2CGRH

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 34
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH02
2RQ8A 1ACYL 3B9KB 1XR9A 1KCSH 4JPIA 5IB4A 4AT6A 1WTGT 1MREL 4X6BB 4EN3A 1EV2E 2DF3A 4M6OL 3UTZB 1EDQA 1AXTH 1FGNL 3CFCH 1DEEA 2R56H 3NIDF 1A3QA 5KW9L 4KTEH 3I50L 4CBPA 3DVGB 2A6DB 2OJEB 4L3AA 5JW3L 5DDHA 2MQ3A 3LKSB 4JPWH 4HK0B 4FQ2H 1EFXD 1MFDH 2D0GA 1A14L 4YO0B 2QQNH 2AKRB 2FBOJ 4JQIH 3V0WL 5F9WB 5IHUL 3L7FB 4HUWB 4JZJB 2V9RA 1BREA 4RMTA 1FL5A 4YZFF 2V2TA 1ADQH 3AM8C 1UCBL 2YWZA 3IKCB 1MPAL 5L2KB 1UB6B 1KGCD 4PJAF 5EBMB 5C0EA 3RAJL 3WDHA 1B9ZA 3G6JA 3WKMH 4GXVH 4ZD3L 4F33B 2DQIL 1HOCA 3P11H 4R90L 5IM7A 1YMMD 1TCRA 3MBEA 2WQ8A 3T2NH 3VFPB 4G8GE 2DQJH 4Y5XB 3S4SA 3JV0A 3TT1L 2J6EL 1Q0XH 4MQ7A 1RIHL 4FTVE 5CEZH 3KJ6L 5I1HH 1OP3K 4L8SB 3LKOA 4MNHB 3FT2A 1N6QL 4OTXL 5C3LD 5FYKE 1R5IB 5FGBA 4LDOB 5F88B 2E7MA 2IADA 3TNMB 4JANA 3VGFA 1B88A 5E5MA 3QFJA 4KY1L 1MEXH 3MOQA 5J7CC 1DR9A 4P9HL 1NH6A 1HDMB 2B1AL 1FGVL 3WUWA 1KLUA 4L29B 1AHWC 4P3DA 3SGDI 2VLMD 3P4NB 5GGTH 5CCKL 4PJ8B 4LMQI 4JN1L 3ARFC 3EJZC 1SBBA 2H8PA 3FO0L 2DQDH 5EOCL 3CDGA 5ESAB 1GYAA 4OF6A 1QFPA 4NCC1 3FN0H 3QIWA 3P9MA 1D5XB 4UQ3B 4D0BB 1DQJB 4Z7WB 1KYOJ 2VLLB 4GO6B 3SDXE 4EVNB 3MNWA 2HFGH 4TTDC 5EUOF 3L5WB 5E95B 5KVFH 4MNQB 1PZ5A 3IJSB 5DWUL 4PJGF 2DI9A 1CDCA 2ZSVA 4J3TA 5F7EH 5IB3A 3FJTA 1WV7T 3I6LD 3RDTD 1OTTD 2W91A 2X05A 1ZHKB 4KU1A 1K8DA 4JFDB 3Q5TA 2MHAA 1P6FA 2YN3A 4PUBH 4NRXA 1IC7H 3CZFA 3NCMA 4U6HA 1QO3B 1QLRB 3QI9B 1FL3A 2OR9H 5AWNL 4K94C 4GW5B 1WBXB 1C08A 3H9SE 2QQLH 3LQAC 4IRSD 3UAJD 3R8BB 3GJFH 2FJHA 1T83A 5E1AA 5EO9B 3GIVA 1DL7L 3T3MF 1U2CA 5ITBH 5GRVK 2R39A 4YNYA 1AFVH 2X09A 5TE6H 2XNAB 5GIRA 1QA9A 1PQZA 4UNUA 3N1QC 3K8KA 3D25A 4BZ1L 3CFBA 2DL9A 3GSXA 3HI5H 4WEBH 3GSRB 1E4KA 2F53D 1XF4B 3PUCA 2DQTH 4IBLT 1MF2L 4Q6IC 3RKDC 3ZDZF 3P73A 3ZZ1A 1PG7W 1NFDA 5AEAA 4LKCA 3EYSH 3O3BA 1OM3L 1JMZA 2F54A 2Y4SA 1VERA 3TF7C 5DEFB 4UB0H 4AL8H 4IOIA 3JWOH 1U91B 2PYEB 3SPVA 2AI0L 4Q9BA 4J3OC 2LVEA 5SWSE 3SKMB 5IEHA 1K8IB 2YA1A 1G7JA 2DKSA 2AK4D 5ITFA 4LSVL 2G5RA 4MCYA 3LEVH 5SV4A 3Q3GB 3O8XB 2E8ZA 3QAZB 5MENE 3TN0D 1IM9D 1PFCA 4JG1L 3RWEB 2YSSA 1FC2D 4P5TB 1NGQH 3OAYH 5GGRA 2R0KH 1D6VH 1KFAH 1R3IH 4L3EA 4LLYB 5DRZA 5JHLH 3ZT7A 5TFSH 1CXIA 3X3FH 3H2WA 5IMMB 1MCIA 4GS7B 1G7IA 4Q2ZB 4PP2A 2Y07H 1DLHA 2NTFA 2AJZA 1MCCA 3EYFA 3RWDA 4HFUH 4JAMB 5JQ6H 1DBKH 5JXEC 3C5ZC 4PRNA 4OGXH 3U4EB 1QSFA 4TOYH 2EDQA 1UWEL 1LEKA 1CK0H 4DUXA 3K8LA 4G6ML 4ALAH 2H9GA 5D1ZB 4YDJA 4HIIB 1PZUB 2R4RL 3WNLA 4NC2B 3BP6A 3HNTH 1E28A 1XF1A 2YA2A 4R96A 1INEL 1ETZB 1YEFH 1B4JH 3ROOB 1F90L 1J05B 1KJMA 4ZO9A 1GHFH 4K9EH 4UT6H 4Z9KB 5MEQB 3MR9A 4I0PC 3HZYB 5IFJA 5ICXB 3STLA 2HJKB 5C9JA 1XGQB 3O6ML 3H6JA 1L0YA 3N9GL 1EGJA 2NY5L 4F7PA 3NPZB 5BS0A 2WBJA 5CSZA 3UTPD 3O81A 4PTUA 4UT9L 4CADB 1L0XA 3OKDA 1J88A 2P5WE 2C3WA 5A1AA 1NJ9B 3IJHB 5FM4A 1KB5B 5FO9A 5E7BA 5IBTH 2EE3A 1HH9B 1OY3B 4H1LH 4LAQL 4MDIA 1JRHL 2YPVH 5F7FA 4UDTA 2FSEA 3OXRA 1I8LC 4M5YL 1YA5A 3B9KD 1IAKA 2ZUUA 5KTEH 5IGXL 1TZHB 4NBYB 4Y5VC 4HCRL 1PEWA 2CK0L 3MRGA 5I9QB 1F2QA 3KGRA 4TUKL 3TJHC 3CH1B 1EBPA 3VFGH 1I1RA 3BWAA 3DROA 1MJ7H 2ZOLB 3O3EB 5DUBA 4GRLC 5KVDL 3RGVB 4G8EB 1KEML 4WI5A 3JWNC 2DLTA 3PABB 1XIWA 4LFHG 3MV8A 5CINH 1QRKA 3I6GB 1D5IH 2P24B 4ODTL 5KSBF 2RIKA 2G75B 4N0CC 4CKVX 2VDLL 1Q9KA 3O2VH 3C8KB 4KK5D 3DMMB 1E6OL 4KROC 5FDWA 1DBJH 1OVZA 3OHXB 4HS6B 1DP0A 4ZS7L 1FNEA 3SDAB 3NCJH 3UYPA 3KPLA 1L4IA 3QDJB 1AXSA 4XBPB 3KYNA 1KXQE 3LH2H 2GK0B 3ARQA 3BKYL 3MV9B 3GBMH 4GBXA 5A3IC 1JF1A 3QULB 3TZVA 4ZXBB 2B20A 3VCLA 1MJ8L 4PJDE 3UO1L 2CH8A 1WFTA 1TJIH 1AJ7L 4E0RB 3FRUA 4NWTH 1MWAH 2FYYB 1S9VA 1VEOA 3CAFA 1LK3H 1R24B 3MSPA 1T22A 3BOVA 4HKBA 3MCKB 4KMTL 4KWUA 3GI8L 4QXUL 1YEJL 4KTDH 3PWVA 1NCAH 1N2RA 5F7LB 3O9WA 2R2HB 2EIZB 4UIKL 4HZLA 1OLLA 3MV7E 5F9JA 3ILQC 2F5BH 1CIUA 5HGBB 3KDMA 1BQHB 1AGEB 3NVQA 5DD0L 4FMKA 5ADPL 3QNYA 5INCA 2M1KA 1OWRM 4UDUB 3T0VA 3IFOA 4G7VL 3RVUD 2NY1D 3CNKA 3LHPH 1T1YB 4HWEL 4KRPC 4PJ8D 3PIQB 1VGEL 1SEQL 2ZKHH 2IALB 1YN7A 2Q6WA 5E6ZA 3VFRB 2BC4B 3AM8A 3KNBA 5JIHA 4XVJH 1VADA 4N0UA 4DGYH 4NZTH 3HNSH 1KJ3L 1TVDA 1NGYB 4NKMA 2HVJA 3JUYA 4YBQC 4NQEE 5K9QI 1I9IL 5EU6A 3SOBH 4U1NB 1TETL 5F9AC 1AD0B 1NEUA 5I73C 2KPNA 1CR9H 2ZCKL 1MLCA 3MRBB 5EU4B 3MJ7A 3AMLA 2Q8AL 1O7SA 3Q6GH 4IJ3B 4NQXB 3DSFL 4PB9H 4YDIH 2E9JA 1WFUA 1TPXC 5I30L 3X17A 3VRIA 5D7JC 4UQ2B 2APXA 3MUGA 4JRXA 4XGZA 1ZAGA 1BIIB 5EBLB 4KAQH 4LRIC 2VDKH 5M94B 3EGSB 5L2JB 2L7JA 1H3UA 4ZAKA 3GIZH 3O0RH 5AZEL 3WIHH 4YAQA 2QADC 2QQQA 2X9XA 4IRZH 3MRKA 1Q72H 1AHWA 2APWA 2X4SA 3TNNB 1SM3H 3L95B 4S2SB 4KKBC 1F8TH 2D7MA 4U1MB 4QTHA 1IILE 3ARFA 5DJ8A 4HT1L 3EZJB 4LQFL 5FO8B 1JPGA 1A22B 4RGNB 3HC0B 4PLJD 3U0WL 1TQBB 5EZOH 3WEXA 3PGFL 3B3IA 4AJ0A 4WFEE 2AAVA 5GS0L 1OSZB 2PYED 3LEYL 5K59F 1I7UA 2R1XA 2GQHA 3VXUB 4PJEA 4FQHB 1AC6A 1HXYA 4LDEB 2A74B 4LCYB 4YFEA 2VQ1B 3RVXC 1LEGA 5T1LA 1F3JA 4GRWB 3O8XD 1BQSA 1BM3L 1JYWA 3DPBA 3JSSA 5GZOC 3O3AA 1JGLL 3B2UD 1BIHA 3U6RB 3L5HA 3OGCA 4P5TD 5ANMB 1LP9E 1NC4B 1R3KA 1PG7L 2BOBA 3AREB 5TDPB 2YK1L 1EZVY 4EOWL 1IGFL 8CGTA 1CFVL 3FO1A 3T2OA 5KSVA 3ULVE 1P4IL 4H88L 5HHNB 1NDMB 4X6FA 3TBSB 4KUCD 3QUYB 4ZUWA 1C5BL 4JKMA 3H9HA 4JM2C 3ARGC 3QEUB 3GK8H 4PV8B 5EU5B 3K4ZA 3VWKC 5D1ZD 4NBXB 1AGFA 3IDXL 3MRCA 5JOPE 2ZP0T 3W5MA 1FYTA 1Z9LA 2DLGA 4PS4H 1IQDB 1INDH 4S1DD 4KDVA 2QL1A 4Q6IA 1RULL 3KPSB 2HFEB 5E4EC 4EQ3A 1HYRC 5GGUA 5DHXB 2CKBA 4FHBD 1DQTA 1T04A 2N7AA 1JWSA 4MDJA 4G3YH 5I71B 4HGWB 5TH2A 5J6HA 3DRTB 2P5ED 2UUDK 3HUJA 3QPQD 4MQXD 4FQQA 2KDGA 1L0QA 1IAIM 3I3DA 4YX2H 3FOMB 3EFFB 4M7KH 1OGTA 3B5GA 1TJGL 5IB5B 1H8OA 2ORBL 2WSKA 4BFGA 3SO3B 2CDFA 3CU1A 5T3ZD 2R2EA 4TULL 4Z7VF 5C09B 2YEZB 3MCLH 4U4BA 1Z9SA 3VD3A 4XNZB 2BVTA 3CCHA 4UTBL 4JFEA 2IAMD 3FB5A 1PVHA 1HHJB 5ID1A 4MJIE 4X5WA 2OR7A 4UU9A 2Z93A 5EB9A 1T80A 2H26B 3ZE2E 4NGHH 5EA0H 1EJOL 3RVVD 2DJUA 1A1MA 4Y19E 3S3PA 3QH3A 5E8PB 3X3GL 5BO1H 1XH3A 1J8HB 1WJ3A 3EFDH 1OSPH 1X3DA 5JXEA 2EYTB 1KCUL 3H7LA 3C5ZA 2IG2L 4HS3A 4JPVL 3RGVD 5CP3A 4WI3A 5DRXA 5CMAB 3IU4H 1F3DJ 3JTTA 1EO7A 3HE7C 4M93B 1K3IA 2QHLA 1ORSB 5I18H 1LO5B 4CVWA 4JY6B 5IW3A 5DHVH 1AH1A 2QSTA 4K8RC 4CUCA 4XP1H 3DMMD 4Y2OA 1UKSA 3MLUL 2OXHA 4KKNA 5JXAL 4E42B 4ODSH 3QPXH 4OZHE 4PJAA 3SDAD 1U3ZA 2I9TA 3TO4B 5HVHC 2VH5L 4I0PA 4JFZH 4ETQA 4PLKD 3QDJD 4TSCL 2HLFC 2XY2A 1YEIH 1F42A 1KJ2A 4XCCH 3BZ4B 5DT1H 4U1SB 1SJHA 3OJDA 5E00B 1SMAA 1II4E 3MV9D 1A7QH 2JJTC 4TPRH 3G5ZA 4ZXBD 3VGGA 5HHOA 3MREB 1HYSC 1M6OB 1YN6A 2KUTA 2YD9A 1DQMH 5HVFB 3BWUC 5GQBA 5D7IB 1ZLWH 4H20H 2MQ0A 4HFWA 4XTRD 1FNLA 4GLRI 4OLWL 3QEQB 4HGKC 1I8LA 4XPBH 5D7LB 4AYFA 3WHE1 1JZ4A 3NFSL 3QISA 4Y5VA 1HH6B 4OCNC 4JO2H 3RX5A 1NAKH 1JZ6A 1NGWB 4CMMA 1U8MA 3GRWL 2AV7A 3JWDH 1NC2A 2Q76B 4PP1D 4R4FL 4C4KO 1JNJA 4GRLA 4WUUA 5ACMA 1T5WA 1GOGA 3BN9D 3VD4A 4UBDD 4KJWC 1LP9F 4NOBA 2IH3B 4Z78B 5C7XL 4LCWB 1NEZA 2WAHA 5IV2A 4ZTOL 1KNOB 2W65A 3WNNA 3L9RB 3QA3B 4KK9C 4FNLL 4FFWC 1MCFA 4XBEH 2I60L 3EO1A 4HUUB 1JZ2A 4J1UA 4YFLF 5EUOA 1QLEH 4P2YA 4APQB 5AG9A 4R0LC 4LLDA 3NPSB 4PJGA 4WWKC 1N5YH 3LD8B 4F7CA 3ILPA 4S1QL 3F7PC 3PWJB 3GM8A 4L3CB 4WJ5A 4YK4B 3BUYA 5DZLA 2YXFA 3SGEI 3WNOA 3KR3H 3RTQB 7FABH 4RBPH 4Z8FL 4BK5A 2GT9A 1T4KA 2VZUA 5LAXA 3Q1SL 1YC7A 1XF2A 5LGJA 1DBAL 3L3IA 43CAB 3D3VD 4U1JA 3G5YB 4J12A 4XRCA 3D0LB 4UINL 3MRHB 4HWUA 3SKJL 3QUKA 1CGWA 3VDAA 1HXMA 5LXGH 1JNLH 2Y06H 4OCWL 3GMNA 4Q9QL 3GSWA 3K80A 3VRJA 4YWGH 4KI1A 5JMOC 2Y1VA 4U1KB 3SE4C 4M02A 1B0RB 5EC1B 5SWZA 4NKIL 2H45A 5F70A 3LRSB 3SDCB 1YMHB 32C2A 4KVNL 5BVPH 5HYJA 5I19H 5JMRA 4HV8B 1EAPA 4NJAL 2X70A 3CFEB 2H6PB 4OZ4A 2D0HA 3MLTB 1EK3A 1KIPA 4RGND 4BQ6A 4DZBB 2V6HA 1A21A 4XP6H 2DD8H 2W0KA 3C60B 2I07A 2W0FB 3VXUD 1F3DH 1K5NB 3FRPG 2AERT 5I1EL 2OL3B 1WAAF 4DQOL 4OCXH 3TH4T 3QJFB 4MA3B 1TZGL 3DUUA 3P4LA 4Q9CA 4XPAH 1F6AA 2JK5A 1CE6A 1NC4D 3L5XH 5CKAA 1MAMH 1FN4A 3ARED 5HVWA 3TIDB 4KDTC 3MQIA 3GBNL 3FB7B 4PRPE 4D9QE 1Z0MA 3GJFK 1I7RA 1RK0A 4HC1H 4LBEB 4WW2B 5D7JA 3W39B 4H0HB 4EDXA 1H0DB 5DD6B 3CSYA 4LRIA 3QUYD 4BH8B 1C12A 2IPKB 2XA8L 3HPLA 4OIIH 4G8GA 3ALXA 3V6OC 1EEYB 2GJ6B 4GAGL 3WHE0 1WLHA 3IDIB 2GKIA 3MLSL 4PLOB 5GSRA 5FCUH 3F7QA 4FTVA 2YUVA 4ZMAT 4R4BB 1YPZE 2JIXB 4ORGB 4ZNEA 5IVXE 4ONFL 3KPSD 5C0JA 2XXCB 4NM4L 1UZ6E 4O2FA 1UXSA 5A2FA 4DGIL 5GJTH 1KCVH 1CLYL 1GL4B 3V4PH 2HTKC 3BHBB 4XBGA 4KI5F 3U7WL 3WUZA 2ZPKL 1HZHL 2PCPB 5IQ9B 4OIBA 5JNYA 2ZOKA 4M6ML 4Y5YB 1FG9C 3O6KL 1AGBB 1ITCA 1M7IA 1QFWL 3QEGL 4M8VA 4N8CH 5C09D 4CJ0A 1N59A 2E6JA 1QLFA 5E4IA 4XNMA 3VGAB 3RWGA 1DN0B 3V5DB 5KSAB 1OGAB 1RZKL 3G6AA 1IC4H 2DI8A 3SDXA 1U8LA 2AEQH 5CBEA 4LHUB 5KS9E 1O5DT 1J8HD 4PR5A 1QSEB 3SGKC 4F8QA 1LWRA 1FFPA 2Z31A 2KBGA 3MJ9A 1CQYA 4OLYL 5L2KE 2DKMA 4DN3H 4JM2A 3ARGA 5HPMA 1NCNA 3U30C 3FHQA 4Y2DC 3VWKA 4HUVA 1AP2A 1IEAB 4NM8L 2CPCA 3CU7A 3LMJH 5DA4A 5HHXH 4EIGB 1A64A 1CDYA 3IGAA 1QYGL 1TVHA 2BVQB 4K3JH 4L8DB 4N8VA 4I13B 3TO4D 3TBYA 1T7XA 4P4KC 2Y7QA 3D39E 5I16B 2V2WA 4QHMA 1A6UH 2EH8L 4AEFA 1NGPL 5DURB 5FYLL 1JFQL 5C0RH 2O5ZL 5IBUG 1S7TA 2VXVL 4RZCA 3D69B 3RNQA 4R26L 2AJXH 1Q8MA 1JGUL 5D72H 1KIUA 1JL8A 4WW1A 3JWOC 3VXQA 3D0VA 5C07E 2NY2B 4AH2B 1FORL 1KYOK 4XVSH 5BV7H 3UZVB 3QEQD 4HKXA 2D31A 3EW3B 5HHME 1OAZL 3QWOA 1N0XL 2ICCA 2DBJA 2YKLH 3H3PL 4YLQT 5D7LD 2G2RA 1FIGH 1B0GB 1JN6A 1VPOH 3L1OH 4IEFB 2FJGB 5JIPA 1U6AL 3B9AA 5SWSA 5T5FH 1MJJB 2XQBL 4NUGL 2EXYD 2VC2L 1YECL 2EYRB 4WHYG 4I8DA 2ARJA 3ES6A 4WFGD 3IS1X 3T4AB 1RZ8A 3HI1A 4LCCC 5CS7A 2OCFD 1KCRL 3RA7L 4LCWD 2XKNA 4MNQE 5DJYB 4WHTA 3G5XA 3D87B 3NTCH 3HMXA 1OQOA 5K9KB 2VZ3A 1JPSH 4PJIB 1ONQA 1ZTXL 1I85C 4YR6A 1EGJL 35C8H 2FDBP 3HRZA 5J1TC 2PO6B 5FGCB 4ZTPH 2VL5A 4JFDE 2C3VB 1AY1L 5EDXA 1CZ8L 4PJHE 4APQD 4FOMA 1KN2L 1MI5D 4K9EC 2AV1B 3LAFA 1A6AB 4UUJB 1IEHA 4LSTH 3M17B 2JJTA 4OQTL 1RUKH 4YHZL 2EZ0D 2OYPA 3QUMH 3FQXA 3RTQD 1H3VA 3MLPA 4K2UH 5H2BB 5E2TH 1JNNL 5I8EA 3ZTNH 5DD1H 4OFPA 1TIUA 2EEDA 4G6FD 3PHQA 4LLWA 5HHPB 1UJ3B 1GC1L 1NL0H 4LEOB 2FEEL 3P4OB 4NQDE 4NQCB 4EIZC 1TTUA 2BDNH 3U9UA 2HRPH 2P5WA 3DTXB 5CWSA 1KF9B 5EU7E 3V5HB 5C0BA 4PJBB 5FV2A 2P49B 3UYRH 5E03A 3C2AL 3SDCD 3VFWB 5JHDE 1BFVL 4QHNB 2AW2A 5JZ7D 4QEGA 5CHNA 3MROB 3RNKA 3SE3C 4OZGB 3DGGB 2YPLB 3REWB 1S5IL 3KPRB 3C60D 1QFHA 5KS9F 2YRZA 4MXQC 5BMFL 5I66B 3DECA 5C0CB 3UEZA 1G84A 1U8JB 3V8OA 3KYKL 4IHOB 3BKML 4R0LA 2GFBB 1SVCP 3BXNB 3QG6B 4WWKA 1UYWL 1VFMA 4HEPG 4KTYA 1T0NB 2J7LA 3ZKQD 4N5ED 4QNPF 1YY8A 1FHGA 3LV3A 3BMWA 4GAJH 3UTTD 2B5IC 1MRDL 4Y4HC 1KJVB 5D1XB 4L5FH 2M8XA 5E1HB 4OLUH 2BMKA 2R0LH 3WIFB 1N26A 3MRJB 1HSAB 4NT6B 4NKOB 3FQRA 5I0ZA 2CLVB 1ND0B 3QG7H 4EDWL 4YEFA 1IC1A 4YPGB 1BWWA 1MUJB 1BD2B 4YHMH 1S7QB 2RCSL 4BM7A 4BZYA 2GJ6D 3O45A 3L3DA 4N9GA 2KZ1B 5D71L 1CFBA 3ZKSD 1AQDA 2ADIA 3FZUC 2JIXD 4NZJA 1T7ZA 1KCLA 4F7MA 4KRMB 4OB5H 3IF1A 1XGPB 3QDGA 1IEBB 3D5OF 3OKLB 2W9LA 1UA6H 4CU7A 2VKWA 1IT9H 4UIMA 4YBLC 4NC1E 3VXMD 2Y23A 4XC3L 3BIKA 2DWDB 4JFFE 3I3BA 4M6NH 2OBGA 1OAUL 2CRZA 1UWGH 3ARDB 2DN7A 4KVCH 1IGYA 3V4UH 2ICWI 4NFBA 1ADQA 4PJ5E 1BX2B 1A5FL 2P8PA 2YUXA 4XZUB 2CLZB 2YD2A 2P43B 3PWPB 4X6DB 1RUAL 4Z7VA 4WFHD 1XCQA 1AGCB 4BQCA 3MYJB 4KXZH 4LU5L 4DVBA 5KSAD 2XXMB 4KKAD 1OGAD 2UZIH 4I5BA 4KDTA 4O4YH 3E1F1 4HX1B 4M7LL 4Z7NE 3VG0L 3DVNA 3WBDA 1T03L 4X9FA 5C8JA 3V7MA 1QSED 3FT3A 5D5MB 4PJXF 4X0KA 3BISA 2C3XA 1ES0B 4NQEA 3UZEA 1P9MC 1SYSB 3SJVB 5GZNC 1FH5L 3V6OA 5DUMH 1KLGA 1L9MA 4UV4L 3ARBC 2BK8A 5FYJH 25C8L 3RKPA 2L7UA 2RR3A 3T1FB 1IGCL 2OK0H 1J11A 1QFWI 2F58L 3C09B 4B7LA 1A9BB 2HG5A 3TA3C 1FNHA 5IP4A 1SJEA 3LPFA 4HULB 5E5RB 4YFLI 3OL2A 4JRYA 4PPTA 1MCOL 3QNZB 4TVPE 5C70A 5B21A 3IXAA 3UTQB 3HB3C 5HVGB 3RWCB 3WJLA 3C6LC 2APFA 1FJ1A 1A7OL 1RZ7H 3RVWD 4F2MB 3DXAE 3NH7L 4JHZA 3E8UL 3T08A 1RJCA 1CWVA 4I2XE 5DJCA 5TGBA 3SQOH 3OKOA 3DO7B 3BPCB 4LVEA 4P5KA 4K3DH 3ZDYF 2C3GA 2NY2D 3U7YH 1CXEA 3MRLB 2EDDA 3LQAL 3GMMA 3DX7B 4QTIH 4AIOA 1T21A 2ARWA 2PYFA 1ORQB 2QSCL 4MWFB 1FG2A 4X7TB 3KPNB 4RWYH 2A9ML 5I1IH 1XF5B 4W70A 4LPYA 1N8ZA 1R6VA 3FQNB 3ZKMD 3QHZH 5D8JL 3SGKA 4LEXH 4OZIF 4AT6B 3KLAA 4JPIB 2NX5E 5IB4B 1TDQA 5IWLC 4EN3B 4ZYKA 3QIBD 1DEEB 1I1AB 2CXGA 3VMOA 4LLUB 4GMTL 1LP9A 4Y2DA 5JDJA 5EZIH 2AJYH 2D7TH 5HDQL 1HWHB 5LQBH 2QQKH 2CKBL 4K23H 4F15B 4XC1L 5DDHB 2RGSA 1GJIA 3Q6FA 3ZKXB 1W8OA 2BNRE 4G6AC 2PO6D 4IDJH 4P4KA 1AO7E 2VDPL 5IW6A 2ADFH 1FL5B 2C4XA 1IAMA 5L9DL 2GY5A 2V2TB 1N6VA 3HC4L 3GUTA 2F8XC 2HH0H 5C0EB 1ZLWK 3GSQA 3G6JB 1FNSL 4JLRA 5GS0D 1DANU 5IM7B 5C2BL 3MBEB 4NO0A 2FX7H 4O02H 1CCZA 1CG9A 5GGVL 3S4SB 3BDYL 1CFNA 4JY5H 4MQ7B 5EO0A 1FYHB 1FZOA 4XP4H 4EUPA 4PTTA 1RV6X 3LKOB 3FT2B 3HPJA 3NA9L 4JY4A 4UOW1 3BSZH 1HKLH 4YE4L 3RWHA 4MAUL 1T6VN 3C2SA 1K2DA 1RURL 2IADB 4JANB 1FAIL 4LCCA 5E5MB 3CFIC 1N64L 3QFJB 1CE1L 3NABH 5A16A 4YHOL 2FECL 4MJIA 1RFDH 4K3HA 4GRWE 3WUWB 1KLUB 2B1HH 1I85A 1UM4L 3BDXA 2YPLD 4P3DB 4Y19A 1AKJA 3JTSA 3KPRD 4JO4H 5FGRA 3MLZH 3KXFE 3EO0A 2H8PB 3OAZK 5I8CA 2ZCLL 3CDGB 1CTNA 1S9YA 2VDML 2JF1A 2XOTA 4D3CH 1B4RA 1WAAA 2FEEI 4BZ2L 3QIWB 3P9MB 3LKPA 1FFOA 1YQVL 3WFZA 5JW5A 4RBPK 4BKLA 2HJLA 3MNWB 3WJJC 4Z7QF 3BE1L 1PZ5B 3VXTA 2Q8BL 1QFUH 2ZSVB 2VDOL 2FX9L 3GO1L 4PJFE 3CFDA 1JGDA 4KUZH 4PY7A 2NZ9C 1K8DB 4POZC 1VEMA 4M62H 2MHAB 4H1LA 5TF0A 4NRXB 5F96L 4G42A 3CZFB 4MA8L 4U6HB 4C57C 4GSDL 1FL3B 1BD2D 2CUIA 1C08B 5AAMA 5I1AA 1GXEA 4LSPH 4PRAB 2FJHB 3PV6A 1RMFH 5E1AB 3GIVB 1WBYA 2ZUWA 3RGHA 4AMKH 1IQWL 4YNYB 4FXLA 4ERSL 5JW4M 1PQZB 3SDDC 2DL2A 3D25B 2V9TA 2EEBA 3GSXB 1F58H 5B3JF 3SE3A 2AJVL 4OI9A 5H35A 4OCRH 4WU7A 4P2RA 3ULUL 3WIIH 3P73B 3WHXA 5T3XL 1TENA 5EU7C 4FABH 4LKCB 3O3BB 2E7HA 2V5RA 2F54B 1LO3L 1D5BA 3VGDA 1G0XA 4IOIB 5D7SH 3SPVB 2FNBA 5HI5C 3PWPD 3MRRA 5TQ2L 4NHCH 5IEHB 4DOHE 1KPUA 3RI5K 1G7JB 2EH7H 5ITFB 1I3UA 4K71B 4M7ZB 4S0SD 1A1NA 1AE6H 3MZTA 1U92A 4Y4HA 2YSSB 2FATL 2UY7A 3IETA 1MWAA 3PP4H 5GGRB 3OF6A 1EMTL 4L3EB 2XZCL 5CKGA 2Z9TA 5DRZB 4XX1G 4WTZG 4FFYH 1VKXB 1QZ1A 2QR0A 1U41A 5C0IA 5FXCH 4JM4H 1G7IB 3SJVD 4PP2B 1DLHB 1CD0A 1D5ZA 2NTFB 5C0GA 5F7UA 2AJZB 5J3HD 3EYFB 4X9IA 3RWDB 3GMPA 1IRAY 4GKZA 1GOHA 2YRPA 4PRNB 4LVNC 3OB0H 2K7QA 1QSFB 4KJQD 3VD5A 4U7KA 1LEKB 4UOW0 3DARA 4XHJC 5AD0B 4YEEA 1EBAA 2D3VA 5D7IE 1UJTA 2FH6A 3BP6B 1HCFX 4BSWA 1E28B 3BZEA 3LVEA 4R96B 1WWBX 1A6VL 2ZJSH 3BAEH 1FDLL 1MRFH 5ICZA 1KJMB 4JHAL 3DBXA 4XI5C 3MR9B 1MQKH 1BBDL 1NCWL 1OPGL 3LZFH 2UYLA 5IFJB 3STLB 4LHQB 5C9JB 4P23C 4F7PB 5BS0B 2CK2A 5D2LB 4EBQH 2WBJB 5C6TH 5CSZB 4B41A 5E56A 4PTUB 3OKDB 3KS0J 1PJ9A 4HS8H 3QXTA 2DKUA 5FO9B 3B5HA 2DMBA 4I3SH 4HH9A 4QLRA 4MDIB 4G6JL 3TFKD 5E94A 1KBGH 4OCLC 3O6FD 1A6TA 4UDTB 2FSEB 3OXRB 1VA9A 2BHUA 5DSCA 5EIIA 1IAKB 3HAEH 5ACZA 1JHLH 4M48H 5L8LB 4M7JL 4EN3D 5TQ0H 4RFNB 1P9MA 4NZUL 3MRGB 3CX5K 1I1AD 3IDGA 4JO3H 4WI9A 2Z92A 1BF8A 4QCIA 3ARBA 2C1OA 3BWAB 3DROB 5FYKL 4R97C 4CN4A 1OLZA 1ZT1A 2HKHH 5DUBB 2NNAA 4PRPA 3WIHA 1QD0A 2Q20A 4NFDA 4OF8A 3BJLA 3TA3A 1XIWB 2X6MA 3MV8B 3T0DA 3WLWC 5GGSY 1G1YA 1Q9KB 4MMXC 4ETYA 4G9FA 3GMRA 3C6LA 2VN4A 4ELME 1CXHA 1FNEB 1R3HB 1TCMA 1EXUA 3KPLB 3NCBB 5CUSH 1AXSB 1YPZA 3KYNB 3GSOA 5E8NA 2IQ9L 5LJYH 2W9DH 5IVXA 1JF1B 2DI7A 3MBED 4YXKL 2A77H 2FHBA 3VCLB 1AQKH 4FP8H 5IFHL 1GAFH 15C8L 5B4MC 3PG2A 1QBLL 1S9VB 3SHSA 3RX8A 3MJ9L 4O2EA 1T22B 1MNUL 4HKBB 1SQ2N 1MAJA 1ZA6A 2GCYA 2PTTA 2EEAA 3VXPA 4TRPH 4DUWA 3PWVB 1N2RB 3OKYA 5IWLA 3O9WB 4HZLB 5F9JB 3NCEB 4RQQA 4XPFL 3KDMB 1YUHA 3LKNA 3QNYB 1SJXA 3VWJC 1M7DA 1CBVH 5INCB 3HNVL 3IFOB 1TJHH 5KS9A 4M1CD 3BP5A 1A0QH 1YN7B 4JFHE 1BP3B 2XI9A 2JE8A 3DYOA 5INDA 2AJUL 2Q6WB 3SY0B 5C6WH 3QUZC 3QIWD 4PG9A 2OP4L 3KNBB 2E7CA 1VADB 4N0UB 3MRDA 5IUSA 3O41A 3PL6D 3I9GL 4NKMB 4RGOH 4PRHE 2WIIA 2JELL 5E2WH 4Y4FC 1P1ZA 1RUQL 2WV3A 4MXVF 4OJFH 5EU6B 3R0MA 2FECI 3D39A 1OAXL 1HIML 3WFHA 4XAWH 4PRIB 5IT2L 5D93C 2AEWA 4ONGH 1X5JA 1Z3GL 4I9WD 1NGZA 3S5LA 5L8JB 3VRIB 2E27H 3MUGB 4JRXB 4XGZB 2DIBA 5C07A 2XACC 4PD4J 4R2GC 1WIUA 3HMXL 1S3KH 4NKDA 1JBJA 1X5AA 4ZAKB 4I4WA 2XTLA 3CXHK 3TBWA 3MACL 5EOQH 1F02I 4XVUC 1J10A 2GUOA 4FQ1L 4YAQB 3IFPA 2X4SB 3JXAA 2BVPA 5J0BA 1GH7A 4F58L 4KZEH 1P4LA 4QTHB 5DHVA 3A6CL 3ARFB 5DJ8B 1YDPA 4Y1AE 1JPGB 3L3OA 2F54D 5ISZD 2VERN 1MAKA 2X9YA 4UNTA 3U4BL 3WEXB 1QSZA 3B3IB 3BH8A 2VXTH 4ZFZA 1I7UB 2CUHA 2R1XB 4P9MH 1A3LL 4PJEB 4XH2A 3WJJA 1HXYB 2HKFH 3OG6B 1LEGB 1C5CH 5T1LB 1F3JB 5FYLD 2K1MA 4WGWB 1RQ5A 2UWEF 4JKPH 4JR9L 3WSQH 3O3AB 1DSFH 1T2QL 3QDMD 1RI8A 2A6IA 3OGCB 4LCIH 5F9DC 1IKFL 1G9ML 4HPOL 4PJHA 1U58A 3UDWC 1JP5A 4PJXA 1R3KB 2BOBB 5I2IB 3NZ8A 5FV1L 1CFSA 2WQRA 3L3JA 1WC7A 5C9KA 5EZLA 1H3WM 3B2VH 5AG8A 3FO1B 5KSVB 1B6DA 1TNMA 4X6FB 4NRZA 4RFOL 4PRDA 4ZUWB 4LDLB 3QUXC 3H9HB 2FZ3A 1QRNE 4GOSA 3UZQA 1K4DA 3A6BL 3GKWH 4MMZC 2EXWC 2A6KA 3W5NA 3SDDA 3O11A 2ADJA 3V6BR 1AGFB 4Z7OE 3MRCB 3OJMB 1FYTB 1RUPL 3KYOA 4ONHA 2V2XA 4NQDA 4DWHA 1OHQA 4Z18A 3F58H 2VRAA 4Q6IB 4D9LH 1X7QA 5I8OH 3P0YH 4KKLD 1LDPL 3UC0H 5KOVC 5GGUB 4MA7H 2CKBB 4KKCC 1T04B 4NQSA 5EORL 3WO3B 1JWSB 12E8L 4E41B 5K9JL 5KSUA 5TH2B 5J6HB 4U31A 5JHDA 2DYPA 4D94A 3HUJB 5BS0D 3OPZL 4DGVH 4FQQB 3KLSA 3NCFB 1QR4A 3OR7A 1AD9A 4KQ4L 3EUUA 3MLYH 2MCPL 1OGTB 5ESQA 1UH4A 5KJRL 3C5JA 5D2NE 2IFFL 1R3JA 2QBWA 3RWFB 1IAOA 2CDFB 2LTQC 5CJOL 2R2EB 4P4RA 4PGCA 5CAYB 1RVFL 1FZJB 4XP9H 3UBXA 1CU4L 4PJIE 4JFEB 3DRQA 5ID1B 5IESH 1FCGA 1NCCH 4X5WB 5BCAA 4M00A 1JJUA 2Z93B 3HAEG 5DJ6A 5I76B 1NCTA 2DM2A 1A1MB 5EN2A 5FGCE 3U83A 1XH3B 1I3RA 5DK2A 3GHEL 4HD9A 3QZWG 3TCXA 5FCSH 4JREB 2GTWA 3C5ZB 4HS3B 2IPTH 1U8OA 4QWWD 5B38A 3M07A 5DRXB 1YEEH 3QHFH 4WRLA 3JTTB 4PJ7F 2J8OA 1NBYA 4PGDA 1XIWD 3MV8D 3ZHDA 4JDTH 2F53E 1BVKA 1RHFA 4F7EA 2OSLA 2PXYC 1C1EL 4JVUA 3G04B 2I5YH 5E2VL 4G8IA 2I9TB 4PJAB 3WKML 5F3BA 3VJ6B 5I15H 4I0PB 3HLAA 4ETQB 2XWJA 3P11L 5ILTH 4FMFA 1KJ2B 3FQUA 2ID5A 4P23A 1I9RL 1SJHB 3OJDB 3MBXH 4NQCE 3TBVA 4MXWH 1FVCB 3G5ZB 5HHOB 4WCYH 1Q0XL 1YN6B 4G7YH 1DUYA 4OCMC 4YFDB 3VH8A 1EO8H 2EDWA 3OR6A 2YPKA 3O4LA 4JFFA 3JV6A 4HFWB 3QFDA 2CDEA 1DQQA 1G9NC 2BVOA 3AS0A 3EOBA 5TF1H 4PJ5A 4WUKH 4TSAL 4Y5VB 3O9WD 4MJ4A 1KB5H 4HC1A 1UZ8B 4OLXH 3QXVA 3CMOH 4FXKA 5T3ZH 3FQTA 2GSIA 9CGTA 2H1PH 5C0CE 3G08A 4P48A 4P2QE 1H3PH 4CMMB 1U8MB 4GMSH 2AV7B 3LDBB 2DQCL 1NC2B 3VG9B 3LPGA 3AB0C 4GRLB 1WZ1L 4WUUB 1X4ZA 3E6FA 2OXGA 5GJSH 1T5WB 1NBVL 1BEYL 4W68A 5CJQL 2WBWB 5HDBE 3TCLA 3SGDH 1IL1A 1YY9C 4HQQH 1S78C 3GMQA 1H3TA 1NEZB 5IV2B 5DLMH 2CQVA 4X7DC 1JWUA 2W65B 4L1HA 1T6WA 3ET9F 3UTSD 3LRHA 4KROB 1S5HA 3X11A 3RJQB 2EDRA 4N0FA 3EO1B 4YHYC 3PDOA 4J1UB 2O5YL 3IKKA 3G6DL 1NMBL 1NDGA 3IFLL 1JYNA 4NRYA 4PJGB 2P44B 3HKFA 4U6XA 4F7CB 3WD5H 3ILPB 3WFCL 4RX4A 5EU6D 1JE6A 2XA3A 4WJ5B 3BUYB 2CD0A 4HKZB 4HW6A 4PUBL 5IVZA 3S37L 1ULVA 1MJUL 4K55A 4PRID 4PYGA 4MJ5A 4MQSB 2GT9B 1T4KB 4MB5A 5LAXB 1C7SA 2X5PA 2BXZA 5LGJB 3DXAA 3L3IB 4JPKL 2DLHA 2AABH 1BQLH 1PYWA 4U1JB 2EO1A 4JRXD 2H2PC 5ITBL 2FLBT 1A6WH 4OGYH 4XRCB 1AFVL 3CVHA 3QUKB 4ZAKD 2BZDA 3BD4A 2VWEE 1HXMB 1WWCA 5HTSA 3GMNB 3ULVL 3GSWB 3HI5L 3VRJB 4QXGL 3VWJA 5SWZB 2DQTL 5HD8C 4M4PA 4MLSA 32C2B 5C0NC 5HYJB 1SY6H 1J1PL 1NLDH 2CIKB 1EAPB 4FQCL 3SKUD 4ZUUB 3ARFD 3EJZD 2ESVD 2X70B 1Q1JH 3W11C 2XRAH 4S1SL 1KIPB 3MLVH 2ZSWA 2BJML 3QUZA 5DI8A 1HNGA 4WY7H 2W38A 5EO1B 4H0GA 5AZ2H 2I07B 1K6QL 4GG8A 5B22A 1A6ZA 5T1LD 3FFCE 3WO4C 3MA9H 4M3KB 2HN7A 4CDHA 4Y4FA 1WSST 4Y16C 1WICA 2X9WA 2BNRA 3I3EA 3DUUB 1MCEA 1RIUH 3SDYL 1AO7A 3UX9B 1F6AB 1JHTA 2JK5B 1DBBL 1J9CT 4CU8A 2M2DA 2X4OA 3DUHA 5ALBH 3HZVA 1XAUA 1FN4B 4X7SH 3EYUL 2W0PA 5E6IC 2PNDA 1I7RB 1TPXB 1DBKL 3LS4H 1Y6KR 5D7JB 1ZE3C 5IBLD 1V5JA 4P46C 4WEMB 3WFDH 2OJZH 3CSYB 1UADC 3DVFA 4YGVA 2F15A 5F44A 4B0MM 4JDVA 1JPST 1C12B 2J8UF 3HPLB 4ZPTA 4G8GB 1T0MB 4Z0BH 4NPYA 2QADB 2R0WL 4IRJC 4BQ9A 5GSRB 5GRJH 3A67H 1PDKA 2ZNXA 4FTVB 4YH6A 1FYTD 4UT6L 4XP5H 1HQ4A 1ZA3A 5C0JB 4OUOA 4O2FB 4HPYH 1UXSB 3V95A 2EIDA 4FXGA 5J06A 2WUBL 4JKLA 3MLXL 4FZEH 3ZYZA 3LN4A 4E41D 3LRGA 3MV11 5FF6A 1N6UA 5EOCJ 5E99H 5C08E 1IFHH 4TUOA 3RUGF 1E4JA 1UKQA 3F5WA 2ZOKB 4PGEA 3ARVA 2MJWA 2DQGL 3KXFA 3QUMA 5J1AA 3PP3K 5HJ3A 5KTEL 4Q6YA 1N59B 1QLFB 1AIFA 1KELH 4XNMB 3UDWA 2B4CH 2IGFH 3RWGB 4JFED 1KLFA 3IB4A 1E0OB 2OZ4H 1NQBA 3G6AB 3QBTB 1GZQA 3SDXB 1U8LB 3CUPA 3MODH 5CBEB 4ZFOA 5CEYA 5BRZD 4PR5B 1HK6A 5DUPH 5ELIA 3FFDA 1KULA 3LN9A 2HT2D 2Z31B 4TNWK 1ED3A 5HSFA 4J3XA 2FWOA 2DJ4A 3QUXA 1CXLA 4JM2B 5HPMB 4OUUA 4PJFA 5B39A 1D5IL 3S96A 3VWKB 1A7BA 4HUVB 5F6IC 1AP2B 1DQDH 1HWGB 1Q9WA 4QF1A 1TVHB 3IGAB 3MUZ1 3QRGL 4N8VB 1ACYH 5E4EB 5ESVA 5KN5A 3LH2L 4I0PD 2V2WB 4QHMB 4QT5A 4M6OH 3DVIA 1P53A 1FGNH 3B8YA 1ZVSA 1F5WA 2HFFA 1QKZL 2KQNA 1S7TB 4RZCB 3RNQB 1FCCA 5HHOD 4NWTL 4XXDA 3IDJA 1N5AA 4WW1B 3VXQB 3D0VB 2IBZX 3QFJE 1A14H 5TDOA 2DJSA 4KXZI 4NUJA 1D9KC 4FFVC 2J8HA 4HKXB 1SYVB 2D31B 4PGBA 3QWOB 4OM0H 1I8KA 5IHUH 2I24N 1EA9C 2G2RB 1W0WA 1JN6B 5E6YA 1DTUA 2EDEA 1UCBH 1MPAH 3TPUA 5SWSB 5SWQA 1EX0A 4LSUL 4P59L 3MNZA 1PY4A 4IOFD 3D2UD 4ZD3H 3DJ9A 2DQIH 1NC2D 3OSKA 1KACB 5MENB 2ARJB 1F2XK 4WUUD 4OCSL 4R90H 4W4OC 2WM0A 1OTTC 1RZ8B 3HI1B 3BGMA 2ZKHL 4KPHH 4GG6E 4ZS6C 2VXUL 2XKNB 4RMRA 4YHLH 4WHTB 3TT1H 3G5XB 2QEJA 3NIFE 5J6GA 4N0CD 1RIHH 4TUJB 1J0HA 1ONQB 3KJ6H 4GKOA 2DIAA 5JUEL 3KPMA 4KROD 4CNIA 2PXYA 3M8OL 1I8MA 2KH2B 4YR6B 3HC3L 1CT8A 5IF0A 4RAVA 4OFYA 4OFIA 3D9AH 1N6QH 4OTXH 2ATKA 2VL5B 3EYVA 1W0YT 3U7AA 5A3ID 4KY1H 4AENA 3ULUD 1T3FB 4P9HH 3TH3T 5T3XD 5F1KC 4NFCA 5IW1A 1CTOA 2B1AH 3RIAF 3QCVL 3BPOB 1FNGA 5ERWA 3AXLA 4YDIL 4C83A 5CZXD 2D9CA 4KZDL 5CCKH 5I8EB 1NANI 4JN1H 3FO0H 1EEQA 5EOCH 5SV3A 1IARB 3TYFB 4Z7WF 3PHQB 2E6PA 4LLWB 2Z35A 2VLRA 2MCG1 3O0RL 5FK9A 1O7VA 1OP3H 4DKEL 3TPKA 3LPWA 5JOEA 1NFDE 3U9UB 2P5WB 5CWSB 1Q72L 1JPTH 5C0BB 1ZHBA 3PWUA 4C56E 1EUUA 3DURA 3MRIA 3ZSTA 4CAGA 3C87A 4DKAA 5HYJD 5DJDA 2H3NA 4M9PA 1L9NA 5CHNB 1BQHG 3T3PF 3N1FC 2ED9A 1MCRA 2UV3A 2YUZA 3RNKB 2GTZA 4LPTA 4QHUA 5I74C 5CGTA 1L7TL 1UQSA 4L3EE 2VZTA 4DCQA 5GRXG 4X83A 4XNXH 5F1SA 2FBJL 4R0LB 4WWKB 2FGZA 4NN5C 4ZFGL 1TZIA 1UM5H 4YBQD 4MD4A 1EVTC 4OF7A 1HE7A 5DJZA 1S7UA 2QTEA 5DYOA 4BZ1H 3REVA 2DLEA 3LS5H 3LV3B 1QSFE 4F7TA 2NY6C 4ELMA 5D7JD 4JFPB 1OM3H 4OT1H 1I8IB 1KPVA 2A9NL 1RU9L 1F4HA 3GK8L 3OXSA 2AI0H 1BGXH 5J12C 2L4OA 4G8GD 3GSNL 1JMXA 4JZNA 3O45B 4LSVH 3L3DB 4N9GB 3DX8B 4EKXA 5E2UL 1NGXA 3IU3A 2HP4A 4PS4L 5EZJA 1HHIA 4FTVD 1AQDB 2ADIB 1CGUA 5DMJB 4JG1H 5IOPA 4F7MB 4HMEA 3IF1B 3B9KC 3PWNB 1FVDA 2WWKT 3QDGB 1ZLSL 5IEKA 3S34H 3U79A 3FAWA 5FYKD 4UIMB 5LVEA 4L9DA 4NN6B 3RIAK 3MV7B 1D3CA 1MCWW 2BVEA 4YIQA 3P0VL 2VWEC 4ZUVA 3BIKB 3NMEA 5GRUL 1P84J 2CIIA 4KUCF 2FL5A 1IGYB 4D0CA 1LO4L 3V7AE 1VCAA 2BFVL 2P8PB 5C86A 4Y16A 1VFBA 4QRUA 4G6MH 3VA6A 2R4RH 1XCQB 1DFBL 1QR1A 4DVBB 4NO3A 2HVKA 2FR4A 1INEH 1TMCB 5EA0L 5BQ7A 2Q7YA 5E6IA 4I5BB 5BXFB 2FIRT 2XTJE 3DVNB 3WXVL 4LSQL 4PRHA 5C8JB 3K2MC 2A1WL 3FT3B 4P46A 3SEPA 4X0KB 3K46A 1WGOA 3O6MH 2Z31D 3N9GH 5D6CA 4NQEB 2NY5H 2ZUVA 1WWWX 4JM2D 2PW2A 2FEDC 3ZTJH 4S11A 1KENL 3Q48A 1EEZA 1KLGB 4UT9H 3VWKD 2GY7B 1KSRA 4OCYL 4IRJA 1H8SA 1E4XL 1N7ML 3B4NA 3H9SD 4LAQH 4E5XA 1NBZA 1JRHH 3RU8L 3LB6D 5T33H 1RD6A 3PNWA 5KVEH 4M5YH 1SJEB 3FT4A 3CK0H 4XCCL 1HHHA 3NZHH 4JRYB 2XZQL 5DJAA 2CK0H 2F9BT 2SEBA 4JDZA 3X12A 3IXAB 4ZPVA 3VFMA 5GRYA 3QQ4A 1FJ1B 3BPLC 3BMVA 1XMWA 4U3HA 4OGZA 4DEPC 1EFXA 5DJCB 2VAJA 3U1SL 1MHEA 5KVDH 3RVUC 5TGBB 2FIKA 2NY1C 3OKOB 4P5KB 1KEMH 4PJ8C 1P7HL 3O6LL 1LD9A 5SX5K 3KPOA 3GMMB 4JHWL 4Y1AA 2PYFB 4ODTH 2VDLH 1NAMH 1FG2B 1E6OH 5H37H 4JO2L 4GW4A 5SWSD 1KPRA 4ZS7H 4DAGL 1N8ZB 2IQAA 2V5TA 1YMMA 1KTKE 3MRFA 3QP3A 5MEND 3BKYH 3MGTA 2VDRL 4ZYKB 3U30B 4PLNC 3U0PA 1BBJA 4AQ1B 1LP9B 4Y2DB 5HGDA 4XNUL 2QSQA 4HJ0D 2C1PA 3GGWB 4XBEL 4NCC2 2AGJL 1YNLL 3Q6FB 1MCLA 4KMTH 4BFIA 3GI8H 4QXUH 5E7FA 1YEDB 3SQBA 3HS0A 5HI3C 2XG5A 4P4KB 5IQ7H 5IW6B 5ALCL 3OKKA 2HLFD 4UIKH 3S98A 2AXFA 1TTFA 3JUZA 1QRNA 4L8BA 3GUTB 2PUQT 1DCLA 1E4WL 1KB9K 5DD0H 1HYSD 3GSQB 4GJTB 1MIEL 2HJFB 1HNFA 4IMLA 3NIGE 4XPTL 5EOTA 1PX3A 4JLRB 4G7VH 3BT2L 3HN3A 4NO0B 4HWEH 1D9KA 3QQ9D 1SEQH 1REIA 1CG9B 4CN6A 1D5MA 1CFNB 2ERJC 4RRPA 2EDFA 5EO0B 5LXGL 1FZOB 4EUPB 4PTTB 3EOAA 4YWGL 1KN4L 2X44D 1KJ3H 3HPJB 3WL9B 2P5WD 4JY4B 2P8MA 3RWHB 4M1DL 4L4VE 5D2NA 5BVPL 4YJZL 4W4OA 1K2DB 1I9IH 4QRTA 4LCCB 3C08L 4KJWD 1TETH 5A16B 4MS8D 4X4XA 2ZCKH 4MJIB 4X8JA 1YJDL 4XP6L 1NFKA 3DSFH 1BVLA 4KK9D 1R3LB 5TE4L 4Y19B 1AKJB 3JTSB 4FFWD 5I30H 3VD7A 3OKNA 3EO0B 3UMTA 3T0WA 5I8CB 1S9YB 1FL6A 5FKPB 1P5VA 5BJTA 2XYCA 3A6OA 4RMUA 4WWKD 1FFOB 5JW5B 5DC4B 5AZEH 2VXSL 4BKLB 2HJLB 2F53A 3MFGB 4S1DC 2J5LC 5DJ0A 2NXZC 4LKXA 1MCPH 3C8HA 4XVTL 3M1BA 2AQ3A 3QEHA 5FUOL 4DKDC 2UZYB 1GPOL 2V17L 3CFDB 4UT7L 1JGDB 4PY7B 3U0WH 5CFHA 1CYGA 2VDNH 3PGFH 3QPQC 4H1LB 1UC6A 4G42B 2IH1A 5GS0H 3LEYH 2J8UA 3L3HA 4LVOC 5T1DL 3R4DA 5I1AB 2Z8RA 4Y89A 3PV6B 1IM9A 2P4AB 1BM3H 1WBYB 5FEBA 4UV7H 3HUJE 2P46B 4O5LL 3GJEA 3AVEA 1FAKT 2IAMC 5GJTL 2XQYG 2BVYA 3V4PL 3MRPA 3GHBL 4Z0XA 2F5AL 3MV7D 2YK1H 5DMKA 5H35B 2OQJA 5F71A 2EDNA 3ZE1F 1BZ9B 4WU7B 1HQRA 4P2RB 4ZUTA 4V2CB 5DD3L 1Z0NA 3WHXB 1J5OL 1P4IH 3OKMA 4H88H 5HGHA 2NXYD 1IKNC 3WCYA 4TVPL 5J56B 3D18A 1C5BH 1FVEA 3SE8L 1J86A 3NIDE 4N8CL 1DLFL 2CO6B 3ZDXF 2CJUL 1RZJC 3MRRB 4OAWA 1KPUB 3EDJA 3DMMC 3IDXH 5KANG 1U9KA 1M4KA 1G7MA 1DVFA 1U92B 4Y4HB 2IBZY 3CVHL 2F74A 5CILL 1MCSA 1BFOA 4PLKC 5TPWL 1EHXA 2QHRL 2VAAA 3IETB 4CVZA 2YC1A 4XMKL 2GK2A 3RWIB 2QR0B 4YZFE 1CDGA 4NQED 1I3VA 5C0IB 3S36L 4PJAE 1D5ZB 5J89A 1M7XA 2BSSA 5C0GB 2R4SL 3MTRA 3ZTJG 1Q0YH 1IGTA 1Y6NR 4DW2L 3GMPB 4LP4A 4GKZB 4XTRC 4JE4B 4LASH 5DVOA 2JTDA 1TJGH 2ENYA 2ORBH 1A9EA 1V8HA 4NWUL 4TULH 4UTBH 4YBLB 4B5EA 4BSWB 3BZEB 1QG3A 4HSQA 4M03A 1EJOH 2HTKD 5ICZB 4PP1C 3DBXB 2WUCL 3X13B 5D72L 5CJBA 3RY6A 1FLRH 3L7EA 1KCUH 4HK0A 2IG2H 4CVUA 4JPVH 3OKEA 5LKNA 3IT8D 3VFOA 2NR6C 3L7FA 1FIGL 4R3SA 1E4XI 2HTLD 1I7TA 4O51A 4P3WA 4PJ9D 3IKCA 3MV01 4WFED 3MLUH 3Q0HA 4OM1L 5JXAH 4HH9B 3ZE0F 5FHAL 1VFAA 5H37G 5E94B 2DQHL 2VH5H 1A6TB 5JORA 4TSCH 1H5BC 5EIIB 1LMKA 5DSCB 5I8KL 3LKQA 4M1GL 5ACZB 3FFCA 4PY8J 2MPAL 1GGYA 3KYAA 3VFPA 3CPLA 2OMBA 1MRCH 1ZHLA 2Z92B 4QCIB 3ARBB 2C1OB 5EUOE 3L3KA 5J9PA 2VLJE 4LHUG 4WFFE 3U46A 5DGRA 4PJGE 2NNAB 3BEWA 4HWZA 2XTJC 3VMNA 3BQUC 4HXBL 4PRPB 4RIRA 1V7NH 2EE2A 5MEPA 1UXWA 3RZCD 3ULVD 4OFDA 4XAKE 5F88A 4P4KD 4M6AA 3VFUA 3TNMA 4LLVA 3NFSH 2FO4B 4U1GB 2EDBA 4G9FB 3GMRB 3C6LB 2C3HA 3GRWH 1KT2A 4YC2B 4R4FH 3CVIL 4K2UL 2CRMA 5JOPD 2VABB 3MZGB 3T3ME 1YPZB 3GSOB 5E8NB 4PJ8A 1C5DA 5IVXB 3C6SA 5KG9A 1G7QA 3OV6A 2E7BA 4NO0D 2C4FT 5C7XH 1YEGH 1TQBC 4KHXH 4X4ME 5SWZE 4ZTOH 5DTFB 2R15A 2GYSA 1DQJA 5D7KE 1TVBA 4FNLH 3B83A 4O2EB 3ZDZE 3RRQA 3C8DA 5C08A 2I60H 2B4CC 1ZA6B 2GCYB 1C7TA 2PTTB 4P2OC 1BVZA 1Q94B 3VXPB 2EDTA 3UYRL 1O0VA 1QP1A 3LQZA 1AI1L 3IFNL 2H2SC 2OR8A 4S1QH 4ODWA 5FHBL 3WFBL 4PG2A 2R8SH 1ZHKA 1A7PL 3INUL 4RQQB 3WE6B 4Z8FH 1YUHB 2IANE 1Q9OA 4MJID 2YMXL 1M7DB 3Q1SH 2DS4A 5C0AE 1DBAH 3GSNB 1AKJD 4Y19D 5KS9B 3LCYA 1FNAA 4KK6C 5EO9A 4NYLB 4BUHA 5CJ5A 3BP5B 4L9LC 5LBSL 5INDB 3GMOA 4HIEA 3HCVA 4UINH 3SKJH 4PG9B 1P7QD 4OCWH 2AQ2A 1NFIA 3MRDB 3O41B 3ARXA 4Q9QH 4DTGL 2G60H 1S7SA 1RK1A 2WIIB 4NKIH 5L7XL 5FA3A 2NYYD 2VNCA 3HR5A 3RP1A 3MUJA 4KVNH 4G5ZL 2R0ZL 5D9SA 3TO2A 3ZYJA 3O3DA 1HILA 3D39B 3QG7L 3O4OC 2WIMA 5IJKA 3VXSE 3WFHB 4YBHA 4X6CF 1T1ZA 2O93L 3G5VB 4ZNEE 3MLWL 2C7UA 1NGZB 1LHZA 3S5LB 1BJMA 2AVGA 3VXOA 2BY1A 5I1EH 4R7DA 5C07B 3RWEA 1OOAA 4DQOH 3UP1A 4NKDB 1CQKA 1TZGH 5MERA 4U2ZA 1L7IL 4R8WL 3NFNB 3TBWB 5HHMB 4OFKA 1U42A 2GUOB 4CU6A 3IFPB 1YNKL 1SEBA 1NUFA 5CP7A 4M6NL 3GBNH 2BVPB 5KBNC 4H25A 4JAMA 5TDNA 2IMMA 2OTUA 3DHMA 1P4LB 4A6YA 5BOZG 1RJLA 1YDPB 3NFPA 2EDHA 1CFTA 1OTUD 3L3OB 5HBBA 1UCTA 2XA8H 2ATPA 4LOUD 2Z91B 4EXKA 1BLNA 3BH8B 1BJ1H 1JHKL 4GAGH 4ZFZB 4GG6A 1MVFA 1P7KA 2JCCF 3UJTL 1B90A 1G9NL 3CLFL 3MLSH 4XH2B 1OTSC 3ECBA 4M8QA 4UNVA 3BH9A 2LAAA 4Y4HD 3ESVF 3MJGX 4ONFH 1CGTA 2WWMD 5ABDE 2A6IB 3HZYA 5EU3A 1XGQA 5KSBE 4PJHB 1CLYH 2P5EA 1KTRL 2ZUQC 4H5SB 4Z77B 3NZ8B 1X5GA 1CFSB 3MOBL 3U7WH 3L3JB 5HDLA 1WC7B 4ENEC 1MFBL 1F4XL 5EZLB 2VUOA 1HZHH 5IB1A 1UACL 3RX7A 5JLZA 1T5XA 2P8LB 4NRZB 2XQYK 5BZDA 2MFNA 4PRDB 1U3JA 4M6MH 3HFML 3DV4A 3O6KH 4HF5L 2FZ3B 1QFWH 3QEGH 3ZSSA 2IAMA 4ZQKB 3BW9A 4KV5F 1K4DB 2AP2A 2A6KB 3SDDB 3O11B 2ADJB 8FABA 3OTTA 1RZKH 1RZ7L 3KYOB 4ONHB 4KMQA 3V52L 2V2XB 4NQDB 2EXYC 1JF6A 1IAII 1X7QB 3TJEL 5E8EA 4WI6A 1A7RH 3VFSA 1IKNA 4C56A 4Q0XL 4YUEL 3I75A 4G8FA 2DTML 4NQSB 4OLYH 2YD3A 3RIFK 5KSUB 5ACLA 5JHDB 2DYPB 3TWCL 2G75A 3OR7B 2ITDA 4NM8H 3OHXA 4HS6A 2W1NA 4ISVA 5ESQB 3C5JB 3SO5A 2YZ1A 1QYGH 1OT2A 1IAOB 4LEXL 4PGCB 4P4RB 5F89A 5GGRY 4I3GA 1X4YA 4FFZL 3UBXB 5DMIL 2EH8H 3LD8C 1NGPH 3D85A 5FYLH 6FABL 1JFQH 4X6EA 3PQYE 3QULA 1NPUA 5DQDL 1I3GL 4YK4C 2O5ZH 2VXVH 5DJ6B 1HHGA 2R29L 3RTQC 4R26H 5LQBL 5EN2B 1MIML 4HAGA 1I3RB 5DK2B 3BRGC 3ARBD 5IB2B 1FLTX 1T2JA 2GTWB 2MNUA 3MCKA 1QEWA 1U8OB 1FORH 5B38B 1U0QA 4PRPD 4D9QD 1FFQA 5A2IH 3QWQB 1CS6A 1N0XH 1NBYB 2EIZA 3H3PH 4PGDB 2DICA 2OL3L 4G6KH 1BVKB 3UJIL 3ARSA 2FGWL 4O00A 5E08H 1U6AH 5D70H 4F7EB 2HH0L 2OSLB 3HB3D 3C6LD 5JOFA 1A4KA 2XQBH 4G8IB 3MUY1 4RISL 3TVMC 5F3BB 4NUGH 1YECH 2I27N 3SDCC 1FSKC 3V2AR 4ZOAA 3FQUB 4J3WA 1EFQA 3ROLA 3TBVB 2XZAL 1JPFA 4H8WL 2DIJA 4BFBD 1G6RA 5C0BE 1CFQA 1F97A 2CMRL 1DUYB 3UCRA 3VH8B 3C60C 3OR6B 1ZTXH 4GRMA 1OW0C 2Y72A 3VW3L 2YPKB 1EGJH 2JB5L 3O4LB 4JFFB 5EFIA 1ROWA 2YBRA 1ZKAA 3QFDB 2CDEB 1DQQB 1HKLL 2BVOB 3EOBB 2VE6A 5DFVD 2Q87A 1AY1H 4PJ5B 1H5BA 1IGIL 1KN2H 3S97C 2X41A 1C8PA 5K59E 4OQTH 3DI3B 4FXKB 4D2NA 3FQTB 1QPXA 2GSIB 5JPNA 4YHZH 3G08B 1GGIH 1CL7I 1MLBA 3MRBA 2NY5C 4R97B 1XFPA 1LE5A 1JNNH 4JO4L 3E6FB 3H8NA 3BQUA 4URTB 3D3VA 3VXNA 1SBSL 4OD2A 2HT3D 4BUGA 3HG1E 4QKXB 3TCLB 1EUTA 1IL1B 3GMQB 2YUWA 1Y18A 4H0IA 1YEHH 1JWUB 1MFCL 5L2KD 1S5HB 1R5WA 3X11B 2NY0B 4PJBF 3T0EE 4ODVL 3OAUL 2JB6A 3PDOB 4NNXA 4HDIB 1NDGB 3T4YA 4POUB 5T1KA 3AU1A 1CGXA 4NRYB 4U6XB 5ENWA 1P84K 5L6YL 1BFVH 2Y25A 5I1LA 3D39D 4OZGF 4DK6A 5IVZB 4Y4KC 1PKQE 4MJ5B 3QDGE 2CRYA 3DXAB 3D1MC 5J11C 4P2OA 1PYWB 3KYKH 4I2XB 3BKMH 4QRPE 4AMKL 5C07D 1UYWH 3CVHB 3QCUL 3S4SG 5IFAL 2VQUA 1S7XA 3VFVA 5HHMD 1PKOA 2DQEH 4Q74A 3VWJB 2CKNA 4NOFA 5EWIL 1MRDH 4JO1L 1DE4A 3KVQA 5DHYB 5LCVL 4HJJL 1GVIA 5IMOA 1TNNA 5FO7A 4Z7VE 3EDKA 2NX5B 4EDWH 2DAVA 4L9LA 4CJ1A 2BRQA 5EU5A 5F6HI 2ZSWB 3QUZB 5DI8B 4AEHL 4NHCL 3I2CH 3WUWG 3T04D 2FX8L 4GG8B 5CEZE 4MNQD 5C0FA 2JJUA 1A6ZB 5D71H 1JWMA 5GXBB 5IJVA 2HFEA 2HN7B 3QXDA 4Y4FB 3V6OE 5C92A 5CBAA 2BNRB 2NY7L 1WT5C 3UROR 2NQCA 4W6WB 1AO7B 4M43L 3ZL4H 4G9DA 1JHTB 3QR2A 4FFYL 4JFDD 3O2WL 5DC0A 2BX5A 2X4OB 2NZ9D 3DX6B 5TE7L 4POZD 5KAQG 3HZVB 3QI9D 5D93B 3E3QE 3RVWC 3U48A 1V7MH 4ZFFA 4O9HL 5I1JL 1T66D 3KHOA 1OAUH 3SN6N 3SCMC 4OKVA 4JRYE 2NY2C 2DWEA 3MX0A 4Z7UE 1A5FH 4X6DF 4R2GB 4YGVB 4JDVB 4ZPTB 1FV1A 5I1DA 1HHJA 4NPYB 3T65A 2DM7A 1FNFA 3SDDD 4CL7A 1XGTB 1MRFL 1JK8A 1Q9LB 2NPLX 4M7LH 4NQDD 4E9LA 5D5MF 3VG0H 1JGEA 1T03H 1MQKL 4JGMA 1ZA3B 4J3VA 3LZFL 3QIBC 4L4VA 1XF3B 2OX5A 3A0OA 4NJ9L 5HHQA 1QBML 3LN4B 5C6TL 1FH5H 3RY4A 1DUZA 1GSMA 5JHDD 2DYPD 5HI5D 5FF6B 1ZGLA 2FRGP 4UV4H 4HS8L 4TUOB 1QVOA 4FQXC 4HWBL 3F5WB 3BD3A 4PGEB 1F4WL 4LHJB 4JG0L 1IGCH 1DQLL 4MJ2A 4F3FB 2PO6C 1A3RL 3KXFB 5J1AB 1CICC 4K07A 4AIZB 5HJ3B 4X9GA 4UAOC 1AIFB 4HWNA 5E00A 1LGVA 1MCOH 1YYML 3GNML 4LLQA 5A43C 4QXTA 1A7OH 3NA4A 4XXCC 4OLVL 1GZQB 3NH7H 4ODUA 3CUPB 5JQHC 1I1CA 3E8UH 4ZFOB 3BIAX 2HKHL 5FYKU 5DEZA 4M5ZL 3FFDB 5HYSA 2NY3C 3BN3B 1ED3B 2FWOB 3QUXB 4OUUB 3LQAH 2C9AA 4PJFB 5B39B 3S96B 3B9VA 3DETD 2VIRA 4AEIL 4WI2A 2QSCH 3QT2A 3HR6A 1OCWL 1X6LA 3BYYA 2A9MH 3FN3A 1NGWA 4HXAL 4OD3L 5KZCB 1Q9WB 5BZWA 4QF1B 2Q76A 1R0AL 4R4NC 5D8JH 3CXDL 5ESVB 5KN5B 5MHSE 4QT5B 2W9DL 4LPVA 2HFFB 1ZVSB 2R1WA 1MCWM 2A77L 1UGNA 5CJXC 5E5UB 4FP8L 3FB8A 4YHPA 5HDQH 1R5VB 4PREA 5JPMA 2K9UA 2CKBH 4XXDB 3IDJB 1N5AB 1ZXQA 5KANI 4WO4C 2VISA 4HUUA 4JFFD 4G43A 5E9DE 5TDOB 4NUJB 3N85L 2VDPH 1MI5A 3PWLA 4LRNL 4PGBB 1I8KB 4PJ5D 5L9DH 2LVCA 3AC0A 3HC4H 2BCKA 3DYPA 4OZFB 3TPUB 5SWQB 3G6JF 3RTQA 5KVMC 4DOHB 3S3JA 5GGVY 4IIQC 1CBVL 1WAAE 1FNSH 1NUDA 4PBWD 1U8PA 5L88L 5C2BH 5DVNA 1CD1A 3BGMB 4OV5B 4OGAC 1J1XL 5CZVL 1JRHI 1FE8L 5J6GB 1MCBA 3L3GA 5CD5D 3KPMB 3MGAA 5CP3H 4CNIB 1VESA 2PXYB 5IF0B 1CT8B 4RAVB 2NY0D 3TVMA 4UMGA 4Z7UF 4MAUH 3MOAL 2LFGA 4L1DA 1RURH 3EYVB 5F9OL 1FAIH 1N64H 4AENB 2H6PA 1CE1H 4YHOH 4HG4K 1KIRB 5IW1B 1H3XA 4TVPD 3T1WA 3C60A 3K0WA 1I9EA 4X6CA 1OW0A 1FNGB 3GM0A 5B4MD 1UM4H 4AM0A 4C83B 3H0TA 3DXAD 1IE5A 1GOFA 4GH7B 2J4WL 2ZCLH 1S3KL 2VDMH 2MMXA 5IMKA 2VLKE 3QJFA 1FRGL 2VB5A 5F7MC 4BZ2H 2Z35B 2VLRB 1YQVH 4KI5E 5FK9B 5KAQF 4P2RE 1H15A 4WHYH 4J6RL 3RL2B 3RL1B 4HUNB 3UTTA 2D4FA 1XZ0A 1F45A 2F19L 4NQTA 3TIDA 1ZHBB 3PWUB 3AB0B 2BNUA 2B0SL 2Q8BH 3MRIB 1A02N 3UJJL 2VDOH 3MJ8A 2FX9H 4QHLA 3GO1H 5DMYA 4YHIB 5DJDB 2XKUA 2H3NB 2DQUH 2NX5D 2VOTA 4EXPX 4MA8H 2R9HC 1YC8A 4GSDH 4JZOA 5AYQA 3QUZD 2GTZB 4LGSB 4QHUB 4RSVA 4AG4L 5IR1A 4QYOA 1UQSB 2JCCA 4YHYB 4R4BA 2XN9E 2VLJA 3OAZH 4DCQB 2JIXA 3C09C 1DDHA 1IQWH 2HWZH 4U1LA 5F8RC 1TZIB 4Y4FD 4ERSH 4LCIL 4MD4B 3VI3F 3VXMA 2BNRD 1JTTA 3BKJL 1AO7D 5DJZB 1S7UB 5DYOB 2VJXA 3REVB 4HIXH 4Y4KA 2AJVH 2PCPA 4F7TB 5LGHL 3C9NA 3CX5J 5IQ9A 3T0EC 4ELMB 3ULUH 2XPGA 5T3XH 4XMLL 1NAMA 2CGRL 3S37X 4HLJA 1KPVB 3DIFA 4XCFL 4R2GD 3W9DA 2D7OA 1PD6A 3OXSB 1P4BH 1WWAX 3QNXA 4TNVF 1RZIB 4X4MA 3ARYA 1NGXB 4FQLL 3IU3B 5EZJB 3TFKC 1HHIB 3O6FC 1KC5L 2Z8WC 5IOPB 4DVRL 3C5SA 4YDKH 1FVDB 4K7PL 5D1QC 5IEKB 2E9WA 1EMTH 4MA7L 4U0QB 2XZCH 4DZ8A 1I1AC 5KVGL 3LIZL 3WDIA 2CUMA 4ZUVB 3QWRA 4DGVL 3CJJA 5BVJA 2CIIB 3P77A 2FL5B 2IANA 1ACZA 5FM8A 4D0CB 3VRLF 2OTPA 4WDIA 4EI6A 5IMLB 5C0AA 3WO4B 5F7WC 3JV4B 4Y16B 5GISH 1VFBB 4QRUB 3KXFD 1WT5A 3IDMA 1CLZL 5IHLB 3EHBC 4GT7A 1OP5K 1QR1B 2GEEA 3FAXA 4NO3B 2HVKB 2FR4B 1OAYL 5BQ7B 1A6VH 2XV6B 2Q7YB 43C9A 5E6IB 2MSPA 4JHAH 5IKCA 1WITA 1BBDH 1UKTA 1NCWH 2KKQA 4PRHB 3SCMA 3J7HA 4KJYA 1OPGH 2Q3AA 4P46B 1MVUA 3KPPA 3TYGH 5D2LF 4C58B 4G9FE 5D6CB 4TTGA 4KFZC 2PW2B 4FG6C 1X5FA 4NNYB 1EEZB 3KJ4C 4A6YL 3VXSA 4IRJB 3E3QC 4J23A 2YD6A 3SKOA 3ALWA 4F37K 1B2WL 2W59A 3EJYD 4E5XB 4G6JH 3MXWL 1LNUA 1N4XL 1NBZB 3F65A 3VDBA 3PNWB 2EYRA 3FT4B 5ILTL 3QIBA 1KXTB 1HHHB 3EOYG 5DJAB 4M7JH 3EDDA 4JDZB 3X12B 1ZT7A 4ZO6A 4ZPVB 2EYSA 3VFMB 2B7DT 3WFEL 2BNQE 3QQ4B 4R7NB 5EPMA 1JNHA 4U6TA 4OLZL 1OF2A 1EO8L 4FQXA 3U9PL 2PR4L 5FYKH 5MEOA 4KRNA 5FOBA 1EFXB 3MGOA 3LEXA 3F8UB 1MHEB 2Z0BA 2FIKB 3S8WA 2PO6A 3PGDA 1CF8L 2PF6A 2UY6A 5TF1L 1LD9B 4LARL 4M1CC 1CICA 4TNVK 3KPOB 4OBRA 3K7UA 4Y1AB 3DGCR 4RMWA 3QIWC 1MCHA 2W60A 3M17A 4OLXL 2X4UA 3SE9L 2X4RA 3ARTA 3PL6C 4GW4B 5C1MB 3KYMA 1H3PL 3CXHJ 4XXCA 1KPRB 2H32H 1FFNA 3KG5A 1ZV5A 3BUTA 1RZFL 5H2BA 5F93C 2JKXA 2X89A 5B3NA 4XCYA 5DO2D 5GJSL 3F7VA 3MRFB 2IQ9H 3MGTB 3GFUA 2IJ0C 4I77L 1UT9A 2R69L 3HTLX 4YXKH 4K7FA 1BBJB 3U0PB 2Q86A 5IFHH 5KSBA 2YWYA 5HGDB 2X7LA 3EOTL 4QNPE 5EH1A 15C8H 3AS2A 3GB7A 2C1PB 1QBLH 3LKRB 4KMLB 1T7VA 5J1SC 3MJ9H 1YEKL 1MNUH 1RJYA 2G9HA 3TH2T 1RZJL 1CGYA 3DUSA 3VGBA 4BFIB 1RZKC 3RBSA 3OKKB 3VFWA 1WIPA 2AXFB 4ODXA 5E8DL 1QRNB 4KQ3L 4L8BB 4XPFH 2V5SA 5CJXA 4H26A 1T1XB 1W2KT 4NHUA 5A2LH 4OZGA 5JR1L 4IMLB 1IM3A 5F1NA 1KG0A 1OT1A 2X1OA 4WO4A 3HNVH 5EOTB 4GQ9H 2AABL 2E9IA 5CGMA 3PHOB 1VHPA 3CD4A 3S35X 5JO5A 1D9KB 2ZCHL 3GSVA 4AEEA 1D5MB 4ZO8A 4P99A 5F3HB 4M3JA 2AJUH 3VFNB 1MFAL 2OP4H 3O2DH 1AR2A 3EOAB 5FB8A 1QNZH 4X98A 5DS8A 4IIQA 1UWXK 2HMID 2JELH 2P8MB 5IIEA 3WNKA 1WZKA 5D2NB 2V9QA 3N1MC 1NLDL 4QRTB 3HE7A 5CIPH 4U1HA 1OAXH 1YY9D 2OLDA 1HIMH 1S78D 4X4XB 4MD0A 5IT2H 4X8JB 1BD2A 3PQYA 3ARRA 3OWEA 1Z3GH 3AMKA 1BVLB 2OS7A 4K3EL 1RSFA 3OKNB 1F3RB 4PJXE 1G6RL 2V7HA 3MA9L 1WUNT 3HMXH 5IVOA 1I75A 5GGQL 5BJTB 3NBNA 1TTGA 1NEZG 4WGVB 5I17A 3JV5A 1WFOA 1U3HC 4HUXA 1VDGA 2XT1B 3MACH 5E2JA 1MY5A 4FQ1H 2F53B 2AJ3A 1YNTA 3T77A 2A0LD 5DJ0B 4LKXB 4OD1L 2D03L 4LGRB 3ISWA 3M1BB 4KKLC 1FO0A 3QEHB 5CD3A 3HE6C 5F7DA 2CDGA 2N1KA 5C0DA 3U4BH 2IH1B 2J8UB 3BKCL 3L3HB 1A3LH 4YQXL 1I7ZA 3TIEA 3A67L 1T2XA 3OJVC 1CGSL 1NCDL 4KHTL 4D8PA 1IM9B 1MY7A 1K9TA 2P1YA 5HD8D 3ZDYE 4JR9H 1T2QH 5C0ND 4HPYL 2ICEA 3ZYOA 5IHZA 3U2SA 1ES0A 1IKFH 1G9MH 4HPOH 4NZRL 5F1IA 3BRDA 3MRPB 1GZPA 4RFNC 4X5LA 4Z0XB 1WIOA 3D6GA 1GGCH 4KI5C 5HDOA 5DMKB 5DVLA 2OQJB 1IFHL 3RVTC 3LSOA 4P2QB 1HQRB 4ZUTB 2JJSC 3OKMB 5HGHB 4OZIE 1IC5L 4QWWC 2MQCA 4RMQA 1ZWIA 3KHQA 5DEGA 1FVEB 1U95A 3HG1A 4NN5B 1XIWC 4Y16D 3V4VL 5I1CL 3A6BH 3IXTA 4OAWB 4C4KT 5C3TA 1BZ7A 4JFHD 1RUML 3RWCA 3ULSA 1DVFB 4DN4L 3V79C 3I85A 2NY6B 3OGOE 2F74B 5F8QC 3T0EA 1LO0L 4XPGL 2FHFA 1BFOB 1L6ZA 2VAAB 2IC2A 1LDPH 4CVZB 4PRHD 4XWGL 2YC1B 2BSRA 3QIUC 4P46D 5EORH 4GAFB 12E8H 1I1FA 3MLRL 3R1GL 4RFEA 4TQEL 3OPZH 5J12B 2BSSB 3SE4A 1KUMA 5M7QA 3MA7A 1HINL 1IGTB 4KQ4H 4IRJD 1FFRA 4ZUSA 4KH2A 1PKQA 2MCPH 5KJRH 2X1XR 3O6FA 3ZKNC 1UVQA 2BERA 2LQRA 5CJOH 1A9EB 4UTAL 5D1QA 1RVFH 2IBBA 1CU4H 1JV5A 3O9WC 3QXWA 2N4IA 4PY8I 4QRPA 2EC9T 1XR8A 1I1AA 2EKSB 1LK2A 5K33A 3O4LE 4LLUA 4PRBA 5F7KC 3GHEH 5LG1A 1C16B 5MP6L 3L7EB 4MNGE 2R23A 5E8OA 4JKKA 3OKEB 3IAPA 3VFOB 1ZSDA 4OM0L 3BGFC 1IMHC 4R3SB 1MQ8A 1X6NA 4Y1AD 3K74B 1I7TB 1GGBL 2AJSL 3B5TA 4O2CB 4O51B 4WENB 4QRRE 3NACL 4J4PD 1C1EH 2I9LA 3PGCB 4U3XA 4LHUD 4LPCA 5E2VH 4CGTA 1VFAB 2ICES 3VI4F 1G7HA 1WTLA 2Q1EA 5JORB 3LKQB 3FFCB 1I9RH 3U36B 2WLYA 3CPLB 4KPHL 1ZHLB 3H42L 1EERB 4YHLL 5HI4C 4MVBD 4Z7QE 3L3KB 5J9PB 3U46B 2FO1A 3BEWB 4HWZB 3NN8A 4Q9RL 3OZ9L 4RIRB 3D9AL 1P5UA 3HMWL 5MEPB 1UXWB 2NLJA 2B2XL 4Z7UA 5GGTA 5DURD 3VFUB 4LLVB 2YHGA 4HLZH 4L4JA 4OV6F 4TSAH 4ZAKC 3DOSA 1XT5A 4I3RL 1QRND 2ED7A 3BPLB 4X4YA 2FJFA 4LSRL 4N1EA 2ICWA 4XB8A 5HYEA 4NO5A 5GPRA 2DQCH 3QO1B 1KT2B 4DEPB 5DF0A 4N8VG 1WZ1H 4WTWA 1DBMH 3KPQA 2NY1B 4RMVA 1B0WA 4K94L 2VUYA 3WKNA 1NBVH 1C5DB 3KWWA 1BEYH 5CJQH 3C6SB 3V8CA 5IK3A 5KG9B 1G7QB 3PE9A 1D9KD 1NANH 4FFVD 3WXWL 1KOAA 3KLDA 5B3JE 4PFEA 3BP7A 3PL6A 2DM4A 3P3YA 1TVBB 3EYOA 3CLEL 5C08B 1XR9B 1JPTL 2O5YH 3G6DH 1NMBH 1BFSA 3IFLH 2XY1A 1NBQA 3ULUF 3LQZB 4XNYH 4OI8A 4P49A 3GJFA 4ODWB 3WFCH 4XMPL 1QHOA 4PJCF 3S37H 1MJUH 4HJGA 4ZS6D 1Q9OB 2R2BA 4F9PC 5DJ2A 3VXRE 1QBAA 3U82B 2X4TA 5IBLC 4JPKH 4PRAA 1PSKL 4LGPB 4XNXL 2DDQL 2Y5EA 2AXGA 1UM5L 3GEWB 3GMOB 4HIEB 3HCVB 4RCAA 3PF2A 3W0WE 1NKRA 1JTPA 1U8KA 1NFIB 3ULVH 3LS5L 3MMEA 4N0YL 4QXGH 1S7SB 1HOCB 1RK1B 1TITA 3FMGL 4GAYA 5FA3B 2ZWLT 1TCRB 3HR5B 4X80H 2O5XL 2CRIA 5D9SB 3TO2B 3FO2A 1J1PH 2LU7A 3P4MA 4FQCH 3O3DB 5ISZA 1HILB 4OT1L 5FKAA 2QKIA 4JHBA 4S1SH 3VA2C 2XKSA 1T1ZB 2BJMH 2ERJB 1BGXL 4NQCD 1NSNH 5ICYA 1ZLVH 3RI5F 2C7UB 5J57B 1K6QH 1F4YL 3VXOB 2VDQH 1MHPL 3GI9L 4R7DB 5GRVL 3K4DA 3QDMA 1MHHA 5E9DA 1E27A 4EUPH 5MERB 3S34L 3SDYH 2J88L 5FFLA 1VKXA 1DBBH 5EBWA 1KJ2L 4NP4L 3EYUH 1SEBB 5CP7B 2WK2A 4H25B 2GW5A 5TDNB 5C0CD 2OTUB 4P2QD 4A6YB 5I6XC 2CLRA 2OTWA 2HT2C 3OMZA 4GQPH 4JREC 1RJLB 3NFPB 1CFTB 1OD7A 1CI5A 3X14A 3K3QA 5AD0A 5CGYD 2ATPB 1BLNB 1U3HA 1I1YA 1QFOA 4GG6B 1P7KB 1EHLL 3BVNA 3MFFA 2R0WH 3IVKA 4M8QB 3ECBB 2J5LB 1RIVL 1CLCA 5D1XD 2NXZB 3BH9B 4S0TD 1KTDA 5IB3B 1DVFD 1FZMA 3TP4A 2NY6D 3DO3A 3BFOA 3FONA 5EU3B 1AC0A 3HE6A 5MI0C 2WUBH 5FM5M 2P5EB 3MLXH 5I1GL 1XGYH 5D2LA 2LV4A 2NMSA 3H7BA 4OSUL 3HZMA 4LVOB 4RWHA 5IB1B 2BRRH 5JLZB 3AS1A 4OQTA 1T5XB 4D9RE 3GBLA 5BZDB 3JWDC 2D4DA 3EYQC 5DD5L 2DQGH 1IVLA 1OARL 5T33L 5GIRB 1QA9B 3DV4B 5F7YC 5KVEL 1YYLL 2IAMB 1SJVA 3CK0L 3BW9B 3CFBB 2W9EL 3NZHL 3DI2B 2VLKA 8FABB 3SDXF 3TV3L 4IOFC 4QXWA 3ARDD 4Z6AT 3LDBC 1NFDB 1OAQH 1NCBH 3DYMA 5E8EB 3VG9C 2JJSA 4KK8D 1BOYA 3VFSB 4C56B 4JM2F 3I75B 3Q5YA 3EO9L 4G8FB 5F72S 3E0GA 3T09A 1NLBL 3MO1A 5DA0B 2J2ZA 4MCYB 4FQJL 1NAML 2FLRT 2ITDB 1LO2H 5EBGA 5CEXA 5FUZL 1NMCC 3TT3L 1A7NL 1I9JL 4ISVB 2EDOA 1R3HA 1WBZA 5LWYH 3QRGH 3PP3H 4YHKL 3U0TA 5FECA 2XN9A 1B6UA 5F89B 1T20A 3V5KA 1D7FA 4NCDA 5HY9A 3NOIA 3QIUA 1QOKA 3D85B 3ULUC 1EHAA 3FFCD 4X6EB 2VZOA 2P45B 1QKZH 4HBQA 2KZWA 1HHGB 2FEDD 1PAMA 3S35H 3I02A 5GRWA 3RY5A 5CZXC 1XGRA 2AEIT 1QEWB 3S36X 4MXVE 2H9GB 3BO8A 2VITA 4YDJB 5IQ7L 2DLFL 2VKXA 2VR9A 4NC0B 4N9OB 3ABZA 4HBCL 1HN1A 4JB9H 2E6QA 3B9DA 1GGTA 4V1DE 3WNPA 4HLZG 3BX7C 1K3ZA 4LSUH 4P59H 4WU5A 5JOFB 1A4KB 1J1OL 3VU2A 3T2PA 1QBBA 1KIQA 2FB4L 2OI9C 2IF7A 3B9EA 2VLRE 3T8XA 4HK3J 4OCSH 4XX1E 5DK0A 2X4NA 1A47A 1NMAL 3ROLB 2YS4A 1JPFB 2Y36L 3SY0A 2VXUH 1G6RB 3UTSA 1CFQB 2WANA 4Z76A 4GRMB 5JUEH 2RFXA 1UM6L 3M8OH 3NAAL 5DFWH 3HC3H 4BSJA 5EFIB 5FYJE 4X5XA 2YBRB 2VXQL 5C08D 3FO9A 2VE6B 4L8CA 1H5BB 4YXHL 5B8CC 4BELD 4DKFL 4M7LT 4QOKE 5JPNB 4PRIA 4LF3A 1MLBB 3QCVH 4XB7A 1LE5B 3CSPA 2COQA 2UWEE 3AFLA 2XTJB 3BI9X 3BQUB 3VXNB 3D3VB 4KZDH 4OD2B 1MELA 5HI3D 2HAZA 4NNPL 5LGKA 4MAYC 1Y18B 5FDWB 5EULV 4NN7C 4DKEH 4ELKA 1R5WB 3EBAA 4OQ1A 4PB0H 1W72H 2EDJA 3FRPA 2JB6B 1MCPL 2X4QA 5FGSA 3Q2CA 1J0ZA 4NNXB