2CGPA

Catabolite gene activator protein/dna complex, adenosine-3',5'-cyclic-monophosphate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*CP*AP*CP*AP*TP*TP*AP*AP*T)-3')
publication title The structure of a CAP-DNA complex having two cAMP molecules bound to each monomer.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 66
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 1997-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cgpA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgpA01
3M70A 4NVPA 2PHDA 5FDBA 4M72A 1Q43A 1ONVA 2D45A 3J81Z 2A61A 1H1MA 2MHFA 4IEVA 2Z99A 5DDGA 1U5TA 1EPZA 2M30A 1Z9CA 4HSLA 4ZU4A 5IT9Z 3BOQA 4KU7A 3HIFA 4FBFA 4HYEA 3TDZC 3ERED 4A2UA 1RZ4A 5JR7B 2W24A 3R4KA 4AIKA 5BOXA 2N7GA 4DNCA 2GIVA 4WXHA 1ODDA 2EV6A 4MGRA 2BGCA 3CUQC 1Z6RA 1PUEE 2STWA 2G9WA 2B8MA 5BY5A 1D8JA 4ESFA 4IESA 3BDDA 4EGYA 2VT2A 3S7IA 2RC4A 1W4MA 1QWRA 2CSOA 2KJBA 1UW8A 5C8WA 3VFZA 2DT5A 3L2HA 3FMSA 1J3RA 4S04A 3H1YA 3OD0A 4I02A 3RKXA 2VODA 3CUOA 1ZHFA 1O5LA 1B59A 3PQJA 1IN4A 2BEOA 5FFXA 3EJKA 5KHHA 3V8KA 1Z6TA 1S7AA 2LNBA 4OINF 2VE8A 5FLHA 2XLFA 4IF4A 4QX5A 3OGJA 3IKTA 3FXQA 3OF1A 1DZTA 4Q29A 2OQGA 1R1UA 2MLGA 4GYGA 3G3ZA 2R3SA 2H6BA 4I01A 5FFZA 4EMSA 4CXFA 5LRSA 1KQ8A 1BI1A 3ISPA 3U2RA 1ZG1A 1GXPA 4HLTA 5JSRA 2EFQA 3HRSA 4A12A 2ZNYA 2FMLA 3HT1A 1XMAA 4PIYA 4UVBA 1FBUA 1LVAA 4KUMA 5E17F 3T1BA 3WGIA 1EV7A 3KSCA 3KGZA 4MGZE 5HDGA 3WTXC 2KRFA 4PDKA 2JPCA 2D1VA 5D8KB 1WKMA 1USTA 2ET7A 4LLNA 5H6RA 3ZMUA 2FF4A 2GC2A 4EWEA 3LSTA 4G6DA 1CAVA 3I58A 1IW7F 5EEHA 4XSZF 1J7KA 3J7AO 4IEXA 3MFKA 2F5FA 4RAZA 1X82A 2XROA 1T6SA 4LK1F 2XL9A 2PMHA 1J3QA 4Q0QA 3QU3A 2LKPA 2QZ8A 1AOYA 2PN6A 5ED4A 1USSA 3FZVA 5L3CA 1KU9A 4O9GA 1MGTA 2ET1A 5ERIA 3ZP5A 2KKOA 5FGMA 1FYMA 2BE5F 3R61A 4GXOA 2V09A 4A5MA 5F6FA 2PAKA 1B4AA 5DV5A 2EFNA 3MWMA 5LGTA 3SMHA 2LF7A 4LB6B 2CG4A 5DD4A 5D5UB 3PLQA 1TLHB 2ELHA 3ZN0A 1EP0A 4YSFA 2UXNA 3NVCA 1O57A 1FXZA 2B5HA 4K2EA 4F7ZA 2FQ3A 2BNNA 1YUDA 3ECHA 1R1VA 4CHUA 3V7CA 4U7BA 3NJZA 1RUNA 1OKRA 2K7LA 1CAWA 1IPKA 1FBSA 2AXLA 3K0LA 4H0EA 4QGMA 2XIGA 4L9JA 1QXJA 2D2WA 3WODF 5LGUA 4A6EA 5JHUA 2BYVE 2ZKLA 1IPJA 1ZLJA 3KMHA 2GQQA 2PAEA 1K78B 1JUHA 4RB2C 4EM1A 3K9TA 3TGNA 2OYZA 2LSOA 4PGGA 1YWKA 5BS6A 4MNUA 5IT3A 3KEOA 1R1TA 1OPCA 2NRAC 3MZYA 1NHAA 4KIBA 4PZJA 3F8FA 2BBYA 2FU4A 5BUVA 2FOKA 3KP3A 3DPLC 1ZAOA 2JRTA 3FXRA 4O5VA 4I09A 4IHSA 3FFQA 3IBMA 1S7OA 1ULYA 5LGNA 2HFHA 4AVCA 4EJWA 2BNMA 2ETHA 3N4MA 2G7HA 3HTUA 3R0AA 2IP2A 3KP2A 1QY4A 2Y48A 4HDVA 1FC3A 4AQ2A 3JW4A 1T2KA 1U5TC 5E8GA 4I3PA 6PAXA 2OD5A 4XEZA 1DPRA 4XLPF 3MAJA 1Q1HA 2K27A 4XF0A 3PFIA 2RVCA 2ZMEA 2GA1A 5CVRA 2VN2A 1H9GA 3TOAA 3EQEA 5T3NA 3USSA 3W6JB 5LEKA 4G7HF 3WTWC 1IN5A 4QLCU 2E1CA 2VOOA 1GQHA 2JSCA 3D0SA 4KMFA 1XRUA 4MTDA 3LOIA 2OZ6A 3RI4A 1LDDA 2K86A 3NRVA 3ML6A 3CO7C 4XSXF 1W7PD 1H1IA 1FP1D 1HKTA 2Y75A 4HVRA 4LG0B 3UKVA 3VB2A 4JTOA 2Q2EA 2F5CA 4HOBA 1JHHA 3W6KB 1FSHA 1UB9A 2Z3YA 4EJTA 5HS8A 1QXRA 1KYWA 3F6OA 2L02A 1WSUA 1P4AA 3KEQA 2HDCA 3IWZA 4HF2A 4PCQA 3GYDA 2XHKA 2M87A 5K5OA 4NHJA 1JXSA 4IRHA 2XUBA 4HMZA 4MV2A 4RB1A 2ATFA 3Q9VA 2F4PA 2FBIA 1YHFA 3JTGA 1W5TA 3DXJF 5J8FA 1TNTA 1D5VA 3VODA 3E5QA 2R7FA 1YG2A 4ENMA 2GXBA 2D5HA 2CO5A 3NSTA 4B8XA 2RKHA 2HTSA 4KU8A 1CAXB 3GFIA 5KHIA 1R00A 2LDUA 5FD6A 5KK1A 1ZG5A 1FT9A 3ZN1A 3O14A 3O3KA 5JVTA 1EH7A 1OR7A 2XLGA 4HQMA 5FLXZ 1LKNA 3KZZA 4UV8A 4IERA 2V1DA 5FO5A 1XSVA 4M9SA 3RIRA 2FNAA 2K4BA 3E6BA 3IL2A 1Y0UA 3O2PE 1IRGA 2CQKA 1SD7A 4Y17A 1XN7A 4ENJA 5I93A 2RN7A 2P17A 1IZ1A 4WZCA 4IHTA 1F9NA 2L01A 3F23A 1L3LA 1CAWB 3BU7A 2CYYA 3K1MA 2PBIA 4PIXA 3IDBB 2QCSB 4R79A 2HKXA 4HQEA 1Z1DA 3GO5A 4L18B 1FNNA 4IEUA 3VEPA 1J1LA 2QJVA 2A5YB 3F8NA 5DYMA 2IW5A 1RGSA 2GC3A 4UXAA 3GXOA 3HOSA 1X7NA 1XE8A 5E20A 4E2QA 3H8UA 2M1BA 4RB3C 3WW2A 2IXCA 1SD6A 1PMIA 2WC2A 2VBWA 3HHGA 1OD5A 2VC0A 4P9FA 3VHRA 4N0BA 3GEZA 5A2QZ 2H09A 3K69A 1ZG3A 2VBZA 1U12A 1BI3A 1RNLA 2RV8A 1RI7A 2VT3A 4G9YA 3H3ZA 4HDUA 1KGSA 3P9IA 5FD5A 5L3BA 4IEOA 2A69F 3LA3A 4GO1A 2E9QA 1HKSA 1Y3TA 4XF9A 4JK1X 1XGMA 2XGXA 4AXOA 5D8LB 4I2OA 4JBAA 3TO6A 1JE8A 1IN8A 2YX4A 2QDRA 3H7JA 5JI6A 1B9MA 3D82A 5I8YA 2ZO4A 5K8SA 1IXCA 3KETA 1FY7A 2B9UA 3F6VA 4KIGA 3ZMZA 2CFXA 3SZTA 3EYIA 2OA4A 1BBYA 3L2CA 1TW3A 4GCVA 2CWEA 2Q1ZB 5LEJA 2J5OA 1HSTA 3J80Z 2PJPA 1W7PB 1YIOA 3RPUA 2D93A 3IRQA 3F22A 1FPQA 4AIJA 5TRDA 2D40A 1D8KA 3HQXA 2P6TA 5HOOA 1OYIA 4LLLA 3IRRA 3ST7A 3GFJA 4HBNA 4B09A 3R6SA 4O3MA 2G7UA 1ZZBA 4WXCA 4AVPA 5E1WA 3KLOA 4EQQA 4G8XA 1ZLKA 2DAOA 4MQVA 1B9NA 3HYIA 5F1RA 3WW4A 1YFXA 3QPTA 2O1QA 2VPVA 2VXZA 3LAPA 4OU0A 1ZH5A 1KA8A 1G3YA 1S8NA 3WTVC 4MGKE 4YARA 2ZXJA 1IXRC 4L11A 3HTSB 4META 3KP5A 4PIZA 1FSEA 2IVMA 1K78A 4M9XA 3WTTC 1U3EM 1MZBA 3WGHA 4MZUA 2L4MA 3ZMTA 4AVBA 4ZZDA 2UYAA 4MTEA 4QGNA 4I0BA 5L3DA 3S7EA 4YFKF 2ESNA 3R0JA 2X0LA 2H27A 3E5UA 1FLIA 1LJ9A 1HW2A 2P7VB 4PJYA 3WTZA 2PG4A 4XFGA 1BJAA 3ABTA 2MC3A 1DGWA 2FXAA 2EK5A 4HSJA 3WTYC 4M71A 2KIMA 1P2FA 1MJAA 5I8SA 1YQAA 4XFFA 1J0RA 3UKTA 3JAMK 1ZREA 2K9ZA 3IC7A 4HZFA 5DCMB 2GXGA 3ZMVA 4WXDA 3DEUA 1RL3A 5CADA 5HS9A 3FHZA 4E2SA 1IUYA 1A04A 5H6QA 4LA2A 2HQNA 2QUFA 4P55A 4WCGA 5HLGA 2XRNA 4ONUA 3T0YA 1BN5A 2L4AA 4P9GA 2JPBA 4L9NA 3M1EA 1XSDA 5BPIA 5ILUA 2PHLA 3QP5A 5JSOA 4ZU7A 3E6MA 1J2XA 1QBJA 3TDUC 4FX4A 3AAFA 3FF5A 1ZZ7A 3U9GA 3WW1A 3IKVA 3WE2A 4LEJA 2FE3A 3KGLA 1UHWA 4LG0A 2V79A 5DUKA 1PP7U 5DCFA 3FHIB 5JFRA 1ZN2A 2HYFA 1J58A 2UZKA 2WFPA 2W85A 1NE4A 3SXYA 1O3RA 3RZZA 5KHKA 1LDKB 4Y13A 1XCBA 1XDUA 5HLIA 4HLYA 4BIFA 1G4DA 5DUIA 3UKNA 4D7SA 5FPXA 4L0ZB 2KIUA 1KU7A 2VBXA 5JSPA 4RGUA 2M8EA 2D1HA 4HVOA 3BROA 5D4RA 3BJOA 2ZFWA 1IN6A 2E1NA 5J3UA 3CJXA 1FOKA 1NYWA 2DQRA 3TO9A 3QACA 3HSEA 1CAXA 3EUHA 1GXQA 1NE6A 4LD5A 1YS6A 4YNIA 2QBYB 4MGIE 5CJ9A 3M8FA 1SFUA 4LB5A 1XSXA 1ZZ9A 3EDPA 1L0OC 2PQ8A 5BV6A 2WV0A 4XFCA 4J1XA 3BY6A 5BPXA 3M9AA 3ELKA 4DQ2A 2PFBA 4R1HA 4LTAA 3KFWX 2K02A 5D5VB 4OIPF 5BMZA 1UHMA 4Q0UA 4LUMA 2V6CA 3RYRA 4KWLA 4J1WA 1OMIA 4GULA 3U11A 1XDSA 5E1ZB 3LQRA 2EA4A 1YTYA 1U78A 1GVJA 2DQLA 4HVQA 4E2GA 4ZYHA 3C3WA 2HEOA 5HVQC 1MD0A 1DDNA 2PMUA 2J5PA 1I1GA 2AS5F 2DK8A 1G3WA 4UVCA 4BH9A 2EWNA 3SFZA 4MGYE 3REOA 4IEPA 2YU3A 2DO7A 2C0ZA 2V1UA 2QWWA 1WWXA 3MPBA 4FAGA 3H7YA 1XGOA 2ACJA 5I0SA 1O7LA 2BNOA 1I1SA 2OBPA 3RKWA 5I0RA 1TQMA 2UYBA 4M6XA 1SAXA 4L0YB 4U88A 4IETA 2QQ9A 5HDNA 4BXUA 2HR3A 3O6BB 1ZZ6A 2YR2A 2A68F 2L54A 4OFGA 1ON1A 4P9UA 4EROA 3BB6A 2CAVA 1P4WA 4IEYA 1ON2A 1QPMA 2QQAA 1TBXA 4IEZA 3QU6A 4OIRF 2ETEA 3ZPLA 1LRHA 1XCVA 4EWDA 4R52A 5CVVA 1ZGAA 4KFCA 4WX9A 1YLLA 1JGSA 2COMA 3SXWA 1QGPA 2OZJA 4KN7X 4OOIA 1W7PA 4KMUX 3C18A 3WG9A 2XKOA 1SFNA 4RGXA 4Q0PA 2P7CB 4YFNF 4L9VA 3GFMA 1HW1A 1ZYRF 3I5UA 4Z2YA 5BQTA 3KE2A 5HLHA 2M5WA 1PDNC 1UCRA 2VBYA 5FB2A 2MD5A 3RNSA 2Z9OA 2DTRA 4BQAA 2DU9A 4KA4A 2P6SA 3TQNA 3DQVC 3U10A 3BPVA 3LAGA 1YO5C 1XMKA 4F8AA 3D0JA 1REPC 3JSPA 1SFEA 1U8RA 3IIAA 3HSFA 1G6NA 1BC7C 2Y0MA 2UY8A 1U6GA 1D3YA 3KCCA 3U0ZA 1UD1A 3OOPA 3DN7A 4QM9A 1OYYA 2XAHA 4E70A 5J7MA 5CVJA 3P9KA 4PGHA 4EJVA 5L3GA 5K5QA 2DW4A 2JTVA 4GYIA 3CTAA 5FLXK 3NW4A 4EGZA 3B02A 2FRHA 3SZPA 3WTSC 4ORFA 2XV4S 4ZH4F 2HQRA 4LA3A 4I98B 1R7JA 4CICA 2Q8KA 1P4XA 1K6OA 1SD5A 2CAUA 1ZVFA 3E6DA 5K5RA 3CO6C 1UCXA 4Z07A 2DPUA 4WK8F 1ZARA 1VJ2A 1RC6A 3P7NA 1FYKA 3ELNA 5LRRA 4N9HA 3FE5A 4UBHA 1R5GA 2BV6A 2M45A 3EBRA 1NXMA 3E97A 5CVUA 2JZYA 4YYOA 5DCMA 3GUDA 4M74A 3EQLF 1DGRA 1LEAA 3ZMSA 1FBQA 4EM0B 3ROUA 3HSRA 3ZMDA 2PFWA 3MQ0A 5BXXA 1FI2A 3FM3A 3SCHA 5F64A 2PYTA 4HX8A 1O3QA 1FYLA 3CL1A 3H1MA 2UXXA 3L09A 4MUVA 3F21A 1RUOA 2QLZA 1O3SA 1TQIA 2FBHA 3LQQA 2FEZA 3BCWA 4ESBA 5ICFA 2ISYA 1DZRA 1TW2A 1WQ2A 4GGGA 5AIPA 2O61A 3KP6A 3V4GA 3KZYA 1FWZA 5HI0A 4G6QA 2XAQA 3H1WA 1LB2A 1I27A 1ZZCA 1KU2A 2Z2SB 2IXIA 2IA0A 2Q4SA 4LLGF 4BAYA 1KQ9A 3F3XA 1YW8A 1CGPA 1XD7A 5HS7A 3LAJA 3DL3A 2IXHA 3F8CA 5FQ0B 2D5FA 3FX3A 1Z05A 3ES1A 2GU9A 3CJNA 1KYZA 1UIJA 4M6YA 4JTNA 3U1DA 1G3TA 4RB0A 3SQNA 1ZRRA 1MDMA 2MA3A 1BM9A 5KHJA 2EB7A 1CAUB 5LLQA 1VR3A 3Q5FA 5LHGA 4QXKA 2B0LA 4IRGA 3NEUA 1YFHA 1Z91A 2RGVA 5KBFA 5HDKA 1ZX5A 3CEWA 1BOAA 3COAC 5CYVA 3DFGA 3N97A 3I54A 1QQIA 2CV6A 2GZWA 1XB4A 3SHRA 3J81K 2QBYA 3P9CA 4WBBA 5EFUA 2UY9A 2FBKA 2L3DA 2DCTA 4Q0VA 1GHCA 2OPKA 3GZ6A 2UWMA 4UVAA 1EH6A 1O4TA 3OCPA 4ZYEA 4QWQA 2QENA 3T5XA 4M9ZA 3BZ6A 4KN4X 1YFYA 4IEWA 5IT9K 3R60A 3GW2A 1J3PA 5FPZA 4KNYA 4TLFA 5ILSA 2GA2A 4YFXF 4DINB 3LA7A 3F8BA 5D6EA 4A0ZA 4ZYDA 2VONA 4P96A 5D5WB 2STTA 1J9IA 2ZKZA 2KXLA 4FAHA 3IHUA 3MYXA 1TTYA 2MBFA 2ZNZA 3TOBA 3V8JA 1K7AA 1CF7A 3GBFA 1BI0A 4L5IA 1Q3EA 3LFKA 1TQPA 4YIFA 3F72A 3IDCB 4XLNF 3ZDSA 1VTNC 2HZTA 2DFIA 3I59A 3K2ZA 1S6LA 3IWFA 5E8IA 4WF2A 2OAZA 5AIQA 2DK5A 2YX7A 1HQCA 5L3FA 3CF6E 1MJBA 3M8EA 4HN1A 1BIAA 5J48A 4P5OA 2XAFA 3WGGA 2IA1A 4YIIA 3NKTA 5D6FA 3V8LA 4MHGA 1LNWA 4CDGA 1OI6A 2F2EA 4D7TA 3FM5A 2ISZA 3HOTA 3C7JA 2K0GA 3BP8A 5CLSA 2EFPA 3I7DA 5C6CA 2W84A 2DPDA 3BJ6A 3NQOA 4CYDA 4OLLA 4ZZLA 2FQPA 2PTMA 4YRDA 5E1RA 1O5UA 3FWEA 4LUKA 5ICEA 3G7DA 3TNQA 3LWFA 1XGNA 3RYPA 1ZRDA 4FX0A 1R22A 4UNOA 4IPAA 1F5TA 2Q0OA 3EETA 1DP7P 3OTFA 4ON0A 5LHHA 4EV0A 4LULA 3DKWA 4G94A 3MDPA 2DLLA 3MEXA 4XFBA 2XL7A 4G7ZF 4JV4A 2EA7A 4BHCA 3HUGA 3CLPA 4N9IA 4BNCA 4LMYA 3L7WA 3JAMZ 3I64A 1EH8A 2ADUA 2VQAA 3FMQA 2PLYA 1YLFA 2VE9A 3QPHA 3K1NA 5TJJA 4X6RB 2FA5A 2H6CA 4O9EA 1FX7A 3BPZA 2NYXA 3H9AA 3I4PA 4MH0E 2E7XA 2VOPA 3G73A 1Q5OA 3RTRA 5E16A 1F4KA 2EAAA 4D0PA 3SCFA 5CU1A 2I45A 3TO7A 1SMTA 4G7OF 1WGPA 1MDMB 2FMYA 2IT0A 2XAJA 2EV5A 2JT1A 4AVAA 2GWRA 2EVXA 3HT2A 4RAYA 2EV0A 5CVIA 2K4JA 2O03A 4HN0A 4L5JA 5J6XA 4HA8A 4LLOA 4OMYA 3GLXA 3T8TA 2MPFA 3T8RA 1QZYA 1FP2A 2OA2A 4YG2F 2HOEA 4AQ6A 3CDHA 3S2WA 2EFWA 1LEBA 1Z7UA 2OZUA 1QZZA 1BI2A 4H7LA 4RGSA 3GWZA 4L9TA 1O3TA 4EM2A 2O3FA 2GAUA 3ECOA 5JAXA 4ENNA 1CX4A 1X3UA 4JQFA 4ENKA 4OMZA 4Q0SA 4LK0F 1T38A 3PNAA 1QO0D 1H9TA 5DEQA 3RPQA 4ETSA 1O7FA 1C0WA 2VECA 3Q9SA 4O6JA 4XF4A 3FJSA 1R5HA 2DBBA 3KLNA 2F5DA 2ZCWA 1ZZ8A 2QQBA 4FHTA 4HF0A 2Z5UA 4UUVA 5ICCA 3WU0A 4XETA 1CF7B 2XVCA 2IJLA 3MCZA 5D4SA 5I0TA 2CGPA 2HS5A 1V4RA 1IF1A 4RGRA 1U5TB 2OQRA 1V70A 4JVAA 3TNPB 1WI9A 3I59B 3GX4X 4B29A 1Y9QA 2NAZA 5LBQA 3H50A 1BIBA 2NNNA 1WLTA 5BPDA 2IXJA 2KJCA 3EO6A 1UFMA 2X4HA 3H3UA 1HW5A 4EJOA 1NZCA 3ULQB 1YS7A 3JTHA 1V3FA 1H0MA 2QYOA 5ILVA 3GFLA 2P5LC 3GZ5A 1PP8F 1KU3A 5DD8A 4IVNA 2TDXA 1J75A 1XGSA 1I5ZA 4CO8A 2XAGA 3DF8A 1OFNA 3QAHA 2Z33A 4HV6A 2Z69A 1IRFA 4Q4ZF 3RDIA 4IJAA 2Q30A 3MZHA 4KICA 1FZPB 4Q5SF 3HHHA 5FQ0A 4K8FA 3SCGA 1ZGJA 3LZZA 1TQ5A 2YSRA 2HGCA 1B1BA 5LHIA 3B73A 4NQWA 2NS0A 1UIKA 5K1YA 1JHFA 4U0VA 2PAMA 5KHGA 1CAUA 4HV5A 3WE3A 4LGWA 2O8QA 3D5LA 4S05A 4X6QB 4NB5A 5I8TA 3OV8A 1AWCA 1LDJA 5KVRA 1HBXG 3E6CC 1ZNPA 2Y0OA 5E1XA 3GYHX 4EJUA 2ZJ2A 1E2XA 2XLAA 4MQ9F 3BWGA 4XBFA 5L3EA 1S3JA 2QNKA 3FZ3A 1R36A 3DP7A 5FLJA 2PEXA 3V7RA 2W57A 3PVBB 3EHKA 5ICGA 4FT8A 1BC8C 1EY2A 4KL1A 4RS8A 4U0WA 4WVZA 2H94A 3I0TA 3CUQA 3C1DA 2E7WA 3RKYA 2IXLA 1IXSB 3E5XA 1QNTA 2O8XA 1YW7A 4AWXB 4BHBA 2FNPA 1IAWA 2QM3A 1LR5A 4KYWA 4Z82A 2EFOA 5H20A 4UXNA 2P8TA 2HWVA 4OIQF 4KIFA 4UV9A 5D5XB 4IEQA 1SQ4A 2HYGD 4AD9A 1XE7A 2ZBKA 3WU1B 1CAVB 3KP7A 3GF2A 4XRFA 3ACLA 1SD4A 2LF8A 1KQ0A 2WTEA 3FXUA 4KWKA 4Q47A 4XF1A 1WA4A 2GC1A 2P5VA 3BPXA 3V7SA 5I91A 4OIOF 2YPRA 1T0FA 1K79A 1YFUA 3I71A 5I0UA 2RQPA 2A07F 4CZZA 2C6YA 4HLXA 2HTJA 3QOPA 4BHPA 2NNYA 1SFXA 2XKPA 4A0YA 1T39A 2O6GE 1UPIA 4L2NA 1LQ1A 2GC0A 4QMAA 3BALA 1STZA 1YFWA 4UHTA 3HRUA 2A6HF 4RD7A 4WWCA 2MNGA 3I53A 4XFIA 3S0MA 2H0VA 2HJIA 3BJAA 3VOEA 1HKQA 1J5YA 2MLKA 1SMYF 2GH2A 4Q48A 1DPUA 4I7HA 5AONA 1W5SA 2QVSB 4U0YA 5A2QK 3WW3A 1VP6A 4I0AA 3KP4A 2OU2A 3F8MA 4UBGA 1MKMA 3DV8A 4MX3A 1TNSA 3CLOA 4CGZA 3ES4A 1L3JA 3ZQ7A 2F5EA 2PI0A 3LWCA 4KWJA 4KDPA 5JR3A 5FLIA 3M3IA 5EZWA 1WRJA 1PM7A 3JZVA 1I6XA 5JCTA 2CW0F 2WWYA 4HW0A 2P4WA 4HX7A 2IPQX 1OYWA 4ESJA 1P6RA 2IA2A 4HF1A 3TKYA 5FCCA 2W25A 3RJPA 1YYVA 2R7DA 2PQQA 3E3VA 3M7GA 4HAMA 4HBLA 3ABUA 3PQKA 3GVAA 4R8HA 1GQGA 1ZRFA 2IXKA 4MEYF 4ASNA 1DUXC 1U2WA 2MH9A 1EYBA 3LA2A 1SEFA 4LJZF 4A5NA 4EVIA 5EEGA 2A6EF 3HRTA 4LFUA 4A0XA 1HSJA 1ZRCA 2RDPA 2MH2A 2Q0AA 4A6DA 3J80K 4XFHA 4M73A 1F1ZA 3JSOA 4HX4A 3ETQA 2EJRA 1P92A 2PA7A 3K1PA 1RIOH 2A3SA 2DI3A 4ZU5A 4BYYA 2V1XA 5E18F 2ZMEB 3L00A 2XASA 2ESHA 3HRMA 4XFAA 3L9FA 4ZYGA 4QGLA 5J8CA 2FSWA 2QVOA 3RYKA 3SHFA 1IN7A 2O0YA 4KT5C 2RNJA 5D1IA 1HXDA 3DPTA 4U7DA 4XF3A 3WTUC 1MJ9A 3NL1A 3QRFF 2IC1A 1X8MA 4EWAA 2IRFG 3CUQB 3C3VA 3QP6A 3CO2A 2HKOA 4MEXF 1RTVA 4IXAA 1X8EA 2P5KA 1E17A 1R23A 2EA2A 1YW9A 3EYYA 2KIFA 2VC1A 4TV7A 5AVPA 4IRIA 2V9VA 4QM8A 3FMRA 3H92A 1G3SA 1B6AA 1R58A 1S29A 1J59A 4AIHA 1T98A 4Y15A
chains in the Genus database with same CATH superfamily
4FI9A 3MPPG 4BLIA 3M70A 4NVPA 2OCCH 2PHDA 1P9QC 5FDBA 2GN7A 1ONVA 3ZXKA 3J81Z 3OS0A 4RA0A 1RIRA 2MHFA 3BZKA 4KJZA 5DDGA 2VMCA 3JB4C 1JT0A 2WSVA 1GMMA 1WCQA 2G9FA 2M30A 3B69A 5KC5A 2H8RA 3HIFA 3VD5A 3OYAA 4COUA 2BHZA 4HSRA 1ZK8A 3TDZC 1RZ4A 1J84A 5BOXA 2WAFA 2GIVA 1IQDC 1YI7A 1JZ6A 5FPAA 2G19A 1L7LA 1AJKA 1PUEE 2STWA 2G9WA 4A3JJ 5T5PA 4RSUA 3N9LA 1QWRA 1SLLA 1ENHA 5F37A 3WOGA 5JHFA 3WUDA 3VFZA 2HBUA 3LDBA 4S04A 4DXRA 3H1CA 2A75A 1MNEA 4CPBA 2A70A 1JU3A 3KPHA 3BG9A 4BL0B 4CP0A 1APNA 3L2WA 4QHBA 1ZHFA 2WAEA 3NAPB 1CIWA 1B59A 2BERA 5EYRA 1NK2P 2JD4A 1IN4A 1ZYBA 2ZABA 5FFXA 1NZIA 4BJ0A 2K9SA 2VE8A 5LWBA 5A80A 1OCTC 1OF4A 3OGJA 1V9U3 4Q29A 4NDLA 4SLIA 4XLFA 2DA6A 1GNZA 3AP7A 3NRUA 4GYGA 1YIJI 2R3SA 2C1FA 4I01A 4YGDA 5FZAA 2CL2A 3CNAA 4YW2A 1BI1A 3ISPA 1EPWA 5DG2A 2RS32 4HLTA 4KISA 2OUHA 4IV1C 3ZXGA 2C6SA 1XMAA 4UVBA 1FBUA 1LVAA 4KUMA 3T1BA 2L5QA 3KGZA 4MGZE 2Y31A 4B4RA 2KRFA 4XUNA 2FDIA 4BE3A 2D1VA 3PJYA 1AXZA 1OA2A 2A6ZA 3UGHA 2CU7A 5H6RA 2ZEWA 3FBYA 2IXSA 2GC2A 5F8PA 4IX7A 3NJYA 4ZZ8A 3W2VA 5D21A 1E3HA 2VJXA 3APBA 1IW7F 4XQFA 4GD4A 3KLSA 2P3IA 4FPYA 1GOGA 2RS51 3RWNA 2G9GA 2KT0A 4IE7A 2VZRA 2PMHA 4A3XA 1J3QA 1MZEA 3CHXA 5JLXA 2LKPA 3TBDA 2DWRA 5IK4A 1E5SA 3RVHA 5ERIA 3ZP5A 2KKOA 2CUZA 3R61A 1SMVA 4BJTA 3GHMA 3D5SC 2V09A 4A5MA 1B4AA 2ZOEB 4S2GA 2V4AA 5LGTA 1AR63 4PQQA 2JEMA 1UZVA 2JMWA 4BBRJ 2QFEA 4PLMA 2EINH 4FE4A 4XOGA 3V56A 5FOJB 1EP0A 3QD6A 2PJRB 2UXNA 1PVC3 3W5MA 1W8HA 4LKEA 4B4CA 2WB1A 2XH6A 1ST8A 3Q0UA 3BTXA 3BUCA 3QCWA 1OVPA 2TEPA 2BNNA 1R1VA 3V7CA 4U7BA 4CRQA 5EIYB 2K7LA 2YXSA 1TWGJ 3IAS2 1IPKA 1W6NA 2PMZA 3U14A 3K0LA 2VXDA 4H0EA 3QYBA 4L9JA 2P5BA 2DA1A 1PGW2 1K83J 1VBB2 5C9AB 4ZDOA 3CJQB 2ZGTA 3KMHA 2ZXWH 2E34A 4PGGA 1YWKA 5BS6A 1QVUA 2CMPA 5C8CC 3BR1A 2NRAC 1CR7A 5C7GA 2OQ7A 5HXVA 3K6GA 2FU4A 4A6SA 4XTMA 1AHDP 2G1MA 4WM8A 5FXWA 1MH4A 1ZAOA 3FXRA 4O5VA 4BK4A 2JENA 2PMWB 5FZIA 1ULYA 3VBUB 2Q8EA 1RVF1 4IGQA 1C8NA 4EJWA 1DU0A 3MHZA 4DOUA 5FYCA 1HJFA 3N4MA 3I3LA 3HTUA 2ECCA 2W9XA 1QY4A 2Y48A 3NQHA 3HXLA 5KXBA 3JW4A 3LKJA 1LULA 6PAXA 1PO22 4BACA 2OV7A 2R5ZB 5EWSA 3GTKJ 2K27A 3PFIA 2K5CA 1H9GA 3EQEA 2WT0A 3D4KA 5LEKA 2E1CA 4QLCU 1I1EA 4MTDA 3F0CA 1OC1A 2RR12 3CO7C 5FMOL 4XSXF 4FPFA 5FKCA 1H1IA 1HKTA 2GSYA 4Y5SA 3IUOA 4UB6C 4LG0B 4HVRA 3UKVA 3BZCA 4DMIA 3P3PA 4JRLA 1GANA 2Q2EA 5CZKA 4HOBA 2OQ6A 2Y6JA 2R4GA 1FNYA 1XE0A 3F6OA 3CDIA 5FAXA 1T08B 1QKQA 1D0HA 3ACGA 3URFA 4JQRA 2XHKA 4D8MA 5K5OA 1JXSA 2WZR2 4FASD 5APAA 4XQDA 2ATFA 5FP9A 3SEEA 2TUNA 1WJAA 2QQNA 4OZOA 4LK6A 5J8FA 3OMYA 2A3YA 4EE2A 4GH4A 4AWDA 1D5VA 3LIGA 3HC7A 3CP2A 2ZZQA 1AX2A 4DOZA 2R7WA 4F3QA 1UY2A 1Z7S1 2HTSA 1CQ9A 4KU8A 4YVWA 4RMNA 1GVDA 3OY8A 1ERDA 4NRPA 2R0FA 4XRSA 3OEAA 1XNCA 1VALA 2V7FA 4OVEA 2OPWA 2E1MB 2OUJA 4ZDPA 2ENRA 4M4PA 2R7RA 2V6EA 2V1DA 4IERA 4M9SA 3RIRA 2K4BA 4CP2A 1Y0UA 4AW7A 1B35A 4ET7A 1NH3A 1GP4A 3B01A 2RJKA 3RZLA 2COBA 5I93A 5FJ8J 3F23A 1VRH1 2PBIA 4PIXA 3VUOA 3IDBB 4R79A 1Z1DA 1QQP2 3PUIA 1F5JA 1HDDC 2KDOA 1J1LA 4TSVA 3WQ0A 1KDMA 3H35A 2IW5A 1X7NA 2DVGA 4P5HA 4N53A 1SHWB 3WW2A 4YZ1A 2XBO1 4ITVA 1OD5A 2VC0A 3VHRA 3OBAA 2VW2A 3OIQA 2R92J 3VD3A 1RUI2 1W0UA 4Q4V3 2CDPA 3WG4A 1Z67A 1LECA 2VT3A 1RHI3 1O91A 5A3TA 1ALYA 2VG9A 2A69F 3VL8A 3LA3A 2E9QA 2B7EA 2YC2A 3K4DA 1BVP1 1IS5A 1BW6A 1XGMA 1W9YA 2XVGA 1JE8A 1AL22 1IN8A 3CJIA 3OYWB 3UNPA 1Z0XA 1B9MA 3K70C 4XUQA 2ZO4A 5K8SA 3P6BA 4ATFA 2CU5A 4FPLA 3I2OA 1FY7A 1RJ7A 1SCSA 3F6VA 1WUVA 3ZMZA 2LYCA 3EYIA 3BR3A 1QPIA 1G8XA 2J5OA 2E31A 2I5UA 2Y8KA 2PJPA 1W7PB 1GNYA 1G9CA 4WM8C 3BR2A 3RPUA 1FPN3 1Q56A 4DNYA 3A03A 4QWNA 1D8KA 3HQXA 3VBSB 4LLLA 4Q5OA 4HPKB 3GFJA 2I74A 3LPGA 1VLNA 5JMCA 1ZZBA 1LU2A 3TYJA 4RL7A 3KLOA 3OGGA 4G8XA 4MQVA 2PHXA 1VQ4I 2XB5A 2YUEA 3IIIA 5F32A 2E7TA 3OSGA 4EN8B 2O1QA 2E5ZA 1TT5B 2LFBA 3R05A 2ID4A 2LROA 3JQXA 5LATA 2Y9YA 4NR1A 3CDLA 2QZ3A 4OU0A 1MS0A 4C9YA 2D43A 1AR92 1APLC 4YARA 5FJKA 4D3WA 3BT9A 5L7OA 1IXRC 2BPA2 2R32A 4BQ1A 4L11A 1QJY1 1HJGA 3HTSB 2D6OX 3KP5A 5IVJA 2IVMA 1VAMA 1MZBA 3WGHA 3SH3A 4DEQA 2FDGA 4MZUA 3VKOA 4YVSC 3PUAA 4MTEA 2ZMLA 2Y0IA 2WAQA 3S7EA 3MZ8A 1PMJX 2R062 2ESNA 2P34A 2X0LA 5FYMA 2WS92 3WTZA 2XDVA 1AYM1 1LHNA 3AYCA 4XFGA 5HCAA 1BJAA 3WG1A 2MC3A 3WTYC 2E35A 1MJAA 5I8SA 4J25A 1YQAA 5DDJ2 1J0RA 3RJ2X 1ZREA 4JDOA 2AO9A 1S55A 4JGZA 4HZFA 1I3HA 1MBFA 4L8QA 5SV5A 4IV3B 2GIZA 1DFQA 3I8TA 5GLUA 4MFDA 5FZ6A 2MEV3 3H9JA 2XR4A 2QUFA 4P55A 4GH4C 2W68A 4XR6A 4CDQA 1UNBA 4S2DA 3MW2A 4RN5A 1BN5A 3KF3A 1OSGA 2L4AA 3SZGA 1UG0A 1MQTB 1RKWA 4YVWC 3OEBA 3POFA 2IS2A 5ILUA 2PHLA 4M3CB 3O0WA 4LBKA 2K3FA 4FX4A 2Q1MA 2Y60A 4XUOA 2X29A 4JKMA 4CU6A 1F9KA 3MMYB 3IKVA 5KAIC 5A7NA 1JYIA 5DUKA 1S0DA 1QHDA 3GZAA 1E5RA 4CU9A 1VB2A 1GUIA 1ZN2A 2ZX4A 2D6KA 3JD73 2VNRA 2HYFA 3SEZA 1B35C 2UZKA 5FZ3A 2W85A 2IS1A 3FL7A 1RUH2 1GUUA 3SXYA 5BNNA 2WFF3 1LDKB 2RS13 2W2IA 1UO9A 5HLIA 1MBJA 5M0TA 1G4DA 5DUIA 3UKNA 4QPGA 3NJXA 2ZX3A 5IK7A 4J01A 5TGTA 2WZEA 2DVDA 4DXZA 5JSPA 1RUD2 3TRSB 1Q8OA 2JA8J 5D4RA 1YX3A 1QNWA 1HX6A 4B43A 2XJQA 1RINA 2OF7A 1FOKA 1ZBA2 4C2UA 4XMIA 1NYWA 1XQNA 3WZ1A 2DQRA 2DMQA 3TO9A 1YI9A 3VDDA 3DLAA 3EUHA 2DU1A 1GXQA 5M3FJ 1YS6A 4YNIA 1JOBA 4K1YA 4EYUA 1HV0A 2HWC3 3MKLA 3OPWA 1CPNA 3MIFA 3M8FA 4LORA 1RUF2 2WQ4A 3FHAA 3BC8A 1FV3A 4YIRX 5LK7B 1WJCA 4PI2A 1KRIA 5A3NA 4J1XA 3ZGKA 1MZFA 4DQ2A 1D2QA 4FQ4A 3UESA 4R1HA 2JDKA 4LTAA 5FYIA 5D5VB 3CJIC 3LD8A 2FMDA 4Q0UA 3H8OA 2HWD3 3I2DA 1R6RA 5B5EC 4J1WA 3WG2A 4RM2A 1DP3A 4LT5A 2HYJA 3WSOA 3LQRA 1GVJA 5T55A 4F83A 2J1AA 1NCRB 3HOVJ 2HEOA 3C3WA 1T56A 5HVQC 1IDYA 2AS5F 1MS5A 4UVCA 4E7IA 4XORA 1XOYA 3GMEA 3OL4A 4QX3A 1PZ7A 5LY1A 1QHHD 1PZ9A 3VBFB 3ZYHA 5LZ6A 1LHUA 1SEUA 5J37A 2R7VA 3LFUA 2OTJI 2FOWA 2ACJA 1JYVA 1VBE2 5BNPB 5I0SA 1I1SA 4Q4X1 5F7UA 1HKDA 1TQMA 4Y1ZA 4Q4W3 5GLWA 5A7PA 3KT7A 4UI9L 4Z2AA 2HWB1 4XLHA 4L0YB 1MMAA 4U88A 4PLNA 2A05A 3I4MJ 3R4SA 4H55A 3USUB 2L54A 4YRVA 5LA0A 1MEC3 5JLWA 2E6VA 3H8RA 3BB6A 2CAVA 3NKGA 5L7OC 2X9DA 4GALA 1QPMA 2HVRA 3ZQIA 2QQLA 5HNFA 1RMU3 3CESA 2KHMA 1LRHA 1W6MB 4TWTA 3C2HA 5CVVA 1PVC1 4WX9A 1YLLA 3ZOIA 2JB8A 1AR72 3ZQQA 3QBQA 1KQRA 3MLJA 4QQ2A 3WG9A 2GN3A 5FKLA 4YZ4A 2EZIA 1JZ7A 1SFNA 4RGXA 5LBFA 2P7CB 5GZFA 4L9VA 1Y39A 1ZYRF 3I5UA 3ZN6B 4FP3A 4Z2YA 5BQTA 1W8TA 2ZB9A 4AHYA 2P0WA 3WP4A 4W1UA 2XOMA 4AFMA 1B09A 1POQA 5LCWL 3OPTA 3FUOA 3LAGA 3D0JA 1REPC 1TZOA 2VOVA 4RHV2 5A3UA 1CJPA 2A6XA 4PK4A 1GZCA 3U0ZA 2DT7B 1N1SA 4D94A 1XU1A 4JAAA 5FMBA 1OYYA 4BQYA 5B4NA 4B1RA 5IJRA 2Y34A 3BCAA 4FETA 1GOFA 4E70A 2CQNA 4EJVA 5L3GA 3BGAA 4GB32 2JTVA 5FLXK 3BTJA 1QU0A 3NW4A 3KEYA 2FRHA 1YQ6A 1ULDA 5DABA 3SZPA 3THDA 2HDWA 2HQRA 3RI9A 3U1XA 5FYZA 4BM8A 1SD5A 2R7XA 1UZ0A 5F6LB 3CO6C 1NQDA 1AU7A 2GP3A 3HNBM 3LEGA 2DPUA 2ZACA 2JG8B 1RC6A 3P7NA 4YGEA 4N9HA 1AX0A 2HOAA 5BNNC 2CWMA 5D8AA 2BXYA 5CEHA 3E97A 2J1RA 3CJTB 2VUDA 5CVUA 4RR3A 2YPJA 1PGL2 5DCMA 2JDZA 4QPGC 2FX0A 4M74A 4E7ZA 1ULOA 3AP9A 3EQLF 3N9NA 4JGYB 2GM4A 2NMOA 3IM0A 3A2KA 1DGRA 2VCCA 4RS5A 3C2GA 3PMEA 4Z2WA 3HSRA 4MGQA 3MQ0A 3FLTA 3RJRA 2NYYA 2DF7A 1O3QA 4BA6A 4O61A 5FYUA 2XF6A 2IVIB 3VDDC 3EUHC 1O3SA 1S2EA 1JU4A 2VGDA 3LQQA 2VVDA 1GT0C 2BVLA 4DY5A 4DXTA 2M3AA 4XMYA 4BQXA 4GGGA 2V26A 2O14A 1F5FA 1STMA 4IHVA 5B1BH 3MEPA 3H1WA 1LB2A 2OIIA 5FYHA 2IXIA 2Q4SA 2XGDA 3VYRB 3HOYJ 1R9TJ 4XJUA 4P9YA 3F3XA 1W6PB 1OF3A 1UY4A 5EQUA 2YHJA 3CZUA 5EJ1B 4Q27A 1KYZA 4JTNA 2VZ3A 4S2HA 4RB0A 3SQNA 3Q8AA 1ZRRA 2DV9A 1UPSA 2DVBA 1RITA 5KHJA 4AVTA 3W58A 1CAUB 3CMAI 3FLRA 3BTIA 1K6YA 5A70A 2B0LA 3NEUA 3CC7I 2DA5A 2XSJC 3PTRB 1A6QA 2X48A 3DFGA 1OKOA 5A3WA 2HXIA 2WN3A 1H8TB 2GZWA 3PUFA 5FK8A 3T2TA 2PLV2 5EFUA 3IPVB 1OJLA 4JX4A 4LBJA 3PUBA 2PX9A 2UWMA 4UVAA 3ORJA 1EH6A 5FRMA 3WDYA 4GIQA 3OCPA 1UXXX 1LPQA 1W6QB 2QENA 3T5XA 1PUFB 4KN4X 4IEWA 3RS6A 4CDUB 3DF0A 2FDKA 4XN3A 2CUEA 2GA2A 4HFSA 4HKLA 3LA7A 3F8BA 2X6XA 5FZBA 2STTA 4MFEA 1FTTA 4P9IA 2X85A 1Y43B 3MYXA 4M3CF 2E32A 4JX5A 3V8JA 3GBFA 4S2FA 2VPRA 1RHI1 3ZQLA 4IEJA 4L5IA 4QPIB 2R043 2FZ1A 4BJ5C 3H3LA 5A7QA 5GZDA 3F72A 4XLNF 3ZDSA 2HZTA 3BG5A 3C7HA 2JA7J 5E8IA 1FYUA 3FXKA 3BQYA 1J1TA 2WINB 3A0HC 5A7SA 2WADA 4AFBA 5J48A 4Q4Y2 2HPIA 4FQGA 1IOAA 3LSMA 2XG3A 3ZSKA 4PCRA 1ND2B 3O1RA 4D7TA 3HOTA 3C7JA 2QQIA 2K0GA 5IYCJ 4DY3A 3BP8A 5CLSA 2W84A 4WVMA 1Y56A 3BJ6A 3DWLE 2V72A 3KV4A 3S1RJ 2FQPA 1XC5A 1JOJA 4UW5A 1O5UA 3FWEA 2BRTA 4PI0A 1OVSA 2WUHA 2Y6KA 3HNYM 3RYPA 1ZRDA 4IPAA 4GDFA 3ZQFA 4MOAA 5BNOB 4CYCB 4EV0A 1DHKB 4X8NA 3MDPA 2Q8OA 3MEXA 4CCMA 4GAZA 3CLPA 4N9IA 3ZXDA 2GOXB 3L7WA 2Y26A 4QKFA 2EIDA 2KISA 3NV2A 1B8IA 1VMJA 5IP9J 3QPHA 2EALA 3K1NA 2CV0A 1PZ8A 3HL2A 5GKAC 1RC9A 2YG0A 1C1LA 3L2RA 3VBOC 2C9AA 3I2GA 2D7FA 3H9AA 1X58A 3VBRB 4Y20A 5D8AC 3I4PA 1UZWA 2WA3A 4HOOA 4MH0E 3LEIA 3POWA 5FYYA 1RR8C 4K9SA 4RR3C 3WP6A 1Q5OA 1NG0A 1YO8A 3RTRA 1S0CA 4JZRA 2OC6A 3TO7A 3WU2C 3WQ7A 3ZFGB 2F4MB 4G7OF 1WGPA 1MDMB 4RS5C 4PJ0C 2IT0A 2XAJA 2JT1A 4E4DX 4MXWB 3TWIA 3H8XA 3OOXA 5CVIA 2K4JA 1N75A 4LO8A 2MPFA 2M0CA 4Y4YA 5A1LA 2OA2A 3AMPA 1FIPA 3S2WA 4LBNA 3RGBA 1BI2A 4H7LA 4RGSA 5M5YJ 2VUJA 2VBDA 4IKFA 3TN91 3ECOA 2CS3A 2CTVA 2P37A 3OUHA 5FZ7A 3EB7A 3X2QH 5G04L 5FZ0A 3W2AA 4R4ZA 1FMD1 1H9TA 1QOSA 5FYVA 5DEQA 1HIXA 2AQFA 4CCCA 1JYXA 4ETSA 1C0WA 4XF4A 3S2HJ 1QH7A 4QKNA 1XSRA 2WO2A 4FHTA 2WAAA 4CA0A 3NNFA 4UUVA 3VKFC 3THTA 1T33A 5B1AH 3QPLA 2HS5A 4IE5A 3OS1A 2JDMA 2O0OA 4KG0A 2K9QA 1RESA 1V70A 2ADDA 3TNPB 1FTZA 1DGWX 3JD71 3I59B 1QA6A 1H30A 1POV0 4B29A 4P9LA 1DGWY 1Y9QA 3ZXAC 4QXHA 3H50A 3DTKA 4ZTFA 2KJCA 4COZA 3WNXA 4CCJA 3EO6A 1UFMA 1VZ0A 1S5LC 4LO7A 1TNFA 3RKQA 2HBTA 4FISA 2ZSHB 1H0MA 2D3SA 2LUWA 2H8WA 2QYOA 2P5LC 4QQPA 1TWAJ 4JX6A 5DD8A 4IVNA 3VBHB 2VZPA 2AREA 1VNDA 2Z33A 1QGLA 3TW6A 4IJAA 1JOPA 4C0HA 4OI0A 1JTYA 4KICA 3MZHA 4MG2A 3SCGA 4UF0B 1ACIA 1ZGJA 4CEWA 1EA3A 4XQ4A 1IS3A 2HGCA 1SFKA 1IG3A 2R93J 2ELJA 2HWC1 5FZ9A 1UF2C 2F6BA 5K1YA 4U0VA 4E7SA 3MFAA 5KHGA 3LL7A 3HUGB 3J26N 4ZXEA 1W03A 4OQ8A 4Y7NJ 1AWCA 2JECA 1HBXG 4AEJA 2Y0OA 5JIUA 1C3HA 1P8JA 4EJUA 5JXIA 2L2OA 4XBFA 1X1BA 2QSGX 3MGUA 3FZ3A 2HWD1 3VDXA 3DP7A 4M3CE 2IGMA 1Y6IA 2PEXA 1UYYA 4NAMA 1FOWA 5IYBJ 3EHKA 4RS8A 4LHLA 2E7WA 1QNTA 4DFSA 3SYTA 3PUSA 1TVGA 1OKQA 1YW7A 4AWXB 4BHBA 2FNPA 4F3JA 1K5JA 4A7YA 4Z82A 2WLQA 5A1AA 4KIFA 5D5XB 3B9IA 5JOYA 3CIHA 3V0BA 1OHFA 2LLKA 3ZXSA 1CAVB 3GF2A 3ACLA 2LF8A 4ASLA 3CCJI 4Z6YA 2ZAAA 4FCAA 2WY7Q 5FYTA 1W28A 2DCEA 3VKLA 4XACA 3FXUA 4KWKA 1ULGA 3VDBA 1RUE2 1RUG2 4XF1A 3M2MA 2H0BA 1V00A 2GC1A 2RS33 4OIOF 1HN1A 4BISA 1T0FA 3FXJA 4BK5A 3DYPA 2JWTA 2RQPA 3DKXA 3DTEA 1NKGA 2HTJA 4D7MA 5LFAA 4GRIA 1G9AA 2FD5A 1UPIA 4L2NA 1V9U2 3SKJE 5CB7A 3HRUA 1K12A 2MNGA 3PVEA 2IFWA 2H0VA 5JXJA 1SMYF 4KH9A 4Q48A 1DPUA 2X09A 4AAPA 3TAYA 1ACCA 3ZYGA 2QVSB 3QWLA 1O59A 3WW3A 2WN2A 3ZYIB 5DAVA 1GDTA 3E1F1 4COWA 4I0AA 3KP4A 2CGNA 1LKXA 2ZA9A 3PDQA 5IPAA 4YW4A 5F3CA 4MX3A 3U37A 4CGZA 3QPSA 3I3EA 3IMMA 1RYYA 3ACIA 4GWJA 1C57A 4Q1RA 2M2EA 1NLRA 3J8F2 4UFLA 3JZVA 4TYSA 2P4WA 2L9LA 4B44A 4HX7A 1XPWA 1ZTRA 1OYWA 1PIV2 3WQBA 1J83A 4HF1A 2W25A 3MF9A 3RJPA 3S3MA 1YYVA 2BY2A 1W3XA 2PQQA 3PO3J 1VBA3 3M7GA 3G1LA 2BFUL 4Y1UA 1JUIA 2IXKA 1K5MA 1XB9A 2FQ4A 5HPOA 3LA2A 1SEFA 3AG3H 4A5NA 2A6EF 2LG4A 2Q8DA 3RMXA 4A0XA 1ZRCA 1AR62 1F35A 1T8IA 3GDBA 1R1A1 4XXPA 4A6DA 4BUPA 4M73A 5LA1A 3JSOA 4ISRA 1ODMA 2EJRA 1NG7A 1IG7A 1US3A 3OIOA 5FXZA 4BYYA 2ZMEB 2XASA 2VOKA 3L9FA 4ZYGA 4QGLA 4IGPA 4IXLA 3C7FA 1DU3D 2O0YA 2H1KA 2V9KA 1SVMA 2RNJA 3AMMA 5FY9A 3T08A 1D1BA 2ADEA 3AFGA 3ZFEA 2X53S 1UMIA 2WWSA 3NL1A 1X8MA 4D6QA 3C3VA 2VOXA 4MEXF 2P5KA 1UMHA 2R6QA 1W6OB 1G8WA 2VZ1A 1EAH2 2ZPXA 1R23A 3EYYA 3MV11 5HODA 2KIFA 4HK8A 4EZ4A 1W9TA 3FBNB 3M07A 4CEWC 1J59A 1VF9A 3B7MA 2KLOA 1YJKA 5FKBA 3I55I 3CMEI 1PO23 3O7OA 4QX1A 4M72A 2K40A 1Q43A 3EUKL 5F0CA 1H1MA 2BTVC 2Z99A 2NM1A 1FMWA 4H7MA 3LSJA 4FTBA 1U5TA 3SITA 1S9HA 5GZEA 4HSLA 1BYHA 4ZU4A 2JXAA 1SFOJ 4YG6A 3ZFFA 4RFT0 2ELKA 1W9WA 1KXGA 4XKVA 4A2UA 2VW1A 2AYHA 2G9ZA 5T50A 3IT8A 2DVFA 1YX5A 1ODDA 4IV1B 4UB8C 4A3DJ 5BY5A 1D8JA 4ESFA 4EGYA 3FBMA 3GZUC 2VT2A 3S7IA 2RC4A 4GXLA 4TN7A 4CEYB 5JI7A 1ZBE1 4M3EA 4OQ9A 2RREA 2WIIB 1D0YA 2WZR3 1DYPA 3L2HA 3FK6A 2TBVA 1XJAA 5ERLA 5L19A 1PK6C 3LSEA 1GZ9A 2QQPA 2CRGA 2QQ8A 1N1VA 2VODA 3DCQA 2M7BA 2OVUA 1IDZA 3EJKA 5IAVA 5KHHA 1YQ5A 1Z6TA 1S7AA 2LNBA 4BQWA 4NO4A 5DUVA 2XLFA 4IF4A 1NCQB 4QX5A 4I30A 5FYSA 3H0GJ 3OF1A 1R1UA 1C1FA 1NOVA 4HXCA 1NK3P 1ASJ1 4RAFA 4CDXB 1HRV2 5LRSA 1KQ8A 4ITCA 4OMDA 1YRNB 3PIPF 2ID6A 1YJWI 1ZG1A 1GXPA 3AYAA 5JSRA 2EFQA 1I5PA 1WJ5A 4Y5Z0 2ZNYA 3JUUA 4A41A 4FTSA 2FMLA 3HT1A 1Z7LA 2R041 3OBZA 1FJLA 2KP6A 5HDGA 3OGRA 1WW7A 3AJYA 1Z0HA 2W91A 4PDKA 2YBKA 1QQP3 4XHBA 4CP9B 5D8KB 2DUOA 1USTA 4LLNA 5CIRA 2FF4A 4IZZA 2EZKA 2X8KA 1IHMA 2VZVA 4QT6A 5FMCA 1KD7A 4D69A 4XSZF 4XJ8A 4BMBA 3K4LA 4IEXA 4OZXA 3MFKA 5M3MJ 3JRBA 1T6SA 2XJUA 3BIEA 3K2AA 4Q0QA 3OGVA 4AFCA 3QU3A 1RUI3 1EV12 2QZ8A 1AOYA 5C8CB 4J19A 1USSA 1NG6A 2BY1A 2ET1A 4N4OB 5FGMA 1V0AA 2BE5F 4UAPA 5FY8A 3AP4A 2BW3A 4LITA 3MWMA 4BBSJ 4WV8A 4Z8BA 1QDCA 2B9VA 5DD4A 3SQOA 2ZMKA 3ZN0A 2FCVA 2B9SA 3QYEA 1AL23 1MW7A 1LGCA 4Q4V2 3AM2A 1FXZA 4DQAA 2B5HA 5EP9A 1HF0A 4XABA 4F7ZA 4IE6A 3RFRA 3MN2A 5FZCA 4CHUA 5FZ4A 3NJZA 3POJA 3OR1C 1RUNA 1CAWA 2AXLA 2W47A 3CCMI 4QGMA 3CC4I 1ND3B 2PHUA 4A6EA 4CCOA 5JHUA 2BYVE 1TG7A 1J09A 2ZKLA 2PAEA 1OLQA 4ZS2A 3VZJA 4RB2C 3ZFEC 1JODA 3TGNA 5DAPA 2OYZA 1GR3A 4BS9A 3KEOA 1R1TA 2FZ2A 2X1DA 3DCFA 2QCOA 4N43B 2X5IA 2EICA 4RBOA 2YFZA 4BB3A 2BJSA 1R5ID 2FOKA 3O1VA 2E71A 4C90A 4IHSA 2BXZA 5LGNA 5J4VA 2RDRA 2BNMA 3MO4A 3GLLA 2G7HA 4IOCF 3R0AA 2IP2A 2E26A 1B72B 1T2KA 2JG9A 1T95A 1U5TC 4XHXA 1YE9A 4N7IA 4ES8A 1DPRA 2C26A 4ZTJA 1Q1HA 4XF0A 2RVCA 3A0NA 2BVVA 2GA1A 1GZWB 3VSKA 4XPVA 1W99A 2IS4A 3ZFFC 3TOAA 2JE8A 2R063 5FFOC 3USSA 3WG3A 2QQJA 4G7HF 1LCLA 1GQHA 2VOOA 2P3KA 2WS93 2JSCA 1UG2A 3L9JT 1OURA 2K86A 5IVCA 5FPUA 5LW9A 2ARCA 1W7PD 3S5AA 1FP1D 1ULEA 4RGAA 1MPXA 3GM8A 4YGCA 1O4ZA 2ZX1A 5DDJ3 3AMQA 4NAOA 3THCA 4V2FA 1Q8SA 2DXIA 1WJBA 3QH7A 1U9NA 1BR2A 3RCOA 3MKWB 4OUMA 1HB4A 1P4AA 1NT0A 1SZBA 2HDCA 3TEWA 4HF2A 4PCQA 3GYDA 4GWNA 1R4NB 3KX2A 1PO12 1V6LA 4IO9F 4NHJA 3WINE 4IRHA 3NV3A 2XUBA 4YZ3A 4LBLA 3Q9VA 2MYSA 3POSA 2XHNA 1XMXA 1U5XA 4M00A 4A69C 3GTJJ 4NMIA 2D5HA 2CO5A 4B8XA 1QU3A 4B7EA 2MEV2 1CAXB 5KHIA 4XLEA 5FD6A 4AE2A 4QTRA 3MFCA 4R4XA 1RUH3 3CCEI 1ZG5A 2OPTA 1FT9A 3ZN1A 1VIWB 5JVTA 1OR7A 3KZZA 3SH5A 5FO5A 1XSVA 3POEA 3E6BA 3IL2A 2W00A 2CQKA 1SD7A 4Y17A 3PL0A 4AI2A 4ENJA 4DO0A 2RN7A 1RUD3 2W92A 1YCIA 1L3LA 3S5QA 3BU7A 1W6NB 3M8LA 4K21A 4L18B 1FNNA 5LASA 3M4OJ 3VEPA 4DZJA 1ZBA3 1QIQA 2RS12 2HEWF 4NPRA 3F8NA 1R64A 1QF3A 2A6WA 5DYMA 4CA9A 1RGSA 5E20A 3WF4A 2LBFA 4E2QA 2QBXA 1XNBA 5D2AA 2J22A 2M1BA 1MS8A 3CF2A 1BCXA 1T2XA 3CCLI 3I3MA 1SD6A 1PMIA 5EXOA 1JZ8A 1HA8A 3TP3A 1RUF3 3UV9A 1S4CA 2J1SA 5JPMB 2LKXA 2LM3A 3K4BA 2YBSA 3K69A 3RQIA 1BI3A 1RNLA 2VJIA 4RQPC 3H3ZA 1KGSA 5ANQA 5FD5A 2BU9A 3KT4A 3GBGA 2D44A 2IS6A 4PFOA 3DPUA 3VHNA 5FZKA 1WGXA 1FV2A 2W52A 3A7QA 4PLOA 3WF0A 1MSEC 3TO6A 3KVBA 1IGOA 5I8YA 1OCOH 4MGTA 4YWAA 3WDXA 2J7MA 2VVFA 3P3NA 1REDA 2CFXA 1IS6A 2JIGA 2VKHA 2FJ1A 1WHUA 2CWEA 1T6BX 2Q1ZB 5HV0A 2PHRA 2X5IC 4UUSA 1HSTA 1NA1C 1VBE3 3ON7A 1XNTA 2AACA 3IRQA 4XE9A 5TRDA 2D40A 3IRRA 3VZMA 4AFDA 3ST7A 4HBNA 4B09A 3R6SA 4NN0A 4RYDA 4WXCA 1DP0A 3G4SI 3ZPYA 2A73B 5CNAA 2OX0A 3NJVA 4B7KA 3L2VA 3SDBA 2JG9C 3WW4A 1IV6A 1PYVA 2DMUA 2VQ0A 3GTGJ 2VXZA 4O65A 2VM9A 1S8NA 2W1OA 2DCZA 5FBZA 1AR73 3BTLA 1MZ5A 2JK3A 4CUAA 5ANNA 2JJ6A 4M9XA 4E7JA 1V6IA 3OY8B 2CGOA 5L3DA 4YFKF 1RMU2 1VBB1 1N3OA 1I3AA 2DA2A 3P5JA 1FLIA 1JXNA 1HW2A 3PIGA 1CESA 4PJYA 4LHNA 4E27A 2PG4A 3D5RC 4FPEA 2FXAA 2QF7A 4AI3A 4M71A 1LJ7A 4XBNA 3VBUA 3ZIWA 3DXUA 4RHV3 4A3CJ 3IC7A 2NVUB 5H9QA 3ABZA 2GXGA 3ZMVA 1DGLA 4WXDA 3DEUA 4BEHA 2VH9A 4QKBA 5CADA 2E5NA 2VMFA 3A4UA 1IUYA 5H6QA 4GJZA 4GB33 4G4FA 3ASIA 4WCGA 4N53B 1FOD1 4A4AA 2XRNA 3T0YA 4XN0A 5A6QA 1OD3A 4DZGA 1FOXA 2YDEA 1XSDA 4A3ZA 3CCYA 1GWMA 1PO21 5AC92 3QP5A 3LSGA 3TDUC 2P3YA 3AAFA 3MICA 3FF5A 4N4NB 1ZZ7A 3U9GA 1DQUA 3UGGA 1OR7C 4LG0A 4FFIA 4NOTA 1PP7U 4K8RB 2EXIA 3ABKH 2BY0A 2WFPA 1JYWA 2G0EA 4UFJA 3JRAA 2RR11 2O8OA 2Y9ZA 1F31A 1TE1B 4TLGA 4QQHA 4DGWB 2WT2A 4P1WA 4Y13A 1XCBA 1XDUA 1R49A 4XBLA 4QPQA 1H9WA 2JE7A 4BZ4A 1OPMA 3AL5A 2VC9A 5DS9A 4RGUA 2M8EA 4LNVA 3Q8FA 2XF7A 2ZFWA 1KITA 5FJHA 2WZR1 1IKQA 5FZLA 2AZ5A 3HSEA 1NE6A 1UHSA 4GA9A 2QBYB 4MGIE 4E9KA 2D97A 4NPMA 5CJ9A 3GCXA 3LEMA 1XSXA 1ZZ9A 1HQWA 3DBRB 2KD7A 5CA6A 2RMU1 5BPXA 3M9AA 5FZ1A 2YUSA 3NARA 1O8PA 5E89A 3RG0A 4XDQA 1SVLA 1BR1A 4WVWA 2VKVA 5L7OB 3U11A 4I3GA 3WNPA 4AGVA 1YTYA 4P9XA 1TNRA 4IE0A 4HVQA 4E2GA 1MD0A 3OYLA 2ORZA 2EPFA 3K70D 2PLV3 1W0OA 4AI8A 1G3WA 4BH9A 4XXAA 4MGYE 2WWJA 3BLYA 1LESA 2DO7A 2R7ZJ 3VWBA 2V1UA 1JZ2A 5C3RA 4G6TB 2DFCA 2W5FA 3H7YA 3X29B 2DU0A 1GOHA 2BNOA 2OBPA 4CSWA 5HCBA 5I0RA 3OD4A 4DYQA 4JGZB 2UYBA 1RUI1 2YY1A 4TXWA 2QQ9A 4BXUA 2UU8A 1TC3C 1PNGA 1E0EA 4Q2FA 3O6BB 2JRMA 2ECBA 2A68F 4OFGA 2IUWA 4CDQB 4OAZA 1P4WA 3AB0A 4IEYA 1ON2A 3ZR5A 1TBXA 4S0HB 1M06G 3QU6A 4OIRF 2ETEA 1AL21 4Q4Y3 1GP5A 5FZHA 4EWDA 4R52A 3S14J 1H88C 4BU2A 1JGSA 5IOYA 2COMA 3SISA 2R7OA 2E63A 3PSFA 1BXHA 1QGPA 4OOIA 1W7PA 4KMUX 4QX8A 1H6XA 3Q8CA 2AQEA 3V64A 3K4JA 5FKMA 2HWF1 2LY2A 5GLVA 3VBSA 1RETA 3J7YJ 4P02B 3VBUC 2DDAA 2X51A 1GLHA 1REFA 3T1LA 2RQQA 3HM5A 2VE1A 5A33B 1UCRA 2MD5A 3RNSA 2DTRA 4BQAA 3S6PA 4QPGB 4PHZA 4KA4A 3TQNA 3RZJA 1YO5C 4F8AA 3H5NA 2X1EA 1SFEA 1CD3G 1G6NA 2IBDA 5C3SA 1HRI2 2Y0MA 2VLAA 1D3YA 3KCCA 3VHPA 4ABZA 3DN7A 1TMF2 2VASA 2EIMH 4RLFA 4GFBA 1GZTA 1K42A 3HDDA 2XAHA 3JB8A 2ZX2A 1DYKA 3A23A 4PGHA 2DW4A 4I76A 3VDDB 1X50A 4QQLA 2B42B 3B02A 1GNHA 1OLME 1W2AX 3WTSC 2XV4S 4JDNA 4I98B 1ENRA 1AR91 4UW3A 2CAUA 1QMJA 3E1SA 3GZEA 2UWAA 1PNFA 2P6CA 3DPRA 1VJ2A 3ELNA 2KFDA 1WJFA 5JZGB 4OULA 4UBHA 1Q8QA 2OTLI 5ACA3 2X6YA 2R7SA 2M45A 1NXMA 3I3QA 3AL0B 2JZYA 2WS91 5B66C 2M4KA 3WNOA 3DBHB 5KXEA 1JJ8C 1JH5A 3BR5A 1WWYA 2WBKA 4IV3A 3IZOA 4PSWA 5DDJ1 2JVHA 2CUJA 3AL6A 3O1PA 3R4UA 3ZN4A 3BTAA 3N9OA 3PUHA 2I07B 4C1WA 1VFCA 3F21A 2ZJQF 4Q4X2 2HNHA 4INDA 5A6YA 1IRXA 2X1CA 1UL9A 5IVBA 2KMUA 4DPNA 2HWB2 3BCWA 1GV2A 4LBQB 4AI1A 1DZRA 1TW2A 1WQ2A 3V4GA 2VMEA 4XAEA 4C3IJ 2HXOA 2E1MC 4G6QA 1YI2I 1Y8QB 3VD4A 2UWCA 4QIWN 2L7KA 1X2NA 3A01A 1KU2A 2DJIA 2KIQA 5CFDA 2CQQA 1CGPA 2K3PA 1XD7A 5JI9A 3FK7A 5HS7A 3HR9A 3LAJA 2O8KA 2IXHA 3F8CA 3N7JA 2Y30A 5FY0A 1Z05A 3ES1A 2IZWA 4NRMA 1G3TA 4B4QA 4MVTA 2MA3A 3UYJA 1KJRA 3CC2I 1MH3A 2EB7A 2D6LX 3K3NA 2EXJA 1POV3 5LHGA 3D5OA 3P1IA 4KGQA 3CEWA 5BNGA 1BOAA 2Y6HA 3I54A 4RA2A 1RUD1 4LOCA 3M3CA 3KIOA 2A3WA 3I2FA 3P9CA 4MYEA 2DCKA 1ZBA1 2KA3A 5J98B 4XDOA 1JGGA 3ZXFA 4M9ZA 3UETA 1YFYA 3TB0A 3R60A 2R5YA 3AZXA 1X2MA 5FPZA 4TLFA 2R0QC 5ILSA 2VZUA 4DINB 4JYKA 5FO8B 4XCBA 1XU2A 2RV9A 3U1KA 2VONA 5D5WB 4A3BJ 3U75A 3BG7A 1TTYA 4CE8A 3HG9A 5KC6A 1V5GA 1BI0A 1VQNI 1QRYA 3IDCB 4AF9A 1U5ZA 2DFIA 4KBZA 1DLCA 5A3MA 3ITQA 1S6LA 1AL0G 3N9MA 4FP2A 4WF2A 1QH6A 2ZEZA 4NWVA 1HQCA 4A44A 2Y64A 4HN1A 2YZ4A 2DMPA 4YIIA 3VBSC 3NKTA 4SBVA 3V8LA 3K10A 1LNWA 4CDGA 2P1BA 1OI6A 3S8PA 1VQKI 3FM5A 2ISZA 3W59A 2W4SA 1DQ2A 4RR3B 5FKKA 2EFPA 3I7DA 5C6CA 5KXDA 4CYDA 2BOLA 4ZZLA 1A8DA 4YRDA 1S72I 4LUKA 4RS5B 1VBE1 3ZDVA 3CQZJ 3AKTA 2YFUA 3OB8A 2Q0OA 3EETA 1C28A 4ON0A 1VQMI 5LHHA 2Y0SA 1HXS1 1RUE3 1RUG3 3DKWA 4XFBA 5J1UA 1VRBA 3DU5A 3T0AA 4W6YA 1SFPA 4CVUA 4LMYA 4Y24A 4CP1A 4OMCA 1A36A 3I3DA 1EH8A 5FWEA 1BEV2 2VE9A 4FOQA 2V4JC 4X6RB 1Z78A 4QB2A 4AAXA 3DPRC 3C7GA 4L97A 1AR71 4XIDA 5GTHC 3J7NA 5GAHJ 4F55A 1RUC2 3NNMA 3CBNA 2E7XA 3ZN6A 1HC8A 3IP4B 3OIPA 4LIUA 4D0PA 1LFBA 1S7EA 4XJWA 1CX1A 1WJEA 1UY0A 4IV3C 1SMTA 1TWFJ 1CVNA 4YFWA 2DFHA 2VKDA 2FMYA 4IHXA 4XOPA 3BKZA 2GWRA 1QJFA 4HNUA 1BW5A 1AR82 4OI2A 4L5JA 3T2OA 2DOAA 3GGLA 3J8F3 2FD8A 1FP2A 3JRFA 2VR4A 4LG3A 2LKSA 2QKMB 2HOEA 4AQ6A 3CDHA 2EFWA 4XCAA 1LEBA 1Z7UA 1HDKA 1N77A 1PIV3 4PQ9A 4BXXJ 1W2TA 4NRQA 2ME6A 4W8JA 3GWZA 5HNHA 2O3FA 4BE0A 2J1TA 1F43A 4A45A 4NHYA 1CX4A 2DUQA 5FXXA 4JQFA 4GB31 4ENKA 4OMZA 3JRCA 4Q0SA 5CFDC 3CCVI 3AYEA 1T38A 3PNAA 4W6WA 3WNLA 3UGFA 3Q0VA 3O8HA 2DURA 3Q9SA 3DTIA 3KLNA 3ZSJA 1ZZ8A 4HK9A 3PNYA 4G12A 1VBA2 2VNGA 5DZEA 2BDRA 4JGYA 3WU0A 1S0FA 4AQTA 1AA7A 2W1UA 3MCZA 5D4SA 5KWRA 3KZ4C 2ZGSA 1V4RA 1C5IA 1IF1A 1S0IA 1IKPA 2A6YA 5JVVA 3LDRA 1YEWA 1BIBA 1WLTA 2IXJA 3UK9A 3H3UA 4EJOA 2VMDA 1W36C 1EAH3 1JI6A 3JTHA 1RR7A 1ETVA 1ULFA 4XUPA 2AUYA 3SC7X 1PP8F 2TDXA 4LIVA 1I5ZA 2XAGA 3DF8A 1OXCA 1OFNA 3VB9A 4B3NA 3HOUJ 1W6PA 3MV01 3AZWA 4YZ5A 1CWPA 3PM1A 1IRFA 3RDIA 5IVEA 5J1RA 4Q5SF 4QXBA 3HHHA 3QH6A 4ZKTB 1XC6A 2YSRA 1N3QA 4AHXA 1B1BA 1OCPA 1UIKA 2NS0A 1UXZA 3V0AB 1CAUA 4HV5A 3JQWA 3HMYA 4S05A 1FIAA 4X6QB 2C5DA 4XK4A 5BNQA 3ZKYA 2VCAA 3FXOA 3OV8A 2XQXA 2WSUA 1B8IB 4FOYA 1ZNPA 2IVJA 2BV4A 3GYHX 4YPJA 2ZJ2A 1E2XA 1H8VA 2XGEA 4II3A 1S3JA 1V6OA 2ARAA 4AGRA 4HNTA 1R36A 5C70A 2L9NA 3PVBB 4YVSA 5ICGA 4AEDB 4R9AA 2VNOA 1BC8C 1EY2A 3PTYA 3WVJA 3ZYFA 2H94A 2VJ4A 3CUQA 3C1DA 2R49A 1W6QA 3E5XA 5DUWA 2PLV1 4XW3A 4RM3A 3DXTA 5IVFA 4HSTA 4UXNA 3H9QA 4OIQF 4UV9A 4XKBA 3ZO0B 4AD9A 1TEIA 5T5OA 3WU1B 1MBGA 3TN92 4OYUA 3WNKA 4XRFA 5GLTA 1JKRC 3MLKA 1AVBA 3VZNA 4DYRA 2E60A 4X8PA 1KQ0A 1W8OA 2WTEA 1HRV3 1XG1A 1ONAA 5IOZA 1VBD3 2NQYA 3OYJA 3BPXA 1U9OA 1LHVA 3V7SA 4NBQA 3DEWA 2YPRA 5AFEA 1TT0A 1K79A 5FLMJ 2HEVF 5I0UA 2C6YA 4CZZA 1QEXA 1BHGA 3SDGA 4RFRB 1XTAA 1SFXA 3TL4X 2XKPA 4A0YA 3WEZA 3L2YA 4E4HA 5EGOB 3M7AA 1STZA 1ND2A 4UHTA 4H4KC 4JKKA 4OHVA 4YW1A 2VULA 2E2HJ 4ISQA 4Q4Y1 1CPMA 3S0MA 2YU9J 1J5YA 4URAA 3N9QA 2GH2A 3JU9A 1D5YA 4V1PA 3HQUA 4XLCA 3OY9A 3PURA 3WG7H 4JX0A 1W8FA 3WF1A 4U0YA 5FO9B 1VP6A 3CF5F 4CYCA 5BNOA 3G1OA 2VMGA 4CUBA 4OHZA 3ZSLA 1EV13 3F8MA 2AENA 2WNEA 3BPSA 4UBGA 1MS3A 2WNOA 3HNMA 1HOMA 2HWE3 4BMEA 3EMRA 1TNSA 3EXUA 5CKTA 1IS4A 3HOZJ 1GWKA 5A6XA 4KWJA 3WDWA 3WV6A 4KDPA 4UFHA 5FLIA 3CJRB 2F17A 1I6XA 2FUG2 4N90A 2WWYA 4DBRA 2Z1DA 4ESJA 2Y6FA 3S1QJ 2JG8C 3TKYA 5FCCA 4ASMB 2LALA 5CFCA 3VN4A 3SLIA 3JBG2 1SLTA 4YLZA 3VBRA 3PQKA 1DUXC 1ETQA 1WD4A 4DJAA 1U2WA 2BOJA 1EYBA 2O7OA 4NNJA 1OPOA 4CEWB 4EVIA 4FOVA 4JGYC 3VHOA 3FISA 3ZFGA 4NIAA 2MH2A 1EKEA 5HLTA 1N3PA 2Q0AA 5C4WB 1WD3A 3K77A 4MXWA 2P4EA 5DAXA 3F95A 3THPA 1G9DA 5A1FA 4LXLA 1R082 2ESHA 1KDKA 2WBMA 2VQLA 1W05A 5J8CA 2FSWA 2QVOA 5JOZA 3WDUA 3ZYRA 2IWGB 1US2A 3HPNA 4I6ZA 5D1IA 4M3DA 2GP5A 2WJSA 1HXDA 4U7DA 1H2KA 1ETYA 4PUSA 3WTUC 1MJ9A 2B39A 1UAAA 1BK0A 2R7EB 2K85A 2K9NA 2Y38A 3NWSA 3QP6A 4PJMA 3UR3C 1GKBA 1E17A 5H2FC 3K7AJ 1W1WE 5AVPA 5IAXA 2AHQA 3L2UA 3D3AA 4AQSA 2V73A 1R58A 2GNDA 1S29A 1RB8G 2YB7A 4AIHA 3OYBA 4Y15A 2JE9A 4QD2A 2A61A 3S93A 5FZGA 2WO3A 3LOBA 5KNLA 4C2TA 1MZ6A 3L1PA 4F91B 1PMHX 1M1EB 4L5EA 1EPZA 4FFGA 2D98A 1NLSA 1NAEA 4KWUA 4D5CA 1W39A 2C4XA 2VI6A 1H8TC 1UOBA 3ZMNA 2E36A 3ERED 3OBRA 3DEEA 2W24A 5JR7B 5LA9A 2KDZA 5T5JA 1UY3A 3E7LA 1S2KA 2N7GA 1GLNA 4BDZA 4LKDA 1BVVA 4WXHA 1VQLI 2B4KA 4V19K 2EV6A 3ESWB 4MGRA 2BGCA 3CUQC 1VAVA 1GWLA 3AZVA 5CYYA 2B8MA 3VBHA 3S1MJ 2CSGA 2XONA 4CDUC 2BFUS 3BDDA 4IESA 2RS53 1QOTA 3CZ6A 4QX2A 3SNMA 2EIGA 1VQ5I 1PO13 2KJBA 2LS6A 2IGKA 4Y52J 5C8WA 3IH2A 3D6EA 1H2NA 4XAAA 3H1YA 3OD0A 4XVHA 4I02A 4DZPA 3RKXA 3LQCA 1VBC2 4PFPA 4B3XA 2JA2A 2BEOA 4CXYA 3AKPA 3V8KA 4A6OA 4R9BA 5FLHA 3RZOJ 5ABJB 3HOXJ 4IGOA 3FXQA 1DZTA 2EIKH 3WDVA 3H5AA 5IW0A 2ZJCA 5HXMA 5JVGF 5FFZA 4EMSA 5FTTC 1ZA7A 3BIWE 2D6PA 1IV8A 1MR5A 3U2RA 1BKZA 3ABLH 3B6AA 1ND2C 4YM1A 1U0JA 1K5MB 2RJLA 4A12A 3LGRA 2X6OA 3LOCA 1W04A 2VKEA 2RJ2A 5E17F 4BQ3A 1SACA 1EV7A 2A3XA 2XXZA 2DT6A 1XYOA 2LD5A 1DU6A 2JPCA 2ZC2A 3B93A 3POBA 5FZEA 1AXKA 4EWEA 3LSTA 1ENXA 4Y22B 5BNOC 4G6DA 3CD6I 1OOPB 3RZMA 1CAVA 2HYKA 3AKQA 3I58A 3PU8A 5EEHA 5J1YA 2ARBA 1I39A 3J7MA 3W5NA 4JCKA 2F5FA 3OYCA 3WDTA 2WO1A 3OPZA 1MVEA 1GYKA 2VJJA 4BGDA 2ZGOA 1ITYA 2PN6A 3IDAA 5ED4A 3FZVA 2X10A 2EIEA 4O9GA 5CFCC 2ME0A 2RDSA 3BU0A 1FYMA 2QKLB 4FVVA 2PAKA 3VBRC 3JR9A 2EFNA 1RUE1 1RUG1 2W95A 1X1CA 3SMHA 2LF7A 3OYMA 3WUCA 1CN1A 1TLHB 1QZEA 3PNVA 2QA4I 4YSFA 3JREA 3ZFGC 4ZYAA 2IFRA 1V9U1 3VYTB 2JA5J 1H2LA 3BODA 3Q8BA 4ZPIA 4XKCA 1YUDA 3ECHA 5E3NA 1DQ4A 5FY4A 1L7QA 1N25A 2ZZJA 1QXJA 2D2WA 5EJZB 1K78B 1JUHA 5A6ZA 4EM1A 1ULCA 5FROA 1ZBE2 5IT3A 3GALA 5A7OA 3MZYA 2FBEA 3JCIA 3LIHA 1SDWA 1NTCA 1SLCA 2BBYA 5J1XA 3POIA 4Q1PA 3DPLC 3S3NA 4I99C 3AZYA 4I09A 2A1XA 3FFQA 1MMDA 3GTLJ 1PIV1 4AVCA 1Z7S3 2G4IA 1JHNA 3UNGC 5L9BA 4WZFA 3CZJA 3KP2A 3FFZA 2WA0A 2YU1A 2JDYA 4HDVA 1FC3A 4AQ2A 5CBLA 2PHTA 2W1WA 2ZKNA 5L9RA 2FCUA 2N8GA 4PDWB 2OD5A 1YJ9I 4QB1A 1AR61 2JDPA 1FX5A 2ZMEA 3D8CA 2VN2A 9ANTA 1BBT2 1YYNA 5EHDA 2AH2A 5JR2A 4LO6B 2NVQJ 3WTWC 1IN5A 5C4XJ 3K4NA 4KMFA 1XRUA 3KM5A 3VYUB 1VRH3 3K46A 1LDDA 3ML6A 3S57A 3MBWA 2CWSA 5F3EA 3VBHC 4PJLA 2Y75A 2NMNA 1YHQI 2QDNA 2QTWB 3SH4A 4KI5M 3W6KB 1WFXA 1K4TA 4OCTA 2E51A 3HBLA 1K3IA 1UB9A 2EBIA 4XL9A 2XBO3 4EJTA 3HKZN 1QXRA 2CNAA 1WSUA 5IK5A 1Z3YA 3IWZA 4BLJA 2L7MP 3BG6A 2XMLA 3INAA 1E57A 1EAH1 2M87A 2GXAA 2O5RA 3K4CA 1U5YA 1D4M2 5EZGA 1XNKA 4MV2A 5T52A 3N35A 4AYBN 1YHFA 5CAZA 1TME2 5AC93 1TNTA 2RDNA 4W6XA 1C4RA 2F4LA 3E5QA 2XJVA 4XTPA 2NS8A 1YG2A 4ENMA 3NSTA 4ZXKA 4QXCA 3BVCA 4P14A 2R16A 2ZHLA 3GFIA 2BW3B 1R00A 4QAWA 1HCRA 2LDUA 3S3OA 1D4VB 3IH4A 2CHHA 5KXCA 1V6JA 5KK1A 4A42A 3IAPA 4Y4RA 5J36A 1EH7A 4HQMA 3CCSI 4UV8A 4EN0A 4CEYA 5C3EJ 3VBOA 5K9YA 3O1MA 2FNAA 3ZXJA 3O2PE 1IRGA 1ORKA 3OYGA 5DAWA 3PHMA 1JTXA 1JI8A 2P3JA 2W39A 3CCQI 1OQ1A 2L01A 1CAWB 4ZHNA 4BOWA 1DGRM 2CYYA 3MKZA 1WZ2A 3GO5A 3JRGA 2ZGUA 2WNVB 1MIJA 1WBFA 1TWHJ 2GC3A 4E7HA 4UXAA 2ZX0A 3GXOA 4QKDA 4RLQA 3PMSA 4XUTA 4RB3C 1O4YA 4FPKA 3LNQA 2WC2A 1A6IA 4P9FA 2QSFX 4CDXA 1ENSA 2DBNA 4IOAF 3FIWA 5LBEA 2VCBA 4N0BA 4YG3A 1YRNA 2H09A 2NVYJ 1ZG3A 2VBZA 2RV8A 5IYYA 1RI7A 5IUQA 4ZDLA 2LY9A 4G9YA 4RGGA 3TW7A 1DZQA 1W5CC 5L3BA 1DYOA 4IEOA 3GTQJ 4GO1A 1LE8A 1HKSA 4XF9A 5KR7A 1SLIA 5FREA 4JK1X 3H42B 2XGXA 1F4AA 4AXOA 4I2OA 1VI0A 4JBAA 3DU6A 5IFPA 2X6WA 2AGSA 2Z16A 3KETA 2B9UA 2R30A 3VKNA 5CG9A 2HI3A 4KIGA 2W1SA 1V55H 3SZTA 5K0UB 2OA4A 1TW3A 2BOIA 3RMYA 3T09A 1WBLA 2B63J 2JDUA 2NP0A 4XONA 1I6HJ 3OJBA 5H9SA 4MADA 2HQAA 2D93A 3F22A 2XJRA 4AIJA 3HOBA 2P6TA 5HOOA 1OYIA 4PT6A 1WCDJ 1V5FA 1PVEA 1ZQ3P 4KQ7A 2EXKA 2F4IA 1UU6A 1VQ6I 1Q8VA 3VPRA 4EQQA 2A7AA 3WT3A 3V42A 2BVBA 1RUJ2 1ZLKA 1B9NA 2EIJH 5F1RA 5IY5H 4UT5A 1YFXA 5DAQA 1DCSA 5DXDA 3ZPOA 3QPTA 3W6VA 4BXFA 2VPVA 5LB6A 3LAPA 5T54A 1ZH5A 1KA8A 1G3YA 2ZMEC 4Q4V1 2YC4A 4IQJA 3AZZA 1ZKGA 1ND3A 3BTCA 1YQ2A 4PIZA 4AGGA 2BY3A 1R71A 1U3EM 4ZZDA 5IFTA 1K45A 4QGNA 1POGA 3H36A 1HQNA 4N43A 3ZX7A 3ONQA 1IRZA 3R0JA 2H27A 3I9V2 1SLBA 2W82A 2I10A 3ABTA 5GALA 4FPCA 4UUTA 2C9KA 2DN0A 1AYN2 5IVYA 1MS1A 4XFFA 1OQEA 3UKTA 3JAMK 2K9ZA 4LMFA 2R072 1YOVB 1HRI3 2X05A 1UYZA 5FK7A 4D1QA 2WB1N 5JOXA 4MXVA 2VD7A 3FUQA 1TMF3 1B72A 2XQRA 3FHZA 1A04A 3ZRGA 4OAYA 2ZMNA 3CP8A 3NWTA 2XVLA 1W2UA 2LBFB 2PMZN 1FPN1 1X4OA 1BMV2 5F5IA 1W90A 2HOTA 1OCZH 3VD9A 2ZHMA 1ULPA 1RRJA 1GZWA 2HH9A 4BQ2A 1H2MA 1YIPA 4FE7A 2FHRA 3AMHA 5JUVA 2JPBA 4L9NA 3M1EA 4DYCA 3A4CA 5K7PA 5GPCA 3N7KA 3E6MA 1J2XA 2KR2A 2IGNA 4NWWA 2DFBA 1HDPA 2GNBA 1A78A 2FE3A 5GZGA 4M3FA 3GJAA 1CZTA 4AUXA 4CEYC 3FHIB 1K61A 1RXGA 3HEIA 2ZHNA 5IVVA 1OQYA 3M3YJ 1NE4A 2WA4A 3RZZA 2ILMA 5E6HA 1H89C 4LBOA 4EEFG 3C8XA 1MACA 2M0MA 3MIDA 3C2BA 4BIFA 5FPXA 2EILH 1D0XA 4L0ZB 5ACA2 2D6NA 2KIUA 3I2KA 4Q4X3 3BTZA 2D1HA 3T0DA 1NCQC 4HVOA 4K20A 3PVNA 1PO11 2HWB3 3RQ0A 5J3UA 2VZTA 4UUSB 5A32B 4CDXC 2LY1A 3QACA 4GZ9A 3HBKA 5FY7A 1CAXA 2VUMJ 2FDJA 4QX7A 2W87A 4LD5A 4Y1VA 1HLVA 5GM0A 3PNTA 3J7ZI 1TL8A 2XUMA 1OCRH 1SFUA 4LB5A 1GQPA 2WT1A 1SDDB 2YC0A 1L0OC 2MEV1 3I4IA 3LSIA 5BV6A 3VZKA 4G3YC 4M3GA 4B1MA 2PFBA 4YW6A 3KFWX 1CZVA 3DYOA 5BMZA 1MMGA 5IT6A 4IHWA 1SAUA 5FP7A 3FBIB 4L0PA 4LUMA 2V6CA 4DRVA 4GULA 5FPVA 1XDSA 5E1ZB 3UL2A 2EA4A 4GMP3 4CXXA 4CXWA 1ZA4A 2DQLA 3WNMA 4ZYHA 2PMUA 3KT1A 1X9TA 1FOYA 3VSLA 3GHNA 4IDZA 3SFZA 4AZZA 3GTMJ 2WFF1 5B4XA 4XBQA 2RS11 5J09A 4LOTA 4LBQD 3MPBA 1F4HA 3CDZB 2ORXA 3UJOA 3GZTB 1DLLA 1VMHA 5G05L 2ZSIB 2Z4FA 3O1SA 4MO7A 1FOD2 3R0RA 3KYLA 3AKZA 4M6XA 1SAXA 4BEHB 4IETA 2Y2ZA 2HR3A 4YM0A 2KZGA 5IP7J 1WCMJ 1ZZ6A 2YR2A 4HPQA 1ON1A 1OH4A 4QQOA 4P9UA 3V65A 3HGYA 5F3IA 1ZM1A 5J96B 1ND3C 1WMDA 2QQAA 2LOOA 1AJOA 4IEZA 4D5FA 2IEKA 3RRDA 4D0QA 1WCUA 3ZPLA 2LC2A 1XCVA 4WM7A 1ZGAA 1Y4WA