2CGRH

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
b'RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
source organism Mus musculus
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
total genus 34
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH02
1HHKB 3DETD 4OCRH 1CQKA 1I4FA 2YA2A 1UJ3B 3IFOA 5DYOB 1EVTC 3BESR 2J8OA 5D6CB 2QV2A 4H1LA 4JDVB 3T0WA 1QSEA 1AQKH 4MQTB 5HYEA 4IRZL 4M1CD 5AUMA 3GIZH 5HJ3A 2Q20A 3MGAA 3OB0K 1OGAD 5B22A 4YNYB 1EAPB 1FO0H 4P2OA 3O3DA 3WSQL 5B4MC 1KJVA 3IKCA 4LVEA 4P4KD 1E28A 1DL7L 1T6WA 4OB5H 5C0IB 1F00I 1RZGA 3PABB 1J7VR 5DJDB 4XPGH 2CLRB 5DJXB 4KPHL 3BP7A 2EXWC 4JAMA 3OGCA 2W9EH 1A7QL 2X7LB 1HINH 5KSBE 5IVZB 4PGZA 4R26L 1RQ5A 3JV6B 1FQ9C 5SV4A 3BOVA 1FN4B 3S34L 5C07D 5IMOB 1YMMB 1BIIA 1MJ7L 2C7UA 3P73A 5FIEA 2HFEB 4K07A 1A6WL 3IJHB 5SX4H 4B7IA 5DRNB 1UZ8B 4LSDA 5E70A 3KPRE 3EYUL 5IEKA 3VG0L 1HEZA 1I3GH 4ODHL 3MOBH 3SDXF 4JHAH 4QTHA 1PDKA 2ADIA 4KTEL 5D7LA 5C0ND 3MR9A 5D7LB 3M45A 3N9GL 5I76B 1UM5L 2CKBL 4F33B 2F54D 3AY4A 3E6FA 3QCUL 3GSRA 2VXSH 1JHLL 2FH6A 3QNZA 4RGND 3G5YA 2VXUL 1ACZA 1VFAA 1VFAB 1Q9OA 3LEXB 3BUYA 3W81A 4PLNC 4RFNB 3VFUB 1J1PH 4O4YH 3UTOA 2F5BL 1MI5A 3WJLA 3FT4B 4KDTA 1AGFB 4QRPE 4EI6A 4WWKB 3CC5A 1J8HA 2WWMD 1RIUL 4XBEH 4EVNA 4YQXH 4QYOA 1DQQB 4NQXA 4PP2B 1YYLH 1S8DA 2H32A 1JTOA 3D39E 3S37L 3HE7C 4UV4L 5EOCJ 2CIIB 1EO7A 2FBJH 2GJZA 5INDB 4MGXA 4XPFH 3UMTA 1CR9H 2DKUA 2FECI 1MCBA 1EHNA 3D3VD 3MRQB 5C07A 3LRHA 3O6LH 1N0XH 5F1SA 3TH2T 3VXMA 2I5YL 2EE6A 1MCQA 4HIHB 5F1OB 3GMMB 5DC4B 4LHQB 4DZ8B 1PG7X 2FYYA 3IJSB 1UB6B 4Y19A 2YUWA 1QR1B 4O9HH 5HVFB 5ADOL 1YA5A 5E8DH 2AW2A 2WINA 4JAMB 3EIFA 5GRWA 2WINB 1BREA 2XQYG 2WIMA 2P5EB 5TH2B 2XN9A 2BSTA 2CRZA 3ROOA 2IBZY 5D1XC 3BSZH 4NPYB 1KCVL 1YMMA 4UNTA 5ICYA 1DQTA 4UQ3B 3U9PH 1P84K 3WYRA 4F8TA 3BN3B 4YDLB 1ZLVK 1TJGL 1LO0H 5JLZB 4O2FB 3RHWF 5BXFA 4HULB 4OJFL 3QUYB 4XWGL 2NY5C 3GKZA 3MYJB 4HDIB 3QO1A 5I1DB 5T1DH 3D2UA 5MENA 5HI3D 3WS3B 1PW3A 3KAAA 1SHMA 2BSRB 2MMXA 4UQ2A 4J1UA 5D71L 2ED8A 1HI6A 1MHHA 1MHHB 3I50H 5IR1B 4W4OA 1RK1A 3V0WH 1LO3H 4YDJB 1KJMB 1KPUA 1BFSA 1CLYL 1A1MA 2IWGA 4NQXB 3KLAB 1P1ZB 4P3CL 4NNXB 4U6TA 4OD3L 3VXRD 4G8EA 1JPSL 4MA3A 4MJIE 5CIPA 2J4WH 5GGTA 1CFSA 3B5HA 3MCLL 3TF7C 1QFHA 1BOGB 4A6YA 5DEGB 1EGJL 1RU9H 1EFXD 3RWGA 2LTQC 1CE6A 2GTZA 4QHUB 1AKJB 4G9FB 3LCYA 1FIGL 3FB8A 5I1AB 1U36A 4YR6A 3MLVL 3BPOC 1A1NB 4QHLB 2VLRD 2UZIH 1D5ZA 3LDBB 1RZ7H 43CAB 3RPIA 1OSZB 3D2UD 2DQHH 2BSED 5D93C 3HC3H 3L9RB 4OFDA 3TP4A 3TBTB 2ESVD 1BM3H 2JKXA 3WE6B 1AY1L 3NFNA 5D70H 2H45A 2DTML 4HGWB 1Z3GL 5GS0H 3TO4B 3VFMB 3PGDA 1QPXA 4LPVA 4NQDD 4NKIH 1JGLH 2R1XB 2AJUH 3SGKA 1CFTA 3T2OA 4UDTB 1UKSA 4PJBF 2ICEA 2H6PB 4P4KB 1RURL 5EU6B 4C56B 4DZBB 1RK0A 3EOAB 3RTQA 3BEWB 4U3XA 1RD6A 1A8JH 1OB1A 4TSCH 4IRZH 4TNVK 2QR0B 3PP4L 3BE1L 5DMKB 4P46A 1KUMA 2NY1C 4YIQB 5DTFA 1HI6B 2IBBA 1JI2A 3C5JB 3U2SA 3U2SB 4Z7QF 3LZFL 1A3RH 4XCYB 2P24A 2ICWI 4KJWC 3OJMB 2ZUVA 1P1ZA 1MCRA 4QOKA 3QDME 1T83A 1YN6B 2F5AL 4M00A 5GGSY 1INEH 4P5TD 3ARRA 2VC2L 4ZD3L 4U3CA 4Y5YA 1CICD 4O5LL 5IW1B 1C08B 3G04B 5CGTA 2DQUL 2QSCH 3WFDL 1K2DA 3O81A 4Q6IC 1T03H 5INCA 3MLYL 4F9PA 4KRPD 2FB4L 4Q6IB 3JTSB 3GNML 1IM3A 4ZG1A 4P2RA 1BVKB 3U46A 1U8LB 4XI5C 1BFVL 3CJJA 2MKWA 3CFJB 1IBGH 3HE7A 5E08L 2P8LB 3STLA 4S1DC 5C0BA 2BVOA 4J4PC 2XA8H 5HI5D 1MI5B 2ADFL 5HHOE 4P2QA 1PKQB 4L29B 3VFWB 3D3VB 1S7TA 4FFVC 4KHXL 4XC3H 5MP6H 3LMJH 5GJSL 4LLUB 1S8DB 2YPLE 4JFXB 2Z8WC 3V2AR 3MV11 4KAQL 4MXQC 5F7DB 3MXWL 4XCNB 3SOBH 3OL2A 1XCTB 4XGZB 4JCMA 4PG9A 3D39D 3CFCH 4N5UA 2JELH 1SYSA 5EOCL 5TE4L 5BRZB 4K8RH 2YK1L 2Y06H 2ZPKL 3ES6A 1DCLA 4HMCA 3F7VB 4PJ8D 4XVTH 2WUBH 4WWID 5AYQA 5GZOD 4U3HA 1JF5A 4GRWF 4GT7A 4V1DA 3RVVC 1JPGB 5I2IA 3D6GA 5C0FB 1LO2L 3UDWC 2VUYA 2DJ4A 1P5VA 1LO0L 1NCWL 4F15B 4MXWH 4PGBB 4JM2D 3L3KA 3TJEH 1GJIA 5EUOB 1KPVB 3TO4C 4MJ6B 3HI5H 1AKJD 1JUFA 1G9ML 3FT3A 1UVQA 1TMCB 2NY4D 1AO7E 2RR3A 3GSVA 1GGCH 4PBVC 3MREB 4K9EH 4WY7L 3KPMA 4OQTH 1Q9WA 1U8IB 3DRTA 1J11A 4LKCA 4LRIA 5SX5H 1WC7A 1AI1L 4YDLC 3TH4T 4PLOB 4GLRI 1P7QB 2HT4D 2GT9A 4PJ8C 3SGDH 4R3SB 3O0RL 2NZIA 4HWEH 1FZOA 5T1KB 5CJBA 5D71H 5K9KB 1EEYA 2P8MA 1KF9B 4HPYL 1Y6KR 2Z8VC 5J9PB 3K2UL 3K80A 1WV7T 4FQXD 2JJVA 1LO3L 4ONFL 3GKWL 4GRWH 4YHIB 4Y0GA 2BVTA 4HWBH 2G9HA 3JBG7 4JM2C 4X83A 3D18B 5KVDH 2BZDA 1UGNA 1S9YB 3T77A 3BX7C 1SMAA 4OUUB 2DI7A 4FRWA 4GKZA 3CGTA 1L7TL 4YK4C 5F7DA 2OP4L 5KSVA 3A6BL 3PWPB 2J4WL 3P9MB 1PY9A 1T2XA 4LBEB 4QRPA 5DR5L 4UTAL 3JUYA 4X99A 4P59H 4I3SH 3VGFA 3GGWB 1AKJA 4LDEB 4WDIA 2J6EA 2ARJA 4CU7A 4F58L 4AEHH 2DJUA 3RWFB 4TSAL 2K1MA 1VACB 4OM0L 1CU4L 2A77H 1T1XB 2LAAA 3Q2CA 4AEIL 3QA3A 1RZ7L 2FX7L 4C4KT 5DVKA 3QI9B 1RY7B 2CKBA 4OFYD 1H3PL 2R0WH 4K3DL 5D1QC 3L3KB 4X6DA 4NQCE 3OKOA 1XH3A 2AABH 3Q3GA 3M1BA 3WKNA 5L8JB 1RIVH 1HXYA 5J6HA 2AJSH 1OAZL 4KJYA 1FYTD 3FONB 5JHLL 5ALCH 2X1OA 3BT2L 3OKMB 1NGXA 4NUGL 3HPLA 4NKOB 1AP2A 3CPLB 1MJUH 4NQTA 4ERSH 5HHNA 2ZCHH 4M8VA 3IU4H 1D9KD 3FOLB 4UOJA 3HC0B 1CFVH 3BHBA 1IC4H 3L3DB 5E5MB 1ZAGA 2EC8A 2FO4A 1B6UA 2QHRH 3C2AL 2VITA 4LVHB 2WV3A 4H1LG 4ZSOA 4N8VG 1IQWL 2IG2H 3H7LA 2FSEB 3C5JA 1HE7A 3EYOB 3W39B 5J89A 3L3HB 3QUXD 3GSQA 4LASL 3KNBA 4AQ1B 3T2NH 1OLLA 4TRPL 3L7FB 4UT7L 1FZKA 5CINH 4XTRD 3OF6A 3QULA 4MS8D 5LKNA 1CK0L 4K3GA 4WHCA 4PLKC 4ZAKD 1U2HA 4WTXA 1A0QH 2OR9H 1S7XA 3VRIB 3UJJH 3MOQA 2GW5A 3MPCA 4ONHA 1A7BA 4OD2A 1J8KA 5TE6H 3QUXB 5IB3A 1A7PL 4HX1B 2JK5A 1ZOXA 3MRJB 3K8LA 1WF5A 3CU1A 2Z93B 1MCNA 4DKEL 3N06B 25C8H 3HNVH 5DJ0A 1A2YA 1KPRA 5DJ0B 2P8LA 3STLB 3OGOE 2AV7B 5E08H 2VQ1A 1U58B 4M5ZL 5ESVA 5HYFA 5IMLB 1D9KB 3B2VH 4D0DA 1JNNH 1MPAH 1JF1A 3GK8H 4POZC 4Y5VC 3CFCL 2XWJB 2FGZA 3I6KB 3W9DA 1IAIH 2GTWA 4XTRC 1JRHL 3SKJH 3CPLA 4R9HA 3T8XA 2XWBB 2GUOA 4MA1B 3LIZH 4WHYH 3MLTA 4PRNA 3DXAE 5FKAA 2VWEE 2YEZB 3I9GL 4F57H 2DMCA 4Z7OF 3OKDA 4X5WA 4HPOL 1P9MC 2CRYA 1FFPB 5KSUB 4E0RB 2VE6B 4OGXH 2FDBP 1V8HA 4PRAA 4IEFB 5EZOL 5ID0B 3OAYH 4F37K 4ODWA 5FA3B 1G9NL 4LU5L 4ODWB 4G7VH 2D7TL 2DQJH 2AERT 4OLVH 2BP3A 5ERWA 5K9JH 1TZIB 2DI9A 2H1PH 3OBAA 2NTFB 3CDCA 5SWZA 1CZ8H 2PF6A 3FQRA 4G6KH 4TQEH 3IFPB 3LKNB 1WTLA 4JG1L 1KIUA 3VWKA 4K7PY 1JZ2A 4P9MH 5C6TL 1OB1B 8CGTA 3D48R 2R0KH 1U95A 1NJ9A 4JLRB 4RNRA 2N1KA 4WV1A 3LQAH 2IBGA 4YC2B 5SWQA 2X4OA 5F6IC 5FO8B 1NCAH 4WY7H 1SMOA 4JZOA 1KJ2H 3LKSB 2MCPL 1J1OH 3DXAA 1NC4B 4HD9A 3ARPA 2P5EA 5DK3A 1P2CA 5E4IA 1WZKA 3O6FC 1GOHA 3HAEG 4PJEB 2XWTB 1RZFH 1SY6H 3TZVB 5FUOL 2XPGB 2AXJA 1I8IA 1KJ2B 1RIHL 2VDKL 5CILH 1DLFL 4PJIF 3MUZ1 3P30L 5C0CD 2B8OT 2H2PD 5CBEB 3FN9A 2HRPL 3JWDH 5L2KA 4U49A 1M6OB 1JYXA 1HH6A 1G9EA 4UZGA 5HHPB 2P8PB 2Z4QB 4NQEB 4TSAH 2FD6H 3MYJA 5FYLH 4I2XA 1I7UB 1NGWA 1DDHA 5EDXA 4TVSa 6FABH 5T33H 3UAJD 3BP6A 4U6VL 1KT2B 1RUKL 2VLME 4LK4A 2J8UB 2XQBL 2HT3D 4NO3B 1A5FH 5HI4C 3NCJL 2BHZA 3F8UB 3F5WB 2F19H 5HYJB 4OM0H 12E8L 3WNLA 2BHYA 4X6BB 5FA3A 5D7JD 4GO6B 3U36A 3FFCD 4P5MB 1KJMA 1KPUB 1NUGA 1KB5A 3KPRA 2FJGA 3O4OB 3OJVC 3O6FD 1EXUB 3IDXH 3LKPA 5DRXA 4UV7H 2DQDH 5IB1B 3EDEA 5H35B 4GBXC 3CH1B 3FQXA 2B4CL 4JRXB 4HK0A 4QO1A 3F58H 3BMWA 3RL2B 3HLAA 3TN0A 1OAZH 3HG1A 2CLVA 4ZSOE 1GXEA 1FNSH 4PJXA 5CHNA 1NGZA 5CZXC 4BFBD 2EDFA 4HIHA 1FPTH 3CXHK 3LN5A 3ZDYE 3WV0A 1BJ1J 1AQDB 1GHFH 5JQ6L 3BH9B 1L0QA 3DMMB 4BH8B 1U91A 1BEYL 1BFOA 3DX9B 2EDOA 5D1QA 1W8OA 2BSTB 5C0CE 4FABL 4YDVA 4GMTH 2DQIL 4ZXBB 4BH7A 1INQB 5KSAB 4N0UB 1MLBB 4MQXC 4DGIH 3ARDA 4DWHA 5HHMB 2E27H 4XAWL 3CMOH 4YFLF 5F6HI 4Z7OE 1X5LA 5D4QA 4RAVB 1Q8MA 2UZYB 3ARGD 5DMYA 5I19H 3OR6B 4NFDA 1R3LB 3W9EB 3VFNB 1JF6A 5LGJA 3QUMA 2P45B 1I8KB 4XNZB 1WFTA 2XKNA 4LAQL 3MV9B 5MEOB 5IVXB 5CGYD 4OCMC 1F4WH 4BQ6A 3OAUL 1E0OB 1CL7L 1NFDE 4BK5A 4PJIB 2R4RH 3MUGA 4PJ9C 1HIML 4MJ5A 5EZIH 5GRUH 2F74B 1LK2A 4I2XE 1AO7A 5I8OL 1SM3L 4OCWL 3I6LD 4Z18A 4XNXH 1J1PL 3WFEL 5TDOB 5CWSB 4RA3A 5DDHA 4IM8A 1CF8H 4Y4KB 5T5NF 4J3VA 3QO0B 4U6XA 4RX4A 1SYVA 3PL6C 1RZGB 1IMHC 4LBEA 4OF3A 1KG0A 4QRPB 5DEGA 1X5XA 3G6AA 3RZCD 3I9GH 3PWUA 4F57L 2APVA 1NGZB 3AB0B 2AXHA 1Q72H 4RRPA 1GIGH 2PO6A 3BKML 3IU3B 1R5VA 1ES0B 5KN5B 3DSFH 4OZIF 1IAIL 2PTTB 2PYEB 4RAUA 5IB4B 2ADJA 4PJEF 2UY7A 3MRRA 3CLFL 3MNVB 1DVFB 5D1ZD 4E5XA 5SWSD 5ISZD 4P2YA 2FHBA 1C16B 4PJFF 1KTLB 4HKJA 1LDPH 3PV6B 1ERNA 4FP8L 4G5ZH 1UCBL 3QG6B 2OL3B 4P23B 3UDWA 1MREH 4DFIA 3U82B 1FG2A 3CFKB 1B90A 2X1XR 3BP5B 1K9TA 1NGPH 2X89A 3HE6B 4J3XA 1CGWA 4TOYL 1T80A 3BIKA 3U30C 1E4JA 3GHEL 4D8PB 3AXLB 3EYFB 1Q9OB 1S7UB 3LEXA 3D85B 2E6QA 3DYMA 4HIEA 3WKML 5HJ3B 4BYHA 3I02B 4Z7NE 5C6TH 5B39A 4JY4B 1U3YA 4H5SA 3MUGB 3C08L 4JY6B 1B4JL 4NJAL 1NC2D 2PO6D 1SJVA 1A6ZB 1IC5L 3O9WC 4GRMA 4NFCA 1X44A 5CWSA 2ZJSH 1WTGT 5DVMA 4M62H 1QSED 2YPLA 4ZXBC 2A1WL 2FYYB 3IJSA 2EDWA 3JV4A 3P30H 4HCRL 1RZIA 3RVUD 4YFEA 1N2RB 1QRNE 4TUJB 2PN5A 1BIIB 4ZYKB 1JJUA 5DUMH 3RI5F 5DC0A 3O3BB 1EDQA 3I84A 4MDIA 3VWJD 2IH1A 3JUZA 4XCEB 4PBWD 3MRNA 3AAZA 3AAZB 1FJ1A 3NACL 2VZ1A 3GO1H 1NCTA 3W0WE 2X89D 4WJ5B 5D6DA 3U7YH 5K59F 2XZCL 5CJQH 1WT5C 1UXSA 2HKFL 4HCRA 5DD3L 4LLVA 4OKDA 2VXQL 5J1AA 2HLAA 3QNZB 1H8NA 3K4DA 3BDXA 3IDUA 1YPZA 1NCDL 4PJAF 3CFJA 2YKLH 4IOIA 3MRHA 5F3HB 4LVNB 4JHZA 5DMGC 4OKVA 4E42B 3PUCA 4O9HL 2JJWA 2BOCB 5HYQA 1I1AA 2X42A 3T3PF 1NBQA 4JQXC 1QRNB 1AGEB 4CNIB 1JIBA 1PQZB 3EUUA 1OPGH 3HUJA 4JFXA 1MEXH 5B8CA 4LLUA 2YPLD 1B4RA 1WIPA 4P2QD 4TTDC 3VXSB 4OCYL 5J8OA 4ZNCD 4M6ML 1TJGH 1NL0H 1RURH 4PJXB 5CHNB 1SJHA 3MRCB 2Q7NA 5F7UA 5ABDE 2IALB 4WI8A 1K8IB 1G6RA 3QEHB 2APFA 1X7QA 1YMHB 3RNQA 4FQIL 5H8DA 2PNDA 4Y5XA 2W1NA 3BKYH 3A6CH 2CH8A 3KLHD 4FQCL 4R4FH 1FDLL 2KUTA 3QP3A 1DSFL 3EJJX 2Y5TA 2R9HD 4K71C 4G6JH 4L8BA 4NPYA 1N2RA 4P5KA 4TUJA 4KK8D 1NGQH 1EBAA 2W91A 4NQCA 1KPVA 1QYGL 2WLZA 4RGOL 4JDVA 4YBQC 5EN2B 4U1KB 1K4DA 4R7NB 2R23A 2X4RA 4OI9A 2YD8A 4X6CF 3HNSL 4PV9B 1MAMH 4M6OL 5F7FA 5E9DB 3GM0A 4KV5F 3VWJB 3D0LA 5ILTL 3DSNA 3WD5H 1YMMD 1C1EL 4P2CG 4RWYL 3LKSA 1EGJH 2BSRA 4NZRH 3BKJH 1OGAA 2AV1A 3V79C 1QLEH 1PYWB 4JKWA 5GGTL 2WNGA 2Q8BH 4LNRA 1S9VB 4F3FB 3QEGL 1H5BC 4EQ3A 3ZE2F 3CFDA 3I3BA 5T1LA 2VDLH 3WN5A 2H6PA 3MLVH 4P4KA 1KCRH 2VLJA 1MCWM 1X3DA 3W11D 1IBGL 1RK0B 3EOAA 1OWWA 3DRQB 3O3AB 3HMXH 5FYLE 3GI8H 2UWEA 4NIKB 1IILE 3H0TA 4XP4H 3SKOB 2CUIA 5EU3A 5DK2A 2BERA 1KC5H 1S9YA 3HI6L 5FHBL 3T77B 3IKCB 5HHOB 3TA3C 4U1SA 5GJSH 4NQEA 3DHMA 2MOVA 3ARXA 3T0VA 4JDZA 3V5DB 4ELMA 5LAXB 1D5IH 4APQC 2FECL 3CDGB 3CX2A 3NTCH 5I75C 3ZE1E 5KVEH 5DMIL 3DV4A 4EDWH 4Y4KC 3DV4B 1Z2KA 3ZKND 4FP8H 2VDNL 5D7LD 5JTWA 1U8QA 3MGTB 4KDVA 4MAYA 5IK3B 3HFMH 3BO8A 5AZ2H 4K2UH 4R96B 5HYSB 3EOYG 3NFSH 3ARSA 3RWEB 1NPUA 3PWPE 5T5NG 3ULVC 4NDMA 4XH2A 4LSVL 5INCB 1PX3A 5I1KH 1G7QB 3V6OC 5I1JH 1DVFD 2X6MA 2YC1A 1AR1C 5DK0B 3UXFA 1ORQB 1UJ3C 4HJGA 4LCUB 5F21B 4ESKA 4X7SL 4ZUUB 3BZFA 2V6HA 4XNQA 4YXKH 3EYVB 3HAEH 4HKXB 2VMFA 5ACZB 4PJ5B 1FL6B 5GGSB 3H42L 3NA9H 3ZTNL 3QPXL 3ZKSD 2ESVA 4H0IA 4HXBL 4KK5D 5EORH 2AJVH 2JIXD 2DQUH 3WFDH 5L6YL 3QPQC 1KLGA 5D5MA 2OJEA 3QH3B 1TJHL 3VMPA 1TQCB 4XXDA 2EDEA 3C08H 3WFCH 2GCYB 3ROLA 1CYGA 3QJHB 3KJ4C 2DRUA 1TVHA 1QR4A 1DJSA 1IC5H 4K71B 3RU8H 1A4JB 3ULVD 2CK0L 5BMFH 3KXFD 3SGDI 1GGUA 3K0WA 3M17A 3WFHA 3G5VA 4HLZG 3M07A 4DUWA 5F8QC 3SE8H 8FABB 2VRAA 3ULSB 3IDMB 1DANU 1ZT4A 5SWZB 3VFNA 3JV5A 3OKLA 4P48A 4WU5A 5ID1B 3DROB 5ETUB 5J6GB 5C6WH 3VWKC 3OKYA 1S7XB 3VRIA 4HJ0D 3UPRA 2J8UF 3UROR 5CJ8A 5J7CC 1FLTX 5EUOA 5FM4A 4KI1A 5JNYA 1QSFD 4YDIH 4G8FB 5CJQL 1OP3K 5JNYB 3MLZH 5MEND 2Z93A 3S35X 3X12B 4BZ2H 4OZHB 4RFEB 1MJ8L 5CJOL 3ISWA 1OPGL 4MAUH 4NZUL 3CLEL 3B83A 1Q0YL 1XR9B 1I7RB 5IG7A 5IJKA 2DQFB 4J1UB 3VXUD 1KACB 1KN2H 2CK2A 3MRDB 5LGHH 2LQRA 2VLKE 2DL9A 2ZCKH 3MACL 5DHVB 4X6FB 1MCPL 5IGXH 3HE7D 4FQPA 4NN6B 4APQB 5I74C 4RZCA 4U2YA 3AGVA 2IC2A 3MV9E 2C4XA 3QFDB 4YBLC 1CBVH 3WIHH 5HYSG 5BS0D 4JFDB 2FR4A 4PRPE 5E99H 2NNAA 3Q5TA 2D4FA 3QRFM 1UACH 4KPHH 3OKNA 4ALAH 5HYJA 1I3RB 4DEPC 3WNKA 4X99B 1X5ZA 1DBBL 2FX8H 2A6KB 3THMH 3V4VL 3ZYZA 2L7JA 3F6LA 1ZWIB 4YEEA 3FB6A 1QLRB 1JNLH 1NAMA 3P3YA 4H1LB 4UBDD 3PDGA 5I16B 1T66C 4Z0XA 5C07B 4ODTL 5I16A 5JDSB 2WUCL 3O8XA 3FN0H 2DDQH 4F37F 4JANA 4JDTL 1A6PA 4OLYH 1W0YT 5E9DA 4WV1B 1F4XH 3T3MF 1Q9WB 1PVHA 3M1BB 4JM2A 2R2CA 2Y07L 1MHCB 2VDLL 4LKCB 5A1AA 3V5KB 3VRLF 1UJTA 1QRKA 1A3LL 4MA7H 4OZFA 3EYSH 3GSWA 3TN0C 2EICA 3MV7A 3RX8A 5E7FA 3BWAB 4OIIL 3NIGE 4XWOD 2A83B 5I71C 5AZEL 5CBEA 2VDQH 3F7PC 1NBZB 1ZT7B 1LEGB 1WT5A 4ZS6C 3N1FC 5JA8B 3S36H 2P49B 3QIWB 2VDML 1U42A 4Y1AA 3HR5B 4PJ7B 4RDQG 4LOUC 3SKJL 4U6YA 5E2TH 5EBLA 4HZLB 5HDLA 1Y0LB 3ZKXB 4ZUTA 3DI3B 3T0EC 1ZEAL 1YY8B 5DUBB 4M5YH 4KRPB 2G60L 3NFSL 3ARGB 1M4KA 4OCXL 1OF2B 1MJJA 3VCLA 3ESVF 1YQ2A 2MNUA 2IQAA 2BOCA 1WGOA 3CSGA 4HQQH 3K4AA 2J1KA 5CD3B 1UC6A 4RRPG 3RWEA 5FUZL 1TXKA 5C0EA 4KXZH 1CFQB 3ZSSA 2UUDK 1XGTA 1R3JB 4YXLH 4JFDE 3GMQB 5FB8B 1Q94B 5BQ7B 2DICA 5D6DC 5M7QA 2MSPA 3IXAB 2EYRB 1G7HA 1CGSL 3DPBA 4MNQE 3C5ZC 2EYRA 4X6EA 4WUKH 1CZ8L 5DEFB 5FUCC 4DOHB 3BUTA 1EGJA 2DM7A 1SYSB 1CQYA 1NLDL 3S88H 4M6NL 1DQJB 3QUKA 3NMEA 1QVOB 1CVSC 5EOQL 1K8IA 3RNQB 3KYOB 5KTEH 5IMLA 4AEFA 4XP1H 4EN3D 4OBRA 2CRMA 3MLRL 1T7XA 2MPAH 3KJ6H 3N9GH 3GIVB 4KI5E 1XGRA 4LLWB 3O9WA 5FECB 1J0YA 2RQ8A 3QZWA 1YY9D 4OLXH 3QZWB 2CSPA 1R5IA 1XGQB 5EZJA 5I18L 4JREB 2F54B 5D93B 2E9BA 4Y4FA 1L7IH 2J2ZA 1FVDA 4DN3H 5IT2L 3TBYB 2O61A 4X7TB 3IT8D 3L5JA 3CIQA 2P46B 3NFPB 1FVEB 1CG9B 3SKNA 3WUWB 4LHUB 3QFJB 1KFAH 1I8KA 2B2XL 1P5UA 3MJ9H 4WRLA 2FBJL 4ZUTB 3ZDZF 1LO5B 4P23D 4LLQA 4GXVH 4L8SB 3ARGA 4LLQB 3FT2A 3SO5A 1NMCC 1UM6L 4BSJA 2VZTA 3S36X 3JTTA 5JA9A 4M4RA 5HGDA 3OAZH 1AHWC 2ATPA 5ITFA 4KTEH 4U0RC 4ZO8A 5D6CA 5FYJE 4Q97A 3O4LE 5JUEL 4YHLL 1LEKB 2YRZA 1T7WA 3KLAA 2F58L 3ULUL 4EN3A 1QZ1A 1VGKB 4O58H 3MMEB 1BJ1H 3IDNA 4LGSB 3QBTB 2YA1A 2BHUA 3STBA 1M7DB 5FYKE 3QEQB 3IDYC 1DFBH 2JB6A 2Z0BA 1MCDA 2LV4A 3BXNB 5JDJA 5GS2H 5I9QB 4KRNA 4HIXL 3MOAL 1IAII 1KTKE 3QQNA 4ELMB 2OMNA 2X4QA 1YEIH 1ZHNA 4YK4B 3WS6C 4D9QD 1MNUH 2OJZL 3X14A 4ZTPH 1KN2L 3RWFA 5E2UL 2PTTA 5D9SA 1G9MC 1IAOB 3AC0A 1C08A 4JG0L 3S37H 3CDYA 1FNAA 2FZ3A 3IKKA 3RPIB 3EOBA 2R2BA 5JW5B 1MFDH 2CO7B 3DMMC 5E9DE 1CE1L 3NCMA 4Y5YC 1MHPH 1GOGA 5DD5L 1N6VA 5T1DL 1N0XL 4LVNC 2V2WA 4YX2H 4HJJH 3L5WA 4P23A 4DGVL 2ITCA 1BZQK 4KK9C 2AXFB 1ZA6A 4NCC1 1JNLL 3KDMA 32C2A 4ALAL 1CFBA 2VUOA 2HT4C 1MH5A 3FONA 1S7QB 1ADQA 4B7LA 3BGFB 1A9BB 4HIJA 4CVUA 3OKMA 4DGIL 1NAML 1EHAA 1ZWIA 1FH5H 3DO3A 4EOWH 4O5LH 1MCCA 1FVCA 3RAJL 1HSAB 5EU6A 4C56A 4MVBC 1R5WA 3O2VH 5TF1H 3DGGB 1ZT1A 2KKQA 2A9NL 4LSSL 3GJFK 5GSVA 5B39B 5F97E 1BVLB 2X4NA 5HSFA 4G6AD 3F7VA 4LAQH 4OLYL 4TVPH 5FCUL 2PW2B 2HP4A 3DUHA 1N4XH 4G80B 1S9KC 1FC2D 4PG9B 1JTTA 4LCWB 3MBEC 4LCWE 3LHPL 2NR6C 3DVFA 3BQUB 4PGDB 5BJTB 3FTGA 1II4E 3KYMA 3TPKA 5ESQB 3WFEH 2E3VA 3BPNC 3C8DA 5ENWB 4NQCB 5F88A 4MDIB 1OAUL 1W72H 5CS7A 4NOFA 1WWBX 3EYQC 1FORL 3KPNB 4PYGA 4UI2A 1CLOL 5FUCE 4U1MB 2BNUB 2HTKC 3O2DA 4QCIA 1GC1H 1JNHA 1CGVA 3T4AA 1LDPL 3OR6A 4NBXB 1ULVA 1LNUB 1S9WA 1LNUA 1S9WB 1YQVL 4PJ8B 5TE7H 2CGRL 1Z6JT 4K7FA 1PSKH 2BCKB 1PQZA 4MLIA 4JQVA 1BZ9A 3MLPA 2R4SH 2HJFA 3FFDA 3HC3L 4PJAA 2VN7A 1D3CA 1A6UH 3R4DA 4FFZH 3P9MA 2EXYD 2F5AH 3BJLA 1WITA 3LKOA 5D70L 3QUMH 4KQ3L 4OUUA 1EUUA 2NY5H 1I7ZB 3IGAB 3NIDF 2ZOLA 4JB9H 1ETZA 4Z5RA 3O6FA 1IGCL 4A6YB 5K33A 2Q7YA 4FQLH 5ADPH 4NJAH 1WQVT 5EWIL 4KMTH 4N9GA 1S5IH 4OGAC 3GIVA 1O0VA 5IEKB 3BPLB 2BXYA 3PP4H 4RBPK 5MHSD 1IFHL 1FO0B 4UB0H 3ZKMD 1INQA 2GHWB 4YZFE 5KSAA 4UT6L 5D2NA 2V2XB 5F72S 1U3HC 2W92A 1A6AB 1XCQA 1LWRA 3HZMB 4HGMA 1L7IL 1INDL 5DC9B 4YC2C 1OVZA 1CF8L 2F53D 1CXIA 3LQMA 5DR5H 4NM4H 1NCCL 5DRZA 4JFEA 4WNQA 3EO1B 4JFEB 1JBJA 4EI6B 1HHGA 1CI5A 2A73B 1REIA 5HHNB 4TPRL 4YXHL 2GK2A 2NY7L 5M95B 5JW4R 3VD5A 5F9DC 5D2NC 3EYOA 4FQHA 3K74B 1H3VA 1VFUA 3G08A 2NLJB 4PJHE 1NBVH 3RY6C 3PL6A 3G5VB 3GHBL 1ZSDB 1WAAE 2OZ4A 3V5HA 1A6VL 2E7BA 4GAGH 3PABA 3QRGL 4I0PC 3DHJA 2XICA 1OAKL 4PD4K 3BDBA 4PJCA 4CBPA 1EBPA 3DX7B 1D5XA 5IBTL 3BT2H 1K8DB 3BPCB 5F89A 3CDGA 5CGMA 3T2QA 1KENH 1U3JA 2CR3A 4GJTB 4MNQB 2BFVH 2QSQA 1VPOH 1U8PB 1LD9B 4JPVH 5CSGA 5L2KD 4OD2B 3IU4L 4M4PA 4F8QA 1G7IB 3O6FB 1GGBH 2HFEA 1Q0XH 3ARBD 3N85H 4I0PB 4I5BA 2V5RA 1FE8H 5D8JL 1HQ4B 4MCZA 1FL3A 3V0VB 2VDOL 3RGVC 1WAAF 1CFNA 2IQ9H 2DLHA 3FOMB 1DBJH 1A2YB 4YX2L 5MEQA 3I6GB 1X4ZA 2EO1A 3L95B 2NZ9C 1ORQA 4G9FD 3NN8B 5JW3H 3RL2A 4LCUA 2FCBA 3C6LD 4OLZL 5I30L 4HJGB 3WIHA 5J1AB 3ARDC 3LS5H 3MRBA 5FM5O 3R0MA 4AZ8A 3SBWC 2GJ6A 1N0LA 1XZ0A 2VKWA 5JZ7C 4U4BA 2CRIA 1WWWX 3BPNB 2GUOB 2WLYA 3MZGB 3FQUB 1U8MB 4AL8H 3BHBB 1GPOH 3UJJL 2JB5H 2X1PA 4LVHC 4IRSD 4CNIA 5ILTH 3KWWA 4JM4H 1R0AH 3TYGL 2H32B 1N7MH 5TFSL 4J2XA 3MO1B 4P46C 4GUPA 2ERJB 4PRIA 3LHPH 4ZUVB 4P9HC 3UZQA 1PLGH 2I26N 1FBIL 3TPUB 3W39A 3S97C 1NCBH 1YJDL 4BJLA 3CZFB 5ALBH 5IIEB 3BAEH 4PRIE 3ARBA 5IF0A 2CD0A 2IMMA 1HILB 1FNGA 1LE9A 5IESH 3F6IA 3GSUA 1JHKH 4PJIE 3RKDD 1F8TH 1N59B 4HBCH 1UT9A 3B3IA 4X7EC 3EJZC 3QFJA 4X4ME 4S1SH 3DI2B 3ARDD 3B6SA 3SBWA 1CDBA 3QI9D 3VXRA 4HUXA 3QHTC 2WK2A 5FYJH 2DBJA 4L1HA 4XX1E 3QQ3A 4QRRB 3FT2B 2NTFA 5CKGA 3VXPA 3V4UH 3IFOB 1P4BL 3IFPA 4HHAB 5DYOA 5DURD 5CUSH 2QQQA 4JRYA 4X0KA 2MWCA 4PJDB 5AWNH 4HUWB 3OPZL 4CVZA 3MLWL 3RGVA 3ZYJA 4MCYB 4UNUA 1Z9LA 5FAAA 2VDNH 5TF0A 5J57B 2EE3A 3QCVH 5KG9B 4EQ2A 5SWZE 1CFVL 1F4AA 4RGNC 1CD0A 1DL7H 3VFGL 4WFGE 3QIUB 2P48B 2V5TA 3ARWA 3BP7B 5I1KL 2D7TH 3IJHA 1UWXH 2PETA 4XHJC 3BWAA 1ZVSA 4QRSB 3CFEB 1MVUA 4BSWA 3KPSE 4YIQA 3T8XB 5K9OA 3CVHB 3TT3H 4MNHB 5K9OB 2F74A 4MQXD 1R3IH 4XXCA 1XR8B 2D7QA 3VG9B 1AHWA 4JB9L 1QTYT 2XFXA 4XCCL 5JW5A 3VG0H 4JHAL 5EOTA 2DM4A 3ARGC 3FAWA 5EOTB 4XP9H 3MX0A 1FHGA 5CSZB 5CZKA 1RHHA 4NRZB 4OCSH 3BRFA 3FRPA 4I18A 3BZEB 4M6OH 4U1GC 1MJJB 1KJ2L 4ZAKC 4NYLA 5JO5A 5LXGH 4DCQA 2X09A 1S7RB 1TNMA 5EBGA 1UKTA 3WD5L 5CGYC 5JW4N 2VISB 2ZZUT 3OG6B 1JYVA 4FQJH 5HYJE 4KV5E 4G9DA 3GMOB 1QFWM 4M43H 4G9DB 4OZFH 2PYEA 2XG5A 4AMKH 4PJDE 2CJUH 4JFEE 3IFNH 1JHLH 5INDA 1RJLA 4H8WH 1OT2A 4QRRE 1DQDL 1B9ZA 4KQ4L 4M5ZH 4JY4A 3S4SA 4G42B 3TVMC 4WI5A 2JCCF 3MRFA 3MNWB 2E7MA 4PY7A 3RZCC 3MNWA 3WFBL 4F7MA 2PYFB 1YYLL 3MRMB 4CVWA 4NKDA 4YDIL 4JFFA 2A73A 1CFTB 1HSBB 2XZQL 3HA0A 5GIRA 5DMIH 2I07A 4FG6D 1KULA 4YDVB 4WFEE 4DK6A 3S35L 5C2UB 3NZHH 4I77L 1N5YH 1JZ5A 1A6TB 1KYOK 1EH9A 2A83A 2F54A 1OAKH 3PP3K 1JWUB 5EU5B 1X5JA 2J5LC 1KCVH 5BRZA 1QSZA 2IH3A 3LKQA 2YD1A 3GHBH 5ICYB 1KELL 3LKQB 1JMZA 4PJ5E 1F2QA 4Q74A 1TQBB 2IPUG 2MKLC 1MFAL 1PKOA 5IJVB 2YUZA 5DVLA 5FCSH 3LQZB 2Q6WA 3D25B 5EBLB 2AK1L 4DQOL 3G5ZA 4QRQB 2OTPA 1NEZG 2BJMH 3SDCA 5HHXL 2VLJD 5MEOA 2QHLA 3QDJE 1I8MB 5DA0B 2YPKB 3W82A 4J4PA 4PG2A 2RCSH 1FFNA 3L7EB 2NY2B 5FHAH 4K3EH 3OKLB 1Q0XL 3RWIB 3BYTA 1KB5B 4RQQB 1IE5A 1MRFL 5IUSA 3GMOA 4WFFD 4F7CB 1CICB 1MHEA 4XP5H 5E8DL 4LCYB 4PRPB 2IQ9L 3TV3H 4P57A 1Q94A 4Y19D 1W0WA 4GS7B 5JXAH 3U0WL 1CLYH 4Y1AE 4HWUA 5JOPD 1G1CA 4OLZH 4RA0C 3C60C 3I50L 1SY6L 3WEXB 1G9NH 4ZQKA 5GGUB 3W2DL 4LLMB 1KNOB 3T0EA 4U6XB 1CICC 1QVOA 5JHDE 3EO9L 2ED9A 5IHUH 3OG4B 3P40A 4P2QB 1DVFA 2XY2A 2C3VB 3MNVA 5I73B 4TQEL 1P4LB 3RWCA 4U0QB 2Y4SA 2DQEL 2IEPA 4LLYA 1A21A 5JMRA 7CGTA 4MD4B 3QQ9D 4J8RB 5C3TA 3MO1A 1DQLH 2KDGA 4AM0A 4WUUD 1SY6A 4UAOB 4U2ZA 1D5ZB 1NAKH 1TJIL 3MBXH 3EBAA 1FBIH 3F12A 2XQBH 5GGRY 4YHPA 3MJ6A 2KPNA 1AH1A 4JPKL 3TBTA 1DUZB 1WK0A 2GSGB 4KRMB 2H8PA 3NABL 4L4VD 4ZFOL 5ID0A 4W6WB 3ULVH 3O6ML 5HGBA 3VGEA 5HVGB 1FLRL 3AFLA 4RIRA 3SQOH 2V5SA 5LWYH 1HHGB 3UO1H 1YEDA 2DS4A 2B4CC 4U05A 5F7KC 2D7OA 3O8XC 3EOTH 4KRPC 2DBLH 4NC1C 5DUPH 2R1YB 3BP4A 1CGTA 1FZMB 4D0CB 1MFCH 1XIWB 4OIBA 1XF5B 3CU7A 3MJ7B 4MCYA 5AUMB 5ELIA 4U6HA 1BQLH 1JN6B 5GGQH 4W68A 3OJ2C 3QUZD 1AD9B 1YEHH 1BEYH 1MREL 3FKUS 5FO8A 1KTRL 1A3RL 2QSVA 4LARL 4GMSL 4M7ZB 4PJXE 1JGEB 2HFGL 4HF5L 4KK8C 1TVBB 1IQDB 1CGSH 4DUXA 4XB7A 4ZD3H 2X4SA 3TT3L 2DTMH 4XVUD 2FGWH 2QBWA 3WKMH 4N0RA 4WWKC 4LIQH 5GRXG 1F4YL 4M7ZC 4TTGA 4NKMB 4Z77B 1FSKC 2EIDA 1I3UA 3HE6D 3QUYA 4M1DL 1L4IA 4NRXA 3O4LB 4ZFGH 3ZL4H 4M48L 4HFUL 3VXUA 1T4KB 5DI8A 3V52H 3SGEH 5IW6A 1F58H 3CK0H 2Y07H 4M3KB 4BA8A 4QKXB 4K7FB 1YEGH 2YMXH 3LD8C 4IOSD 4FQJL 5DZOA 1BZ9B 5D7SL 3TYFA 2KH2B 3E3QC 1A3LH 3GMLA 4BQ8A 3QUXA 3JZ7A 4BKLA 4P4RB 3W0WB 4JPIA 4Z0XB 4AQOA 1DQDH 4WHTA 3ZYOA 5I17A 4MA8L 4J3OC 2E9IA 2XA8L 4PB9H 1KFAL 3TA3D 4S2SA 1I8LA 3DV6A 3O41B 3OX8A 2PYEE 1HOCA 1HOCB 2F54E 1QHOA 1WBYA 3DUSA 3WNMA 4Q9CA 4KHXH 4KJQC 3FO9A 1J0IA 4EJ1C 4F7MB 1E6OL 1ZVYA 5HY9B 3MCKB 5ITBH 3X13B 1CGXA 2EH8L 1N3NB 1Y18A 1KXQE 3IYLW 1RVFH 4Y4KD 1U92A 4I48B 1I1FB 3I6KA 3W9DB 3BGMB 3GBMH 5FGCE 3RY6A 3KYMB 4P9HL 3NCEB 1U3HB 4ZFZA 4P2QE 5ENWA 1B0GA 3BH9A 3NZHL 3BVNB 3PIQA 5F7EH 4EXKA 5TPWH 2I9LA 2DWDB 4Z0BL 1TVBA 1FFPA 4CMHC 2FRGP 3ARED 1LEGA 2ADFH 3C87A 2BNUA 2WBJB 3MRPA 4DOHE 4XMKH 3QJHA 3KPSB 4DUVA 3Q5OA 5F8RC 3TESA 3MV7D 5FA4B 4RBPH 5E2UH 1A14L 2OCFD 1R3HB 3S3PA 1WFNA 4OZHA 4RFEA 5AYUL 5DRWA 1OTUC 3LD8B 1ZLSL 1HHIA 4D0BB 3D2UB 4JQVC 4L8CA 4PGCB 3BEWA 2FIKA 2E7HA 2EZ0C 3DVNB 4Y1AD 4X9BA 4NWTH 2R2EB 3D18A 2AEIT 4P2OB 3WN5B 3TV3L 1NAMH 4MAYC 4P2OC 1G7HB 3VXSE 4GBXD 3WN5C 5I18H 1KBGH 5F9OH 1H5BA 1E27B 3RAJH 2WIIB 2HH0H 3GSNL 3ILPA 5FO9B 3W2DH 2OP4H 1G6RB 3BFOA 4NN5B 5LCVH 4I3GA 1AFVL 3QEQE 4N1CA 1DQLL 3ZHDA 1DEEA 3DIFA 4WW2C 4DN4L 1G0XA 5DRNA 3P9WB 1ZANH 4J6RH 4W6XB 2EC9T 2LFGA 1IGJB 2ZUQC 2HG5B 3VDAA 1UH4A 1B4JH 1TJIH 5MEQB 1NFDB 5HYJD 5JXEC 2NY6B 3RVVD 3Q6FA 1ADQH 5AAWA 3KHOA 4N68A 4IRJC 4AEIH 3QG6A 4XNQB 3VFOA 1IAKB 2J8UE 4OT1L 1ZHLB 2A1WH 1RFDL 2EXYC 1MCKA 2AJSL 5T3XL 1M7IA 1ODAA 3NTCL 3PGFL 2GIYA 1G7JA 2F53A 1EEQA 4TTDD 3GRWH 2R1YA 3VRJA 3WS6A 3SCMD 5AZ2L 1XF5A 4OV5B 4OFIA 3SE4C 3SDYH 4QRPD 1UXWA 4IDJH 4I9WD 2Z31C 5DJCB 3PWNA 1D6VL 2VXQH 4LP5A 1YMME 4PJDF 1KCLA 4KXZI 5E00A 1FZKB 5BW7A 2MQ3A 4FQXB 4NZTH 1QR1A 4LGRB 2VOTA 5HPOA 3LQZA 4GQ9L 1OHQA 4NO5A 2JIXB 3GI9L 2FGWL 3Q1SH 2GJ6E 5LAXA 5ETUA 5J6GA 4JZJB 3MC0A 1IAMA 4X7SH 5E8EB 2VLKB 5EU6E 4C56E 3V5KA 4HC1A 2FEDD 1QO3B 4WUUE 2DM3A 8FABA 4ODSL 4JRXE 2WQRA 4EOWL 1MEXL 3H42H 3ECBB 4UBDC 4LASH 1T21A 1HHHA 4KHTL 4PJHB 2OR9L 4YDKL 5DWUL 2MQ0A 2OSLA 3CK0L 2FATH 4OGZA 1FO0L 1TCRB 3WFCL 3TGXA 4KK6D 1YPZF 1D7FA 4N8PA 1T1ZB 1WZMA 5C86A 2GY5A 1W72B 1C5CH 1BF2A 3ZE0F 5H94B 3VFPB 2HYMA 2ATKA 2IG2L 1HINL 1KNOA 3T0EB 3DUUA 3VCLB 3E6HA 4G6FB 1CXKA 1B0WA 1HSAA 4XBPB 1JNNL 1WAAA 1V7MH 3HI6H 4EBQL 1AGFA 1PKQA 4P5MA 4IHOB 5CLWA 3VFSB 1E6OH 1FCCA 3RVWC 4ZS6D 4XAKE 2H9GB 3HZVA 3U30B 4PRIB 1RVFL 1F6AB 3O2DH 3TPUA 4D9LL 1MWAL 1AIFA 3V4PH 4Y4FC 3HLAB 3Q5YA 5T1KD 5I1GH 3R0NA 1T1WA 3WCYA 4PRID 1T22A 2ZSWA 4NZRL 3BGMA 2APTA 2X70A 1IZJA 4JZJA 4XMKL 1AGDA 2N56A 1NEZB 3N50A 2V2TB 4KJWD 1LO5A 4HXAH 3B9KB 4CN6A 1TETH 1ZLUH 1LO4H 1XGYH 3RZCA 1LEIA 2EDQA 3MROB 3HS0B 4UOW0 4XPFL 4LEOA 1FG2B 3CFKA 2FEEL 5CJXA 4Z8FL 5A2KH 2X4TB 4LOUD 3LEYL 4Z9KB 1BJMA 3P0YL 4MD5B 4NJ9L 1P69B 4NWTL 3KYNB 4JO2L 2VABA 1T2QL 1F42A 1JV5B 3JXAA 3P11H 2W9LA 4PR5B 4PGCA 5HVWA 4WI7A 4Y16D 2DL2A 1XF1A 2AGJH 2EDJA 3QXUA 3O6KL 1KJ2A 4XB8A 1CT8A 3L3OA 4KMTL 2ZNXA 4P49A 4K2UL 4YHNA 5T1KA 1MRDH 4JY6A 4OD3H 5EU4A 5TQ0H 4YGVA 5IFJB 5FUOH 2H3NB 4Y5VA 4G7VL 4U7SA 2FJFB 4LCCB 3UTZA 1AFVH 3B9VA 1I9IH 4WW2F 2VLLA 5EBMA 3KNBB 2QADC 4LPUA 2VIRA 2XYCA 1JPSH 1OGTB 3CUPA 1NKOA 4NYLB 4IOFD 4JFZL 4OUOA 4Y5YB 6FABL 5IW6B 4WEBL 3VWKD 1D5XB 3GRWA 1JWMA 1KT2A 1UWEL 4HKBA 1OCWL 2BXZA 2DQGL 4JQIL 3BN9D 2FJGB 5J11B 5J13B 4F7CA 5CBAA 1T5WA 2MCPH 3AS0A 3O3EA 4FXLA 5H35A 4HZAA 1LMKA 4GOSA 2Q3AA 1X5KA 2FJHA 4JCLA 5GSRA 3GMRA 4OAWB 2NY1B 4LSRL 4N0FB 4NQEE 1KB9K 3VXQB 5I1IL 5D7LE 1OP5H 1BVZA 5C09E 5FV1L 4HW6A 4U1HA 4FQ1H 4U7KA 4HMDA 4OLWL 1CD8A 1WCBB 3Q3GB 1RFDH 1MHCA 2D31A 2DN7A 4R4BB 4WNQB 1FGNH 1I1AB 2W0PA 5KSAD 4LCWA 4L4JA 1WUNT 4IMKC 5IV2A 3WDJA 4QXTB 5C0CA 3X3FH 5EIIA 4GAYA 5FYLL 5D5MF 5D72L 2EDDA 2ED7A 5TGBA 3UBXG 3IVKB 3L3IA 4NHUB 3SDAD 4NRYA 3IVKA 1QEWB 3C6SB 4I0CC 1OAQL 2A6IA 3DMMD 5E03A 3TC9A 5L7XH 4AJ0A 4GQ9H 1A5FL 5KVFH 5KSUA 2ITDB 3VGGA 1IM9B 1LK3L 1M7XA 4GUPB 1B3JA 5JHDA 3GJEA 4KK9D 3EFFA 3JWDC 3DECA 2QADB 4S0TD 4ZO6A 1VENA 4GW5B 3CLEH 5EBWA 2QTEA 1OW0C 1A64A 4JPWL 3BD3A 4P99A 1J86A 1G7IA 5DJZB 1H3UA 1P84J 1EHLL 4LHUA 3ZSTA 4WU5B 1AO7B 4H25B 4AL8L 2H32H 3MRNB 4OV6F 4JFPA 2ZUWA 1OARL 5EUOE 3IETA 2R0LL 3IETB 4PRPA 2I25N 4MJ5B 1BVKA 1IEBA 4QTIL 1RUML 2OTUB 5F7NC 4KU1A 4XNXL 2E9WA 5JMOC 4OZGE 2ZG1A 2X1WL 1JNHB 2O5YL 4HS6B 3P77B 3BI9X 4LLMA 1DBBH 3FO2A 1JL8A 2GKIA 3WEXA 1FZOB 3QEQA 3GMPB 4PJBA 1HQRB 2XA3A 3VD9A 1J18A 5BRZE 2D31B 2XT1B 5JHDD 3F65A 3WHXB 4M02A 2W38A 1GIGL 2JJUA 3F7YA 1FRGH 5I1GL 5D2LA 4AM0B 1IL1B 2GTWB 2D4DA 2C1PB 3SJVB 5C0JA 3NZ8A 5C9JA 3L3IB 2Z35A 1MFBL 1KTLA 1T20A 4MB4A 2CKNA 1CD9B 2GK0B 1PKQE 2AQ1A 4LHJB 4X7TA 2YUVA 3L9RA 5JHDB 1PX4A 2IALA 4XPAH 4IRSA 4YBHA 4A2LA 4HXAL 1M71B 5DMJB 1IC7H 4PRAB 4UINH 3OHXB 2XTJB 4PJCF 5AD0A 3OHXA 5CJXC 4CJ0A 3C2SA 3LN9A 1DN0A 5F1NA 5AG9A 4C58B 3TO4A 1PBYA 3FJTA 4L8BB 5GSVB 3LEYH 1VEMA 2AAVA 5EC2A 4HJ0C 3B9AA 4KAQH 1NSNL 4RX4D 4FFVD 2PTVA 3BP4B 4GXUN 4CU6A 5C71A 3FO9B 1T2QH 1ZT1B 2ORBL 4OTXL 3MCKA 2PCPB 4PREA 3RY4A 1U95B 1OM3H 4B41A 1A1OA 1HZHL 5E8OA 3O3DB 1T3FA 4BQ9A 4WTWA 2VABB 2UVFA 3RX7A 1UG9A 4RWHA 2CDGA 3LKRB 1ZVSB 4QRSA 5A2LH 2K7QA 2W07A 4HQQL 1MVUB 4OQTA 1WIOA 4XVJH 5D7IB 3TH3T 4KY1L 3TJEL 2I9TB 5E7BA 1J9CT 4ZTOH 5IFJA 3IFNL 5IW1A 4YBQD 5F88B 5IT2H 2E6PA 5DQ9A 3RIAK 4LCCA 4TN9A 1CCZA 1G9MH 2A9NH 4IJ3B 4DW2L 3PGCB 3MRKB 4JKPL 4JKKA 1CXLA 3WFHB 3CSYB 5KJRL 1MI5E 3TO4D 4NRXB 1UYWL 4X7FC 2XZCH 4U1MA 5T1MB 3T0DA 5A40E 4JGJA 4MMXC 5A43C 3V8OA 1T20B 4Q2ZA 4LVOB 1ZE3C 3NN8A 1UEMA 3D85D 1XIWD 3ARFC 4ZAKB 2R1WB 3H9HA 2BNQA 4X6CA 4PBXA 4DVRH 5BZDA 3G5YB 2ARJB 2YN5A 1M71A 5CBAB 4K8RC 4OKVB 1MCOL 3ARTA 3QA3B 4Z7WF 4GFTB 2X05A 3VXNB 1HDMA 1NLBH 1IGIH 2NXYC 2Y72A 3C6LA 2Y6SD 1LP9E 2AVGA 5I17B 1P7KB 1RI8A 4FQ2H 2AJYH 1H3PH 2ILLA 4YJZL 4NN5C 3VI3E 4A6YH 4I0PD 4ZUVA 4CDGC 3GMQA 2EKJA 1EV2E 1MNUL 2PYED 5ECJE 3U0PA 5I1LA 2VDPL 4AIXA 5E5UB 4I3SL 2DLFH 5C0CB 3WXVH 1E4WL 3CX5K 3TA3A 4ZQKB 5E95B 1QSFA 5D1ZC 4G3YH 1NDMA 3ARBC 4ZO7A 1ONQB 1S5HB 3C2AH 5GS3A 2YD3A 1U8MA 3S3SA 2CDGB 1NC4D 4M3JA 2CMRH 5BOZG 3RTQC 1I1AC 2EXWD 1QBAA 4CRPA 4K8RD 4MDJA 4HK3N 1MCJA 4ZSOB 2R2HA 3GUTA 1JPFA 1QNZH 5CEXB 1MRCL 1C12A 2BRRL 4BH7B 3VI4E 4MJ6A 4N90E 4H0GA 1FDLH 4X9IA 1IGML 1RJCA 1J88A 2WP3O 5DLMH 2IANA 4Y16B 3T2NL 3GSUB 3JWOC 4MQ7A 4OQ1A 3S6CA 5EU7C 3EYFA 3MYZA 3S96A 5B38G 4OZHE 5ID1A 1MIEH 3PDDA 2EYTA 3W0WD 4TUOA 1MCHA 1W0VB 1MAML 1IC4L 5EA0L 3ARFA 1A7OH 4FQIH 1D9KC 4S10A 1I4FB 4HK3J 3WIIL 5TE6L 5JIIA 3MRLB 4WO4C 2H2SC 4M8QB 5IQ7L 1GRWA 4I8DA 4NT6A 3OKEA 5D7IF 4Q58C 4J4PD 1T04A 1SEBA 4FZEL 4XCYA 2QEJA 3AU1B 3C6LC 3ILPB 5A3IC 3GK8L 3KPLA 3QHZH 3AM8C 1OAUH 1OAYL 2JCCA 5FK9A 5J3HD 1LD9A 4JN1H 3RKPA 5F9JB 1YZZA 4QRUA 3AS2A 3PWVB 4DGYL 3IXTB 4NQCD 5JW4Q 1S7RA 1T21B 4PJHA 1FLRH 2Z91A 5SX4I 3EJYD 2PO6B 5CZVL 5TDPB 3FAXA 1ONQA 1S5HA 2IAND 3ZHKA 3BMVA 5GZOC 3REVB 4R0LA 5HHPA 1CLZH 2XFXB 2Y1VA 1IC7L 4TVPL 5FCUH 5EZLA 4Q0XL 5IVXF 3QFDA 4IBLT 4PGEA 4QXWA 4Z95H 1RMFH 5J1SC 3FB5B 3MODL 3I75B 2H2SD 4LSPH 1WEJL 2YSSA 4XBPA 1PY4A 1UEYA 2RJMA 2A2QT 2FHFA 5HDBF 4IIQB 2CQVA 1HHKA 1DQQA 4Q9QH 1L6XA 1EXUA 1VA9A 3QDMB 1OM3L 4G6KL 3AS3A 4I3RL 5D8JH 1W0VA 3QDGD 2BC4A 4HPOH 1FAIL 3FFCE 1G9NC 1E4KA 1TJHH 5IF0B 4X5LA 2O5ZH 2EDBA 4AENA 4PTUA 5FYJU 2YWZA 4LHUG 4YFLI 5GPRA 1I85C 1FFOA 4KY1H 5E2VL 1D5BA 1SEBB 1MFNA 5KVGH 1EEZA 4KKAC 3AMLA 4F7EA 2DQJL 5LJYH 3WUZA 3PDOB 2I9TA 3R8BB 2RBLA 5T3ZE 3IAQA 2G5BB 4PJDA 3FO0H 5GGRA 5I9QC 5DQDH 2I9LB 3E8UH 3SDDC 4YPJA 4QRRA 2AEPH 2ADIB 1FYTB 4R2GD 3KPNA 3QIWA 2ZWLT 2EDTA 5ICZA 3TBWB 1MCOH 3WNOA 3WXWL 4LLDB 1R3HA 4WO4A 4WO4B 4UDUA 1FFNB 3L7EA 2ICCA 4X6BA 3QO1B 4ELMF 5I1DA 3KR3L 1RZFL 4U1IB 1IKNA 3N1PC 2VLJB 3MA9L 4WWKA 1XF2B 1XF2A 5C0EB 1BQHG 3NH7H 3SEPA 1G7PB 5L2JB 4H0HB 3L5XL 5GS0L 1E4WH 3IS0X 1J87A 3QQ4B 4XAKD 4WU7A 3PWJB 2EYSB 3BKCH 5A16B 3OKNB 1CS6A 5JQ6H 4G8IB 4EDXA 3QXAA 2GK0A 1N3NA 3LKOB 4JFDA 3ZKNC 2IGFL 3VA6A 2XZZA 1MCPH 4I48A 3MBEA 5CIPB 1QLRA 1CD1A 1NAMB 1GHFL 1CD1B 4EIZC 3MRRB 2ZSVB 5ANMB 3GBNL 5BW7C 4ELKB 5LQBH 4HUXB 3ARZA 2E27L 4N9GB 4MD4A 1DVFC 4XCFL 2GFBA 4JJ5A 3VGDA 2Y5TB 3FB8B 1CXEA 2R8SL 4U1NB 4OI8A 1X9QA 4NKIL 4Z78A 2F8XC 4O2EB 4LEOB 1INEL 1MIEL 4R90H 4JLRA 1BQHA 3X17A 4M7KL 5E8OB 1JTPA 1OQOA 1EO8H 3FO1A 3BDYH 4RIRB 3IF1B 3MLUL 3PGDB 1JHTB 1J05B 1NCBL 3VFRB 4FZEH 1P2CB 2FHCA 4UDUB 1UACL 3LZFH 1G7JB 2R29H 1C5CL 4PUBH 4KTDL 4ZFFA 4E41A 1F3DJ 4PJCE 2WBWB 2XPGA 2V17L 3OF6D 3UTZB 1UXWB 3IB4A 3EYSL 4D94A 2IAMB 1HEZB 4PJXF 4TUKH 1HNFA 4BFGA 1GGIH 1UB5A 3U0TB 3O4LA 1J0HA 3KPOA 5DF0A 1NBYA 5DQJA 4OZFG 5CEZD 3MLSL 3TFKC 2YA0A 4XRCA 1QFPA 4GBXA 1M05B 3CCHB 2FH8A 3O8XD 4TNVF 1BFVH 1M05A 3V4PL 1SEQL 2R4RL 1T5WB 1HIMH 4Z95L 3QUYD 3H9SD 2YK1H 2ZPKH 5EG6C 2ZSVA 2FZ3B 3EOBB 5FYLD 3HPJB 3Q6FB 3IFLL 4Z7UB 5IHZB 3DO7B 3HI1B 3QDJD 4GAFB 5IROA 3KLHC 3ZE2E 3BISA 3U79A 4HK0B 1I9JH 3R06A 3C60A 3NFNB 4GG6A 3MNZA 1HXYB 5DD0H 5J6HB 4JO3H 4X6DF 4E41D 2AJ3B 4Z7VF 2W60A 4H88L 3MXWH 1AGBB 1QRNA 3MRBB 5GGUA 3PQYD 1F45A 4WGVB 4ENEC 3L1OL 4OSUL 2NY6D 1O7VA 4PLJD 5ACZA 5IOPA 2ENYA 5L88H 1PZUB 5IOPB 5IB2B 3OKDB 4OCSL 4WFED 4X5WB 4EI5D 3O4LD 1MWAA 2EO9A 2JJSA 1TCMA 5BS0B 3T0XA 1DBKL 3OKKB 4G5ZL 2O5ZL 4CGTA 3O6KH 1F5WA 4O00A 5IMKB 3X3GH 3E3QE 2QQKL 3MLRH 4YBLB 3SDCC 4QXGL 2O5XH 1BWMA 1MQ8A 3SDCB 4HPYH 3VFVB 1FNFA 2M26A 5FOBB 4PJBE 3TBYA 5F7YC 5DVOA 3E8UL 3HZKB 4DEPB 1VHPA 2ADGB 4OZIA 2H2PC 3GO1L 4H26A 4YUEL 4FS0A 3WL9B 3QDJA 4V1DB 3QUMB 1HNGA 1J0ZA 1RV6X 4F7PB 1IGFL 5K9QI 1L7TH 4U1KA 2E7LA 4MHHG 1GAFH 3CCHA 3Q6GH 3LEVH 4NZJA 2EE2A 5T3ZH 4U6HB 2NY6C 4ONHB 3DXAD 4GS7C 3VXPB 4XP1L 1DUYB 1X5IA 3HE6C 3ALXA 5IKCA 5D7JB 4NT6B 1NKRA 2AKRA 4P2RE 3DRTB 2OXGA 1JZ7A 2AKRB 1WLHA 3QFJE 5D7JC 4GH7B 2WP3T 3ZKXC 3O9WD 4DTGH 3MV7B 5C0IA 2JTDA 5FF6B 5F3BA 3AY4C 2Z31B 4L29A 4LLYB 3SQOL 2VDRL 3V95A 1ZHNB 1YN7B 3F7YB 4ZOAA 5J13C 1BWWA 3UC0H 1OL0A 2ICWJ 2Q86B 2EH7L 3WNPA 2Q86A 3TWCH 3U7YL 1MFCL 4LSTH 1ND0A 3PV7A 1MOEA 5IP4A 2R2BB 4LPTA 4GXVL 1MJUL 2NW2A 4XP6L 4MJID 5GGQL 4NNYB 4U1JB 1BBJA 2BSSB 4Z7VE 4FQCH 4JKLA 1NANI 3RJQB 3FQWA 4XNMA 3UTTE 3I75A 1MRFH 1NDGB 3IDGA 2DD8L 1NDGA 3IDGB 1DBMH 4MHHI 5FKPA 3QNXB 4JO2H 3KDMB 1NH6A 4PTTB 1M7IB 5CP3A 5LQBL 5SWSE 1DSFH 5ISZE 3TNMA 4X98A 5BCAA 1F4HA 1TLKA 1XGPA 3DJ9A 5I66A 3MROA 1XGPB 2YD5A 4MNGE 1RSFA 2UWEE 3X11B 4G8GD 4G80A 1HCVA 1J8HB 4EVNB 3EDFA 4ODHH 1FH5L 4RWYH 2VO5A 1CWVA 1AD9A 4MXQD 1HYSC 2DQEH 5E00B 3V52L 2BY2A 5EO9A 5DJYA 2QHRL 4KKCD 3ET9F 4QHNB 3OAZK 3SCMA 1DTUA 3QQ9C 1DQMH 3A6CL 1FL5A 5IVOA 3BDYL 1P7QA 3RA7L 1E6JH 1YECH 3HNTH 5TH2A 1BJ8A 2EIBA 1QBBA 3KWWB 2FX9L 1KB5H 4G6JL 3ZKMC 4LMQI 4RFOL 4HUNB 5CFHA 2N4IA 25C8L 2OX5A 2BNRA 1CGUA 3G08B 1PD6A 2A38A 4LIQE 4MJIB 3GI8L 5EU5A 3BEVA 4QXUL 4PJEE 4Y16A 2MHAB 2NX5E 4LKXB 5KVEL 3MXVL 5JR1H 2OTWA 1DBAH 4LNVA 1KCSL 3B3IB 1I7UA 4I2XB 4C83B 3ZKQD 3GB7B 1QHPA 2XKNB 3ULVE 1JWMB 3QYCA 1FORH 2D03H 3H9HB 4GBXB 2YPVL 3FZUD 3GMLB 4EDWL 5IVXE 3X3FL 1N4XL 4BKLB 4DKEH 4HHAA 3VFTA 2V5MA 4TSBL 4TULL 3CVIL 1TPXC 1YEEH 4CVZB 2GITB 3C6LB 3UTSD 1GGTA 4FTVE 4LFHD 5F93C 2G75B 1DN2A 1S7SB 2CO6B 2NY0D 5B8CB 3MMEA 4WTZG 1KC5L 5FHBH 3OKOB 3V9FA 3ETBF 2DLTA 1M7DA 3PQYE 3FQXB 1Z9MA 3TVMD 5CD5D 2VQTA 5HHME 2NY3B 3VMOA 3L1OH 3LB6D 1XCTA 4Z5RB 3NIGF 1XF4B 4N0UE 1I7RA 5IG7B 3V6ZB 4JFHE 1H5BB 2Q7YB 2W60B 1RZJC 4JG1H 4LFHG 4Y2DC 4H88H 5KSAC 2A74A 2F15A 1VERA 1GOFA 3QXVA 1KCKA 4ZOBA 3Q48A 2P5EE 5IB4A 3CD4A 3MUY1 3UTQA 4LGPB 4OCRL 3VRLE 2WAHA 5DHVA 1TDQA 4E5XB 1OAXL 5EPMA 2ENSA 4HUUA 5C08E 2J88H 3ZTNH 1NGYB 2XXMB 2J3SA 3U83A 2IF7A 2BDNL 1IFHH 4J8RA 1U93A 3BQUD 3DX8A 2KZWA 4J12A 1CXFA 1IGJA 2CGRH 1C7TA 2NZ9D 1JPFB 4C55A 1XMWA 1XGQA 4QXGH 1L9NA 4HGWA 4UT9L 2X44D 3U4AA 1V7NH 5EH1A 3VWJC 2O5YH 3BIKB 2APBA 5LCVL 2GJJA 1OP5K 2GAZA 4GRLB 4GRLA 1WC7B 4OV5A 2FWOB 3HCVA 1PEZA 3MQIA 2GT9B 2EIZA 2VZ3A 2K7PA 3PL6B 2F53B 1H8SA 4YAQB 1EAPA 3MOBL 3QIBD 5EC2B 1T89A 1FV1B 5HI4D 3UJIL 4WGWB 1J1XL 1F3RB 4KROB 3B9DA 4UUJB 3TIDA 3V6FA 1ZTXL 3PWLB 3DRQA 3O3AA 2A6DB 1F58L 2B1HL 3RUGB 2VXSL 3HN3A 2UZXB 4TPRH 4YWGH 3RKDC 4YXHH 3SE8L 4K7PL 2VQ1B 1AC0A 2A9MH 1DEEB 3QUXC 1MF2L 3ZMRA 4YEFA 1JYNA 3CSPA 3D39A 3QI9C 4I1NB 1JVKA 2B4CH 4R0LC 5I0DA 1OTTD 3OTTA 1BOYA 5D7IA 1U8PA 5I8KL 5FGRA 5AEAA 3NZ8B 4FFYH 1EVUA 1T83C 4MSWA 2XWTA 3MR9B 2AEWA 5IK3A 3TBVB 2IPTL 3H2WA 3HR5A 1DBML 5GQBA 3UJTL 1X5AA 3HPJA 2NCMA 4L4TB 2VDOH 4JPVL 4NNYA 1CDHA 3N1MC 1KTDB 3HKFA 3NAAH 1RUAH 1KTDA 1RHHB 4MZ2A 4NRZA 4NQVA 5E99L 5B39G 3FOMA 4IRSB 2DMKA 5L8KB 3FHAA 5E2WL 4PJGA 3B9KC 2AXFA 3BWUC 2YRLA 3FQUA 1TITA 4AIZA 2VISA 4M1GH 2Z8SA 1A22B 5IV2B 5JPNA 3L3GB 5KANG 2J6EH 2WUCH 4CKVX 2B0SH 4K3HA 3T04D 3ULUE 4D8PA 4P2OD 4YZFF 3EO0A 4ZTOL 5FB8A 1RJLB 5IB2A 4BM7A 1QFWH 4UTBL 4HLJA 2NY3D 3WJJA 2FWOA 4X8JA 2PCPA 3TN0B 3DBXA 1N7ML 4WFFE 3BIBX 1A1OB 3ORJA 4L4VB 3HHRB 1G0YR 2Z92A 4FXKB 4JHBA 4P23C 1PZ5A 2Z9TA 4ODUB 4BQCA 4PRHB 2DF3A 4JVWA 3HMXA 3WIFA 4XNYL 3UTSB 4ZPTB 4OJFH 1ETZB 4ZPTA 1A7OL 1JPGA 2VAAA 1T1YB 2VAAB 3DXAB 3DMMA 1T1WB 1I9EA 1LE5A 3W11C 2E6JA 5I74B 5IQ7H 3THML 2Q8AH 4MA7L 4RFNC 3SDXB 5JW3L 3QULB 3RZCB 3WL9A 4CU8A 1V7ML 3TT1L 4EBQH 15C8H 3D39B 1AJ7L 1K6QH 4X6DE 5HHQA 3UTPD 3L5IA 5KS9E 1KN4L 3GSVB 2GJ6D 4MD5A 1E4XH 2X9WA 1HH6B 2PTUA 1X4XA 2P8PA 4OLEA 1T7VA 2OQJB 3S36L 3KYNA 1FVEA 2P5WE 3MJ8A 3C5SB 1ZS8B 3QIUA 3GB7A 1K5NB 1MI5D 4IOFC 4XVSH 1QQDB 5GRUL 3TBWA 1G7LA 4OFYA 4OCLC 4K3JL 3T2PA 5KG9A 4JO1H 1KPRB 4YHNB 1PYWA 3JSSA 5J0BA 1B2WL 3EDDA 5D1XA 4PRPD 2DYPA 2SEBA 3CFDB 1RMFL 4M7JL 1ZLWK 4YHMH 1UCBH 2VLRE 4RQQA 4HT1L 2NLJA 2AJXH 3T4YA 3KPRB 1OQXA 5KW9L 5BVPL 1H3WM 3LKPB 5DRXB 4HS8L 3GI9H 3Q1SL 1T0NA 5CSZA 1B0RB 3BW9A 2H3NA 1HXMB 4WU7B 2LTQB 1P4IH 1CFSB 1IKFL 5DJDA 5DFTA 1I3VA 1BQUA 3WMSA 4KK5C 1NLDH 3S88L 3MRCA 3PGFH 3QO0A 2G60H 1OGTA 3CUPB 3TNNB 2X70B 4RSVA 5LXGL 5FKPB 5EPMB 4DCQB 4ETQB 4I0PA 3HMWL 1IT9H 3RGVD 3GMRB 4OAWA 2HT3C 5FUZH 1QFOA 4JFQB 3MBED 4QWWD 3E2HB 4PJ9B 1V7NL 3WLBA 1FO0A 3FB7A 5D2NB 4U1LA 5JIPA 4HCRH 2Y7QB 4CL7A 4CMMB 4Y4FB 4ONGH 1S7QA 5E6IC 43C9A 2HN7A 2YRPA 4QHMA 3HPLB 2W65B 2CR6A 4UAOC 1YEJL 2AK4B 2OXHA 2WW8A 4GG8B 1UWEH 2APWA 1JRHI 2V9TA 1FL5B 4Q6YA 1VCAA 5DD3H 4FFWD 1ZTXH 4JFFB 1KGCD 1CU4H 1BQSA 3NA4A 5E4EC 5IM7A 3U1SL 2I27N 3HC0A 4XC1H 3HZYB 4K7PH 4Z7WA 3D25A 5A2IH 5F44A 5JUEH 4PYHA 3WDHA 4HH8A 3ARBB 5J1TC 3KR3H 4WI9A 4DN3L 3CSYA 3UPAA 1IGTA 2OI9C 5F9JA 1VESA 4AY0A 5DFVC 2UWEF 3REWB 1AGCA 4HAFA 2VLRA 5CJ5A 2DB8A 4DQOH 2XACC 4GRMB 1A47A 3PWUB 4ONOA 4OZ4A 2IPTH 3ULUC 5BZDB 1I8MA 5AAMA 1G0DA 2XIDA 5MP6L 5C0GB 3QWRA 3NAAL 1IAOA 1MCFA 1C5BH 4P57B 4MB5A 4X0KB 4XPHL 4JG0H 4R4NC 1C16A 5IEHA 4HS3B 3O2DL 5C0NC 5JQHC 3RGVB 4HS3A 5GS1C 4NCDA 3EHBD 3JWOH 4MJ4A 4Z7UA 5ESAB 1C7SA 1KCUH 4NQDA 5F96H 3WHE1 1ACYL 4K8RL 3PNWA 1BIHA 4Y16C 2P5WA 1KIPA 2GYSA 4FTVD 1NMCB 4KWUA 4YPGB 5MENB 1KIPB 2VH5L 4LDOB 3U0PB 1MQKL 2CLRA 5DJXA 5H2BA 2NW3A 5B38B 3DYOA 5I71B 4PB0L 2WM0A 2C3WA 1YPZB 1AGBA 2ATKB 1TZGL 3QUKB 2DOCA 5D2LE 3VDBA 3CVHA 4NRYB 1KGCE 4OZGA 4PJ7F 2OBGA 4M93C 3SCMC 5DQDL 1BVLA 3MRIA 3PQYA 4NKQB 3OB0H 3WO3B 5IHUL 1HN1A 5HDOA 4HJJL 3B9EA 3BKJL 4G9FE 1OCWH 2DLEA 1OW0A 4YHZL 1TFHA 4EI5A 1T1YA 2D7NA 1KEGL 5I2IB 1MSPA 3BH8B 2YPLB 5GGVY 3DVGB 4KH2A 3FQNA 1I7TA 4ORZC 1RZIB 4K94H 1KN4H 1I7TB 2VXVL 3O0RH 4HWEL 4GW4A 4JRYE 1L6ZA 3D3VE 3H3PL 4IMLA 15C8L 4Y5XB 5L0QC 1Z5LA 3PG2A 3X11A 4OGYH 2IPUK 5B21A 1W72L 1MUJA 2P5WD 5BZWB 5CMAB 2DTSA 5CMAA 3GKWH 4PP2A 4Y4HD 4HG4J 4WI3A 2R2HB 5M94B 1DE4B 3GMNA 4PRBA 5GHWL 5IW3A 2B1AL 1GYAA 5ITFB 1T5XA 5D7JA 1QBML 1A02N 5GGTH 3LS4H 5FA4A 3A6BH 4PJFE 4KVNL 3RVXD 3X12A 1MCLA 2J7LA 3KPLB 1NFIB 1IKNC 2HVJA 3SDAC 3U4EA 3UBXB 3IFLH 5FK9B 3E0GA 4AEHL 4LARH 1HKLH 2BVQA 4HUVA 4L8CB 5B38A 5HVHC 4ZXBD 2A77L 1T0MB 1YEHL 2J8HA 5HGAA 1YN7A 4ODBD 3V6OE 2B7DT 1T0NB 3O4OC 5C70A 1M6OA 2R0WL 3NCYP 1XR8A 1A7QH 4U33A 2R69H 4V1DD 3RNKA 4ZNEE 4G8IA 4NO5B 4FFZL 4U6YB 5GRZA 3RBGA 4ETYA 4N0YH 1HZHH 5JPMB 4QOKB 3P4LA 4CJ1A 1BZ7B 4HXBH 4QEGA 1NCAL 4PP1D 3OR7A 5KZCD 3ILQD 4NO2B 4FXGA 3LVEA 3I6LE 2J5LB 3D69A 4UB0L 2YXFA 5GXBB 1DDHB 1I3RA 3ZE0E 5I1JL 2ZCHL 5TE7L 3VG9C 4L4TD 1CGYA 1MH5B 1PSKL 5DQJB 3HMWH 3VXTB 4OZHF 1S5IL 4WHTB 3WUWG 4OB5L 4Q7DA 4FNLH 1BLNB 5C0AE 1U6AL 3IS1X 2C5DC 2O5XL 3QT2A 3FRUA 2HWZL 3QCUH 2V2XA 2WBJC 1BD2D 1R5WB 1R3KB 5FDWA 2D0GA 3JVGA 5IJKC 2CIKA 1NCCH 5F9WB 1E4KC 1G84A 1EZVY 2CLVB 3DBXB 1F90H 1UWGL 5FDYA 4H5SB 4S2SB 5IB1A 4JANB 4TUKL 3N0PB 4JPWH 1UB6A 4Y19B 5E8PB 3U6RB 4ZOEA 4YQXL 4DAGH 5CINL 1I75A 4M61B 3LKRA 1HHJB 1N64L 4DVRL 5D1ZB 4XMPH 1Y18B 3VXME 4F7EB 3DX9A 2QQLL 3VFRA 2EKSB 2VSDA 3P4MB 1PJ9A 5BMFL 3HB3D 3H7BB 5IQ9B 4ZDHB 3NGBC 5DJAB 3QUZC 4RMWA 2BOBB 5JXED 4R2GB 4N0UA 5HGHB 3SN6N 2YD7A 4HWZB 4MD0B 4JFHD 4O51A 2XTJD 3MRKA 2R9HC 3KS0J 5F1KC 3SO3C 4JZNB 43CAA 4NUJB 2IAMA 5IBLC 5D1QB 2O61B 1CL7I 3ULUF 1SBSH 1OD7A 3KS0H 1C12B 1KIRA 1U3HD 5KSBA 3N1QC 5KSBB 3WE6A 4J23A 4GW5A 3GBLA 1Y0LA 3OWEA 1BD2A 3TWCL 1FE8L 3SJVD 3U9PL 4UQ2B 2Y36H 1WBZB 2CDEA 1YC8A 4L1DA 3T4AB 5C0GA 1BBDL 4OTXH 2Q3ZA 2DM2A 4BZ2L 2DYPB 2SEBB 4BELD 1DBJL 3LIZL 3GJFB 4U1IA 5GGRB 1QSEE 2G75A 3SE9L 1E27A 5EULV 2A6DA 1QD0A 1TCRA 4Y4KA 3QXDA 5IB3B 4GAGL 4NP4L 3UBXI 1WISA 1FNLA 5T5FL 2XV6B 4XPAL 4Z0BH 1D9KA 3IXAA 5LGHL 4LL9A 3QJFB 3U4BL 3MACH 2EDLA 4JVPA 1JFQH 2RAMA 1T66D 1QFUL 1KENL 3AMKA 1CT8B 4XVUC 3NCBB 1EJOH 4LEXL 4MZ3A 3H6JA 3RZWA 4H1LH 4DN4H 1ZHBA 3N85L 1JGVL 4JDTH 1HHJA 5BV7H 2LE9A 4JO4H 4IHOA 2AJZA 1YJDH 4KJQD 1OP3H 1KLGB 5EZIL 5MEPB 1YC7A 1DP0A 3MCLH 4JFDD 2QSTA 3HG1E 2VE6A 1LQSR 3SJVA 5C0JB 1PAMA 4WFHE 3RFZC 3REVA 1XIWC 5H37H 1KB5L 3F12B 5A2JH 1KEGH 4L8SC 4PGJA 1VADA 1H9VA 1A9BA 4HIJB 2A6KA 3SDAB 4HV8B 2DLIA 4G43B 3VE0B 3LB6C 2MQCA 5T3XH 2YD6A 2NXYD 2H8PB 3S7GA 3RJDA 4TUOB 5IFHH 4NO0B 5AWNL 1IC1A 1NMBL 4LMQE 2VDMH 3QQ3B 4K55A 4AK1A 5DMKA 1J05A 3TYGH 4X98B 1QOKA 2PW1A 3SDDD 2QJDA 3QDMA 4G6MH 4YAQA 3I3DA 4L3EE 3QAZC 5T1LB 4AENB 4EEEA 1LEIB 5GHWH 5IKCB 2GY7B 2DQTH 5I6XC 3MLWH 4Y5XC 4J6RL 5KAQG 5HD8C 2ZKHH 3OMZA 1AXTL 4LSQH 5AG8A 3V7AG 1RUKH 2JCCB 5IESL 1P53A 3JV4B 3VMNA 4IMKA 2WBKA 5E24E 4IDJL 5TGBB 4YHOL 4K7PX 2F19L 4S1SL 1VFOA 4HWNA 2BRRH 5FGBC 4L5FH 1NMAH 3RRQA 3L3DA 3EFDH 3TZVC 2AI0H 1IGIL 3VD3A 2ZNWA 4GLRH 1QBLL 2VZSA 4YGVB 3IDXL 1VFBA 4JQXA 2X4UB 1DLHA 2YXMA 3HAEB 5C0AB 3RL1A 4AH2A 3MV8E 4EN3C 4XCCH 1K5NA 3DOSA 3FT3B 2ZCLL 4K23H 3GRWL 1OAXH 5DGRA 4NQDE 2NNAB 1ZA3B 2GSIA 4HGKC 4W81A 5F6IB 3WXVL 5DWUH 4YDKH 4LRIC 3I6GA 5CLTA 1SBBA 3D69B 4R97B 3SDDA 5KBNC 4YPGA 3MLYH 3UTTA 4AIZB 5L2KE 4BFIB 1BD2E 2IFFH 3QCTL 1VADB 2BNQB 4X6CB 4JHWH 3RWHA 3HR6A 1U9KA 1U6AH 5BVJA 4UT9H 4E42A 3DX6B 3BUYB 1U41A 3FHQA 5C2BL 3ALWA 1N5AB 1XEDA 2JK5B 3MLXH 1NCUA 3R8QA 1W0WB 2BC4B 4HSQA 4IJ3C 4YDJA 1MRCH 1UFUA 3WBDA 3NACH 4OZIE 3K7UA 3QDGE 3S4SB 3D5OF 4PJGF 1P7KA 2OJEB 3QH3A 4ZS7L 1BECA 2ZUXA 4LHUD 5DLML 2VAJA 4J3UA 4OF7A 5T1LD 4QNPE 2HKFH 5IFAH 3K8KA 3PWJA 1YMHA 1HYSD 5I1EH 1F2XK 3WO4C 4ODVH 3WFBH 1KCSH 3NCFB 2HFTA 3ZDXF 3UJIH 2D0FA 1PG7H 5HHVL 2AQ2A 2QQLH 3P4MA 4KKBD 1JE6A 3RQ3A 4D3CL 3CAFA 3RIAF 3UTQB 2OL3L 2B1HH 3RGHA 2V7HA 5DSCA 3VXMD 3PHOA 4HG4K 4JY5H 3MODH 4H8WL 1AGDB 3VXRB 1AD0A 2H26A 1MCSA 2D7PA 4WW2B 1UM4H 4PGBA 4JJ5B 4XMLL 2VB5A 3MJ9L 4P3WA 5HHXH 1P7QD 5DEZA 5C0BE 3R1GH 1YEIL 3B43A 1OGAE 1FZJB 1IEHA 5DJ8A 1UM6H 2X4PB 5GRJL 3BPOB 4QRQA 5IBUG 2VWEC 1CDCA 4FZ8L 5C8JA 4RAVA 1ZGLM 5DD1H 4PLJC 3ARQA 3BKMH 2P8MB 3DSFL 4O58L 3QIUD 1RUAL 2EYTB 4ZFOA 3TCXA 4W4NA 4OLUH 3WHE0 4S11A 4XCFH 2AP2A 2Z8RA 4N1HB 1CLZL 4MA1C 1QUNA 3TN0D 1G7PA 4KKBC 1VGKA 3OXRA 4S1QH 4XP5L 2Y6SC 1NCNA 2D9QB 1KELH 5HGDB 1E28B 1UZ6E 1LO2H 1T2JA 4ZNEA 2OK0L 4NM8H 4ZTPL 2B0SL 4KGLA 2JIXA 4MVBD 1UA6L 3U4BH 3G6JE 2GEEA 4PJHF 2B5IB 4MNQA 2A74B 4Q9BA 3JV6A 3K2UH 3AREB 5HPMA 1ZGLA 1QSFE 3U0TA 4ONFH 1L9MA 4G6AC 5LVEA 4XNZC 5ICXA 3RIFK 2AEPL 3WHXA 1YNKL 3FRPG 4MAYB 1T7YA 4LCIH 4Q9RL 1H0DA 2A0LC 2VLKD 1NFKA 5MERA 4HKBB 1QLEL 1VDGA 1EMTL 4EKXA 4PJ9A 4JFQA 1MVFA 4RCAA 2OR7A 2VQUA 1T1ZA 2PR4H 1R24A 5EZJB 2G2RB 3NIDE 4CMMA 2NY2C 5IHZA 1AE6H 3GJFH 3ZYIA 3VGBA 3DO7A 4JREC 3RDTA 2ARJQ 1RZ8A 4Y88A 4BUGA 3O11B 1CG9A 3SKNB 1MELA 2V7NA 1OTSC 3KVQA 4LSRH 2V7NB 1HYRC 4NC2B 5DUML 4M93B 3SCMB 3CMGA 4JPIB 1LGVA 2AXGB 3OV6A 3L3GA 4GRWE 3UO1L 1G6RL 3CXHJ 3WO4B 3NIFE 5EFIB 3TM6A 5HGGS 3D85A 1OAQH 1OTUD 3HZYA 5L7XL 5DT1L 4Y2DB 4DZBA 3DUSB 4F58H 1GL4B 1U8NA 4QHKJ 5KVFL 3UYPA 4ERSL 2ZKHL 3QFJD 5DJCA 4PS4H 1NBZA 1ZSDA 4X5XA 2Y9RT 3U9UB 4OZIB 1FIEA 1IGYB 4AT6B 3OZ9H 3QIBA 5CSBA 4FQ1L 3UYOD 4XRCB 3T0AA 2CUMA 2AABL 4IRJA 5F7LB 4X4YA 5E6YA 5DUBA 1J5OL 5I1CH 3EOTL 1KIQB 4X80H 1FGNL 5E0QA 4F2MB 4GAJL 2FEEI 2ICES 4M9OA 2DIAA 1MLBA 2X4UA 3HAEA 5C09A 4HFUH 1ZLVH 5HHQB 5DFWH 5FYKH 4KJPC 2P1YA 5JLZA 3MFFB 1L0XA 5B8CC 1FL3B 3V0VA 5D72H 5BXFB 4NQDB 3P77A 1CICA 1MHEB 3QWRD 5FGSA 3X3GL 4NHCL 4PPTA 4UILL 2XG4A 3ZZ1A 2DKMA 4GG6B 4RISH 4N90D