN6A 2ENRA 4Q1PA 3GO5A 1Y0NA 1W9FA 4HLTA 5F1RA 4RQPA 4A2UA 5CKNA 4BJ5C 2DOFA 1GZTA 1GNYA 4O6JA 1W5TA 5FWJA 3JRIA 4N9IA 3KVBA 2HS5A 4XLPF 2GH8A 1DF0A 1VBB3 3HRSA 4H2AA 3NKTA 3M70A 3DV8A 2FF4A 5DAQA 3E1SA 2WS92 3MKYB 2GP5A 1PO21 2K9NA 1RUD3 5GZFA 3D6EA 1LU2A 1ND2C 1FNYA 5BUVA 2IJLA 4XN0A 4IEUA 3O8GA 3OBRA 1RUNA 5FR3A 3LWFA 2HTSA 3LEKA 4XSZF 1IRZA 4IQPA 3JRGA 2FDIA 1AKHB 3MLJA 3H1MA 5GAEJ 1OHFA 4A7ZA 3JTHA 5FLMJ 4YPJA 5GLZA 4D6RA 1G3SA 1IC8A 3HJEA 1J1TA 2OPWA 1SMYF 4YFWA 4LK7A 3L2UA 1LHOA 4Q27A 1RUG1 3PTYA 3ZSMA 2K9SA 3V4GA 4CDUA 4D7YA 2NQYA 1SQ4A 2YROA 4PCRA 1HDPA 3I4MJ 1W0NA 2VOTA 1JKQC 2EAAA 1B6AA 4BB3A 3BC8A 4WX9A 1A3KA 1AYN1 3DYPA 5I8TA 5C70A 3DTKA 4WVMA 3TMOA 3OUIA 1IUFA 2WWJA 4OI2A 1OLMA 4FOQA 1PDNC 2IBDA 3FK7A 3K10A 1A04A 1RUC1 2K27A 3IV5A 2XONA 3I3QA 2EILH 3KS7A 2EIGA 2ZGLA 3D5RC 5FLXZ 4IV1B 1N1VA 5CKQA 4LIVA 3ZX7A 5E8AA 3I64A 1IZ1A 4LOTA 5ILSA 4AXOA 1V3FA 5C9AA 3HOUJ 3C2GA 3ZYBA 3M1HA 5FP3A 5T5LA 2P6CA 3ERED 2MABA 1VBC2 3ACHA 4NPMA 1AR72 4FBFA 1YS6A 5E8GA 2JRMA 2XGDA 4YRDA 1YO5C 2L7KA 4ON0A 3HM5A 3BGAA 3M07A 2BY1A 3QYBA 1SEFA 3PO3J 3TP3A 3JRFA 1W05A 4B7KA 3GJAA 4UF0A 5IATA 3IM0A 1WW4A 1FIPA 1JYTA 2PLYA 4QSHA 5CQGA 1JKRC 1XMKA 4D6SA 4AVBA 1FIAA 3FL7A 4XFAA 1N25A 1JYXA 1S29A 4YW3A 3ILFA 1K3IA 2KRHA 2VU9A 2DCJA 5JWPA 2LY9A 3OMYA 4OUEA 1R5ID 3Q0VA 1WLWA 1RUJ2 4LGWA 2L3DA 1RUH1 1E57A 1ZR2A 3RRDA 2VZUA 5E1XA 3WDTA 2WC2A 2QGUA 3V7SA 2OT7A 1IQAA 1W0TA 1FOXA 2E35A 3QU6A 5FYMA 2BV4A 5EZWA 3MKWB 1WSUA 4MO7A 3CCMI 3NWTA 1S3JA 2BY0A 2M4GA 1UCRA 1K78A 4CXFA 3J7AY 4AU7A 4E7SA 2IGKA 2A70A 2JEMA 5AC93 1QOTA 1C28A 1POV1 4XVHA 4X6QB 3SEZA 3CZJA 2ZJPF 2VNRA 1R64A 1EH6A 2AZ5A 2W47A 2ZHLA 4IGOA 5FZ9A 5A3OA 1PNFA 1TWGJ 5F5IA 4XRMA 3BCAA 1K45A 4JKLA 2R0HA 1OUXA 4EJTA 1AXYA 1XYPA 1UYXA 5GPAA 3LSHA 3KEQA 1U8RA 5K8SA 3E6CC 2ET7A 1V6IA 3FN9A 3J7MA 5L3EA 4JDMA 1X50A 4QU1A 1JGSA 1E3HA 3FISA 2MH2A 3KZIC 3THTA 2BGPA 1UZ0A 1TMF1 4M4PA 3BTIA 3TRSB 3GHMA 5CAZA 4BJTA 1DU6A 3GTKJ 3IZOA 1S4CA 2X5IA 1OA2A 2EQRA 1X2NA 3V7CA 3RZDJ 4L5IA 4D3WA 1JN2P 5FTTC 1OLME 2IWGB 2CYYA 1SFPA 2QQAA 1Q43A 1QJY3 3AYAA 3ZFGA 5LD2C 2XOMA 2Y0OA 4IEXA 3POSA 4NB5A 4PUSA 2NS7A 4K8RB 4B4QA 1FV3A 4NHLA 4QXBA 1ENRA 1US2A 4CCOA 4G7OF 3CEWA 4UV9A 4MGRA 2FZ2A 3ZFEC 1UNBA 3OSDA 2CUZA 3P5BA 1I9RA 2E1MC 3DKXA 1MQTA 4UI9L 2BV6A 4M71A 4HBLA 2P0WA 4XNFA 2F4IA 4CDWB 2FDGA 5GM0A 2XJPA 3PVEA 2NVTJ 1XG1A 2VNOA 4MTEA 4HETA 2J1AA 5DD8A 3OOXA 2PEXA 5F04A 2HWD1 2E36A 3LOCA 5J1YA 3M3YJ 1ETXA 2Y30A 3NWSA 4C2UA 2LC2A 4M3CE 4RYDA 2PI0A 5D8AB 5GZCA 1VQ8I 2EH3A 1EYBA 4JTOA 2DVAA 5FYSA 4KUMA 2O9LA 4XE9A 5KR7A 4AI8A 1AA7A 2WNEA 3TAYA 1DGWY 4YIRX 4TZDA 1MBGA 2ORXA 2XAGA 2JPCA 3ZOBA 5C7GA 2PG4A 4TN7A 3E97A 5B1BH 4HSJA 2RMU1 4XBLA 4XR6A 5DG2A 4HANA 1SD7A 3BY6A 4QXCA 1FOYA 3HB9A 2DU0A 5T5PA 4KU7A 3ZMOA 1H0BA 2QTWB 4HDUA 2LMDA 1CZVA 3KLSA 4BHPA 1BHGA 4MH0E 1DZRA 4SLIA 2O8XA 1MDMA 2JSCA 1MS0A 1TT0A 4A93J 3N9OA 4DJAA 4F93B 3DGTA 2ZGQA 2KDZA 1SD5A 2H1LA 3L2HA 1U5TA 3GCXA 2IC1A 4JGZB 3M4FA 2W25A 2EWNA 1OURA 3T3YA 1KU3A 3OGVA 3F2ZA 4HMZA 5FOBB 1BJAA 4I3GA 3USUA 4P5OA 4E4HA 4HSRA 2VUJA 4B43A 5A3UA 2VQUA 2YBPA 3I53A 2AO9A 2X09A 3CQOA 3SDBA 2WFF1 3CU7A 4OHXA 4QWQA 4CP9B 3RKYA 2E60A 3U37A 2R30A 1NE4A 3H7JA 3T08A 2LREA 2YU2A 3MIEA 4ZU4A 4ATFA 4ENJA 5DZGA 3D8CA 4HXCA 3TWIA 3BQZA 2DMPA 1WJAA 5FZOB 5C3RA 1U5IA 3DTIA 4XXAA 1BW6A 1FBSA 4R9BA 3SFZA 2GA1A 2WY8Q 5DAWA 3EDPA 3WG4A 2VW2A 1ZLKA 3L00A 1VBD3 1OFNA 3MUZ1 3HRTA 1WLTA 3AL0B 4KWUA 2ZPXA 5DDGA 4GH4A 4XFHA 3THCA 5HDGA 3WP6A 1ASJ2 2LLKA 2P81A 4EJOA 5HNFA 2D97A 2QZ8A 2YUSA 3FXOA 5F3CA 5GLUA 3BDDA 5F6LB 3LFUA 3TEZA 4OU0A 1FSEA 3CO2A 3IPVA 3I58A 1QVTA 5F5CA 4XTPA 2DI3A 1GICA 1HB3A 2VPRA 4S0HB 3OBZA 4HSTA 2VKDA 2L0KA 3ZFFB 1Z6TA 1ZZ7A 4QPIB 3UK9A 4HNTA 3MLKA 3AVSA 3PUHA 1UKGA 2QVOA 5IT9K 3M1CA 1DU0A 2ISZA 2D43A 2PMZN 2PYTA 3RQ0A 2YC4A 1BR1A 2IXCA 3H8RA 5GADJ 4DRRA 4IDZA 4XDPA 3AFKA 3RKWA 4OUSA 2M7BA 3NV1A 1FMD3 3SEEA 3WGHA 2WO3A 4DNYA 1R081 1RUE2 3R4KA 2HJIA 5C3OA 4QPWA 3CZ6A 3SC7X 3BKZA 4A3LJ 3POGA 1ZK8A 5FAXA 1FYUA 2EZKA 3AFGA 1KU2A 2ZGSA 1O4XA 3DEWA 2BOLA 1ZBA2 1WI3A 2AYHA 3KP5A 4XJUA 3BOPA 2DU1A 1OD5A 3DPRA 2D5VA 2JT1A 1ULPA 1RUF2 2VVDA 4Y1YA 2G7UA 3I3DA 4BZ4A 2WA0A 1YLFA 4DBRA 3JBG3 1BBT3 5B4XA 5DDJ1 1K83J 5HV0A 4BDZA 1E3OC 1W6QB 2B46X 1BN5A 1HRI2 3I7DA 1S8NA 4BQOA 4AGGA 2A07F 3CZUA 4QPIC 1IN7A 3WQ0A 2UZKA 2VQCA 1C1LA 3MEXA 4ORFA 3IIIA 1E5RA 4BHBA 5L7OA 1RTVA 2R062 4XMAA 3A7QA 4RSUA 4HV5A 1JZ2A 1XC6A 4AF9A 3ZR8X 4HFSA 1YJNI 1BCXA 1GOFA 1UY4A 2P6TA 2YFUA 2ME6A 4X1EA 1YC61 4BGDA 4FPEA 2V6CA 2XGEA 1OF4A 3M3IA 2FDHA 3S93A 4Y22B 2W24A 5A33A 5BXXA 3VBOA 5E17F 4BWOA 3WTTC 3FBIB 1NY72 3M7GA 1UL9A 5H6QA 3EYPA 3VZKA 5JMOA 3HOTA 4NWVA 2HBTA 1KONA 5DZFA 3AMQA 1EH7A 5IVCA 4CP9A 5HV4A 3WF2A 4K1YA 2C4XA 1Z7S1 1CN1A 4CUCA 2A3WA 4AHXA 1QU0A 4O61A 4DO0A 1K7AA 3WV6A 3B5LB 1T33A 5LGTA 4AVZA 4UFLA 3I71A 4IV3B 3VDDC 4HPKA 2D3PA 4CCCA 4YFNF 2XV4S 3C18A 3MPPG 5D21A 4FFHA 5IVFA 1QPMA 3VDDB 2OCCH 3CC7I 1Q5OA 2W08A 2XSJC 1GR3A 2LR8A 2LF7A 2ESHA 4Q8KA 3CCRI 1ACIA 3CCQI 3TW6A 2DFCA 2E7AA 2DA4A 3BTJA 4BLIA 4I7HA 4WM8C 2XGCA 4XUOA 4LO7A 5CISA 1OJLA 1PK6C 3KETA 1VQ9I 1QKQA 2FE3A 2RVCA 3DWLE 3OG2A 5JZGB 4CVUA 2RS31 1NOVA 4ZXKA 3U1KA 2V1XA 1R7JA 2GMPA 2ZX1A 1OQ1A 4XJAA 4LK6A 2PHRA 2HYXA 4Y20B 1YX5A 5EJ3A 1MS9A 1XCBA 5DYMA 3JU9A 4JZRA 1USTA 2R4GA 2C5DA 5APAA 1AYN2 4TSVA 2R3SA 3AXDA 2XJUA 3VBSB 3NSTA 3CCLI 5J3LA 4EWEA 2LS6A 2JSPA 3RMXA 1WFXA 1NLRA 5J6XA 1E5IA 1E17A 1RB8G 2VL4A 4COVA 2B9SA 1PX4A 2A73B 2XL9A 2ZGTA 2OUMA 3QOEA 4H0EA 4EN6B 1HW1A 4L9BA 1X1BA 5D5UB 2ADUA 4ZPIA 3OPZA 3MIHA 3RSJA 1D4M2 1WJEA 1HF0A 5D8AC 2GIVA 2B45X 2ARCA 5CZKA 1BR2A 1Q3EA 5LBFA 3WP3A 1D5YA 4L0YB 1TZOA 3LFMA 5KBFA 5A32A 3KLNA 1O3SA 4DYCA 3IDAA 2F5FA 3OF1A 4DUVA 1AKHA 1OLRA 4HKWA 2IFWA 3DCFA 4N4OB 5IT3A 4XFFA 2WADA 2BYVE 2XPUA 5D8KB 4IE6A 1I5ZA 4KYWA 4UFIA 5M3MJ 1VQMI 4CDWC 2I10A 3OYLA 2HVQA 3RZMA 5FZFA 2Z4FA 4CDQA 1XU1A 1QH7A 5D8LB 4CZCA 4IRGA 3HUGA 1KQ9A 2W39A 1F9NA 3LD8A 2R92J 3P3NA 4Q0PA 4JKMA 1DQ1A 1A36A 2HTJA 5KHHA 1YFHA 2D44A 4A3GJ 5CQEA 3L1PA 2XG3A 3WG2A 5KAIC 3ZKYA 1JZ7A 1GP6A 3DTEA 4BQWA 3MW2A 3VDCA 2OAZA 4X6AJ 4BQQA 4EE2A 2J42A 3CDHA 1TE1B 1J3QA 3WG7H 2VLAA 2KJCA 2YC0A 4P9YA 1EA3A 2O6GE 2P4WA 1QWRA 4QQOA 3ENRA 3DPRC 2J1TA 3KSCA 1XGSA 1W8ZA 4CU7A 4D6QA 2QSHX 3KP7A 2D3RA 3IRQA 3ZQHA 3IKTA 2VW1A 3B6AA 2HYFA 2QSGX 3ZMZA 3I4IA 5J4VA 1B8IA 3EUKL 4N7IA 4YM0A 5A7WA 4EM1A 3ZMVA 3WGIA 4K3UA 3FBNB 4R4XA 1FC3A 2ZEZA 1YOVB 2PQQA 4XONA 4LLFA 4BH9A 4LFUA 3UT0A 4AFAA 1ULDA 4DQ2A 4JX5A 3WW2A 2M2EA 4SBVA 5IVVA 3J80Z 4RS5B 4OIPF 3DN7A 2ICWG 1PIV3 2DK8A 2D6MA 4BDYA 4UV8A 4BAYA 2EIJH 3LWCA 2KDOA 2LD5A 3AZVA 5J1RA 4UW6A 4QPYA 4XFBA 4AFMA 1J59A 1CJDA 3OBTA 2QDRA 1V55H 1WMEA 2LBFA 4Q2FA 2RC4A 2HWVA 1RKTA 1W0PA 4GA9A 2M1BA 4HX8A 3NAPA 1J09A 2E5ZA 5HPOA 4HAMA 3VSKA 4HZFA 1QNTA 3D5LA 4FPFA 3TB0A 3ZYGA 4IHTA 1MEC1 2VH9A 1R71A 2IVMA 2R5YA 5IW0A 3RKXA 1VBD2 3OPTA 4DS0A 2AQEA 3TL4X 4XM3A 2H0BA 4DB5A 3MV11 1IN8A 5A3TA 5JOZA 4BJ0A 4M9SA 2EIEA 3J7AO 4GD4A 1JS9A 4GWIA 1RHI1 5EZGA 3JSOA 3NARA 3OYCA 4YGCA 3MAJA 1NQDA 1C5IA 2FEZA 4R9CA 3VKLA 1K5MC 5JPMB 3ELNA 3KYCB 2C6YA 1F15A 4K9SA 2RREA 3VBUC 3JUUA 4AQ2A 2QQMA 2X53S 5LY2A 2P5KA 5A6XA 3O7OA 5KHGA 5H2FC 2UURA 3T4VA 3AK0A 1YYVA 1WBLA 3TN91 2GAUA 2X5IB 2JJ6A 1O3TA 4IQ4A 3BJOA 1H30A 3VYRB 3MGUA 4JQRA 2IS6A 3AKTA 1Z21A 5FMBA 2ZKZA 2V1DA 2PXJA 5J7MA 5BNGA 4PT6A 1WW6A 5C44J 1X19A 2QQVA 5FZCA 2WINB 3ZFEA 4ARYA 3TEYA 2ELHA 5JXGA 1AUYA 1IKPA 4GALA 1ZHFA 4JC1A 2PMZA 1XB4A 4KG8A 1CPMA 3N7MA 1X9PA 1UAIA 1QJX2 4P55A 4TLGA 1BI3A 3M3EA 2JE9A 3I4NJ 3L09A 4EATA 1OKQA 3A23A 2VZTA 3MW4A 4YVSA 2EPFA 5JHUA 4MX3A 2BE5F 1MQTB 5FXVA 3JD72 1Z0XA 4HDVA 1UWWA 2E1MB 4QQ2A 4M6XA 4O65A 2JDZA 3FMQA 4KBZA 3VWBA 1H1MA 4H55A 3A01A 2IP2A 2DMNA 5GAGJ 1U8BA 4YFXF 2VJXA 1USSA 4I30A 4DZGA 5FLXK 3KM5A 3U21A 3A0KA 3S30A 1V5FA 1S0FA 2W1WA 1W8FA 1Y8QB 2Y9ZA 3FLPA 4GYIA 3RZKA 2HZDA 4C9YA 3RVHA 3VPRA 2VMDA 2CG4A 3HOWJ 5A7WB 2WAOA 3CDIA 2D1VA 4GAZA 3HOXJ 4HX4A 1J3RA 2JG8C 5DXDA 1J58A 2ZCWA 2WZPP 3VBUB 2ZMEC 1QJEA 2IUWA 4CICA 4J01A 3LDRA 3ZXAC 3UESA 5LBBA 1HCRA 4A7KA 1AVBA 5HDKA 1X3WB 5DS9A 4M4RA 3R61A 2B9UA 4W65A 3JAMK 3PJYA 1BI1A 1OKRA 2WFF3 4FP2A 2JWTA 2BOIA 1M1EB 3DLAA 4DXRA 3VBHC 2JE7A 4KA4A 1EY2A 2ZBKA 1QJX1 4BDVB 5FZHA 1NY71 3LMMA 2WNVB 4PZJA 3NJVA 3EETA 5IYYA 1BC8C 1ETQA 5LK5A 1VJ2A 4Y1XA 2PJRA 3FFQA 2E2JJ 4XBFA 3RGBA 3ZQ7A 5J47A 3USUB 1PZ8A 2C6SA 1ONVA 2WNVC 4EWAA 5HBAA 4CCMA 1QXPA 2KT0A 3UGHA 2O8QA 4NBQA 3QAHA 4HG2A 1G6NA 1QZEA 4CPBD 2PHTA 1PUEE 3K77A 1QBJA 1OLTA 1L7LA 3K4CA 4OHZA 1EV11 3K2AA 4A3IJ 2D2WA 3VSLA 3UJOA 3DLLF 4AEDC 4AWXB 2YU3A 3PUAA 4NJ4A 1RUJ3 3FMRA 5FWEA 1JUPA 4HKLA 2FBKA 2EIBA 3RJ2X 2NYYA 2VJIA 1ZG1A 3F72A 3DCQA 3W2WA 2WNUC 4BQYA 3F95A 2UXNA 1PM4A 2VVFA 2ZBJA 2VO5A 4TLFA 3JRBA 1YIOA 4L0PA 1GFF2 2Y69H 4NIGA 3I2KA 2UWAA 5IVJA 4RM2A 1U2WA 2ZMEB 4ASMB 5A7PA 1IN5A 5ED4A 2JUCA 4A3XA 2E1OA 2GIZA 4XKWA 5K7ZA 1AYM3 2D98A 1W6OA 3VBOC 3EUHA 3K4LA 1NA1A 5J37A 1POQA 1FP1D 3EB7A 2BW3B 2HQAA 1XJAA 5JXHA 4Q4V2 2QQJA 1R5GA 4OCTA 4OOIA 5HLGA 1GT0C 1S7OA 1VQKI 5HNHA 3U75A 3C7HA 2Q1MA 4IRIA 1RINA 3JBG1 3WTZA 4D69A 2ME0A 4GXLA 2F5DA 1DU3D 2BP6A 5ACA2 2VBWA 2XWJB 3FJSA 1FAYA 2QQPA 4HOOA 1OPCA 1VBE1 2VOXA 4BQ5A 1LODA 3H9JA 5K5RA 1REFA 1CX4A 3N7JA 2VJJA 2PN6A 4ET7A 3H5NA 3ZP5A 4YVWC 5FZGA 3BTYA 2XBO1 3C8XA 2GOMA 2Y6JA 3K70C 1QMJA 4Q4ZF 3RCOA 2ZGNA 1JUHA 1UOBA 1IDZA 1VAMA 2I2SA 5C9AC 3CJTB 4D7SA 4YEJA 4O9EA 4CXWA 5IAXA 3ILNA 5DTDA 2HKXA 3NEUA 2VM9A 1HX6A 5FMCA 3RG0A 4HF1A 1QEXA 1K5MA 2WAFA 3WE3A 3MHZA 3Q8EA 3W2AA 4CTEA 1VBE2 3VHRA 1R1A2 1YNAA 2G9ZA 2XHNA 2P5LC 2HGCA 1Q8SA 1ZGJA 3ZRGA 3ABLH 3OUJA 1D2QA 2P6SA 4AVCA 5L7OB 3RDIA 4CCLA 1J5YA 5EJCA 2VCCA 1JTXA 5LWBA 3LSIA 1KYZA 2VONA 1FJLA 2FUG2 4NC6A 1SEUA 3VKOA 1NE6A 3FLTA 1NX9A 4M0HA 4TYSA 1KGYA 1GNZA 3E7LA 4ZTFA 1V6LA 5FZAA 2XR4A 2JA6J 5EGOA 3SFIA 3K4NA 1IHMA 4L11A 5FJHA 2G9GA 1UOJA 3JCUC 3NVCA 1WWYA 1WD4A 2XDVA 5J36A 4G94A 1FPN1 2HLEA 1WPKA 2GSYA 2V5YA 5E6HA 5K0UC 3MBWA 3ZSEA 4FCYA 2B4KA 3BPSA 4IHSA 2ZOEB 2MC3A 3V56A 1D5VA 2R1DA 2QBXA 5JUVA 1G2HA 2CW7A 4QKBA 1G86A 2XF6A 2B63J 4YGEA 3WINE 3HQXA 6PAXA 5DUXA 3J81K 4Y15A 3VBHA 2XJVA 4ZTJA 1W5SA 2AC1A 3JBG2 3N97A 3LEGA 3CMEI 2LW8A 1K79A 1R4NB 3ROUA 1NQJA 2M30A 1AL22 1YS7A 1KS4A 1RVF1 2Y26A 4COUA 3DEUA 1JUMA 4MGIE 1NTCA 5DUUA 3LCPA 3IMMA 1GQHA 1DGRM 1SFOJ 1GVJA 2MLKA 1IS4A 3ECOA 3WZ1A 1TL8A 2GWRA 5JVGF 3HBKA 3EBRA 2W57A 1MACA 3ABMH 2YS9A 2GC0A 4UHTA 5DM7F 4HKOA 1R1TA 1QJZA 2XJSA 1IG3A 1HXDA 1X1PA 2OQ6A 2W4SA 4YVWA 2RE9A 1OBNA 1K61A 3I0TA 1NCQB 3AP6A 1JHJA 4BY1J 2HU9A 3VOEA 2A7AA 3X2QH 1REDA 2J1SA 4CZZA 2HZTA 1ZRCA 1WLCA 2P3YA 3UGGA 4CCKA 2L9VA 4XUPA 1VMFA 2OPTA 5L3GA 3J7ZI 4L9JA 2A6HF 2YHJA 5J48A 1XPWA 2WO2A 4AEDB 4CDQC 4XMIA 3JQXA 1LQ1A 3TDUC 2ID3A 1MD0A 2W1OA 1QHGA 2FDKA 4KMUX 4P9GA 2MH9A 4AEMA 3UETA 2WT1A 3KGZA 1F4HA 2R49A 4G9SB 5J40A 2PELA 2LG4A 1TC3C 1OVPA 1MVEA 5C5UA 5DQ0A 5C3SA 1FYKA 2FJ1A 5LB6A 2XBO3 4PF5A 2WO7A 1GZCA 3HQUA 3VHNA 5EPAA 4GWNA 2VZ3A 3RPQA 1CAUA 5DG1A 1NXMA 3ATGA 2L7ZA 4PFPA 1FBQA 4IHYA 1JYCA 1TZLA 3CJIA 3D5OA 3GZAA 5KXCA 3KHBA 2X1CA 4YW4A 1XYNA 1LNSA 2ZGOA 4EQVA 4FXKB 1DYOA 4AD9A 5FO8B 3U4SA 2VZQA 1AXZA 2JG9B 2FBHA 2VL8A 1SLLA 2RS51 2JQ7A 4NC7A 5FPBA 5EDNA 3BVCA 1F31A 2ZS6B 1MW7A 3DKQA 3CJNA 3H3UA 1JKPC 3KZZA 2WT2A 4BIFA 1X33A 5FKCA 2LRPA 2QLZA 5L36A 4ZYHA 1K5MB 4XJZA 3HJRA 1K6YA 1SFNA 3A22A 5B4NA 4OUMA 4CUBA 3WDUA 4AFDA 2C9KA 3SZGA 3LDBA 4HN1A 2XSDC 1OR7C 1PO13 3HOZJ 3GYDA 4Q4V3 5BNNB 2RR11 1DGRN 3ASNH 1LJ9A 4ES9A 4QKNA 5FY8A 5DEQA 2EIDA 1LR5A 1EAH2 1H8TC 3WNOA 2V26A 4ENKA 1DP0A 5JAXA 2YGLA 4AG4A 2FBEA 2DWRA 2VXJA 1XB9A 4HN0A 3FHAA 2W52A 4N53C 1IS5A 2HFHA 1HSJA 1BVP1 1V9U2 1GBGA 1ULYA 3PU3A 4QQLA 1YWKA 4YG6A 3PNAA 2D7FA 4BEHB 5FRMA 1U0AA 2NAZA 1TME3 4HA8A 4O7XA 4EGYA 3TN92 5CLSA 3K69A 2Q8KA 2WZ8A 3ES4A 2Z99A 1DPUA 3KP4A 2Y75A 2QM3A 4LJZF 4MGQA 3CMGA 2PMUA 3GMEA 2HWE3 4CSWA 2D1HA 3OTFA 5F27A 1LGCA 2WSUA 1W90A 4JGYB 1HDDC 2MC4A 5TISC 3HPNA 5FZ3A 2CMPA 3ZSLA 3J8F3 2GN7A 2W82A 2BU9A 4XRSA 4XACA 2P7VB 2HWF1 2HEYF 3RZOJ 4OFGA 3GFMA 2UY9A 3QWLA 2WN3A 4LLOA 2CV0A 5G05L 2IS1A 4KL1A 4RMNA 3M8JA 1HQCA 2IRFG 1K4TA 5TJJA 1WKYA 2AENA 4NHMA 3P3PA 3KT4A 4V1PA 4L9TA 2DCTA 2LY2A 5AIQA 1GLHA 2VBYA 4ZDOA 1LEDA 2RG4A 1L7QA 1VMHA 3LIHA 1QZZA 5KHJA 3ZYIB 4IESA 4IHVA 1KJLA 4XUTA 1UX6A 4S04A 1ZZBA 2BRTA 3LAGA 4R9AA 2FXAA 4UUSB 3TOBA 4ETSA 4D8MA 3BG3A 5FUNA 3NAUA 2CUFA 2LROA 2ZMKA 2YX4A 4R52A 2ECBA 2CY6A 2VE1A 2OX0A 2VOPA 2WWUA 1PIV1 1ENQA 4NR1A 1O7FA 3WU2C 1LKXA 3CL1A 2H09A 1X3ZB 2UWCA 5FB2A 3MIGA 5EEGA 3ZN1A 3JRHA 1O5LA 2VTFA 1Y9QA 4EEFG 4O5VA 3ONQA 2NMOA 4QX1A 5JI9A 2ZKLA 5CFCB 1WMFA 2DK5A 3UV9A 1APNA 3WU0A 2G4IA 4AI0A 4L97A 1V00A 3NRVA 1XTAA 1IV8A 2ZJCA 2WQ8A 4Q26A 5LY1A 3T09A 4P96A 4LG0B 2W3JA 2XJQA 4QGMA 4I6ZA 3WU1B 4AWDA 2Z33A 5FBZA 3O1UA 5I0UA 2ZX2A 3P1IA 1UHSA 4OIOF 1O4TA 3HG9A 5H6RA 2KLOA 2OUHA 2V5DA 4IQJA 4J19A 2LOOA 3OYMA 2W1QA 1IS3A 5EG0A 2DFIA 3OB8A 2WRAA 4E2GA 1UELB 4OQ9A 3D5SC 2D5FA 3RYKA 2KHMA 3PVOA 2RMU2 3GCWA 4BK5A 3IDCB 1KU9A 3ZN5A 4YG3A 3KP6A 2W2IA 3COAC 4DUXA 3FLRA 4ISRA 5C5TA 2R5ZB 2Z16A 2KJBA 1W2OA 2NVQJ 1A5JA 2XPJA 5E1WA 1W6NA 1WI9A 1WJFA 2ID4A 2RV9A 4OLLA 1YXWA 3D0JA 4AAPA 4D7NA 1A6QA 5FYUA 2UUZA 3OD4A 1ZBE3 4Z07A 1ENSA 4U87A 4DFSA 4CCJA 3ASIA 4LNVA 4RAZA 1EUUA 5H9RA 5EV7A 2AXLA 3L2WA 3OYBA 4NHYA 1XSXA 2NMNA 1D4M1 2BPA2 5EYRA 1ENHA 2Y6HA 2PAMA 1OSGA 4BOWA 3OYWB 2KZGA 4KMQA 2YU9J 2ZXHA 2VQAA 2WZR2 3H35A 1N75A 2PLV1 1EJ9A 4JAAA 2AGSA 4MGSA 1EV7A 5IOZA 1W06A 3NJZA 2WABA 4F7ZA 1AR91 4MUVA 1I1SA 2CRGA 4MYEA 1NHAA 1Z9CA 2RDSA 2VZRA 4C8DA 1ORKA 4C3IJ 3ACGA 5JSRA 1D8KA 4OWRB 4MSVA 5E1RA 3FXMA 3MUY1 3FDYA 5J1XA 3REOA 1Y56A 2K9MA 2GXAA 3Q5FA 4YZ1A 2HBUA 2MEV1 5E18F 4CUAA 1FATA 1YHQI 3IKVA 5LATA 2CWSA 1MJBA 3JTGA 1QZYA 1BEV3 1LOCA 2R1BA 1X7NA 4YZ5A 1Y1VJ 3J8F1 2Y6LA 4FSJA 2DYCA 1H8TB 3QACA 1SBFA 5DN2A 4Q47A 3M1EA 2IA1A 2QQLA 1YJLA 2VASA 3BP8A 4PJ0C 3EYYA 1UFMA 2RAEA 2WWYA 5FV3A 3QYFA 4R79A 1Z1DA 3W6JB 4LOSA 5SV8A 2JDPA 2XVGA 2Y38A 4V2FA 5IYCJ 4DYRA 3WHUA 1FMWA 2ECCA 1Y43B 1OVSA 1X2MA 2QE3A 4BMBA 3F22A 3CC4I 2FDFA 4G4FA 3HDDA 2DVBA 5I8SA 3Q8FA 5JR2A 3VKFC 1XX5A 2QZ3A 3AZXA 1PNGA 1VZ0A 2PHLA 1GZ9A 4DOZA 3ASOH 2RMU3 3MMYB 3I3EA 5HCBA 1GOHA 3GX4X 5JIAA 3GXOA 1W8TA 3OGRA 4IE5A 1W36D 2QWWA 3VZMA 1LTEA 1WKMA 3A0NA 4FPCA 5FZ8A 2A3XA 1Y8RB 3DPLC 3PIPF 2VCAA 4RB0A 1J75A 2J1EA 1X1CA 3FBMA 5FKLA 4D0PA 4EJRA 1CAWB 3NJYA 2MPFA 4LHNA 3H8OA 1OOPC 3HKZA 1MMGA 3DXTA 3W9AA 1SFEA 3C7OA 4W1UA 4KISA 1COV3 1U5TB 2ZXJA 1PVC3 4I98B 5E3OA 4UW3A 2EFOA 3ZN4A 1SVLA 5D6FA 5F5AA 1RUH2 4GMP0 3GTGJ 2RQQA 3F6OA 1VQOI 5FP7A 1UN1A 4AYUA 4Y52J 3VD5A 3AG1H 3BPZA 1V70A 1JXNA 2ZSIB 9ANTA 3POIA 1YE9A 1ZARA 3PO2J 3FM5A 1HXS2 5T50A 3JW4A 1VB2A 1ZRRA 5IK8A 3DQVC 3WTWC 3WTYC 5C4WC 3MIBA 1GMMA 1PHMA 1UAAA 2A61A 3GF2A 2DDAA 5LHGA 1ZREA 3AB0A 4E6KG 3AJZA 3M3OA 1W9TA 3WLUA 1UG2A 4U7DA 2Y0SN 3LEIA 4E2SA 2R041 1HSTA 2CW8A 2WN2A 2JDYA 2M3AA 4PCQA 1MH4A 1FI2A 1Z91A 3ACLA 1Y4WA 4PLMA 1MBEA 1RMU1 2XQXA 5T5OA 2VXRA 2Y31A 4H14A 2RM23 2RJKA 3R0JA 4GGGA 1YRNB 3U14A 1VIWB 4IX7A 2EINH 3RNSA 2C26A 5ABJA 4UBGA 3EHKA 1VRH1 2NS0A 3S16J 4ZS2A 1G9AA 4KIBA 3FF5A 2FU4A 4XSXF 3QYEA 2BTVC 5IWFA 3H1CA 2YYOA 1SCSA 1MMAA 4QQPA 2PAEA 3AYDA 2PAKA 4ESFA 4L9VA 3ZMNA 1V6KA 5JMCA 1G3TA 3DKWA 4FQ4A 4OMZA 4XDOA 2DT6A 3GM8A 4DOUA 4MFEA 3VBFB 2VMHA 1PYVA 1IKQA 2YUEA 1AJKA 4IEPA 2FA5A 4RGSA 1RHI2 2A5YB 4BQNA 5IT9Z 2CH0A 3PM1A 4AYBA 2JDAA 1Y39A 3J4UH 2CV2A 3FXRA 2FRHA 5GLWA 1N78A 2FQ3A 2ZXIA 3S3MA 1X9TA 3AP7A 2WQ4A 4J1WA 4B47A 4A4AA 1TW3A 2ZXWH 2VBDA 4HF0A 2QKDA 1W8OA 1B9MA 3RQ4A 1HRV3 3KF3A 2PQSA 5HCHA 5FREA 4KIGA 1ZQ3P 1T98A 1G9BA 2VC9A 1IJWC 3FE5A 1UIKA 4ZC3A 1GKBA 5E88A 2M9HA 3MN2A 1GXQA 3O5SA 4QB1A 4QPGA 2RV8A 3QPTA 1U5ZA 2FD5A 4CCDA 3G7DA 5EEHA 3WQ7A 1AR92 3ZQLA 3RZGA 2H0VA 4LBQB 2EXJA 3LSJA 1LEBA 4MXVA 1IN6A 3TO7A 4JVAA 3ZR5A 4RGXA 3ABZA 1UJ8A 5ANQA 4QHBA 4QX8A 2HDWA 5EYYA 1P6RA 1QQIA 3R0RA 4M3CA 1H1IA 1GV9A 3HNYM 2E7WA 1R58A 1S0GA 4AUXA 4UW4A 1AR81 3AC0A 5FMOL 1R9TJ 1NCRA 5L3CA 2BUKA 4YVWB 2ZGUA 1SLIA 2EV5A 4DGWB 2NNYA 4XCAA 2WL1A 5FP4A 2OW4A 4E7HA 3R0AA 1ULFA 2KM2A 3T2OA 2GP3A 4E2QA 5C33A 2BBYA 3LDKA 1V54H 2ZXQA 2XH6A 2G19A 4YSFA 1T6GC 1U9OA 3OYEA 3KMHA 1FOD1 3J7NA 2E51A 4PJLA 5HXVA 1YJKA 4Q4W1 1NKGA 2BEOA 2LKSA 1V4RA 3T0AA 1W8WA 5CVIA 2JRTA 1CESA 2BGOA 4WXHA 2K5CA 5F0FA 2UY8A 4HK9A 4QB6A 3KQ4B 1FNZA 2KD7A 4FE7A 5FKKA 4Y7NJ 5LZ6A 2V9PA 1LEAA 3AZYA 1UY3A 2F4LA 3A01B 2Q4SA 2FZ1A 2AEYA 1LHVA 2JZYA 3SKJE 4FPLA 3ABUA 2VQLA 1ZTRA 1V6NA 4M00A 3WTVC 4HT1T 1JODA 2LBFB 2MA3A 5A80A 3TBIA 4E7IA 4FVVA 1PO11 3OYHA 3FHIB 2R7TA 4LEJA 4U7BA 3EUAA 4TTGA 2VJ4A 3PUIA 1UO9A 4DZPA 1TNRA 4J1XA 3GZUC 4CEWA 1UPSA 3EO6A 1OR7A 1IRFA 4Q0VA 4D9JA 5L19A 3GDBA 1X1DA 2OTLI 4ZDLA 1IS6A 1B59A 2E32A 4EJWA 1TW2A 4G7ZF 3TOJA 3F9KA 3SITA 5CYYA 4DINB 1BOBA 4A3DJ 4Q0QA 4EM2A 5D5XB 2NVYJ 1AX1A 1WCUA 3VBRC 2MD5A 4D5CA 1GXPA 1VBC3 2OPKA 4XAAA 2ZGRA 2BDRA 3VDBA 2X85A 2A6TA 1N1YA 1H8VA 2JDHA 4FPJA 2IGOA 4XTMA 2WT0A 5C3QA 3LL7A 4C1XA 2PJRB 1WQ2A 4XJ8A 3CUQC 2B0LA 4HW0A 1LU1A 1W7PB 4U0YA 1QIQA 2O03A 3H0GJ 2MLGA 1BLZA 2TDXA 4M72A 1QQP3 5FOJB 1BEV1 3L2YA 3PIJA 2HQNA 2R7EB 2OYZA 4ATEA 1CX1A 3U11A 3ZXFA 2STWA 4AFBA 1ETKA 2DURA 4CDXB 1IPJA 5FK8A 3GEZA 1XCVA 1SAUA 1ZZ9A 4A3CJ 3SISA 3W5NA 1QGPA 1DZTA 5A32B 1R1UA 2GMEA 3CUOA 5BMZA 4Y1ZA 1UMQA 1LHWA 4FOWA 3FMGA 2JG8A 3SZTA 2HWF2 5A7QA 1OOPA 2R072 5C4WA 2XVKA 3V42A 2QKLB 2RNGA 2J1UA 4IW3A 1W4MA 3T4HB 1IGOA 4WVMB 4BISA 2Q5TA 4QGNA 1A8MA 4D5FA 4J6GA 3WSOA 2W46A 4A3JJ 2TBVA 4QHZA 2TRTA 1S1AA 1R5HA 4GWMA 1ZVFA 1QJU1 4CDUC 3AYEA 2BBAA 2VI6A 3U1XA 2A5WA 1VBA1 1H8AC 4ZYGA 1WJBA 5I93A 5HXMA 4CP1A 1PMIA 1EAH3 3INAA 3NNGA 1LESA 5JI6A 3ZXLA 5FZ6A 1AR63 3GYHX 2X6YA 3K7AJ 3RJRA 1VALA 1TMF2 1CAVA 3WDYA 5SV5A 1QNWA 2KPMA 2NPIA 2HYGD 1LOEA 1F4AA 5FP8A 4RN5A 4GH4C 1D0YA 3ZR6A 4RM3A 5B66C 1W04A 2RR12 1VTNC 4AFCA 3JCIA 5FYZA 3HN1A 4R9DA 5JXJA 4OULA 4A0YA 4K1ZA 4BU2A 1W0UA 5LBQA 1IN4A 3ZCOA 4IEVA 3I49A 5A1LA 2YPRA 3PUQA 2VOOA 2JB4A 4LE3A 1AR71 4COWA 4N90A 1KD7A 3KZ4C 3BI3A 1GLNA 1SDWA 1HLCA 3MF9A 2E9QA 1XYOA 2LDUA 5A1FA 4W8JA 2DA2A 3L2CA 4IERA 5JLWA 3HOYJ 1LE8B 1DIWA 4EJVA 1WWXA 2WY7Q 5FZDA 3ZYRA 4URAA 1KQ0A 2BJSA 4UNOA 3BR2A 3R4SA 2NNNA 5CBLA 4QAWA 2A05A 5CB7A 5A6YA 2Y0SA 2VR4A 2WLQA 2X6XA 3H42B 1S72I 1R082 2ZHNA 3L7WA 3PMSA 3IPVB 4XILA 1UZVA 1BC7C 1YQCA 1CD3G 2BXZA 2EFQA 1MNDA 2ZAHA 2KR2A 3LIGA 5F6KA 1SFUA 3IBMA 2W68A 3RKQA 3T1LA 2WO1A 2WDBA 5HLTA 1T0FC 1LENA 2MW8A 1UIJA 1IV6A 4BL0B 2CL2A 5FZ0A 2XWBB 4A3BJ 1PGL1 4QM9A 1LOAA 1P4AA 3WF0A 3R6SA 3CJXA 3J81Z 3VD9A 3VDXA 2F6CA 2I5UA 3AKRA 1TWHJ 4F55A 1RKWA 2F4PA 1C57A 4WF2A 1XMAA 4IF4A 1IGNA 3I8TA 1MBHA 1VQPI 1WCQA 2E26A 2O8OA 1HQNA 2JMWA 1ASJ1 3GTQJ 3DP7A 4OAZA 2GQQA 5BV6A 4JOMA 4IEZA 3PL0A 4YW5A 3C7EA 1R091 1HRV2 4RS5A 2XQRA 1MBKA 4KWLA 1DG6A 3N9QA 1ZBE2 2P1BA 4DMIA 1C1FA 1GZWB 1JYIA 5GALA 1UX7A 2ZZQA 5T5JA 3F0CA 4NQWB 3GBWA 5C4WB 2UWMA 4PBPA 1DYPA 4S2HA 3LPGA 1RUG2 1UG0A 1QNYA 4XORA 1IRXA 4COZA 1WGXA 3H5AA 3RJPA 3ETPA 1A6CA 4A44A 2QKMB 4AVTA 5L3BA 1UYZA 2ZGPA 2EZLA 4KWJA 2D5HA 3URFA 2ELKA 1KS5A 4XRFA 1YCIA 5IK5A 1FX7A 4AM3A 4K40A 4AHWA 1WCSA 4XEZA 2MNGA 2K86A 2QFEA 1RUOA 1GSLA 1NK2P 2TNFA 1WUVA 1YLLA 4Q0UA 4XOGA 2BOJA 2HQRA 4XMYA 1NXD1 3KP2A 1T56A 4B3AA 5FYIA 1JUSA 3QLQA 4GIQA 4L0ZB 2GM4A 3BWGA 4Y22A 4J00A 5FP9A 1HN0A 1JJ8C 1KDKA 2QDNA 4FP3A 1J83A 1DLCA 1L7RA 5J8CA 2GXGA 5BPDA 2JX9A 1QQP2 1Z3YA 3B7MA 1KQRA 2HOTA 2ZX3A 4QX3A 4L99A 5JHFA 3RZJA 1QOSA 1UQXA 4ONUA 1W28A 2LTNA 1W1WE 5F8PA 3UGFA 2XB5A 5T3NA 3WXPA 4PHZA 2OXBA 1QHDA 4OI4A 5HDNA 3HOBA 4C3JJ 3SNMA 1JI6A 3HTUA 1PUFB 3I59B 1MS1A 1O8PA 1IRGA 2VTXA 2JA8J 2VQGA 2AR6A 4HK8A 2DLLA 1XE8A 1RGSA 4XBQA 3MIFA 3VBSC 5FZ4A 1DQUA 5GLVA 2P8TA 1KA8A 3CDLA 4UT5A 3ZXEA 2R7QA 1S55A 4ESJA 4PBOA 3TEWA 5CJ9A 3H1YA 1H9GA 3PUFA 2QA4I 4I76A 1KRIA 3I2OA 2XROA 1QDOA 2BQPA 1D1BA 3F8CA 4CU6A 4CXYA 2EZHA 2ZGMA 3QRFF 4PDWA 3HL2A 4OI1A 3K70D 3V0AB 4ZY9A 4UW5A 2YC2A 4IV1A 4I99C 1PP8F 3IAQA 2M34A 4QKDA 1L0OC 1TBXA 1IZ3A 1OCCH 1TMF3 4X8NA 1JT0A 1SLCA 2F2EA 3TO9A 2VXZA 4BXFA 3BTLA 1FY7A 1XDUA 4H4KC 1JKOC 5FLJA 1LVAA 2XB0X 5FZMA 5EQUA 4A69C 5BY5A 1NZIA 2H8RA 3P6BA 1TP4A 3V8JA 4XN3A 3VL9A 1HJFA 1BZWA 3J7YJ 2ARXA 1JZ6A 3OEBA 3T2TA 2DFHA 5A6ZA 4II2A 2KFDA 3KQRA 1ZG3A 1R36A 1AHSA 4L18B 2OD5A 1J1LA 1Y9GA 2E7TA 1I1EA 3MFAA 4A45A 2ILMA 2W0XA 3POYA 2EXKA 5IUQA 4GKYA 5FKBA 2M8EA 2F17A 4N4NB 5B1AH 4YVSC 1W8NA 1GZWA 4AQSA 1P7IA 3OOPA 4BJ6C 3K4AA 2MGQA 1KJRA 4LK1F 3QH7A 3V65A 4JGYA 1W9YA 2I45A 5JOYA 2W1SA 1P8JA 4B4CA 4QU2A 1JZ3A 4EN8B 4B4PA 5K1YA 2ISYA 4Z82A 3WUCA 3LA7A 1MMDA 1SD4A 4M6VA 4QPQA 1MBJA 5JZGA 3B01A 2R073 1JTYA 2FCUA 3CF6E 4E27A 3WTSC 3BIWE 3SCHA 4CA9A 3AXEA 5CPRB 1BJZA 3AKSA 2DW4A 4Z8BA 4AL9A 5B2GB 3WHCA 3DU6A 4QWNA 5F2WA 1F35A 4DZJA 2CGNA 1LVKA 2QENA 2IW5A 2OJED 1HRI3 4B09A 5FZ7A 1SC7A 5DMYA 4FFFA 5JOXA 5FYCA 5F9TA 4WXDA 1C5HA 2QZ2A 4GO1A 4BNCA 3V64A 1W6QA 4AI3A 2QJVA 4YLZA 1QA6A 5FY1A 2AHQA 3RWNA 1XU2A 5LEJA 1SBEA 1DP3A 4ASKA 2DO7A 1XNBA 2E2HJ 3S7IA 1MS3A 2FCVA 1R083 2FCTA 5T54A 3B6CA 1LKNA 3W5MA 4XBNA 1OQYA 2WV1A 5M5YJ 4AE2A 5JZGC 5CFCC 3WNMA 5DCMA 3QP6A 2ZZJA 5KHIA 5BYNA 3H3LA 3VB2A 1FV2A 2RHPA 4WM8B 2D6LX 2D6KA 5A33B 1ZGWA 3IC7A 2ZHKA 1FOKA 2F5EA 4H7MA 1J7KA 3S8PA 4JDOA 2VW0A 3S2HJ 2DT7B 5EGOB 3FMSA 2I07B 4ENNA 4AQTA 1W9SA 4P9IA 5DD4A 3FZ3A 2STTA 5FLHA 3NAPB 5AVAA 3N05A 4PQ9A 2K4JA 3PQKA 3OY8B 5IJRA 2O61A 1J3PA 3UNGC 4MHUA 1STMA 2KIFA 4Q4W2 3HYIA 2Y6KA 3JAMZ 1AU7A 4IZZA 1DGRA 3DPUA 1FX5A 3NMBA 3ZLIA 1X58A 3VL8A 1F4KA 4NAOA 3H9GA 1R1VA 2ADEA 1OYWA 4YGDA 2ZNYA 3M8FA 5FY7A 4LHSA 3CUQA 1B35A 5HLIA 1S7AA 2LFBA 3DPTA 2Q30A 1AR82 1IG0A 1MNMC 2DT5A 2A6EF 4DW6A 4X0GA 2JK3A 1YQ8A 2CQKA 2DCYA 3SQNA 5A2QK 2V72A 3MYXA 5LLQA 4CXXA 3OEAA 3CCEI 2GLOA 2WYSA 3FKJA 1DQ2A 4YM2A 1W9WA 1ZELA 1MGTA 1Q8VA 2I8DA 1ZZ8A 2M87A 4LKSA 4QXKA 5FMOS 1LHUA 1ETWA 2DV9A 2JKXA 2XAFA 2EZIA 4PJJA 1XQNA 3CBNA 3LSTA 1XPXA 3C1DA 1AYM1 3M8LA 3T0DA 1G9FA 2L7FP 1R23A 1H9PA 4FT8A 4XKBA 1A35A 2LTPA 3CMAI 1W7PD 1ZRDA 4ASNA 1SFYA 1HRV1 1ULCA 4FPOB 3LFIA 4A6EA 3D4KA 4C1WA 1VPHA 2ZACA 4B7EA 1MNEA 2AACA 3EMRA 1OCZH 1AHDP 4AGVA 3I2FA 2ZEXA 4CDWA 2R071 2W9XA 1RITA 3KEOA 5JIUA 2VGDA 3QPSA 3FK6A 2CHHA 3K4MA 1V9U1 3ZMTA 5I91A 1POGA 2JUGA 2Q8CA 4PQQA 3NAPC 1XNKA 1HC8A 4Y5Z0 1KQ8A 3S5QA 2YX7A 3IKWA 4UWDA 2BERA 2BY3A 5FZOA 3HPGA 1BIAA 3HZJA 3H0OA 4N9HA 5KC6A 2GALA 2DUQA 3KFWX 2HWB2 2L5QA 1HV0A 4BXUA 2OVUA 5ANNA 1WH5A 3W2VA 3KP3A 1XE7A 5C9AB 1PJRA 1MSFC 3WEZA 1HN1A 2RS53 2YGMA 2VB6A 5IY5H 4JCKA 3FKIJ 1G9CA 3BU7A 3BG9A 5CNAA 4Z6YA 5A3MA 4PLOA 2X6OA 1Q8PA 1PM7A 4NIAA 3BZ6A 3LGRA 3TOAA 4RLFA 4IE0A 4IUGA 5DUKA 1TTYA 3VEPA 2W91A 5CFDB 1DGLA 1YHFA 3I2IA 3KD4A 4BBRJ 2X10A 3LOBA 3F8BA 1V6JA 1XN7A 3BB6A 4I0WB 2EFWA 2VUDA 5DCMB 4A5NA 1QF3A 4EN0A 2ELJA 3VBFC 5FJKA 1FSHA 2FSWA 4MXWB 4J25A 2ID6A 4NO4A 4ANJA 2P4EA 3HMYA 1JGGA 1REPC 4CDUB 5FPUA 5AC92 4BACA 3HPHA 3I5UA 4CE8A 4A0ZA 1DZQA 5LFAA 1B9NA 3PNYA 4JHTA 1RUE3 3ZSKA 1W6MB 1V5GA 3OYIA 5ICCA 4Q5OA 4LLLA 4MGKE 1YQAA 2VJ5A 4XRSG 2P5VA 3H1WA 3KV4A 5L73A 3VZNA 1Q8OA 1SANA 1JMUB 3BTXA 4IEWA 4AI9A 3S2DJ 2ZTNA 4ZZ8A 3PJRA 2JDNA 3K4BA 2WSVA 2WNOA 1S0BA 4QHOA 4GYGA 5FZBA 2VTXJ 2WFF2 2VMFA 3O14A 4LBMA 2CUJA 4YW6A 2A6XA 5JVTA 1T0FA 1HB2A 1UZYA 5K7FA 2ZO4A 1RJ8A 2KKOA 4PI0A 4CU9A 1QJU2 4Y13A 1O5UA 5CVUA 5HLHA 1ZX5A 3E5UA 3TNPB 3B73A 2ZMEA 3F23A 1AR73 2FMDA 1BBT2 2Z42A 5FO7B 4UUTA 4Z92B 3ZFFA 5J4YA 3ST7A 5K5OA 5LGUA 1HKSA 4Y4YA 5F08A 5ICEA 1CR7A 1AOYA 4JQTA 4XOTA 4GULA 2XAHA 4Q4Y3 3VUOA 2L2OA 2XPVA 2DBIA 3TN93 2VG9A 3O0VA 4K6BA 2DCEA 5I8YA 3SQOA 2BVLA 5B5EC 1ON1A 2MFZA 3HOVJ 1C8M1 1ITYA 1D7PM 3ELKA 1EP0A 4F91B 4PIXA 1J0RA 2CQQA 3HHHA 3PTRB 4YM3A 1PVXA 2W7NA 3JSPA 4NRQA 3FX3A 1TT5B 3CF5F 4LORA 2A6YA 2VPLA 4OVEA 2PHFA 1EV13 4QX7A 1AR83 1D3YA 5EEAA 2K46A 5T55A 1AX0A 2WQZC 1UY2A 1ASJ3 5L7OC 1RUH3 1G9DA 3C7JA 3HGGA 3KZYA 1IXCA 1ALYA 1SFKA 4P02B 2R7ZJ 2JIGA 3WF4A 2VODA 3IN9A 3MZ8A 4I2OA 4XAEA 2WA4A 3MFKA 2B5HA 1HXS3 4UOJA 1JJ6C 4QTRA 1RR7A 4LG0A 2K0GA 4XLCA 5GPCA 4XF9A 4B3XA 3SKVA 2JA7J 1ULOA 1UMIA 2CFOA 4MOAA 1ZRIA 5FKMA 5C6CA 3BROA 2CUEA 1YEWA 3CCJI 4ZYAA 2IFRA 1QQP1 1Z6RA 4YFZA 4YNIA 1OISA 3FXQA 4OAYA 3LA3A 4K2EA 3HSRA 2EIMH 3ZYHA 1YRZA 5FUIA 5FROA 3QBQA 1S7EA 3TYJA 4F52A 3ULQB 4IE7A 4XF3A 4YG2F 2W92A 5M0TA 1DDLA 2XJTA 1K5JA 4CP2A 1DDNA 2YZ4A 4MXWA 3B9IA 3S1RJ 3DYMA 4XIKA 2L9NA 1NT0A 1NLSA 1W6NB 3CC2I 4AC0A 4KI5M 2ZJ2A 5FIXA 1IO2A 3BOQA 1V6MA 3GUDA 3H8XA 1B09A 2A3SA 4FISA 4N53B 4C0HA 4RHV2 1NG0A 2IXLA 3ON7A 2NVXJ 4RQPC 2L9SA 3FFZA 2O7OA 1JOJA 2ZA9A 3AKQA 3H8UA 3SYTA 4ZZDA 2M5WA 4UB8C 3R60A 5JSPA 4XFCA 1OFCX 4CUGA 3JZVA 5HS7A 4GDFA 1FOD3 3GFLA 1G59A 3KCXA 1XGOA 4GB33 3JD71 4K8FA 4HQEA 5LRRA 3Q8AA 1JOBA 1UXZA 2CV6A 3S57A 1OQDA 2RGVA 5F1JA 2RKHA 3M4OJ 2RS52 1I5PA 2ZB9A 5DAPA 3O3KA 1AR62 4W50A 3CJQB 2TEPA 1N3QA 2GZWA 2M45A 3GHNA 5J98B 3S2WA 1UU4A 4QMAA 2WJSA 5J3UA 4RB2C 1DYKA 4NIHA