2CGRH

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 34
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH02
1EMTH 1HCVA 1Q9KA 4OD1L 2BSRB 3LKQB 3R1GH 1OM3L 5EOTA 1CTNA 4MCYA 5HJ3B 3GUTB 5KJRH 4Z18A 4P9HL 1T7VA 1HIMH 3PL6B 2HKHL 1GGIL 1UWEL 3VDCA 4EEEA 4KK9D 4U0RB 1JV5A 3GZKA 1DLHA 5ADOL 3GB7A 1I9IL 4RISH 5IQ9A 1T66D 4RAVB 4OT1H 1JUFB 3KPRD 1BJ8A 1LEIB 1OTUC 1KCVH 1T21A 2HJLA 3TH2T 5ITFA 4QTIH 3BAEH 3SCMA 1OGAB 4TTDC 5EO0A 3WJLC 3VXRA 1DQJB 3RVVC 2B2XL 4AIZB 1X4YA 4DGIL 2G5BB 4PB0H 3LS5L 1CDGA 1XF3A 5DT1H 4R97B 1KN4L 3OKDB 1F11B 1YPZE 1QKZL 5GRVK 5C7XL 1M71A 3UTSE 1YNLH 3B9AA 3H7LA 3MNWB 4RDQG 3CZFA 5IK3A 3ROLA 3JV5A 5FK9A 1AKJD 1LO3H 5HVHB 3RAJL 2V17L 4HKZA 2WUCH 1FFQA 2NXYD 2Y06L 1UB5B 2ZUYA 4R2GB 1G7HA 3HC3L 5HI4D 2MSPA 4N9OB 3E6HA 43C9A 1L6ZA 2B8OT 3LV3B 3BESR 1OP5K 4K2UH 1RK0A 4JHWL 3MUHL 5FUZH 3VGDA 2AJYH 2EEDA 2X6MA 2VDRH 4G9DB 5CEYA 5HYQB 2ARJB 1IL1B 3BFOA 1KLUB 3FT3A 4JM2C 5BV7C 3QDMA 5H8DA 5D72L 3FO9B 2EDQA 1HI6A 2ZCKH 5DJAB 4QRSA 5C6WH 5B3JE 3RUGB 5C0AA 4R90L 1GCFA 4MCZA 5SWZE 5BOPA 3LRSB 3CDGB 8FABB 5HGAB 2OK0L 3ARFC 4NKDA 3SCMD 2HTLC 3BWAB 3RX5A 1DVFC 3VXRD 1TCRB 1KELH 4J3SA 1RIUL 3Q0HA 5CJOL 4B50A 3PGFL 4GRLB 2NY6D 3QDAA 4S0TD 1NDMB 3CD4A 3MJ9L 2X4PB 4XT1C 1X4ZA 4O5LH 1S78D 5H2BA 5DD6A 5ANMA 1RZJH 5GGSB 4D0BB 3OPZL 3PABB 1CFNB 2EC9T 2D0FA 5ICXB 4E42B 4AEFA 2WNGA 3EUUA 4L3EA 5F7FA 3UTTA 1VESA 1MCDA 1I1FA 3QWOB 3RZWA 4S1RL 3IJSA 2VQUA 1A8JH 1JGDA 3REVB 1K9TA 1A4KB 1Q1JL 4UDUA 4TSCH 4JN1L 2I07A 2NW3B 1XF4A 3W0WE 4YO0B 3CFJB 4YHML 4X6FB 1AR1C 4U1SB 4PJBE 2VLKE 2HWZH 1KENL 5CD3A 3BN3B 4G8EA 3BZ4B 3EYSH 3IB4A 3QDMD 3IKCA 1FNSH 2Q3ZA 3KR3L 2AP2A 5HI5C 4DZBA 5I73B 2HT2D 1FGVH 3K4DA 1DDHA 3V4VH 5IIEB 2UYLB 4P4KB 1FRGH 3HAEB 4Y4FA 5E08L 4A2MA 3TO2A 1JGVH 4NQSA 5HHMB 4X4YA 5C0AD 1L0YA 1S3KL 2XWBA 4LSVH 4HIIB 4M3JA 1AI1L 4Y1AE 2FX9H 3VDAA 4D9RD 4LSSL 4R6UA 5D5MA 5INDA 5CEXB 2D4FA 2NY7H 3N50A 2CD0A 2H32A 5D7IE 1MAML 5IBUB 4JG0L 1KEGH 3ES6B 3MUY1 1J86A 1GOGA 3ZL4H 4KI5E 5L8KB 4FFVC 3GMOB 1DQDL 3B9DA 1N0XH 3BP5B 4F37F 1FBIH 5I1DA 1XAUA 4L3ED 1ND0A 3UTTD 1KJ2B 3FQRB 4N9GB 5FGCE 1HXMB 4QCIA 3SDDC 1U3JA 4OI8A 1LEGB 2C1OA 5HHVH 2BRRL 4MXVE 2OYPA 2BJMH 3HUJF 2VZSA 4KI5C 2HFGH 3MROA 3U48A 4R0LA 3FO0L 4UAOC 2DRUA 2ID5A 2JJSC 4DGVL 1G7JA 2H6PB 1WC7B 3CGTA 3RNQA 2BVQA 3Q5OA 4JDZB 2G75A 4QHNA 1YMMA 4LVHB 1LNUB 2HG5A 1KTDB 1IVLA 4KVCH 5FYJL 3MLYH 4Y4FD 3UTQB 5KSBE 4WWKC 1AGDB 2Y36L 1H3PL 3O4LE 1OWWA 2D7OA 2CMRH 3SJVB 1KEML 5IVXA 3RWEB 4RWHA 4GBXC 3M1BB 4O02L 2EICA 2ENYA 4YBQC 1SJXA 1BIHA 3VFTB 3UJIL 4RZCB 5HGGS 2J12B 1ZLUH 2RQ8A 3LH2L 5K9OB 3ARGB 3GSWA 4N8CL 1SBBA 2WBWB 3BQUA 5FF6B 4DGYH 1NGWB 4BFGA 3ME0A 4JANB 2EYRB 2BX5A 4GRWE 3WJJC 1YDPA 4PRNA 3QIUA 4JPVL 5IB1A 1ZEAH 1OAXL 4DAGL 4PLJD 3VXQB 4XHQA 2MKWA 5ESAA 5CUSH 4NSKA 1TJIH 4FFYL 5CSBA 1EHNA 3S6CA 2BVPB 5C07E 4GFTB 3SKNB 3ARDB 5T3XL 5MEPA 4UTBH 2MQCA 2R2BB 2N1KA 3STZA 4R3SB 4LIQL 4F58H 2HVJA 4ORZC 1JTTA 2W91A 2NY2B 3M8OL 4KKBD 5ICYB 1NCNA 4HBCH 5ENWB 3KYKH 4S1SH 5DO2C 5I8OH 3STBA 2GITB 3QJFA 3ET9F 1WICA 2Y6SD 3BEVA 1WT5A 4H88H 1YMMD 5EFIA 2O61A 4YEEA 5IFHL 2NZ9D 2VZ1A 4TRPL 3U0WH 1JN6B 4GAGL 4HUNB 3PWVA 1UYWL 5E5RB 4LCCA 4U7MA 1HQRB 3UDWA 4JO1L 1JWSB 1VENA 1O0VA 4KUCD 4M61B 3RJQB 1UZ6F 1OPGH 4JVUA 5J89A 5CILH 4X7FC 1LE9B 2JELL 2FJHB 3H9SB 3UPAA 1MI5A 1QQDB 4X7CC 1A9EB 1R3IH 3IU3B 4PJHF 1BZ7A 4ELMF 1FH5L 5DD1H 3BQUD 1NGQL 3LRGA 1AHWC 4HPYH 1U8QB 4Y4KB 1JF1B 1FC2D 3JWOC 5T3ZD 4H20H 2FO1A 4KTEL 4Z95L 3P0VH 4NWUL 2FEDC 2X1XR 3RTQC 4JG1H 2AV1A 3G6JF 2I26N 1MCRA 2LTQC 5CBEA 3QIUD 2ZSVB 2DQHL 5CJ8A 1U8HB 3QG6A 3LHPH 3MSPA 4KFZC 5DGRA 1MIML 4MA7L 2FJFA 5CP3H 4F57L 2DKSA 3DX7A 5B21A 5F7UA 5I76A 3QSKB 3WN5B 1G7MB 2RBLA 3SO5A 4ZPVA 3TVMC 1XGTA 3VD3A 4O2EA 5ISZA 2P5WA 2D4DA 2NY3D 3PGCA 3DLQR 5D7LB 4LU5L 5I15L 4I0PC 4QXTB 1DQQA 3NIGF 5DSCA 5CEZD 4J6RL 1SM3H 4KQ4L 4X9FA 4M7ZB 4ZS6D 2I9TB 1A7RH 1CGXA 1JMZA 1OL0A 1QRND 2ATPB 2YK1H 2EXYC 4LVEA 5DR5L 5GHWH 3UZQA 1MPAH 4Z7NF 5IV2B 3PIQA 3TC9A 3S3JA 4GW1A 1P9MC 4JZJB 2YMXL 4W4OC 3CMGA 5DMGD 5IFJA 1EK3A 3JV0A 1MIEH 3N1FC 3NCJH 4HIJB 2CXGA 2QQKH 1JJUA 2C4FU 1MI5D 4K3DL 4PJ8C 5DRZA 3VJ6A 3R4DA 4WFHE 3ILQC 3BO8B 4HK3J 2J4WL 1TJGL 4KAQL 2H2SC 4WHYH 1T1YA 5MERA 3SKUD 1UXWB 3WNKA 4I8DA 2PTVA 4NQEE 2BNUA 4NZRL 1CXIA 3WFDL 4ETYA 3N1QC 3HNSH 4H8WC 3PWUA 4YAQA 1WZ1H 2XY1A 1A6PA 1LGVA 2IMNA 1MCEA 1EJOL 6FABH 4ZXBA 2GUOB 2DLTA 3GI9L 4FFWC 3LDBB 4NQCB 4XI5C 3C5ZC 4HWUA 4KMTH 4H8WL 2VO5A 2AJXH 2GSGA 3L7EA 3K8KA 1WCQA 4F7MB 2BVEA 3DIFB 3VRJA 5J11B 1HYSC 1QFWL 4Z78B 3MRCA 4OKDA 4QGYA 3LMJH 4URTB 5ISZD 2P5WD 4HEPG 3T3PF 1ERNA 4IIQC 3SKOB 3STLB 1U3HC 5CIPA 3MRGB 3HZMB 1MHHB 1IKNA 3ETBF 3W82A 5E9DE 5T1LA 1JFQL 5EOCJ 3O2DH 2H2PD 1BVKA 3T4YA 4BM7A 1A5FL 1IGFH 5JZ7C 1ZV5A 4UTAL 5HVFB 4ZUSA 5GGRB 2J8OA 1KLFA 2JJTC 2XG4A 4P9MH 5F7LB 4NM4H 4XMLH 2XWJB 2O93L 5D6DC 3VXSA 2VDOL 2XA8L 2ZUQC 2EZ0C 2YC1B 4OGXL 1JF6A 2DJ4A 3QPXH 4MNGE 5DUML 2HTKD 4TOYL 2ZUTA 3LEVL 3QIWA 1T1ZB 4HWBH 4I0CC 3QNXB 1J12A 2OP4H 1PX3A 5FB8B 1G9MH 4KK6C 2G2RA 5C8JA 5TF0A 5GRUL 1T2XA 1ODAA 4JPKH 5D2LE 1MJ7H 5CZVL 2X9XA 1MCHA 2B1HL 3L3HA 4IOIB 1XIWA 1VSCA 2XFXA 5AD0B 4OB5L 3T04D 1HHHA 1PLGH 4ZXBD 5MENA 2E7CA 5L0QC 5CWSB 4FQXC 1IGCL 3EYVA 1G9NC 1N8ZB 4PGBB 3PNWA 3OJMB 5FDWB 4MXQC 1MAKA 2PR4L 4XBGB 1CDJA 5F96H 3FMGH 3PF2A 2AV7B 3ZT6A 4G80B 1A2YA 3E3QC 3FO1B 4BYHA 1JMXA 2CLVA 4XPTL 3B3IB 4YH6A 4G6KL 4K55A 4GQ9L 2PO6B 2Y9RT 4PRHA 4C83B 4ZFGH 2CSPA 1A7QH 1MAJA 1INEH 2X70A 3FRPG 2W9EL 5JTWA 5T1LD 4R7NB 3TIEB 4IOFD 4YGVB 5IBLD 3G08A 4NUGH 2CRYA 4I2XE 4P2QB 1ZT1B 5JW4R 5BRZB 3MRBB 1MCOH 4JY5H 3CUPA 1GOHA 3T2OA 1P4IL 2A38A 3WS6A 1X5YA 3V6FA 4D8PA 5FUOH 4KRPC 1A21A 3EFFA 3VXSD 3LQMA 4U6HA 4NNXB 5JNYB 3Q3GA 3VU2A 2B39A 4V2BA 1N6QL 5I19H 1VGKA 3QRGL 3UXFA 4ZFZB 5KSAC 4OKVA 3QIWD 1AQKL 2NY1B 3CH8A 3EYUL 5KOVC 2CDGB 2SEBA 1DTUA 2YBRB 3A6BH 4JFDA 1S7SB 1EH9A 1VACA 5F7NC 4TUOB 2A6KB 1XIWD 2E27L 2JK5B 2XTJD 2JJVA 5MEND 2NTSP 1OQOA 1Y6MR 3HE7B 4Z7WE 5HHOB 4FXKA 3KYOB 4FQJL 3D85D 1YJDL 3LD8B 3C60A 2R1YB 2VXSL 2C3HA 2E9IA 1DL7H 1HZHL 3GNML 3LQAH 4X8XA 5JPNA 3KJ6L 4HKJA 4Z76A 2EDBA 4OM1H 4UZGA 1TITA 4CVZA 2JB6A 1P2CA 5E8OA 1ZHLA 5C0GB 1RURL 1XF1A 4PRHD 4EI5B 3BKJH 2L4OA 1UQSA 4G42B 5HYSA 3BZEA 1HH6B 2HFTA 3Q6GL 1MJUH 2WINA 4JFPB 3O2WH 4JY4B 3QG7L 2K7PA 2V5YA 4FQHB 4X6DB 1OQXA 3ZTJG 4LMQE 4JKMA 3OKLA 1ONQB 4NRZA 3IDJB 1MQ8A 4X8JA 5T1KA 2OCFD 4KZDL 4RWYH 1E6OH 5HGDB 4CJ1A 1BF8A 4ONGH 1SEQL 3LB6D 3MNZA 4KWUA 1MH5A 3KHOA 3RY4A 4N0RA 4MD5A 5E2TH 3WJLA 4PYGA 3BYTA 3MCG1 4APQC 3V6BR 3BKCL 3KPRB 1LILA 3MXWH 4RNRA 2VZTA 5I1AB 2HFFB 2BVOA 3MLXH 5GJSL 4G6AC 1NBYB 1BM3L 4GO6B 4JFDD 3MRFA 4H1LG 4WRLA 1KBGL 5GS0D 1KOAA 3WS3A 3EOTH 3GBML 4BZ1L 2Z8VC 4NNYB 2XXMB 4FZ8H 4UOW0 4JPWL 5C2BL 2MMXA 4CN6A 2Z92A 2B5IB 3C60D 2EDJA 1AKJB 2BC4B 3S97C 2XWTA 1R24A 3NFNB 2YA1A 2NXYB 1YPZA 5C0EA 1DSFH 1KCRH 1KC5H 4XVJH 1JZ4A 5BMFL 2UVFA 4LDLB 3UTSA 1FVDB 1UWXK 2EDLA 1G0DA 4HS8L 4PJFF 3S7GA 3ZDYE 3MBEB 1I85C 1G7PB 1HWGB 1I8KB 1T1XB 5F6HJ 3W2DL 5DI8B 1NKRA 2ZJSH 3AS2A 4KK8C 3P11L 2Q20A 4JM2A 2P45B 5I8EB 2BK8A 5DRXB 2FLRT 4S10A 2P1YA 3V5HB 4XNUL 1DQLH 3MMEA 1Q9KB 4KPHH 5EOTB 4PJDF 1NL0H 4MCYB 3WUWG 4KKAC 4O4YH 2B4CH 5JW3H 4X6EA 1RZ8A 1BP3B 2VRAA 5T1KD 1MUJB 4QT5B 3JWDH 4Q2ZA 2R0KL 4QHKI 3SDCC 1OTUD 3VWKC 5HYJB 1CD8A 3ARFA 1JV5B 4IHOA 2BOCA 1DLHB 3GB7B 4RGNE 5EZIH 2I5YH 1DVFA 2A6JA 2XRAL 3RVVD 4WTWA 4OIIL 1K6QH 3L5XL 1T21B 4XP5L 3TJHC 2HJLB 5ITFB 1ZVSA 4WFGE 4YZFE 3SCMB 2FHFA 1MY5A 1RK1A 5EO0B 2FATH 5I17A 5DMIL 2XTLA 4YDLC 5FYKU 5SWZA 1NFDE 2UUDH 3DRTB 3PWPE 4NWTL 3V8CA 2R2EA 1QACA 2NY6B 1F58H 4TSAH 2F5BL 3BT2L 1M71B 4XNQA 1Y18B 2R8SH 1A02N 3CZFB 5IK3B 3ROLB 4PJAF 3RFZC 5FK9B 3VXNA 3OG4B 3UO1L 1W0YT 2DTSA 2W92A 4HKZB 3IT8D 3SE8L 15C8L 2JLLA 4R96A 2R1WA 5DFVC 3E6HB 4CU6A 43C9B 3UTSD 4PBVC 1BAFH 3OAZH 1CICC 3NGBB 4PB9H 1JNLH 1D7FA 3JV6A 1FIEA 1RK0B 4KGLA 5BZDA 1Q0XH 2VDNH 4HX1A 5K9QG 1U8OA 4JM2D 1UH2A 1MVUA 5CEYB 4HUUA 2NW2A 5IESH 2CJUH 4ZUUA 5CP7B 5I9QB 4FABH 3FT3B 5JHLH 5IP4A 3RBGA 5IMLA 4OTXH 3QDMB 4FOMA 2VXQL 2C9AA 3K80A 1EEUA 1AXTL 1LO0H 3ARTA 3MYJA 1HI6B 1QYGL 4PJBA 1REIA 2KH2B 4QRSB 3ARFD 1PYWB 1FZMA 1P5VA 4LCWE 5C0AB 1MJ8L 2HTLD 2EDDA 3IDIA 4MCZB 1VADA 1WF5A 1DVFD 1I3GL 5L2KE 5TDPA 5LJYH 3VXME 1C5DA 4RMSA 5SX5H 2VZ3A 3BDYH 3MC0A 2ATKA 4M48L 3TBWA 1CE6A 2A0LC 1F6LL 1I9JL 3BGFB 5SWZD 3BHBA 1C5BH 4PJIF 3QXDA 1X5LA 4Y1AA 5EOQL 3ULVH 1B0WA 3HI6H 2V5RA 4RGOL 2AJVL 4PS4H 2YPLE 1TNMA 4OLWH 3SOBH 4PRIE 4E41A 5AZ2L 5E8DH 5D7IA 5H2BB 1SBSH 5ANMB 2GW5A 3SDDA 5I1EH 2CDFA 3G6DH 3T09A 5AG8A 3I6GA 2FSEA 5KVGH 4L3EB 4K7PY 4OZGA 5FXCH 3UTTB 3GIZL 1I1FB 3IJSB 3U7WL 3VXUA 4A6YL 2GJJA 4UDUB 2DI9A 4UOW1 2JJSA 3W9DB 2I07B 4I3GA 1FO0H 1XF4B 1LP9E 3KPQA 4NO2B 2CKBL 3ARQA 2R4RH 3IDNA 3DV6B 2MWCA 2NXZB 1JE6A 4UU9A 5HI5D 3QNYB 1WFOA 1ZANL 3Q5YA 5D1QC 5CD3B 1YEGH 5I1GH 1NAKL 2D0GA 3P73B 4Y88A 3IKCB 5GGTH 2HRPH 4UT7L 4WWKA 4XXCC 4DZBB 4EUPH 1UJ3C 1DDHB 1MFBL 1HHKA 2C7UA 3KHQA 4Y4FB 5LVEA 4LLYA 3TO2B 1NUFA 2CUHA 4NQSB 5F7MC 4X4YB 1TTFA 2XWBB 1F4WH 5F7EL 1F13A 5IB4A 5JMOC 5GGVL 2PYEE 1G6RA 4F7EA 1YECL 1WCBA 2OZ4H 4M43H 1A3LH 5DD3L 4FHBD 2QQNH 5D5MB 5DK0A 5KSBA 4UV4H 1QTYT 2QSTA 3T8XA 2H32B 1V7ML 3WJJA 4FFVD 5IVZA 5DHVH 4U49A 4TVPH 4UINL 3OKYA 1MLBA 2VLJD 4E41D 4ZFOA 1IFHH 3SDDD 4K9EC 1U93A 1QFWM 2NLJA 1ND0B 3GBLA 4NFCA 4KI5D 1I1RA 1QNZL 1NPUA 4QCIB 5C0BA 3VXUD 3FN0L 5ELIA 2GFBA 1EEZA 4DTGL 2C1OB 1D9KC 1FYHB 3BUYA 2R1XA 3GGWA 3MROB 4R0LB 1WZLA 1OP5H 3KPMA 3BXNA 2EH7L 1X5IA 5I0DA 5BCAA 1G7JB 4JB9H 2V2TA 1CFVH 1IT9H 4KJPC 2BVQB 4LCIL 1QSEE 4XB8A 4WWKD 1DUYA 3DX8A 2G75B 4QHNB 1BQHA 1MCJA 2ADIA 4BQCA 3WXWH 2HG5B 3CU7A 4GBXD 3LAFA 4YBQD 4WFFD 5IB3A 3ALWA 3HB3C 4JFXA 5IVXB 1J88A 1CU4L 1AHWA 4XVTL 3QAZC 3GSNH 1ZGLA 4D0CA 3MLRL 1O7VA 3GSWB 3RTQA 4GKNA 3UAJC 3BQUB 3P4NA 4CRPA 1S5HA 4F15B 2HT3C 2GSIB 1XF5B 4S2SA 1YDPB 4PRNB 1LD9A 3QIUB 3QDJE 5IB1B 2QJDA 1A6WL 4GXUN 4NZUL 4R26L 1OCWL 3GMPB 5ESAB 4NSKB 4P23C 4GW4A 4JRYA 5GS2H 5J9PA 5C0BD 3TVMA 1QZ1A 2R2CA 5DJ2B 3OKOA 1OAQL 5J56B 1HINH 2PUQT 3K46A 5FHAH 5MEPB 4K7FA 5ITBH 5DO2D 3STZB 4I0PA 4P2OC 3VGAB 1CS6A 2EE2A 2HVJB 3SY0A 1BZQK 3VA6A 2NY3B 1BEYH 5HGBA 2JCCE 4YNYA 4GOSA 1KTLA 1XGRA 4ODVH 3QJFB 2H9GA 4XH2A 3HZYA 2DMBA 1P9MA 3ZT5A 2CR6A 4N0YH 4W4OA 1EFXA 5EFIB 2O61B 4YXKH 1JI1A 1PEZA 2YUXA 3VFOA 3PWVB 1R0AL 3UTPE 1WEJH 3BP6A 4LCCB 4XWOC 2ICWI 4PJ8A 1UM5L 3HPLA 5FYLL 3MV11 1MI5B 5JUEL 1JNHA 2FEDD 1BZ7B 4KVNH 3CLEH 3MGTA 2BSTA 3RTQD 3ZYIA 1IBGL 2DQIL 1CGUA 9CGTA 4WTZG 3MRDA 1BPVA 2ADJB 2CUIA 4N0UA 4B7IA 4EZMA 5CBEB 5L6YL 3S36X 4WI9A 1C7TA 1X5FA 5A2IH 3C5ZA 3QG6B 5D7SL 3BH8A 1CD9B 1E4XI 3AMKA 3G5VA 4JRYD 4NQEA 3WIHH 1MCPL 3DX7B 3TVMD 3V5KB 3NCMA 4HS6A 4R4FH 1ADQL 4OZFH 5E7BA 5I76B 2Q1EA 4PJCE 4IIQA 4U33A 1H3UA 1GYAA 1U3HA 4I0PD 2CKNA 3BRGC 1XGYL 4ZPVB 4OT1L 2CDEA 1XGTB 4O2EB 1KCVL 2CK2A 3THMH 3PGCB 1ZA6A 5EBMA 3QWQB 4L4VA 4D2NA 1F5WA 4OFDA 1RFDL 4MD4B 3X3FH 1DQQB 2EXYD 5DSCB 5K33A 2AGJL 4M6MH 4I77L 2JJTA 2RJMA 2P46B 5CZXC 1EFXD 5CKGA 3OXSA 4RFEA 3R8BB 3S35H 4UI2A 5D6DA 2X4OA 4M93C 3PIQB 4GW1B 3ZE1F 4Z7VA 1YNLL 3VXPA 5LGHL 3AROA 4NYLA 4PJ8D 1U8PA 5IFJB 2DWEB 5ECJE 2XN9E 3MRKA 1GAFH 1A7OH 3VH8G 3ILQD 1MWAH 1UZ8A 1FE8H 4HWEL 2WLZA 2H2SD 4PJ5A 4OCLC 4GMSL 4OFYA 5DLML 5DRZB 3ULUC 3NPSB 4HC1L 4R8WH 3KXFA 1TTGA 1ZLVK 5AAWA 2D7QA 2GJZB 2IQ9L 1JHLH 1T1YB 5MERB 2DL2A 5IROC 2GK0A 3ZHKA 2BNUB 3ULUL 4FQXA 4FFWD 3PWUB 4XI5D 3C5ZD 1OARH 2Z91A 4YAQB 4WW2F 4OLXL 4KJQC 4YXHH 3C08L 3UBXI 4ZXBB 1NCUA 1K3IA 3J8F7 5DZNA 4OM0L 2A9ML 4NQED 1HYSD 4PRAA 1CQYA 3L7EB 1SYVA 3QNZA 4C54A 4OZIE 2O5ZL 4BFBD 4XP6H 3VRJB 2EDHA 2OTUB 1U3HD 3FZUC 3MRCB 4FG6C 4B0MM 4QKXB 2GCYA 1MFAH 4OQ1A 4CMHB 3WFBL 4X6BA 5JZ7D 2J5LB 1U92A 4K94H 4L4VD 1OAUL 1H8SA 5CIPB 2WM0A 1MRFL 1KELL 1A0QL 5T1LB 3RZCC 3VGBA 5EBLA 7FABH 1BVKB 3T4YB 1RZJC 4BUGA 5L8LB 1OAYL 3QHZL 4J8RB 4YQXH 4JGJA 1CT8A 2J88H 4ZNEE 2GQHA 2ZCHL 2ZNXA 4ZUSB 3A0OA 1PQZB 2EZ0D 2FX7L 3LN4A 1YEJH 3V0WL 5KAQF 1DBKL 1RZJL 4HIHA 5KSAA 5DWUH 5EZOH 2APXA 2FECL 1KLGA 3VXSB 4PJ5D 5A1AA 4OFYD 4KK6D 1I1YB 4ZO9A 1X44A 3BOVA 2K1MA 3KXFD 4OF6A 1GOFA 4NP4L 3LRHA 2OJEB 2G2RB 5C8JB 5TE7H 1FFOA 4FQXD 3V0AC 4C56E 5HVGB 1ZVHA 5CLWA 1IGYA 2NPLX 3A6CL 2YA0A 1JK8B 3L3HB 3WKML 1XIWB 1QVOB 2XFXB 4MXQD 3ZKNC 4GUPB 5JHDE 5MENB 2NCMA 4ZTPH 1J1PL 3EYVB 4AYFA 1IRAY 3PNWB 1MCQA 4J4PC 2YD6A 4K3JH 3VXTB 3EZ8A 3DXAE 5FYJE 4P59L 1A2YB 4QGTA 1T0MA 4Z7WA 1DE4A 1S8DA 2CLVB 4JPIA 1HILA 2R69L 3MRJA 2FX9L 4GXVL 4XX1G 2X70B 5F6IB 5GGSY 5C0FB 3Q6FB 4M6OH 2V6HA 1N64H 4JRWA 3G08B 3MJ8A 1S7UB 3GEWB 2A1WH 3TEUA 4DOHE 1VGEH 4KRPD 1QLEH 1E6JH 3CUPB 4I5BA 5H94A 3LOWA 3U4BH 3V6FB 4D8PB 1N0XL 1A3RL 5KSAD 4APQA 4D9QE 4PGJA 4U6HB 3RL2A 3FONA 3Q3GB 2O26U 1PW3A 4YHYB 1YNTA 12E8H 1BD2E 2OL3A 4OKVB 3TGXA 1Y6KR 3HI1A 3L3DA 3SDXE 3CVHH 4HK3N 1NMBH 1IE5A 2SEBB 2IBGA 4JFDB 4HV8A 1ITCA 3GO1L 1VACB 5LCVH 3NABH 3PL6C 2X44D 1MHEA 3WIIH 1RU9L 4NC2B 1CGSH 4FXKB 1MRDL 1MCWW 4U0RC 2IFFL 3C60B 5BXFA 1V7NH 4IRSC 2AK1H 4PBWD 3O3DA 1UG9A 2DBLH 1I85A 5JPNB 1IGTA 4Z76B 3N1PC 5ILTH 4CVZB 3KYAA 2JB6B 1G0XA 1DBML 1P2CB 1V3LA 5E8OB 1ZHLB 1CI5A 1JTPA 4WJ5A 2CGRH 1UVQA 4HJJL 5I1CL 1UQSB 5C09E 3IJYA 3BZEB 4IMLA 4PGDA 2CIKB 5HGHB 4JDTL 2EIEA 4LNRA 4PY7B 2Y07L 2DQEH 1LMKA 3OV6A 1FN4A 2WINB 4DGYL 3B8YA 2D2OA 5HBBA 2EEBA 3SDCA 1X5HA 5EB9A 1QHOA 1TENA 3VWKA 1U8KB 4ONHA 1N5YL 4RAUB 2F53A 4JHBA 4NRZB 3RQ3A 4X8JB 1CBVH 3P4MB 5SWSA 4APQD 3GJFK 3TNNA 2ZPKH 4Y2OA 3MNZB 1MH5B 4NN7C 4G6AD 4MD5B 4XP1L 4XNXL 3B4NA 4H0IA 4JKKA 2VL4A 4RNRB 1K85A 2BVOB 3M07A 4HCRH 3C6LC 3DI3B 3I6LE 4F58L 3EO0A 2VXTL 3L95A 2AKRB 3IAQA 4DVRL 3MFFA 4HUWA 3HE6B 3U7YL 3WS3B 2EYTA 4KU1A 5ALBL 3TZVB 4AQOA 2Z92B 3JV4A 1IQWH 4H88L 2FL5A 1QLFB 4WHTA 4OD3H 1I8MA 2DQCL 4NM8L 5EDXA 1NFDA 2F58H 2XWTB 1JPFB 3PWPA 1R24B 3U0WL 1CICA 1YPZB 1FNHA 5C0EB 3MUGA 3B83A 3QQ4A 2QKIB 4KK8D 3S88L 3UTSB 2PN5A 5FUCE 1YUHB 4XVSH 3HZVA 1HKLH 4OZ4B 1IAOA 5C08E 1NUNB 4XX1E 4NKIL 1XEDA 4U1JA 4M00A 4JM2B 5BV7B 5TQ2L 4KKAD 4OD2B 4U1GC 3CPLA 3MMEB 1NGPL 1RUKH 2VH5H 4Y19E 3VCLA 4RDQF 3SDCD 5TF1L 3VWKD 4UT9H 1CR9H 3O6KH 1ITBB 3C2SA 4JFOA 4JG1L 2F53D 4Q58C 4WUKH 3QT2A 5ERWA 4X6EB 1RZ8B 4I3RL 5SWSD 3NCYS 4XRCA 4EN3C 3N1MC 4LSQH 4Q2ZB 2BNRA 5C0CA 2V7NA 3TJHD 1NCCL 3ARFB 2BOCB 4WEUD 1BQUA 4B41A 2XZCH 1NKOA 3QCVL 1DVFB 4AM0A 2A6JB 3DRQA 2DMKA 4OGZA 1ZVSB 4GT7A 1PD6A 5BO1H 1PKQE 1RK1B 1CG9B 1JGUH 4LCWA 4RGND 1BJMA 1TQBB 2X4UA 1JF5A 5IJKC 3WFEH 5SWZB 1UWGL 5E0QA 5L2KA 4M62L 3DYMA 4NO0A 3F7YB 4CBPA 5CD5C 2R2EB 3VXMA 3H42H 1JHTA 3X13A 3UYRH 2WQRA 3NOIA 1AP2A 3UJTL 4WO4C 5KVEH 4XNQB 1SM3L 5DFVD 1FL3B 3VXNB 1A7RL 2ZKHL 3PWPD 1CICD 5GHWL 3QYCA 4R96B 1K8IA 2V5SA 3H0TA 3OAUL 1ZTXH 4M8VA 3HMXA 3L1OL 4G5ZH 5FIEA 4FQ2L 3NA9L 1ROWA 5L88L 1VFUA 2YPLA 4JFFA 1MIEL 4M1DH 4PRIA 3GRWL 3T2NH 4QWWC 5IMMA 1VFBA 1OAKH 4HG4J 5DVNA 5BZDB 4HX1B 5D1QA 3DGGB 3QCTH 1U8OB 3U9PL 1QPPA 4M7LH 2VZVA 4QHLA 1Z5LA 1MVUB 4KY1H 4HUUB 2NW2B 4WI5A 2RIKA 2FNBA 4Q97A 1WISA 2EDEA 2BERA 1TETH 2M2DA 4YPGA 1H8OA 5IMLB 4MX7A 1DANU 1LP9A 1EUTA 2E7BA 2HLAA 3MZTA 4LVNB 3LPWA 5CINL 3W0WB 3VW3H 3WD5L 2ARJQ 4QXGH 3MYJB 2YSSB 3DROA 2Y4SA 3U0PB 3BZDA 2BNRD 4PJBB 5C0CD 1CLZL 3GHEL 1IAMA 1FZMB 5F1IB 2X4QA 1BJ1H 1KF9B 3IDIB 1R5IA 1VADB 1D5XA 2IH3A 5TDPB 1EERB 2A0LD 1QFOA 1C5DB 1KJ2L 2X4SA 1RVFL 5DEFB 4LRNL 3GSOA 2VSCA 2ATKB 3P4LA 3V5DA 4LCWD 3FFCE 3TBWB 1CE6B 5FHBH 5L2KD 2OJZH 3BHBB 4HWZA 3K1DA 4NO0D 2YRZA 2DQGH 5JORA 3VXMD 4LVHC 4H0GA 4Y1AB 1J18A 1FQ9C 3ZYOA 5JA9A 5LXGH 1CDYA 5GRWA 5KS9A 3P9MA 4P46C 4U0QB 4E41B 5D7IB 4IDJH 2HAZA 3AU1A 3D39E 3T1FA 2BMKA 4KROC 2CDFB 3L7FB 3F65A 4HXAL 3I6GB 5E00B 5AWNL 1B88A 2FSEB 3NBNA 1D9KA 2E6JA 5TDNA 5F1NB 2EH8H 2YPLD 2Z31C 4JFFD 4NM4L 4G6JH 4PRID 4JFQA 3VXUB 1C1EH 1G9MC 4UAOB 4YDKL 5E1AB 5DJ6B 5D1QD 3GMNB 4YDVA 1PX4A 3QPXL 4S1QH 3KPQB 3BPCA 3IDNB 1FFPA 4DUVA 5DD5H 4UU9B 4FQPA 5FGCB 1KYOJ 2OP4L 3QCUH 2X5PA 1OD9A 3IS0X 1G9ML 2YR3A 4MSWA 1QP1A 4CGTA 3IGAA 2FLBT 2QSVA 4WWKB 3TT1L 3O6FC 4AIXA 2XKUA 4ZUVA 2VITB 5LG1A 3DTXA 3K1KC 1HWHB 3VI4F 4N0FB 4WY7L 5HHQA 1HHKB 2C7UB 3IFLH 4AZ8A 4LLYB 3I02A 3ARDC 4X5XB 3WNNA 5IB4B 4CVUA 1NGYA 1G6RB 4F7EB 5DC0A 1WCBB 3L5IA 5DFWH 3RWHA 3FMGL 3IDUA 4YE4H 4M5ZH 3ARPA 2NY2C 2IPTH 4ZTOL 5KSBB 2QSQA 3O4LB 3T8XB 1F97A 2LQRA 5IVZB 2EDOA 1INEL 1OTSC 3BWUC 1MLBB 1PY9A 3IJHB 1IAIL 4P23A 3C5SA 2ZUSA 2DTMH 1UM4H 4ZFOB 3AFLA 5IR1A 1U93B 2NLJB 2NNAA 3LKPA 5KVDH 3ULSA 4LEXH 4GRWB 1D9KD 4PLKC 1G84A 2EE9A 2R0WH 5FUOL 3W9EB 3NCCB 4P2OA 4MVBC 3C2AH 4YWGL 3JTSA 2W60A 4ONFH 2GFBB 3SQOH 4ZOBA 2W9DL 1EEZB 4Y4KC 4KJPD 1UKTA 3BUYB 2R1XB 3GGWB 4ZSOA 1JGLH 4MA8L 3KPMB 3CSPA 3BXNB 3O45A 5FECA 3DYPA 4OIAA 8CGTA 3QEQE 3MOBL 2Q8AH 5E8NA 3HPJA 1SY6H 3RWFA 2B0SH 2Q3AA 3A6BL 4HGMA 1F4YL 1W72H 1J1OL 2VDKH 5DURB 1DUYB 3DX8B 1BQHB 2ADIB 3LQAC 3K7UA 1FVEA 1GGBH 3HB3D 5K9JH 2BY0A 5CJXC 3PWJB 1JYWA 3CFIC 3HA0A 5IB3B 1SHMA 3WN5C 2DM2A 3MLUL 3LQAL 2DQTH 4JFXB 1JHKH 3UAJD 2X89A 1EUUA 2FGWH 2MPAL 4NQXB 2NQCA 4F8QA 1N7ML 1AHWB 5JMRA 1ZGLB 2FD6L 3IDGA 1WGOA 4D0CB 4PJXF 2HT3D 1RIHL 3RTQB 4GKNB 3CIQA 2D03H 3KPTA 1HKFA 3BKJL 2LTQB 1H3GA 3IRPX 2XIDA 3P4NB 2XXCB 4OCMC 5C0IA 4OLEA 3ARBC 1JPGA 3B6SA 1PDKA 4OV6F 1UGNA 3OAYH 1MJUL 5C3TA 1JGEA 4FQCL 4P23D 4S2SB 3IS1X 3OBAA 3WDIA 5B38G 4N68A 3K0WA 4WUUA 3HR5A 4MHHG 5ACMA 4GW4B 2O5YH 4JRYB 4MJ5A 5J9PB 4P2OD 1UC6A 3TVMB 4PREA 4HGKC 3OKOB 3CX5J 4K7FB 3DJ9A 1GVIA 4ALAH 3SY0B 3CVIL 5CCKH 4G7YL 5FYKD 5HGBB 3T0XA 4YNYB 3CFCH 1H3WM 1KTLB 1XGRB 4RQQA 4Y4HC 2H9GB 1W0VA 4KUZH 4XH2B 3HZYB 3RKDC 4HC1A 3H9YA 1B4RA 1A6VH 2YN5A 3O2VL 4XWOD 2YRLA 2C3XA 3LDBC 1EFXB 4XWGL 1OF2A 4GSDH 4Q9CA 25C8H 1UZ6E 2FWOA 5I2IA 3VFOB 4YC2C 2E9JA 3BP6B 2R0LH 5TDOA 4EUPG 5J11C 4PJHE 4PJ8B 1RIVL 5JDJA 3TLRA 4ELME 3G5ZB 2MQ0A 2E6PA 2X89D 3HPLB 3V2AR 1I3VA 1FCGA 1I3UA 5IROA 1JNHB 3G6JE 3MGTB 2BSTB 2GY7B 4XPGH 4DEPB 4KJYA 3GKWH 1F02I 2ZJSL 4GKSA 3WFCL 2B4CC 4FTVE 4HMCA 4N0UB 2AEWA 2PXYC 1DQLL 3JWDC 2DICA 3C5ZB 3P0YH 1EEYA 4J1UB 1CFSA 4WUUD 1NL0L 1RHHB 3BH8B 5EOCH 1JWMB 5AAMA 1P1ZA 4P99A 2B4CL 3G5VB 3GSVA 2D31A 4NQEB 1DLFL 1EDQA 5GISH 3JWDL 1SMAA 4HS6B 4OBRA 2OBGA 1KJ3L 1CFQA 3BKMH 5HHPA 3WYRA 3NIGE 2OXGA 1U3HB 2R4SH 3F6LA 1AQDA 1KPVA 2CDEB 3RZCA 3VFVB 3VG0L 4PV8A 4NHCH 5CZXD 1ZA6B 4P0DA 5EBMB 4L4VB 4JFZL 1WFNA 2YXFA 3ALPA 2EO9A 3ELAT 4LSRL 5M94B 3RL1A 3OXSB 4RFEB 2H8PA 4OCYH 4WI6A 3WXVH 1L9MA 2X4OB 5TE6L 5IGXL 4Z7VB 2ZUQB 3VXPB 4OCRL 4NYLB 1NFIA 4WHCA 1U8PB 1CDUA 1HHJA 4RFOH 5LAXA 3MRKB 3S5LG 4YHZH 2PO6C 2VC2H 4E5XA 4U1HB 1UZ8B 4PJ5B 3GSUB 4I1NB 1L7IL 4D0DA 1NCDL 5IF0A 2UY7A 5LQBH 3KXFB 2F9BT 1EGJH 4Y5VB 1MQKL 2YD1A 4XPBL 1R3KB 4OUOA 2NY4C 1Q0XL 3F5WA 3ESUF 1Z2KA 4JZOA 2KQMA 4PUBL 4KJQD 4LCUA 4F7TA 5CHNA 5L0QB 3S4SG 2Y72A 2AJSL 4TNVK 1KXQE 2Z91B 5JHLL 4FABL 5HPMB 3VFMA 1GPOH 4OTXL 4J4PA 3QH3A 3ROOA 2QQQA 5GRJH 3MV7E 3T0EE 3VD5A 4AG4H 4PRAB 3FZUD 4F33A 3FL7A 2VZOA 4FG6D 4C56A 1I9RL 5D2LB 1A1OB 1IC4H 1SYVB 3QNZB 3HC4L 5GRXG 5JHDA 1T03L 4OQTL 3U7AA 1VA9A 4P5MA 4NBXB 3RZCD 3MCKB 1T83C 4M6NL 5FO9A 1EO8L 5T5FH 4X6BB 3ULVC 5CAYB 5J6HB 4NGHL 5DJ8A 3T0EC 4JJ5A 4MB4A 4YUEH 5EBLB 5F72S 3HE7C 2WMPA 1A6AB 2Z93A 3EAKA 3IXTA 1CT8B 2Q76A 3ULVL 4QTHA 3OWEA 4KRPB 1PG7H 1A14H 2AW2A 1F8TH 1YEHH 4ODSH 1FL6A 1SBSL 4HIHB 5JOPE 4PIRF 1KLGB 5ADPL 1OAZL 2F5AH 5JXAL 2ERJB 2CQVA 1C5CH 1WVZA 4L3AA 5IEHA 5JW4N 4BQ9A 3OZ9L 1CK0H 4BH8A 4Y0GA 4HG4K 1FO0L 3PL6A 4MJIE 1UEMA 2PW2A 3X12A 3ZKND 1U95A 2DQUH 3WNOA 1NMAL 1BD2A 1L0XA 2F19H 2G60L 3KPNB 4IRSA 1FLRL 4TVPE 3T3ME 4J4PD 4ZUTA 2HRPL 1YEDA 1LEIA 1FAIL 3RJDA 4C56D 1FYTE 1CXKA 2C1PA 4Z8FH 3OB8A 4CVXA 1WWBX 1U91B 4O00A 2VXVL 3VFWB 5JHDD 1T0MB 4LLVA 1DE4B 4Z7WB 1S8DB 4YZFF 4N1EA 3NH7H 4JPIB 2NY5H 1HILB 2HKFH 3MRJB 3SE9L 2A6DB 2K9UA 3ZMRA 4MDIA 5LKNA 3FB7A 2VAJA 3MJ8B 1OY3B 1M1SA 1XR9B 4M6AA 5DJCA 3V52H 4HXBH 3BUTA 3LV3A 3O6LH 4DKEL 4NHUA 3O3BA 4TUKH 3RWCA 3S34H 4I5BB 5H94B 3E6FB 4HIXH 5HSFA 4FFZH 2OM5A 4HD9A 3MBEC 5IHUL 4MJ6B 3RL2B 4R4NC 4LVOB 1F90H 2Z9TA 1YNTB 3C6LA 2OL3B 4U31A 3HI1B 5A2LH 3L3DB 3CDCA 5GPRA 3PL6D 4H25B 5K93A 5EORH 4ERSL 4TN9A 1AC6A 4HV8B 4JM4L 1I3RB 1ZLVH 1BD2D 1MHPL 1KYOK 3QUMB 4IRSD 1IT9L 1MHEB 3T4AA 1TZGH 8FABA 5HGAA 4AEHH 5BXFB 1QSFE 1X6NA 3WXWL 1BBDH 3O3DB 1IGTB 1NEZA 3HI5L 2RFXA 1LO4L 2JTDA 1NDMA 4TUJA 1JPST 4LKCA 4WJ5B 5F21B 2X4PA 1UACL 2J8UA 5ID1A 1P69B 3BP7B 4EQ3A 3IJYB 1A7NH 5FYLE 4IMLB 4PGDB 3Q1SL 4X7SH 4EI6A 4LNRB 5HHXL 4D0BA 3GJEA 4JO3L 5ICXA 5SV4A 1FN4B 3EDEA 1CE1H 4EN3A 3CDYA 2ZCLH 4ODTH 3OTTA 2XICA 2V5TA 3SDCB 3VWKB 4WV1C 5DC4B 4ONHB 3BDBA 3X11A 3MRQB 5SWSB 1CZ8H 3TNNB 2XNAA 2D7TL 2BP3A 1A6TA 1M7XA 3D1MC 4U1SA 1LEKA 3F7RA 3C6LD 3H9ZA 2Y5EA 4FN0A 5IJKA 4YDLB 4X7TA 4MXWH 1HINL 5C6TH 1KB5H 3NZ8B 5FHAL 1KNOA 5D70H 4MWFA 1XCTA 1P4LA 1IAIM 4PG9A 3EO0B 4WO4A 3L95B 4RGNB 4BZ2H 3QI9A 2QSCH 3D9AL 3MFFB 1T2QH 4PJ9A 5K59F 2EYTB 5F6HI 3BPOC 1EHLL 5I66A 2R0ZL 1FNLA 1PKQA 3VRIA 2AABH 3JV4B 2FL5B 4F9LC 1AY1H 4PJFE 2OXHA 4BSJA 1XGPA 1I8MB 2I60L 1NFDB 5CEXA 2IF7A 3PWPB 4HT1L 1CICB 2RCSL 4G6MH 4X80L 3MUGB 4MNQE 3QQ4B 3RVUC 3NIDF 3ES6A 3VI3F 4X4XB 3B9KB 3LIZH 2ZSWB 3PP3H 2X05A 3AXLA 1YY8A 3MOAH 4HDIA 1IAOB 3ZHLA 3GMOA 3EIFA 2DF3A 4JZNA 4YDJA 3PHQA 4U1JB 5FGSA 4KVNL 3CLEL 4XPAL 1YNKL 3CPLB 4U1KB 4EN3D 3CFKA 3RU8H 5DEZA 2FBJL 5H37H 4N9GA 2VN7A 1XCQA 2NX5E 4N8PA 4JFOB 1MREH 2YD9A 2OR8A 5ERWB 1ZT4A 4MS8C 3SGEH 4YDIH 4XRCB 3EW3B 5C0CB 1A1MA 5GZNC 2V7NB 1T7XA 5A43C 1FG9C 1WC7A 2X7LA 3O2DA 4U1LA 4AM0B 2FB4H 4LAQL 3DRQB 1K5NA 4YLQT 2NXZC 5CD5D 3CX5K 2J6EH 4PJEE 3S36H 4LCWB 4WO4D 2X4UB 1NBZA 4TSBL 3QI9D 4NO5A 1DBJH 4AMKL 5L2KB 4NO0B 2G9HB 2MCPL 4P46A 3VXMB 2EE3A 3B2UC 1JHTB 2A77H 4XCCH 3X3FL 1VCAA 4P57A 1P4BL 5LGJA 1AP2B 4ZO7A 4AL8H 4M6ML 3MBXH 1D5IL 4JR9L 2Z31A 2YS4A 3ZO0A 4HBQA 1A64A 1U3ZA 4QWWD 5EC2A 3TIDA 1K8IB 1GL4B 4UILH 3H0TB 4K23L 2YPLB 4JFFB 4X6CF 4HULB 3PHSA 4K8RC 4PRIB 4GQPH 5IMMB 3D39A 1VFBB 4X83A 2COQA 4XCFL 5E8EA 1AC0A 4HGWA 4IS6A 2JJUA 4QHLB 1Z5LB 4POZC 4ZODA 3O6FA 4NQDE 4K8RL 3BH9A 5C2UB 5EA0L 4FQ1L 4M7KH 2UY6A 4YPGB 4KDWA 1FNEA 4MX7B 4XC1L 1MVFA 4PLJC 2XQBH 1PSKH 1LP9B 2HLAB 3U79A 2KDGA 1J8KA 5I8KH 3DROB 3GSQB 3EDFA 4LPVA 4OGYL 1ZXQA 2X4QB 1R5IB 5E5UB 3WUWB 2OTWA 1D5XB 2IH3B 3HHRB 3TWCH 3GJFH 3KPOA 3FAXA 2DB8A 4K94C 4PJIE 2X4SB 2FRGP 4XP6L 5BQ7B 4YFDB 5F9OH 4QRRE 3V5DB 4UBDD 2JCCF 3I3EA 4HWZB 5IHBA 4F9PC 1KCSH 4K94L 1HQRA 2PYEB 3JZ7A 4P46D 5JORB 1QEWA 4PTUA 1U6AH 1NCWH 1IM3A 4KROD 3QFJE 2A74B 1FC1A 2CK0L 3R0NA 4OZHF 5KS9B 4M1CC 3DVNA 3P9MB 3F12B 2Z31D 3AU1B 3IU3A 4DN4L 4YHNA 4KHXL 1YEJL 1D9KB 1U8QA 5TDNB 4L4JA 4FZEL 3NCFB 4LPYA 3E8UL 3D39D 2ICWJ 1IGMH 2ZSVA 2DIAA 4YDVB 3V9FA 2YPKB 3HUJA 3BPCB 1FFPB 1U8HA 4YX2H 2AS5M 3O6FD 4HPOH 1JBJA 1MJJA 5LGKA 1C12B 4MSWB 1JZ6A 4LF3A 3L5WA 3IGAB 3HLAA 5T3ZL 5CJXA 3ARDD 2MTPA 5EU7C 4ZUVB 3DTXB 3TPKA 5CEZH 5KANG 4HZLA 5HHQB 5HDQH 3K2UL 4GG8A 5DJXA 2NY2D 3QAZB 1QSEB 2YN3A 4QXTA 1NGYB 1WK0A 3SDYH 3VGAC 5D71H 5D1ZC 4XC3L 2UV3A 3GHBH 4CVWA 1OTSD 3ARBA 4NQTA 2B1AL 3HAEG 1WBYB 1DN0A 3DARA 3NZHL 4ODWA 3ZKXB 5EC1A 1M4KA 3WMSA 3D48R 1KCKA 2AXFA 3IFNL 4P49A 1MFEL 1KIQA 4PLKD 4P23B 5EH1A 2DWDA 4XP4H 3PG2A 1VGEL 1RUAH 4MVBD 4F37K 2OR9H 1E6JL 2NNAB 3LKPB 3ULSB 2GKIA 1TNNA 5GGQL 1J0HA 3K81A 3KNBB 4P2OB 5DJYB 3JTSB 2W60B 1UCTA 4KC3B 1PFCA 4Z5RB 3ZLQC 3GBNH 5D8JH 4OCWH 4ZSOB 1SMOA 4NPYA 4Y4HA 3TCXA 3O45B 3FKUS 1N4XH 1MFCH 1PVHA 1AJ7L 1CDCA 3HPJB 5E8NB 1KCUL 2DD8H 2DM4A 3QUXB 1V3MA 2EXWC 3CJJA 3DIFA 3V7AE 3I84A 4Z78A 1FSKC 1NAMH 1FVEB 1F4HA 4YR6A 3WIIL 5E94A 3MLSH 3WNMA 1BGXL 4OZIF 4CDGC 4LSPH 3LS4H 3MRGA 5C0JA 3F7VB 4KTDL 3BISA 1MHCA 3I50H 3ZTJH 3ARBD 2XACC 3IDGB 4PJHA 3P77A 5I1JH 1FDLH 1MF2H 2PXYA 4ELMA 5EUKB 4WEBL 1RZKH 2CPCA 5C0IB 3ARUA 1JPGB 3B6SB 2OS7A 2JIXA 3ZE2F 2DQEL 1JGEB 3G6JA 4NJ9H 1A4JA 5GIRA 3U4EB 3P9WB 4WUUB 4HKBA 1A9BA 3HR5B 2EKSB 3MA9L 4H1LH 3X3GL 4MAYB 1IZKA 4MJ5B 1BFOB 1RJLB 1OGTA 5E99H 5L8JB 1FAKT 32C2A 1EA9C 2GI7A 4HUKB 4PREB 3EJYC 4HJ0C 3BGAA 3EFDH 4P2RA 2CRMA 3RGHA 5FKAA 5F1SA 4Y4HD 5AD0A 1FVCA 3RKDD 1J1XL 3UJJH 4O58H 4FQIL 3DSNA 4HCRL 4JJHA 4M7JH 5KZCD 3SHSA 4PJCB 2DJUA 3QHTC 1W0VB 5FDWA 5KAQG 3CLFH 2I24N 4MNHA 1OF2B 1OOAA 3QXVA 4OZGF 2FWOB 5I2IB 4M5YL 3B3IA 2PO6A 3T0WA 1QFUH 2DLIA 4KGJA 1P84J 5TDOB 5JQHC 1JPTL 1DUZA 3MFGB 4R7NA 1WQVT 4L8BA 4NCDA 4QRPE 5DD0L 2ESVE 1FIGH 3VFGL 5KTEL 4M4PA 4CDHA 1NCBH 3BKYL 2LVCA 5F93C 5HTSA 2PXYD 1WIOA 5HHME 4KJYB 1T22B 3H3KA 4XNYH 2KZWA 1YYLL 4GKSB 5F70A 4ZO8A 3VXOB 2JIXD 3WHXA 1HH9A 4U6YA 2DLEA 3O6KL 3N9GL 2D7PA 5B39G 1P1ZB 1URLA 4PP1C 3GSVB 2D31B 4XP9L 3MV9E 2ORBH 4LSQL 4P5TC 4KQ3H 2WZPD 1T83A 3RHWF 2VQ1A 5IQ7L 4P2RD 1CFQB 5HHPB 1UT9A 2R2HA 5I1KH 3SDXF 1Z6JT 1ZLSL 3FT4B 1KPVB 3T0EA 4PV8B 1X3DA 3HE7A 5FO7A 2V9TA 2NTFA 5FM8A 4XMPL 5BO1L 3V4PL 1JGUL 2H1PL 4OJFH 2FEEI 3ZE1E 2VR5A 5DK3A 4UT6L 3EBAA 5BOZG 3UROR 4LSTL 1P7QA 3HMWH 3WSQL 4OV5A 2H8PB 3QEGH 1FO0A 2PO6D 2DQDH 4WI7A 3L3IA 1NFIB 4LOUC 4HQQH 3NACL 5LAXB 2VN4A 1YQVL 4OLUL 3MYZA 3OKKA 2NY4D 3DSFL 2JKXA 1ZTXL 5GGTA 4JY4A 1E4KC 2MKLC 4I18B 3ILPB 4EUPA 3RVXC 1L6XA 4MLSA 4JZOB 3SJVE 4ZFFA 5F71A 1P7KA 1UM6L 4LCUB 5CHNB 5HGDA 3CSYA 3V6OE 2YWYA 2H3NA 5SX5K 1QUNA 3QXWA 1PEWA 2OZ4A 3VFMB 1IC5H 2DLHA 3W39B 3QH3B 3ROOB 3NIFF 1X5XA 3VW3L 2IH1B 1ZHBA 1RZ7H 4C56B 4N8VA 5JQ6L 3GK8H 4WW2C 2APWA 4I3SL 1VKXA 3REWA 3ULVD 5DQDL 3RWJA 3T0BA 1FG2A 5JHDB 3TFKC 4DUXA 1MAMH 1B2WL 3T0ED 4P5MB 4IBLT 4QRTA 4TNWK 3HE7D 5FO9B 4J3TA 2MFNA 1FYTA 4UIMA 4P9HH 3BEWA 1BFTA 2DDQL 5DJ8B 3S37H 1EZVX 4JJ5B 4PJ7F 2FGZA 2HKHH 2OJZL 4Z0BH 1B4JL 2DJSA 1UWEH 2Z93B 3KS0J 2ZWLT 1P7QD 3IXTB 2VE6B 1CLOH 4QTHB 5ADOH 5K9QI 1FVDA 1X9QA 5GS0L 1I9IH 3MBEA 1I8KA 4UQ3A 1MY7A 2AQ2A 2BFVL 1FL6B 4WI2A 1N26A 4LL9A 2BNQE 3NFSH 4DOHB 1QRKA 1BFSA 3V5HA 4P3WA 4RRPA 3JSSA 1KGCD 2B2XH 1V8HA 3LS5H 4G6JL 5JR1L 4PLNC 1C1EL 5IEHB 5CZKA 4PJGF 1QBLL 4BH8B 1QKZH 1H5BB 5C7XH 1MUJA 1J0YA 2ICWA 2PW2B 4QT5A 4WU7A 3X12B 1U95B 4HUXA 4U05A 5FCUH 5DD5L 4WENB 5E6IC 5F97E 5HYJA 3RAJH 1BD2B 2V17H 4X0KA 5CSGA 3PWNB 4L9DA 4EDWL 2Y06H 4MA1C 2Q86A 1SEBA 1YEKH 4IRSB 5DF0A 3HC3H 4ZUTB 6CGTA 4ODUA 2WIMA 3GSNA 1YEDB 1J9CT 3CH1A 1PAMA 1CGWA 4JHWH 3S4SA 1PKOA 2C1PB 1J8HA 1MCWM 4TVPD 1GHFL 4CVXB 3QHFL 3DRTA 2BSED 4LLVB 4R9HA 3FN3A 1NLDH 3DX6A 4WI3A 1FYTD 1Y18A 1Y0LA 4YE4L 3U6RA 3HE6C 4M4RA 1BREA 4MDIB 4FXGB 4JN2A 3TZVC 3FB7B 4WV1A 4MQXC 4TTGA 5E5MA 1RULL 2Q8BH 4BQ6A 3HNTL 5DJCB 5JDSA 4U6TA 4R90H 2QHRL 2EKJA 3MBED 4H26A 3O3BB 4NHUB 4R4ND 3RWCB 3C87A 3IU4L 4MB5A 4NN7B 4DQOL 5J8OA 5D7LE 2OK0H 1BX2A 1IMHC 2LVEA 4K71C 3FB5A 4W4NA 3DUUA 3UZVB 3KG5A 2BOBB 1TQCC 3H6JA 1RIUH 3VRLE 5CP7A 3C6LB 3OKEA 1HHIA 5CJOH 3PGFH 4ONFL 2YUWA 3SQOL 1M7IA 3MJ9H 3AS1A 1YYML 1JGLL 4L8SC 5HYJD 1PYWA 3MRHA 1G7QA 5I1LB 1QD0A 4F9LA 3OPZH 2Q8AL 5BV7L 1YQ2A 4LLAA 1K2DB 4HUMB 3BMWA 3T4AB 4PGEA 5TPWL 3MO1A 1I1AB 4S1RH 3F8UB 4DN3L 4MQ7B 1RUPL 1Q1JH 4ELKA 1ZVYA 2OR7A 1J8HD 4D3CL 1NEZB 3IDYB 2RFXB 4LHUA 3TCLA 1DR9A 4TUJB 4F8TA 1MLCA 4LKCB 2E7LC 1JNJA 4PJFA 1TQBC 3NMEA 3UBXA 2J8UB 4U1GB 5ID1B 3ALXA 4PV9A 3KR3H 4EI6B 1IEHA 3FB8A 4JFEE 1D6VL 5GS2D 3WIHA 3GJEB 4N90E 4LASL 2ED7A 3QJHB 1BVZA 4ESKA 4OZFA 4EN3B 5B4MC 1CDIA 1A7PL 4NRXA 1S3KH 4PJDA 1WAAE 1I1CA 2WP3T 3BPNB 3L3JA 4G9FA 3LY6A 3W9DA 3X11B 1AI1H 1JNNL 3H3PL 1N59B 1GIGL 3IFOA 2P24A 1VFAA 4LSSH 4NO2A 2XNAB 4WVRA 3DV6A 1T3FA 4NZTL 3L5HA 1A6TB 3F7QA 3QNYA 1LEKB 2RB8A 1DANT 1GC1H 5CS7A 3DMMC 3QO1B 4LQ1A 4JG0H 3P73A 4X7TB 1C16A 3EO1A 3WIFA 1KNOB 4EBQL 1T89C 4MWFB 1F3DH 35C8L 1XCTB 1U8MA 1P4LB 1RZFL 5C0DA 4PG9B 4WO4B 3PUCA 2ICEB 4U6VH 3QI9B 1DBAH 5B8CC 2APFA 1MCKA 3IXAB 4LVNC 4PJ9B 3VMPA 5BJTA 1LK3H 5D1XC 4KKNA 1MWAA 1Z9MA 4FNLL 5I66B 1INDL 5FOBA 4N5EC 3SQBA 5IMOA 1PKQB 3VRIB 5I30L 5GSVA 3RVUD 5IMKB 4ZPTA 1XGPB 2APBA 1UFUA 4PJAA 3RA7L 1HSAB 1E4WL 2BRRH 4BQ8A 2R0LL 2VKWA 3K4ZA 4LHUD 2OQJA 3MRMA 1CXFA 1W8OA 1TXKA 3QRFM 4DGVH 1BECA 3AXLB 1YY8B 4WFEE 4HDIB 1BJ1J 3RWGA 5I8CA 4JZNB 4YDJB 5DZOA 3PHQB 2W0PA 3DETC 1NC2B 3LKOA 1UEYA 4MS8D 5FYJH 1IC7L 4HF5L 3CFKB 1OT1A 2Y36H 1H3PH 1F6FB 1XCQB 5GZND 5C9JB 4WI8A 4G9FD 3WDHA 1S9YA 3VGEA 1ZT4B 1V3KA 1S7VA 2NR6C 4K07A 4O02H 4RFNC 3UJIH 1A1MB 5EOCL 2NXZD 4N8CH 2AJZA 4P2QE 3QDGA 5HVWA 1FGNL 2X7LB 4U1LB 5D7KE 2K7QA 3QBTB 3KAAA 5BRZE 1B0GA 1K5NB 1N3NA 4F7PB 4F9PA 3QEHA 4OLZL 5J1AA 2F54A 3B2UD 2R4SL 4MZ3A 4TQEL 4AT6A 4JPVH 2R29L 1NBZB 3DV4A 1OAXH 4NO5B 1AD9A 4DAGH 4NHCL 4JGUA 4QO1A 1ZK9A 4P46B 4U7KA 5J0BA 4P57B 5LGJB 4FFYH 1NGZA 4KROB 4ODXA 4LK4A 1S9WA 4IRZL 4XPHL 2Z31B 4OCYL 4K8RD 5T3XH 4P3CL 4J12A 4Z7OF 3DGCR 3BD5A 5EC2B 2OLDA 4LIQH 3TIDB 3BZFA 3QFJA 1P84K 2BVYA 4I4WA 3CDFA 1F2QA 3KYNA 2IBZX 4YHZL 3JVGC 3M8OH 4POZD 4ZS7L 5HHOE 2GSIA 3D39B 1QFPA 3ZZ1A 5T5NG 1XF5A 2I27N 5E8EB 1G6RL 2X1PA 2O5XL 2YXMA 4HGWB 4IS6B 4G3YL 3I75B 2HA1A 5LQBL 1RUQL 3HC0B 4ODBD 1F6AB 1IARB 5IFHH 1ZOXA 1GZPA 3GMPA 1R3HA 3O6FB 1NMCB 3KYMA 3BH9B 4GAGH 4PFEA 4TRPH 1UYWH 1N2RA 3SBWC 3CXHJ 1FNEB 2AK4E 4JO1H 5DJ2A 4JEGB 1SYSA 4DFHA 4V1DA 4F7CA 2JELH 4HJGA 5D1ZA 1RHFA 4ZFOL 3KJ4B 1IC1A 4AG4L 3QDGD 2OTWB 1S9XB 5A2KH 3BSZL 3T08A 3KPOB 4X6DE 2XZAL 4CJ0A 3QQ3A 4KTEH 4Z95H 5I1HL 1L4IA 5ID0A 2F54D 2VDLL 3B5HA 4LDOB 1GZQB 3FJTA 4QNPF 1BIIA 2DQHH 4M1CD 3FOMB 2Z35A 1QEWB 4PTUB 1U58A 3TNMA 1IM3B 1MIMH 3IDXL 4MA7H 3GMMB 4NNPL 3PHOA 4F57H 4YHLL 3DVNB 3OXRA 1EXUB 4KMLB 2P5EA 1TFHA 4GXUM 4GAJH 1V05A 2YRPA 4YHNB 1QO3A 1FPTL 3QFJD 4MAUL 2C4XA 3FAWA 1GGCH 3V4UL 2ADJA 5K9KA 5I15H 4LARL 1DFBH 4LPUA 1YEEL 4J6RH 2VLLB 1U9KA 4X5LA 5JPMB 4KQ4H 3MLVL 4P3DA 3HUJB 3OJVC 1VEMA 3JWOL 1WFUA 2FCBA 4XBPA 5DR5H 1KV3A 3I2CL 3VI4E 1MJJB 4DVBB 3G6AA 4LF3B 3BPLC 3L5WB 2GIYA 2YMXH 3V5KA 3VFSA 3HLAB 4Z7QE 4V1DD 5H37G 4JFHD 4HZLB 4K3DH 4DW2L 5D1ZD 1AFVL 1S7XA 1R5VA 4GG8B 5DJXB 2NY5C 4L29B 4KZEH 2P47B 2J4WH 1TJGH 4KAQH 4MD4A 3MTRA 4Z8FL 3SKMB 3F58H 5KVFL 5ESVB 1I7UA 2F8VA 1Z3GL 1CGTA 4NZRH 1MFDL 3ARBB 5J13C 2HKFL 1DN0B 4ODWB 4NN6C 3FQXA 5ACLA 5EC1B 1EJOH 3LCYA 4LGRB 3EHBC 2HN7A 4KMQA 5JIHA 1MFNA 3GI9H 2A9NL 2AXFB 2DWEA 3EYOA 3LPGA 1RMFL 1KIQB 3BIKA 4XB7A 3WE6A 4H8WH 4XGZA 2P5ED 2DWDB 2AQ3A 4LHJB 1RZIA 3VXRE 5F89A 1QFWH 4E0RA 4HCRA 3V95A 1WWWX 3TA3B 2GJZA 1LWRA 4U6XA 1AXSB 2V9RA 1MSPA 1U42A 4UIKL 3IVKA 4ONOA 1Z0NA 4DEPC 1F90L 1JFQH 4M1GL 1JYNA 3HNVL 1A5FH 4NPYB 4Y4HB 3F62A 4UTAH 2EXWD 3D18A 3DNKA 3Q2CA 1LDSA 4WDIA 5KZCB 1MNUL 5E7FA 3L6FA 5IWLC 3N0PB 4YC2B 3KPPA 3UP1A 2AVGA 2OTUA 2XA8H 4GAYA 4YR6B 5E94B 1G1YA 2GTZA 4HFUH 4TNWF 5DUMH 3O4OC 4TOYH 4KDVA 3LEVH 3K2MC 4PJXE 4U1NA 4P2CG 5EUOF 1BBDL 4RIRA 5C0JB 3QZWA 3QDME 3FQTB 3Q48A 1MHCB 5GRUH 4J8RA 2ZOKA 2ZG2A 5CZVH 4D9LL 2B1HH 4PJHB 3P77B 4XCYA 4BFIA 3MXVL 2PXYB 4ELMB 1PQZA 4OB5H 3DBXA 4QRPA 1IGCH 2ESVA 3MQIA 4X7SL 4WIQA 5IT2L 4UB0L 2JIXB 1UKQA 1J0KA 3G6JB 4D9RE 1A4JB 2PR4H 5GIRB 1I1YA 1ORSA 2CO7B 4ODTL 4P5TA 3DVGB 5AEAA 2ITCA 4HKBB 3EJYD 1A9BB 4GG6F 1DJSA 1IKFL 1QFWI 4HJ0D 3O6ML 4FTVB 3AAZB 4GQ9H 5F7DA 2OJEA 1OGTB 2MNUA 5AZEL 2DMCA 2VDMH 32C2B 3S9DB 4C4KO 4AK1A 1A47A 4Y5VC 3MLZL 2UWEF 4DKFH 2W9EH 1TJHL 4GAFB 4P2RB 5FKAB 1JK8A 3FT2B 1QVOA 1DP0A 4YPJA 1FVCB 2HH0L 4GUPA 2EC8A 2Z0BA 4Z7UF 1R3LA 1HNGA 3UTTE 1T0NA 5F7KC 3PJSA 2QSCL 3ARZA 3T3MF 3VXTA 3TV3H 5IFAH 2QADC 5E2UL 4MNHB 1T6WA 1K4DB 4XNMA 3RIFK 1G9NL 2GK2A 3MRRA 3QUYC 2VZUA 4QXUL 3EDDA 1N6QH 4UUJA 3MRIB 3MR9B 2R56L 1PJ9A 3SDAB 3DPBA 1AY1L 1AQKH 1NSNL 1F4AA 1E4KA 3L9RB 1DUZB 3HFML 4BK5A 5C0FA 3Q6FA 4L8BB 2BZDA 1HEZA 2C26A 4G6ML 2FH8A 1X5AA 2NY4B 3ZTNL 4ODHL 5F3HA 1S7UA 2P48B 1MEXL 3QIBB 5KW9L 5DVOA 2E27H 4DZ8A 3MOAL 5E6YA 3GFUA 4QRPD 4KTYA 2ESVD 3M45A 1YJDH 2LU7A 1S9KC 4O9HL 2P8PA 3WHXB 1HH9B 2VXSH 2ITDB 2NZIA 4PP1D 1HZHH 4U6YB 3KJ6H 1HCFX 4P5TD 1LE5A 4WW2A 2BCKA 5I71C 2FDBP 5IW1A 1RURH 4YHOL 4H0HB 4ZO6A 2ERJC 1NCAL 2CRIA 1NC4B 2DI7A 2VQ1B 5C0RH 3Q6GH 1ZKAA 2R2HB 1RSFA 4OF8A 4LHQB 3MV7B 2D3VA 5ABDE 2G5RA 3T0EB 5HPOA 1U8IA 5MHSE 2WBKA 5LBSH 3O3EA 3QG7H 5FO7B 2V5MA 2NTFB 3KDMA 2P8MA 5MP6L 2XYCA 4KZDH 1IGIL 4LOUD 4Y5YC 1H3XA 1P7QB 4IEFB 1SEQH 1EBAA 4OV5B 1IQDA 1MCIA 3VGHA 1FO0B 3BW9A 4MQTB 3L3IB 5IEKA 3R06A 3BKCH 4JCMA 2V2WA 3EZJB 2CIKA 1NLBL 2P42B 5HGHA 5E2JA 2RHEA 3MJ6A 5GJSH 2FH6A 3OKKB 4PY7A 4NUJA 2ADGA 3RVXD 1BM3H 1AO7E 1YMME 3BJ91 3KPLB 3NAAL 1C7SA 4EUPB 3GBMH 5E6IA 4BZ1H 3BIBX 1KXTB 1U8KA 3P3YA 4PBXA 1MRCH 4RAUA 5EIQA 4JPWH 5T33H 5C2BH 4ZFFB 2BNQA 1P7KB 3P4MA 1Z9OA 3CSYB 3DUHA 1BVLA 5ETUA 1U36A 2WQ8A 2YD4A 2H3NB 3B2VH 4XPFL 5CGYC 3ZHDA 3TYGH 2PTUA 4Q9QL 5BMFH 1PSKL 1WUNT 4HS8H 4EQ2A 1ZHBB 3TFKD 3ZT7A 4NJAL 4LVOC 4ORGA 3W2DH 1VPOH 4N8VB 3N85L 4RMQA 5DHVB 2K3TA 1VKXB 5EZJA 3REWB 2YKLL 2AKRA 3VMOA 3P11H 3RWJB 2HRLA 2ICCA 1FG2B 3HE6A 5KSVA 1ETZA 1GGUA 4XNUH 1RJYB 4Q74A 3TZVA 4QRTB 3MODH 4X4ME 1FYTB 2OL3L 1H3TA 2Q7YA 1QLFA 4UIMB 3BEWB 3IRZA 4L8DB 1JIBA 1KFAL 3OB0K 1JPFA 5F8RC 4L5FL 5DVKA 4CU7A 5J1TC 1UA6L 4QY8A 2R0KH 3P2TA 3D3VE 2QKIA 1JRHL 1YUHA 1WLHA 5FGRA 3JXAA 3QUML 3U1SL 4UQ3B 3NTCL 4OZ4A 2XRAH 5FM5O 4ZD3L 5E4EC 1J5OL 2Y1VA 4OIIH 3L5XH 2C3GA 2EDFA 5CEZE 2AEQL 3U36A 3BRFA 4X9GA 1SY6A 5GGVY 4OD2A 5DMIH 1OSZA 4UDTA 3RIAK 1QRNE 1SVZA 4Q9RH 3DECA 2V7HA 4L8SA 4NWTH 3JWNC 5E6ID 2Y5TA 2DIBA 3BT2H 2BNQD 2Q7NA 2X1OA 2ICWB 4WU7B 2R39A 4K3EH 4HUXB 2DKMA 3UO1H 1TMCB 4X0KB 3JBG7 3SE8H 2ZUXA 1OHQA 15C8H 2Q86B 1SEBB 3ULUF 2XI9A 3CXHK 4ODUB 3GSNB 3SGDH 4OUUA 4J3VA 1QBML 3CH1B 1KJVA 4OLYL 3S4SB 1CG9A 1OP3K 5KN5A 5EULV 4GJTB 1J10A 1J8HB 3WLWC 2E7LA 4PYHA 4KHTH 4LFHD 3HE6D 3F7YA 1NJ9A 2WIIA 1I8IA 3TZVD 2P8LA 4PJEF 1HNFA 3DX6B 4MQXD 4RGNC 1QSFB 1DQML 1Y0LB 3U6RB 2VXQH 1FL3A 4EXPX 1AXTH 4CADB 4JN2B 4WV1B 5E5MB 5HYEA 1P6FA 3GI8L 2WBJC 1LO2L 4BSVB 5JDSB 2DYPA 5ISZE 1T1WB 2P5WE 1I3GH 4H26B 1I7RA 2NY0D 3NCBB 4JFEA 2DI8A 3AC0A 3DGGA 1BX2B 1CXHA 2OR9L 3N1GC 3DMMA 3FB5B 3DUUB 3B9VA 2X4RA 3B9KC 4M48H 2MQ3A 5DGQA 1T89A 5TFSL 3OKEB 1HHIB 3FB6A 4JO2H 3RPIA 2NMSA 5EOQH 5B8CA 3W0WA 1M7IB 4RGOH 5E56A 4S0SD 2AJVH 5D1XA 3BPOB 2YSSA 5CFHA 2BRQA 3U0PA 2VLKA 5AZ2H 4UQ2A 1MFCL 3MRHB 1G7QB 5F1IA 3P30H 3PV7A 4XAKE 4GMTL 5C6PB 1HSBA 2DKUA 4PGEB 2DD8L 3MO1B 5DEFA 4A6YH 3SGDI 4I0KA 4ELKB 3SKJL 1Q9OB 2YD3A 3OKMA 3RY6A 3MLSL 2PTTA 2CKBH 3OAYK 5E2WL 4LHUB 3TCLB 3CC5B 1ZGLM 3EJZC 2IGFH 5C92A 1MLCB 1RZKC 1ZANH 1XH3A 4PJFB 3UBXB 3FO2A 1NAKH 2X09A 4OCXH 2WW8A 4PV9B 4UT7H 5B4MD 3NPZB 1FZKA 3FB8B 1D5ZA 4MNQB 3L7FA 5E00A 5JLZA 1BMGA 5D7JC 3WCYA 4FA8A 1MFBH 4OZFB 5F1NA 2DYPD 2YOCA 4NRXB 3EO9L 4PJDB 1OP9A 5F7EH 5GGVH 1FORH 3L3JB 4G9FB 1WSST 4JFED 2VWEE 5E1AA 5HYSG 5DJ6A 3PP4L 3GMNA 5DD3H 3DMMD 2D7NA 4JVWA 3IFOB 2P24B 1VFAB 1CD1A 1T3FB 2ZUWA 2NX5B 1AE6L 1V7MH 1D3CA 2FX8L 5EO1A 2QBWA 3HMXL 1C16B 5K59E 3EO1B 4UINH 3W0WD 3WIFB 4AJ0A 4BSWA 5D1XD 4NBYB 5BW7C 1U8MB 2D7MA 1XGQA 2VITA 5C0DB 2VLKD 4N0FA 4N5ED 4Q0XL 5DYOA 3FCTA 1TPXC 4AENA 3TT3L 5BJTB 1CXLA 2FEEL 4X5XA 1MWAB 5BVJA 2EIDA 4CL7A 4ZMAT 4JKPL 2VNCA 1ZSDB 5FOBB 5IMOB 1QNZH 3NIDE 3B43A 3T2QA 1BFVL 5GSVB 3FN0H 5C0NC 4ZPTB 3VI3E 5GS1A 4PJAB 4DTGH 3H3BC 3JVGA 3O4LA 5IUSA 4QRUA 4UV7L 3UPCA 3T77A 3ZSSA 2OQJB 2EH7H 5DEGA 3MRMB 1U41A 4Y1AD 2XTJE 3QUKA 3IJHA 4YJZL 3RDTC 3DETD 4XBEL 1T4KB 4M7LT 4LCIH 3RWGB 5ICZA 1R5WA 1UCBH 5I8CB 4MHHI 4LP4A 3SBWA 2QQLL 3VD4A 4YBLC 1EZVY 3LKOB 2QHLA 2NR6D 4JKWA 2ADFL 3UC0L 3W9EA 2FZ3B 4L9LA 4PRHE 3LKRA 3HS0B 1S9YB 5JW4Q 4K9EL 1U2CA 4M9OA 4NZJA 5HDBE 1S7VB 4LSUL 1CU4H 4TULL 3OKNA 4NQDB 4XVTH 1GRWA 1O7SA 3WV0A 3MLRH 2AJZB 4KH2A 1L0QA 5C07A 3DVIA 5SWQA 3QDGB 5CJQL 3HG1E 4MA3B 5J06A 1B0GB 5I18H 1N3NB 1CL7L 4X7DC 3CCHA 3QEHB 4BKLB 2B20A 2AI0L 5J1AB 2F54B 4FMFA 4AT6B 4KV5F 3DV4B 1KULA 1A6WH 1AD9B 4MD0B 5EIIB 4NZUH 1Q72L 4R26H 3V6ZB 3PWJA 1OCWH 4F3FB 4PJIB 4BZYA 4G8FB 4OJFL 2IG2L 4ODXB 1NGZB 4QRRB 1CWVA 1S9WB 4NQXA 1YEFL 5ALCL 4X6CE 1OAQH 2BY3A 3O4LD 4K3GA 1T20A 2WWMC 3BZFB 3QFJB 5JIKA 4DUWA 3RGVC 5FYJU 4HQQL 4I4WB 2AXGB 3KYNB 1WBZA 3EJJX 5JO5A 4N1HB 4WU5B 4X9IA 3C09C 2EECA 2W0LA 1KN2L 3ZKXC 4WHDA 4K7PH 1MCFA 4TPRL 5HDLA 3RUGF 1FJ1A 1E4XH 3VFPA 5F1OB 1GZPB 1R3HB 4TVSa 3KYMB 2YD8A 3CNKA 1WTGT 4HK0A 1R0AH 1N2RB 3ZDZE 3BRDA 1SYSB 2DQJL 3I9GL 1A6UL 4V1DB 2ZG3A 5FYLH 4F7CB 2VDQL 4HJGB 2UZYB 2VXUL 4HUVA 4JAMA 5I1IL 2DLFH 5D1ZB 5DQ9B 4AEEA 1FFNA 5C07D 1IBGH 2DQIH 1LDPL 3QQ3B 5DURD 4FRWA 3MLTA 5ID0B 4JO4H 2IBBA 5CKAA 5L6YH 4OZHE 3RIFF 1BIIB 3QUXC 2Z35B 1S5IL 5D7SH 3ISWA 3TNMB 1U58B 4BQBA 4AEIL 3CFDA 1OD7A 3S37L 3G5ZA 5FYKL 4C58B 3PHOB 1MCPH 4Z0BL 3LEYH 5LWYL 4WNQA 3OXRB 1ADQH 1ZS8A 2P5EB 3AB0C 1W0WB 1CLOL 3QQ9C 3CVHB 3S35X 3TPUB 1XGYH 1QO3B 1EVTC 1JPSL 5EN2A 1YEIL 4BELD 4ZAKC 1IAKA 2FYYB 2HJFB 2XT1B 3NFSL 5K9KB 4OCSL 1RFDH 3LEXA 1EMTL 3QQNA 3R1GL 2AGJH 4I77H 4P3DB 4J1UA 1RHHA 4W6WB 1INQA 1R3JA 1QBAA 5IWLA 4JCLA 5KJRL 1JWMA 4XBPB 1HIML 4XXDA 4WTXA 1FSKB 5C1MB 3G6AB 5LGHH 3RNKA 4P2YA 5FCUL 3VFSB 3K3QA 5GRZA 2GJ6E 4MAYC 4LPCA 4K3HA 5DS8A 1X7QA 1YEKL 4WW1A 4HWEH 4RISL 4GMSH 5DLMH 1S7XB 4HC1H 1R5VB 3VFVA 1M6OA 2JJWA 4JQXC 4QTIL 3BAEL 4KRMB 3FRUA 1HYRC 1A22B 2IQ9H 3LN5A 1I7UB 3EHBD 4PB0L 4PGZA 2VABA 3ULUH 5DT1L 2EIZA 3EKCA 3MUZ1 1NLDL 4PJXA 4OLXH 3FQXB 2HN7B 3C08H 3E2HB 5E9DA 2E8ZA 2PCPB 4OM0H 2A9MH 3EYOB 1LO3L 2MJWA 2WUCL 4QLRA 3BIKB 1PZ5A 4U1HA 3WE6B 4XGZB 2Q8BL 3GSUA 2O5ZH 4FMKA 5I74C 1KB5A 1RZIB 5F89B 2P43B 3CX2A 1U0QA 4Y5VA 3HZKA 4E0RB 1R3KA 4K2UL 5T1MA 5FUZL 5J6GA 3OGCB 2F8OA 2AJYL 3WFBH 4U6XB 1OAUH 2VDRL 4HFWB 3IVKB 3FHQA 4WFHD 1MRFH 4MNGA 1A0QH 3L3OA 3OGOE 2J3SA 5HPMA 1OAYH 3QHZH 5F9AC 1EVUA 3D18B 4BFEA 1ZE3C 2ZCHH 3U2SA 3KGRA 2FX7H 2ZCKL 2PYFA 4WDIB 5D2LA 3QUYA 1A1OA 3V0WH 1E27A 1EAPB 3L6FB 3TN0C 1DBKH 3KPPB 5FM4A 4GAYB 3HRZA 3MCKA 2GTZB 4HLZG 3V0VB 4U1NB 1KSRA 4NP4H 5IHZA 4RIRB 5J6HA 3QZWB 3TM6A 2N56A 2N4IA 2W1NA 1BQHG 3WLBA 1A6AA 3H2WA 3GM0A 1C08B 2ZOKB 3BDXA 3A6CH 4U2YA 3ZE2E 3WKMH 1QLRA 4XCYB 2HYMA 5MI0B 2EDWA 4BFIB 2W0KA 3DBXB 4O5LL 5E9DD 4QRPB 1J1PH 2ESVB 3TBTA 4JHAH 4ETQA 4I2XA 1ORSB 5DDHA 1NUGA 3RIAF 4P5TB 4P59H 3RKPA 1CF8H 2ITCB 2J6EA 5L9DH 3INUH 1JP5A 1GC1C 4TSCL 5F7DB 2R69H 2QEJA 4GXVH 3VWJC 2R15A 4GW5B 5GSRA 1ULVA 5HY9A 4I18C 5A2JH 2IBZY 1G0YR 3ARVA 2VLJE 4E41E 2HWZL 4M8QB 1J7VR 4WGWB 3KPNA 1GC1L 3EYSL 2OSLB 1FNSL 3MV9B 4PP2B 1CVSC 2QADD 4KI1A 1R3LB 4Y5YA 4OZGE 1T0NB 1FGVL 3QUYD 3V4VL 3RRQA 3VXUE 4U6VL 3PJSB 1DBAL 1FRGL 1A3RH 3S3PA 1U91A 1JGVL 3PP3K 3VFWA 4NOFA 4MMZC 4UOJA 3S96A 1LK3L 2HT4C 4MJ2A 5DJDA 2FECI 2JB5H 4XNMB 3MRRB 4IRJC 4LSVL 4HKXB 1J0JA 4UUJB 5FCSH 2GY5A 4LPWA 2A6DA 1L7TH 4QEGA 4PG2C 2NY7L 5CGMA 1HEZB 3WO3B 3FHAA 1XR9A 5F3HB 3GO1H 1KEGL 1RJZA 4FQLH 1T04A 3ZL4L 4DZ8B 1RU9H 4WFFE 5JW4M 5DMKA 4X9HA 1MRDH 4LLMA 3E6FA 4F80A 3TJEH 2IFFH 5IM7B 1AO7A 2P8PB 4X5WB 1JZ8A 1WTLA 1FBIL 1FNFA 2DBJA 4MJ6A 3GJFA 1JI2A 4LCYA 4N1CA 4UNUA 1G7IA 1LE5B 4WW2B 1JZ5A 3CZJA 5DFTA 2BCKB 1DBMH 3TO4C 1ORQA 2BVUA 5IW1B 3KS0H 2EDNA 5D2NE 2CLRA 2MOVA 4HJJH 5HHVL 4H25A 5I1CH 2BJML 2BHUA 2HFGL 5T3XE 3VRLF 2EDKA 1I3RA 4JDTH 3ESVF 4LIQE 1TVHA 3HRPA 2A6IA 1XFPA 3CFBA 1H5BC 2Y07H 3QUMA 1U8IB 4PRDA 3O3EB 4GH7B 3EOBB 3GSXA 1N5YH 3KDMB 2P8MB 5F9JA 5C0BE 1J05A 4M9PA 5D2NC 4KVCL 2C5DC 3MLYL 3J7HA 1UH3A 3KLDA 5IB2A 2VERN 5MHSD 3BD4A 4H5SB 2CMRL 2MCG1 4X4MA 3BJLA 1IQDB 2Z4QB 3BW9B 1G7LA 4XP1H 4XNXH 5IEKB 1A7BA 3R06B 5MEQA 1NEUA 3BP7A 2VKXA 4ZUWA 2V2WB 1JZ7A 3PDOA 1ED3A 5EZLA 5F9WB 3OX8A 3PGDA 3BGMB 3D3VA 4U3HA 4NUJB 2ADGB 4HAFA 2VXTH 1AR2A 4DVRH 5KG9A 3U7YH 5E6IB 5ALBH 4PRBA 3FRPA 1FV1B 2BNQB 3CU1A 2AJ3A 4MA1B 1ZEAL 3MRQA 5CGYD 1AO7D 3BMVA 3NIFE 4JY6A 2DQCH 1BVLB 1DEEA 4NM8H 5ETUB 1QRNA 4HW6A 3FQNA 1WAAF 5CUSL 1P6AB 1TJIL 3RP1A 4MDJA 3S88H 4N5UA 3NZ8A 1CIUA 3H9HA 3U30C 4UTBL 4KK5C 4ORGB 1Z0MA 4W6YB 4LLDA 1KIPA 5EZJB 1B90A 3GMRA 4NKIH 5TQ2H 4PJ7E 5KSVB 1ETZB 2BHYA 4HBCL 3KYKL 4S1SL 5B39B 5I8OL 1NGPH 5JIIA 2J2ZA 3UZEA 4TYUA 4JRYE 5TF1H 3VE0A 2Q7YB 2WBJA 1WZKA 4I3RH 1EX0A 4QY8B 3KPSE 1I1AC 1NBVH 1NCCH 3EYQC 3O9WC 4CUCA 3BP4B 4K71B 3UPRA 4X4XA 4X98A 3B9KA 1OPGL 2ZSWA 1TQCB 3QCVH 5CILL 3IDYC 2NY0B 1Q9LB 2UZXB 3QP3A 3IKKA 4Z0XA 1D5BA 2VB5A 4PJGE 1R3IL 3U36B 3D3VD 4EIZC 2FO4A 4GAJL 4GS7C 5DD1L 2BDNH 3MPCA 4W81A 1QR4A 3U9UA 1OSZB 4UDTB 4HPYL 1UWGH 1W72B 4H20L 4U1KA 5TQ0H 4UNVA 3P0VL 4M62H 4L8SB 2V7HB 1GGCL 1NAMA 1W2KT 2Y5TB 4XCNA 1DFBL 1K4CA 3UJTH 3QWRA 5FUCC 1CXEA 1JWUA 2APTA 3VMNA 3ZKSD 4M02A 3LHPL 4CAGA 2ZKHH 5HD8C 1OTTC 4PD4J 3BPNC 3O8XC 3GIVA 1H9VA 3OAUH 3WLWD 1TDQA 1F00I 3L1OH 4XAWH 1CIDA 3HAEH 3NA9H 4FQ2H 5L88H 4OUUB 3GRWH 4YFEA 1KJVB 2VLRE 4PY8I 4KKCC 5KN5B 2EYSB 4N0UE 3U9PH 1TZHA 2W65A 2G9HA 4KZEL 2VSDA 1NJ9B 2WIIB 3K8MA 1I8IB 3C8DA 2P8LB 4WFGD 3F58L 4Z6AT 3QI9C 5D7JA 4PJ9C 4R7DA 3UYOD 2WBJD 2Y23A 4H1LA 5CINH 2YK1L 3WD5H 3IETA 1MPAL 4L3CA 1CGVA 1FHGA