2CGRL

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
source organism Mus musculus
molecule tags Immunoglobulin
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrL01
4X6FA 1NGPH 2R0KL 2VL5A 4DTGL 1C12A 5I1CH 5I18L 5FF6B 5KSAA 4MDJB 1Q8MA 5C0FB 1HILA 5F7DB 5IOPB 1XH3A 5JZ7C 2J4WL 1ROWA 3UROR 1MCEA 3BH9B 4GQ9L 5GS3A 1PZ5B 2QADD 3UTSB 2ICWB 4R97B 3ETBF 4KK8D 5D7KE 4HH9A 3PIQA 1WIOA 3OPZH 2Y5TB 2UZIL 1BWWA 1E0OB 2NR6C 1I4FA 2FZ3A 2BSED 4ZPVA 4ZUTA 2OXHA 1P1ZB 4N1CA 1H3UA 3QUXB 1PEWA 4LHUB 4HIIB 4NOBA 2HG5A 3HZKA 4PJ7A 1QBLL 4OI9A 4ZOEA 2VO5A 3G6JB 1I9RL 3HTLX 3O4LA 3BDXA 3STZB 3QEQA 2BHUA 2Y4SA 4Q0XL 5IB1B 2CK0L 3G08A 1FNFA 3IJSB 4JR9L 4D0DA 4LPVA 2W60B 1RZFH 2QKIA 3OKNB 4BZ1L 4MNHB 2CDFA 4R96A 3RVVD 4F3FA 3QQ3B 2QQLL 2PYEB 1X5GA 3B3IA 5HPMA 4P2QA 4G6KH 2OTPA 4OM1H 3ORJA 1UFUA 4Z7UB 1EGJL 2A77L 3F7RA 2AEIT 3H42H 5FGCE 3I6GA 5DVMA 1IQWL 1GC1H 4OF6A 3CH1A 3VE0A 3WIHH 1MCWM 3U4AA 1F4WH 5A43C 4Z0XA 1U0QA 3MSPA 3WHXA 5IB2A 3HE6A 1S9XA 2W9LA 5C3LD 2V2TB 1HYSC 4ELMF 4NRXB 1SM3L 2WQ8A 5INCA 4FQ1H 2K9UA 5KG9B 3GBNH 4KAQL 4ZUUB 1A6ZB 2Q1EA 2DJUA 1T6VN 1EHAA 2CK2A 2XN9B 3S34L 3T77B 1MIEH 1QTYT 3EJZC 5FYLH 1X6NA 1Q9WB 5IFHL 4MJ5A 1J1OH 3ALWA 3LKSA 1AD0B 2X10A 2BDNH 3L95B 2XWTA 4WCYH 3VXTB 1PQZA 4JJHA 4F7EA 4P46B 5C3TA 4Y8AA 3QDMA 2XI9A 4TVPL 4NWTL 3QXUA 3NIFF 3CCHA 4NZTH 3MRPB 3V6OE 3CH8A 5K9JH 2BVPA 4JRYE 5ACZB 2BY3A 4PJDA 1NGPL 1NMCB 3C6LC 2MOVA 1B6DA 5A40E 3X14A 3LKQB 2ZCLH 4PJ9A 4MNQD 3QISA 4P2RE 4QRQB 1PFCA 2NY4B 3D6GA 1U8JA 5F7FA 4HIHB 4P4RB 3GSXB 3OPZL 4M3JA 3MV01 4QYOA 3BQUB 3RWGA 4Y0GA 3CFJB 4OF8A 4QRUA 2Z93A 5JO5A 3FCTA 4R26H 2FJFB 4X98B 5SWSA 3WJLA 3QNXB 4WI9A 3QJFA 4CN1A 1WBZA 4GBXA 1MOEA 1UQSB 1NC2D 3N9GH 3GSOA 3CSPA 1M1SA 2Z91A 4R2GB 2HJFA 4JKWA 3LSOA 2E9JA 3C60B 4G6KL 4OM1L 1HOCB 3H42L 1KN4L 3L7EA 4UU9A 1GC1L 5EZOL 2QR0A 1EZVY 4FFZH 1VFBA 3WIHL 3CDCA 3S97C 1F4WL 4PJCE 1OSZA 1VCAA 3RY6C 4JG0H 4AG4H 1WZ1H 2C7UB 5CEYA 2GQHA 3INUH 4J3XA 4OZGA 3U30B 3ARED 5CJ8A 4NDMB 1KXQE 4FQ1L 3T65A 3GBNL 3U2SA 4HX1A 4LCCA 2ILLA 1SJHA 3QUKA 4UILL 3NACH 5C0CA 4U6HA 4GAJH 2D9CA 4FXLA 4DK3A 1MIEL 3RZCD 4QRSB 5C0GB 1J1OL 3FQNA 1ZV5A 1UXSB 2BVYA 2BDNL 2Q3AA 3PXJA 4WCYL 2EDEA 4JFPA 4MS8C 2NW3B 3QUMH 4UDTA 1IGFH 1MFAH 1UWEL 3HUJA 4KZEH 2RCSH 4TUOA 1WFTA 4HH8A 4NZTL 3BIKB 3T4YB 4LCWD 4QOKD 1DBJH 2HA1A 3PG2A 5K9JL 4ZXBB 5IEHB 1VB9A 2JJVA 3IU4H 1FLRH 4Q2ZB 3HNVH 1S78D 2ZCLL 2D7OA 4XBGB 1I7ZB 2EZ0C 1SJEA 1SYSB 3LKOA 3W11D 5IBTH 1OB1B 4L4VA 3TA3A 3C5JA 2YD2A 3MMEB 3SDCB 4JFHD 4ETYA 2GK0A 5DD1H 3ULVF 3CX5K 4JZJC 4MD0B 4IRJA 1TIUA 5CBAB 1LO0H 3L3OA 1BFVH 1R3KA 4R26L 2DQEL 4L8SA 2YD3A 3MCKA 1A2YA 3D0LA 4LIQE 1FL6B 1IMHC 4Y2OA 3N9GL 4LLUB 5D70H 4OUOA 4GW4A 3H9YA 2AK1H 4RMSA 1DBMH 3TZVC 2VISA 2VN4A 1AGFB 5HVWA 1T1XA 5J12C 4ZUWB 1FG2B 2GTWB 3B6SB 4FFZL 3UAJC 3UDWA 3E2HB 4AIZB 3Q5OA 1QRKA 2JTDA 4HIXH 5HHME 3DYMA 5MEQB 3OV6A 4JG0L 4AG4L 1WZ1L 4F2MA 3INUL 4Z95H 4UAOC 3VWJD 3ZKMC 1CFNB 5DEFA 3SPVB 1N2RB 5C9JB 4G8GA 4Z7OE 1JYWA 1LNUB 4F15B 1VENA 4X7TA 2CKBB 5E8NA 3QUYB 4GAJL 4QRPE 5FYKE 1GL4B 3ARGD 2MQCA 5DJ6A 4JO2H 1LK2B 1ZSDA 5CEXA 3IRPX 2Z31C 3SJVB 3JV6A 3VMOA 3QUML 4PJAE 1MVFA 1IGFL 1MFAL 3DHJA 4KZEL 5IVXF 3EFFA 1QUNA 4N8VB 4Q9CA 4HAFA 1XMWA 3CFIC 4ZFOA 1A1OB 3PL6C 4J7RA 5DFTA 1DBJL 5FYJH 5T1LD 3FO9B 5D9SA 4X6CE 3IU4L 4Y19D 2DQIH 1FLRL 1F97A 3HNVL 1INDH 4PS4H 5FAAA 1MRFH 4OZFG 2G5RA 3PWPE 5DK3A 3LDBC 1PX3A 4KUCF 3KPMB 5IBTL 4PJEF 3T0EE 3ZE0E 1JPFB 2HTLC 5AZEH 2DQFA 1CK0H 2GFBA 1HDMB 3ILPA 4YBQC 3QEHA 3L9RB 4CL7A 3LB6C 2V5RA 5GGTA 3PGDB 1HHHA 5DD1L 1IKFH 3ZYJA 2O26U 4GG8B 1LO0L 2X40A 3IDJB 1BFVL 3MRQB 3PWVB 4M61A 5LCVH 3GBLA 5D7JA 5JR1L 4D0BA 2CRYA 2F54B 1SQ2N 1J0HA 1JTTA 4GUPA 5L88H 3GHBH 2I5YH 3LVEA 4HWBH 1OSPL 5D70L 4PRIB 5E8PA 2GITB 1NEZA 1RIVH 3QRGH 5FECB 1T89C 1U3HA 2AK1L 3OWEA 2JIXD 1VA9A 2WAHA 1WBYB 5GXBB 2R39A 4OZFA 5ERWB 4OKDA 1BIIA 4HIXL 2IBZX 4JFOB 4LLYA 4WDIA 3AXLB 2A74B 1DQQA 3O9WB 3QPQD 5HGHB 5LWYH 4WRLA 4Z95L 4LIQH 2VABB 2R0LH 5DURD 4GW5A 4PJGB 1YNLH 4YHOH 4NQEB 4JFXA 3MLYH 5C09D 4ORGB 1KPUA 2BC4B 3QG6B 1D6EA 1PZUB 1VEOA 4XP5H 4NN5B 5CLWA 4DOHB 1ADQA 4G6AD 4ODSH 4CGTA 4HBCH 4YDLB 4M03A 3BWUC 4JO2L 2BOBB 3JTTA 3WUWG 3ME0A 2OSLB 4JQVC 3DX8B 1LO2H 3E0GA 1KTLA 4N90D 2WIIA 2UZXB 3UPRA 5DUPH 1TZIB 1DUYA 5BJTA 5E6ID 3EYUH 4PD4K 1IAOA 1JNLH 2IAMA 4PRDB 1FNEA 4JFFD 3QDGA 5FYJL 3QFJE 4BSVB 3BH8B 3ULSA 2DQIL 2JCCA 3JWOL 5DD5H 3QZWG 1INDL 1IGCL 4PS4L 4TNWF 5ABDE 3GEWB 2XY1A 1NANI 3GB7A 1VKXA 5A2IH 2A83A 5FYKH 2VDNH 4JKPH 3BEVB 1EX0A 5EU4A 5DJ0A 1KG0A 5AZEL 1CK0L 3OBAA 2QHLA 1FO0A 3I3BA 3SKOA 5JQ6L 4F7PB 1T22A 2EE6A 1U8MA 3U6RA 1IKFL 3MRRA 3SE9L 3VXPB 5IQ9A 1T0PB 2YN3A 2VXTH 4JFZH 4WUUB 4EI6B 3JTSB 4WGWB 5TDNB 5LCVL 1BZ7B 4I0PD 3QUXD 5H35B 4LHUD 3V0WH 4CVZA 4R7NB 5KSBF 5L88L 1U8LB 3GHBL 2I5YL 2OCFD 4HWBL 2GT9A 3NFPB 4P46C 2H8PA 2HLFD 4E5XB 5HHOB 3HA0A 3L3GA 1LO3H 5EO9A 1RIVL 2YWZA 3QRGL 2DS4A 4JHBA 4RMQA 5GZOD 1FG9C 4ODWB 2WUCH 1CGVA 2V2WB 2CUMA 2DRUA 2PYED 1UCBH 3MROB 2H9GA 2Y06H 4JAMA 2DOCA 2LQRA 3O2DA 5C6PB 3TPUA 1CFTA 4UIKH 1NMCC 1K85A 5EBGA 4JKMA 1UXWA 4LASL 4MNQA 3RIAF 3MGAA 5ILTH 3EDJA 2EDWA 1RD6A 5LWYL 2EDLA 1CDYA 2NY4C 1JRHI 4LIQL 2R0LL 4NCC2 5D71H 3D87B 2C1PA 4YHOL 4HXAH 3MLYL 4HLJA 4JZOA 4U1NB 1SJXA 1RUMH 4XP5L 2WZPD 1I8LC 2Q6WA 1FV1B 4ODSL 2X4SA 4HBCL 5J6GA 3GO1H 3TBWB 1JHTB 5MI0B 5I8KH 2FGWH 2EIBA 3NOIA 1LO2L 2W9EH 4FTVA 4IMLA 5EDXA 1MAKA 3PGCB 1H3PL 5A3IC 5DUPL 3O6MH 4H8WC 4R2GC 1D5MA 3AMLA 3EYUL 3SBWC 4FFWC 2VC2H 3FRUA 4D9RD 2X5PA 3SN6N 1T0NB 5DD5L 3HAEA 3DRQA 3ARBA 5FYKL 2VDNL 3TNNB 4JKPL 4LPXA 4CVXB 1DANT 1MCHA 1Z0NA 3RVWC 4RFNC 4I18B 5EIQA 3VFVA 3V5KB 2ESVD 1QSED 2HFFB 4Z7VE 5EO0B 3K0WA 4ELMA 3P77A 2VXTL 4HLZG 2P5ED 1KJ2A 2ADJA 5IHBA 2HFEB 3BQUD 5EPMB 3RTQA 3MLUH 5JXEA 1KEGH 3I3EA 5T3XE 1B9ZA 3IXTA 4CU6A 2UWEF 3RZCA 3RWFA 4U1SB 4LDEB 1BZ9A 1CICC 3GMMA 4UNTA 4YO0B 3FQRA 1VESA 5BXFB 1EUTA 1FSKB 5AEAA 2JB6A 4O2CA 3S9DB 5HYJB 3MRNB 1QFUH 2YD8A 5HJ3A 3MNVB 1UCBL 4QOKA 3WUZA 2Y06L 4ZO8A 4ZXBC 3BZ4B 1G0DA 4U0QB 5LQBH 3IVKB 4UIKL 2J8UB 1PKQA 3HRZB 5C0AE 3DVGB 5SX5H 1WF5A 1PAMA 2C26A 5DK2B 5ILTL 1AE6H 3W0WB 5C0DB 1O0VA 5DC0A 2ZWLT 3FFCE 5K9QG 4GXUM 5D71L 2JJWA 2XZCH 4P5MB 5F8QC 3V79C 5DUBA 4NNXB 4OD2A 2BOCA 5D7LB 4IIQA 3MBEB 4HG4J 3SGEH 3ARWA 4YHYC 3P9WB 1D9KA 4JPKL 2YD4A 2BVTA 4RMVA 1CT8A 1RK1B 3GO1L 5I16A 4HJ0C 3MACH 3N06B 1K3ZA 3SOBL 5I8KL 3HMXH 4M6AA 1N3NA 1LO5A 3ABZA 2IMMA 1NUNB 1MRDH 2W9EL 1J0ZA 4U1IB 3GUTB 4GOSA 3O6ML 3RBGA 4YAQB 3BKJH 4AIOA 1LP9E 2I07B 3QNYA 1J0IA 4U1JA 3KLAB 4KGLA 5AUMB 4WIQA 2AEQH 4Y4HB 5I73B 1VPOL 5BRZA 2DIAA 2YWYA 3GGWA 1SBSH 3SDCD 1SMOA 1UVQA 3SDDA 5IB3B 3DWTA 4RBPK 3MLVH 1TCMA 3WFHB 1NFKA 4UT7L 3RUGE 5CZVL 4L8CB 1KSRA 3ZKQD 5MEND 1KEGL 1JPGA 3ARGA 4GT7A 3E6HA 2ZUQB 3RPIA 1YEEH 4OFYD 3HI5H 4P23A 5HHPA 1T66C 2KL6A 1MLBA 4PUBL 4MMXC 1T5XA 2XZAH 1M7DA 3GSNA 3MRIA 1QFUL 3BVNA 1L0QA 3VJ6A 3HB3D 4E41E 2CIIA 3BUYB 4MQ7B 1YUHA 5LQBL 3JWDL 4ONFL 2DJSA 4JM2B 4Y89A 3T08A 3GMRB 3PJSA 2IALA 5KN5B 3U46B 4OZHE 2GW5A 5E5MA 3HZVB 4LCUA 1AE6L 1K4DB 5T3XH 3WNMA 3AAZB 2A38A 3LEVH 4MD5B 1ES0B 3JVGA 4KK6C 3NZ8B 1JE6A 2B4CC 3MV8E 2XZCL 4V2CB 3U0WH 3NCBB 3K2MC 2HT4D 4OCXH 2E3VA 1T7YA 3JSSA 1M7IB 3KPOA 2NXZC 3BW9B 4OFKA 1AI1L 3QUYD 1AHWC 4PG2A 5GJSH 1UADC 4AENB 3MACL 4LDOB 2O5ZH 4XCEA 4NKOB 2Q7YA 3HMXL 2OR8A 3IDUA 5BVJA 1JFQH 1MRDL 5KVEH 3MUZ1 4R8WH 3AS0A 4HMEA 4KHTH 5JPMA 2MTPA 1HHJA 2OJEB 1YDPA 5C9KA 1YQVH 4U1HB 3M8OH 1NMBH 1UWGH 3BKJL 5C71A 2F74B 1OAUH 5SWZA 1KGCD 1RZIA 1FAIH 2G2RB 4ELKB 2AEQL 4NO0A 4QHLA 1KEMH 2WINB 3O9WC 3RL1B 3HKFA 3OHXA 1N0XH 3MV9D 1SBSL 2YRLA 5I9QB 4PRBB 3CMOH 2QLVB 3W2DH 4TSAH 2VIRB 4V1DE 3MLVL 5FUOL 4B7LA 5BS0B 5D7IF 4ALAH 2VDPH 1D5BA 1J1PH 4LNRB 2I9LA 3MJ8A 4FQQB 1YMMB 5H2BB 1P2CA 1UB5B 1F4HA 1XR9A 4Z6AT 2F54D 1V3MA 3RVUD 5AWNH 3HI5L 4HS8L 1YEFH 5IJKC 1RJYA 4P5KA 1JP5A 5B3JE 4PRID 3S36H 3AU1A 5EORH 5IIEB 3O6KH 1YYMH 5GHWH 4RAVA 4PJIB 4XP1H 3QPXL 1NDMB 5IVXA 1WUNT 4JFFA 1TTGA 4G9FA 4Y5YC 1MWAB 4LKXB 5JW4M 5D8JH 5E8DH 3AS1A 1EEYB 4FQPA 3DYOA 4XCNA 3VD9A 1NC4B 2IG2H 4WW2B 2P8LA 4KKAC 1KNOA 5J1TC 3H3BC 5T3XL 3AROA 2XQYK 1IAMA 1ETZB 3LEVL 4UOJA 4KU1A 5CFHA 5LGKA 1BQLL 3LPWA 4PJEA 3TIEB 1MAJA 4FMKA 4OCXL 3V7MA 3Q0HA 2AJYH 4NQED 4J3WA 5JHDE 5TE4H 1S9WB 4I48A 1YECH 3SHSA 4I0PA 2BNUB 3L7FB 5GJSL 3MX0A 1JWUB 5DJ2A 2O5ZL 1Z9OA 5D96C 5ADOH 1EXUA 1KIRA 4X7SH 4GXUN 3KJ6H 4U3HA 3KPTA 1TPXB 1JFQL 3SE8H 1FVEB 4R8WL 2Z0BA 2D0FA 4AJ0A 3CPLA 1T04A 3DVFA 1OM3H 3BKMH 1A02N 3M8OL 1NMBL 1UWGL 4KJPC 5B8CA 1MELA 4PJHF 1OAUL 3IDXL 5J13C 4RRPG 5I17A 4NNYA 4KTYA 2P24B 4KRLB 4JM4H 1KEML 3QIBB 4H1LG 3IF1B 3S36X 2AKRB 5FGCB 2HKFH 4CW1A 1N0XL 1PSKH 1R3LB 2H26B 5EOCJ 2WBKA 1XCTA 3C8KA 2BMKA 1EPFA 5ANMA 3CMOL 3EOAB 4B41A 4KXZI 3W2DL 3ZL4H 2RB8A 4TSAL 3QUMB 5MHSE 3G9AB 4P5TD 3FOLA 4ALAL 3VFSA 5GS0L 2VDPL 4U6YA 4XBPB 4FQHB 4WUUD 2A6JB 1CXLA 3ZHDA 2E8YA 3G5XA 3IKCB 2N56A 3H6JA 4QRRE 3G5ZA 2VDMH 5MI0C 4HUXB 5AWNL 4BKLA 1YEFL 1VSCA 1AP2A 1HSBA 3QIUC 1U58A 4PGDB 3S36L 5HHOD 3TN0A 5EORL 5FB8B 3O6KL 5GHWL 4XP1L 2WWMD 1OGAD 2ID5A 1BOGB 3HZYA 3VXME 4N0RA 3S88H 4Y5XA 5D8JL 1J87A 3K3QA 2Q86B 1IGJB 4XPTH 1Z5LB 4WI5A 4H1LA 4FS0A 3IFNH 5I2IB 1MFNA 4K3EH 5FV2A 1D5ZB 2F8VA 2IG2L 4JRYB 5CP7A 5IB5A 2EKSA 2ESVA 3H8NA 5DFVC 4YX2H 1I8MA 1QSEA 2Z4QA 3T3PF 1S5HA 3GSVA 2EH8H 2AJYL 4P9HC 3FN3A 2X4PB 5C0EA 4YXKH 2P5EA 5TE4L 3PXHA 2VE6A 3L3IA 1OW0C 1DLHB 2IQ9L 2OL3B 2YUVA 3GMQB 3LV3B 4M8VA 4HFUH 4P9HH 3L5IA 4I4WA 5ADOL 3WNNA 4X7SL 2IPKA 3MJ7A 3KJ6L 1Q38A 1IE5A 5KSBA 4MDIA 3SE8L 3S96A 3T8XA 4PPTA 1CFSA 1TZHB 3CFCH 3SDAD 4Q6IB 1R5WB 2BRQA 3D85D 2D0HA 3ZT7A 4HZLA 1J12A 4Z7WE 2R8SH 1FBIH 4NKDA 5BW7C 2G75A 5E1AA 5FCSH 1V3LA 4B50A 5F3HA 1ZS8A 3T0AA 1OARH 4JM4L 2PW1A 4K94H 2EIDA 2VXVL 3SE4A 4MD4B 2HKFL 4LLWA 1PSKL 5C07B 1G6VK 3PDOA 4PJCB 4EDWH 4H0IA 2CO7B 3ZL4L 4LCYB 2BZDA 5BOPA 5E5RB 3S5LG 5SV3A 4YHMH 3IS0X 2AGJH 3QA3B 5B39B 2QQKH 4R4FL 4WWKB 2GSIB 4PBXA 1JPTH 4HS3B 2V7NB 4F8TA 4MA3B 2VDML 2WLZA 5JOFA 1FL3B 4KGJA 2OZ4H 5D1QB 1A7RH 1B0GA 1JYVA 3L3JB 3FTGA 1BD2D 4XPFH 3S88L 3FB8B 4Q7DA 4YR6B 3TESA 4WFFE 5CGYC 1S7QA 1J8HA 1ZAGA 3UBXB 1E6JH 2EE2A 2X89D 3IFNL 3FONA 4OFDA 3O2WH 5JW4R 4RQQB 1IGIH 3WFCH 4P4KB 1OVZA 4N8CH 5TDOB 5ISZB 2CDEA 1U91B 1A6TB 5DVLA 4QGYA 4YX2L 3C2SA 4RZCA 3QO0B 1SHMA 1ZMYA 2EH8L 5IJVB 4MWFA 4AYFA 2R2EB 3TBTA 4YXKL 5JW4N 3FRPG 1O5DT 5EU3B 2HVKB 3GIVB 3MBED 5MENA 3VFPA 5FK9A 2PXYB 4K3HA 2ZUQC 3UTZB 5GGSA 2A6KB 4Y4KA 4HFUL 4P9HL 3LY6A 1NCDH 4X9FA 4OFYA 5EUKA 3MGTA 5DTFA 2F19H 2UWEA 4J8RB 5JLZB 3CIQA 5E9DD 2DWDB 3M45A 1SEQH 5HHVH 3CFCL 5CIPH 2A0LC 1M4KA 3HG1E 4NFDA 2R8SL 1FBIL 1R3JB 1LEKB 4XNMB 4LAJH 5KVFH 2EYSB 3LKPB 3MREA 1RZ7L 4MJIE 1OARL 4NN7B 5FOBB 3MLPA 4K94L 2G9HB 4Y4HD 3IDNA 3KYAA 3RWCA 5J56B 4JPWL 4L9LA 1F3JA 4HV8B 4EDWL 4NQVB 4X9BA 5T5NG 2BP3A 2HJKB 5HHMB 3FRPA 3ARDA 3NMEA 4OCYH 5CHNB 3K8MA 4NJ9H 4HUVA 2LAAA 2QQKL 4TVPD 5E1HB 4LGPB 5KSUB 3C5ZB 3PWUA 4WFED 3VFWB 1ZKAA 4BH8A 3CNKA 2R2BA 4GW1B 3L1OH 4PJ7E 1K5NB 3NVQA 3O4LE 2OZ4L 3GI8H 2WBJB 1FL5A 3BMWA 4RA0C 4Z78A 4C4KT 1IAII 4KMLB 1A7RL 4JFYB 5F1KC 3DJ9A 4XWOD 5EZIH 3VFNB 3BN9D 1LVEA 2VXQH 1K4CA 4PJAB 1UJ3A 2XICA 4QHKI 3MRDA 4P2QE 4EEEA 2VDKH 4RIRA 1I8KB 4JM2D 1MCPH 4WJ5A 3ZDXF 1KLUB 3O2WL 1CGWA 2J8OA 4U1LA 12E8H 3WFCL 3IB4A 2VLJA 5I66B 1LGVA 4N8CL 4HCRA 4X6CB 2NY1C 4F7MA 1T7ZA 4LLDB 2VQTA 2AJZA 3MV9A 5GGVY 3PWPB 4H26A 2BHYA 3T0EB 5I15H 2XTJE 4Y5VA 5GS1B 4KRMB 1U8QB 1YEJH 3JV5A 4IHOB 4Y2DC 3RX8A 4M7JH 4H25A 3MA7A 4YQXH 1ZGLM 4UUJB 3BXNA 1NCDL 5HGBA 4D2NA 1TJIH 2ZG2A 4LVHB 4QF1B 2F19L 4BELD 3U0PB 2VLRD 2AABH 5DYOA 2F8OA 1SEQL 5HHVL 3P30H 1AO7A 2VJXA 3WE6B 4AL8H 1W0WB 4JDZB 4MAYA 4YBLB 4YIQB 3B9KB 5JMRA 1R0AH 4GFTB 3CVHA 1F4YH 1AGCB 2EEBA 2Y25A 4KJQD 5D1XD 1ZLVH 3OKOB 4M1DH 1KTDB 1IGMH 5CSZB 1FFQA 3SGKC 4U6XB 4WW2C 4PJDE 4JQXC 2IBBA 2Z8WC 2F8XC 4APQB 3QT2A 1OWWA 3TBSB 3WIFA 3PABA 1KUMA 3LQZA 3VD3A 1F02I 4ONOA 5TPWH 4XI5C 2LAGB 1X5KA 1MH5B 3D39E 4QRTB 4P0DA 5KOVC 3VFTA 4XP6L 5ID1A 4HGWB 3CC5A 4WHTB 3EW3B 3NH7H 3HS0A 4WO4C 4MSWB 3L1OL 2VZ3A 4BH7B 1MUJB 1TPXC 3GI8L 2GAZB 1KB5A 3OKDB 3WEXB 5EZIL 5CWSA 4XMPH 1TDQA 2JJUA 4DZ8A 2NLJB 4NUGH 2EH7H 5ETUA 4JO1H 5KZCB 4NO2A 2VDKL 5K9KA 4XX1G 1MCPL 3U9PH 1QO3A 4MQXC 4IOFD 12E8L 1A4JA 3QIBC 1NC4D 2EIEA 1X5AA 1CLZH 3KXFD 1XF1A 3TO4C 4OV6F 1I1CA 5LVEA 3U9UA 2HT2C 4EUPB 4P5TA 3NA4A 3BZEA 3NN8A 1MCRA 3EZ8A 3EIFA 5C0BE 2HFGL 3F5WA 3B83A 5D7IA 3RX7A 5D6DC 5D7KD 4M7JL 4YQXL 1A1NA 5C0CE 1RK0B 1JYXA 1TJIL 3OZ9H 3CGTA 3PNWA 5FHBH 1OAKL 4X4ZA 2AABL 4M6OH 5C0JB 4PV9A 3P30L 3FT2B 4AL8L 5EBMA 1OAXH 1HXMA 3CFBB 4PGJA 1R0AL 1EBAA 1NGXB 1OGAA 3HUJE 3MRBB 1F4YL 1TQCC 4M1DL 3WN5B 4YBHA 4IRSB 1IGML 3U4EB 2DQCH 4JANA 1KCVH 3H9SA 1CLCA 4MXQD 2CLZB 1IC4H 3KPNA 3ROOB 1HK6A 4L4VE 3QFDA 4IBLT 5TPWL 1NFDB 2Q76A 3UYPA 1OY3B 5IW1B 1J0YA 4HIJB 4ODUB 3OXRB 3CZFB 1QQDA 1VFOA 5ITBH 2YUWA 3NH7L 3FQTA 1XIWB 4OGAD 5EUOA 3JV0A 5BV7B 5DJXB 1NJ9B 1FVCB 2YEZA 3QP3A 4FOMA 5EH1A 4YGVB 2IFFH 3CSYA 3MRJA 5BCAA 3S3JA 1BLNB 2Y7QB 1T2XA 2P46B 3MLWH 1QSZA 4W6WB 3O8XB 4YUEH 4MAUH 2QEJA 4FXKA 4Q6IC 3SDAA 4DGVH 5ACLA 2E9WA 3D85A 2P5WA 2DDQH 4QNPF 4NUGL 2EH7L 4O02L 3EYOB 3RGHA 4RFOH 5DK0B 4JO1L 3FN0L 3A67H 2BY1A 1UKQA 1A6AB 5A2FA 3GHEL 4ODXA 4QCIA 1IGYA 1BIHA 1NMAH 3U9PL 3MYJB 1NDGB 3DX6A 4PJHA 2XWBA 4DZBA 4JLRB 5F1NA 1OD9A 4K9EH 1UKSA 3DBXB 5KS9A 1CLZL 4LBEB 4WV1A 3Q6GH 1BQHB 4JRYD 4KK5D 2HVJA 2YC1B 3ARZA 1EFXB 4EN3A 4MCYB 5CJQH 4WTZG 5HYQA 4GRLA 3QXDB 3I3DA 3MJ9A 4P2RD 3HR5B 5F89B 3MOAH 4LHJB 4WWKC 4G8GE 4F7TA 5I1AA 4R4ND 2LVCA 3CFKB 5I0ZA 2DF3A 4KI5C 2NZIA 5CGTA 3VD4A 1K8IA 5HI4D 3OZ9L 3V2AR 5FHBL 1G7QA 2AV7A 5B38G 5DEGB 3C87A 2R1YA 4M6OL 5DMIL 5FDWA 3D2UA 2VUOA 4HKJB 2C4FU 1OAXL 1WBXB 4NC0B 1BD2A 4BQCA 3I75A 4ISVA 2EKJA 3VXUA 5T3ZH 3VRLE 1KIPB 3F7PC 4BQ9A 4L9DA 2X89A 1KCVL 1AC0A 4CADA 3MRMB 1Q9KA 1KIUA 4WI2A 2B0SH 4P4KC 1IC4L 1XGPA 4WHYG 3UZQA 3KLSA 4P2OC 4WTZA 1P4BH 5C0AB 5F96H 1R5VB 5CSGA 4NQDA 3P0YH 4QT5B 4S2SA 4POZD 4U1GC 4ONGH 5JOPE 4HKZB 2B8OT 1I3RA 3FFCB 1F6FB 3G9VA 3ARFA 3MJGX 3KS0J 3EO1B 4NBYB 5DMYA 5ITBL 2BSRA 2PXYC 2RFXA 1WT5A 3NTCH 3MFFA 5DJAB 1NFIB 2P8MA 1ACZA 2IFFL 3BP5B 1LE5A 1BBJB 4LSQH 1OPGL 5IP4A 5F3BB 5E9DA 3MLWL 4HFWA 4XVTH 2Z35A 3JV4B 1B4JH 4YUEL 4MAUL 5D1QD 2ADFH 4DGVL 2VERN 1GOHA 2DDQL 1D6VH 2IQAA 5D1ZB 4RFOL 1IM3A 5LGJA 1NLBL 3QQNA 4CU8A 1MCOH 5LGHH 2NTFA 5INDB 4KXZH 3LKNA 4GRWE 5TE6H 4NN7C 3SY0B 4K9EL 4LRIA 1TZGH 7CGTA 4J2XA 1S7UA 4U33A 4N0YH 4YZFF 3VCLB 3LB6D 1LP9B 3Q6GL 2FHBA 4M8QB 4HKBA 4OI7A 1YMHA 5JPNA 1DQMH 3QUZB 4QHUB 4Y16A 5CJQL 1FC1A 5GS2D 4XPBH 4LSUH 1ZA3A 5IROC 4PY7B 4ZNEA 3O6FC 3TWCH 2E7MA 3OKLB 1J10A 4XCYB 4ORZC 1QLEH 1I85A 1RJLB 3RUGB 1DVFA 4I2XA 3VMNA 2WBJC 3WYRA 5GGUA 1F00I 3QH3A 3THML 2KZWA 4DVBB 2FEDC 5HI3D 5TDPB 3ZKNC 5T33H 2XNAA 1U8HB 5I0DA 5IHUH 4NT6A 4MXVE 1KYOK 1TVHB 4NQCA 8CGTA 4F37F 3I50H 3QDGE 4YHZH 4Q97A 2NXYD 4Z76B 1A6UH 4GMSH 5DQJB 2JCCE 1LD9B 4E41B 1MVUB 2B0SL 1MIMH 3BSZH 3NCYP 3Q3GB 3KR3L 3KDMA 1P4BL 1QHOA 5F96L 2LU3A 5DJDB 3P0YL 3ARSA 1A64A 1S5IH 2CDGB 1ZHNA 3I6KB 5HHMD 4EI5B 2WP3T 4ONGL 4B5EA 2BK8A 3P4OB 1X7QA 3MV8B 1DQLL 1E28B 3FQUB 3VGFA 1MJ8H 4YHKH 3NTCL 4Q9RL 2BVQA 4LSVH 4TUJB 2WP3O 1U9KA 2A1WL 1K2DB 1X6LA 4HPYH 4LSQL 1A9EA 4LVHC 2HT3C 4LVNC 4YHPA 3U36B 3WIHA 1Y18A 3WFZA 1EA9C 1XGUB 3MUY1 4K8RC 2VLRA 4O51B 2DWEA 1B4JL 3OAUH 1G9NH 3AM8C 2NY2B 4QRPD 5F72S 5FYKD 2HKHH 4LRNL 2CR3A 4NHCH 4YBLC 2CLVB 3B9KC 1D6VL 5I1EH 4PBVC 1AR2A 5C86A 4IDLA 4UV4H 3ZLQC 4RNRA 5D1XA 5JW5B 1YPZE 5LGHL 1U92A 5GSVB 1LMKA 1BAFH 5GGTH 5DZLA 1VEPA 3RP1A 2PO6C 5TE6L 1C5DB 2FHFA 4N0YL 4Z5RA 1H15B 1F45A 5CZKA 4MNQE 3S7GA 2ATPA 3UZVB 4EIGB 3EYFA 3PWPD 1LEIB 4XPBL 3EFDH 4LSUL 3T0ED 4MA7H 4RGNC 1JV5B 3M1BA 4U1KB 5F8RC 3TWCL 2W65B 1T4KA 4KK9C 3UO1H 2OR9H 1NPUA 5IQ7H 3IJHA 1QLEL 2RAMA 4G7YL 2ZCKL 5DJZA 3HZMB 4JFDA 1QBAA 3T0VA 4EQ2A 3MTRA 3SQBA 3S6CA 4BM7A 1F11B 4HWZB 4WEUD 1N6QH 3O45B 5DLMH 4X99B 4E0RB 2NNAB 5EOCH 4FTVE 4OLYH 3NZHH 4TNWK 2X4UB 3C6LA 5HI5C 3P0VL 2JJSC 2PR4H 3I50L 2GJJA 4X0KA 1A6UL 1X5XA 1OP5H 2FRGP 1MIML 1XZ0A 1J05A 3CDFA 3BSZL 3KYMB 1A3RH 1DEEB 4WTXA 2KUTA 4APQD 1DN0A 4YLQT 3S35H 5DMKA 2V17H 5I8OH 5EU5A 1S5IL 2C3VB 1HEZA 3BZFB 4G42A 2UVFA 2XKNA 2AQ1A 4RFEB 2E7HA 4PLNC 2UYLA 3L6FA 4ELME 3BESR 2XT1B 3AUVA 3OX8A 1MJ8L 4YHKL 4LSVL 1BVLB 5CILH 4XXDB 1M6OA 4HIEB 5I30H 15C8H 4HPYL 5JHDB 5E8OB 4KC3B 1UEYA 3RVXC 3TM6A 1BFOB 3L5XH 2DMCA 1G9NL 3OAUL 1Q94B 5EBWB 5J57B 2HKHL 1CXKA 1JUFA 5J1AB 1I9IH 3U7YH 5CEZE 1MCIA 2O5XH 3IJYB 5GGRA 3LRGA 5TGBA 1S7SA 5IF0B 1F6AA 4MHHI 1G1CA 1ONQB 4QOKE 3RY6A 5GGTL 4EKXA 3RIAK 3P73A 3NIFE 4LPYA 4JRXA 3G5YA 3VXOB 2C1OA 4FQCH 4BSWB 1PKQE 3SKMA 3QFJD 1A5FH 4JJ5B 3BHBA 1M05B 2Y23A 1GZQA 3MRFA 2QQNH 1OP9A 5FXCH 1HHKA 3OJVC 4MA7L 4ZDHB 5F1IB 3UO1L 2OR9L 1BVZA 5E5UB 5BV7C 5IQ7L 4LOUC 5HHQB 1PYWA 4UTAH 4PGBA 1MJJA 3S35X 5ENWB 1HCFX 1PKOA 1KJVA 1I1AB 1Y0LB 4KHXH 4L8BA 2ITCB 3DYPA 4J4PC 1N6QL 5CD5D 4IEFB 4QRRB 3KJ4B 4IOIB 5DLML 3MPCA 4L3AA 5EOCL 2D4FA 4OLYL 3NZHL 1BFSA 3KPQB 2AXGA 2IBGA 3SKNB 3CFEB 5DS8B 1IQDB 2PR4L 3S3PA 2JF1A 2YXMA 4IRSD 2DYPB 1KCKA 1IAKB 2FJGB 3VXMB 1QHPA 1UZ8B 4FZ8H 5DMJB 4HDIA 4O9HH 3VD5A 2DBLH 3TH2T 1A3RL 5H94A 4YHLH 3D3VA 3MFGB 2FO4B 1L7TH 3S35L 4JZJA 5BRZE 1N26A 1F3RB 2V17L 5I8OL 1FCGA 1FZOB 4M6MH 2H32B 3F7VA 4Z9KB 3TBVB 2R1XB 4P2RA 4PJBF 2R2HA 5ICXA 3G6AA 2BVEA 1CF8H 4B0MM 4YK4B 3OSKA 3V6FA 5CILL 3QJHA 1XIWD 4PREB 5I30L 15C8L 2KBGA 2XQBH 3AFLA 2HFTA 4A6YH 4AH2B 4CVWA 5GGRY 3FO0L 3L5XL 2DTML 3QO1B 3LQMA 2AS5M 3LN4A 4MCZA 2VQ1B 1B6UA 4Q9QH 4G80A 3O8XD 3TZVA 1A47A 1I9IL 2RJMA 3U7YL 1MREH 2HMIC 5D6CB 1A0QH 2O5XL 3RDTB 1QLRB 1ED3B 3GMOA 4JGUA 1GGCH 5CMAB 3R8QA 1I1FB 1UH3A 2MKLC 3X13B 3IT8D 1Q72H 4TUKH 1T5WA 3MLXL 5IEKB 3T1FB 1A5FL 4YDJA 5DVKA 1ZT7B 4HZAA 2AI0H 5C08B 1DUZB 4OIBA 2QQNL 3QIWB 3EDFA 1QR1B 1TCRA 4U3XA 5LXGH 1NCUA 3KAAA 3NGBB 1RJZB 1ZLUK 5FKPA 1RUAL 4MQSB 2ZG3A 4KKNA 1T1ZA 1AR1D 3ULVE 2Z31A 3DRTA 4UTAL 5DO2C 1NGZA 1ZT1A 4PTTB 5CJBA 5F1SA 1YN7B 3IETA 4PJ5A 4ZS6D 1RFDH 4FQXC 4OGYH 4X5WA 3RWIA 4D9LH 2V7HA 5T3XD 3PL6A 3G04B 3VWKD 3D0VB 5E94B 5ELIA 4JY5H 4N9GA 4HXBH 4NBZB 1TNMA 3TIDB 5L2JB 4GG6F 5EC1A 3CLFH 1MCWW 1OTUD 1BBDH 4HLZH 1F42A 2MCPH 3RBSA 3MRCB 4KK6D 2DBLL 5SWZE 2VDRL 3IFPA 1PW3A 2P42B 1AXSA 4EQ3A 4YHLL 1L7TL 3FQXA 3QUZC 2DLGA 4M6ML 3DROA 5C0AD 4HWBA 1HI6A 4JCMA 2X4TA 3DV6A 2WWKO 3K4ZA 3FFCD 2I25N 4LHUG 5FO7B 1CF8L 1QSFA 2H2SC 2Y07L 5DI8A 4DGIH 2CUHA 4KUZH 2XQBL 3NFNA 5D2NB 4A6YL 5MERB 2BNQA 1BJ1J 3TLRA 4BFBD 4JFEA 4LU5L 1T89A 4UBDD 4X4YB 3KYNA 4Q9QL 1FFPB 4S1RH 2X4RB 1C08B 1MREL 1A0QL 5B3NA 4G43A 4L3EA 4CKVX 5D1ZD 3CDGB 2OLDA 2W1NA 1YNTA 1AGEB 5IVXE 1NLDH 3VFUB 1MHHB 5GS0D 4G9FE 1Q72L 4X8JA 4TUKL 3DVNB 3UTSA 4D0CA 4F57H 4N1EA 1KJ2L 2EDTA 2FWOB 1I1YB 1EERB 4OUUB 1XT5A 1TETH 4HS6A 2AI0L 4MJIB 5DVOA 1VFUA 1T3FA 4KKCC 4PLJC 4X6FB 2VL5B 5LXGL 1C12B 4PJEE 4HIIA 5IW6A 5KSAB 2VITA 1HILB 1XH3B 3AS3A 2Q3ZA 3STZA 1BHGA 1CWVA 2B20A 4Q58C 1OD7A 4IRZH 4RWYH 4XXCC 1RMFH 4HBQA 4JQVA 3IDIA 4HH9B 3EYVA 3PIQB 1RFDL 3C6SA 5DA0B 1I4FB 4OGYL 4AM0B 2FZ3B 4D9LL 3DI3B 4ZPVB 4ZUTB 4QRPA 2B39A 4JY5L 3UYRH 5C0RH 3PV7A 2YRZA 2HG5B 3HZKB 2D7TH 4PJ7B 3O4LB 4Y4FD 3BJLA 3QEQB 2E6PA 1WICA 1YNKH 1BBDL 4O00A 5KVGH 3G08B 2MCPL 3RVTC 4D0DB 1FZJA 3REWA 2QKIB 4Y7MA 4R96B 2CDFB 5F1OB 4F3FB 3LKRA 1KPVA 4E41D 1LDSA 3B3IB 5ID0A 5HPMB 4P2QB 2WMPA 2QBWA 3QI9C 5KSVA 4TSBL 3BD3A 2UUDK 3I6GB 1A6ZA 3CH1B 1G84A 3VE0B 4EI5D 4Z0XB 5ANME 3WHXB 2XZZA 5IB2B 3HE6B 1T03H 3V52H 3MV8D 5EU7E 1S9XB 4DGIL 3CFDA 4KUZL 43CAA 1YQ2A 2XTJB 1UB6A 1Z3GH 3WS3A 5INCB 2I60H 4PJ8D 5HVHB 4IMKC 2ADGA 3OB8A 1P84K 4QY8A 2J8UF 3WNOA 2DL2A 1PG7W 3FN9A 2P48B 3LKQA 4MJ5B 3K2UH 4D9RE 4TN9A 4XRCA 1NLDL 2XWTB 1PQZB 4MJ4A 4F7EB 2VDLH 1FP5A 5FM5O 2W0KA 2XY2A 4KKBD 4F57L 3QDMB 2VDOH 2FX7H 1IEHA 1DR9A 3EZJB 1U3YA 3ARQA 3CCHB 4HIHA 3P4MA 4NC2B 1ACYH 1MCFA 3VFOA 3EHBD 3RQ3A 1TETL 1OT2A 2BVPB 4PJDB 5HDQH 1I8LA 1S7RA 1X4XA 2ESVE 3O3DB 2VLLA 4PJ9B 5TQ2H 2PTTA 5TH2A 1WTGT 4OLUH 4RWYL 3A0OA 1RMFL 1JN6A 3BPLC 4V1DD 1U8JB 3QIUD 1OP3H 1U6AL 4QYOB 1I7RA 3RWGB 3SBWA 1IEBA 1A7QL 1XF3A 2MKWA 4EIZC 1NGWA 4QRUB 2Z93B 5JO5B 2W92A 3FCTB 3UYRL 1HOCA 4KROB 3MV7B 1AH1A 3RKPA 2D7TL 1DN2A 5SWSB 3C8HA 3QJFB 1WBZB 4GBXB 1CLOL 1YNKL 3B4NA 4LLVA 3GSOB 3BRFA 1H5BA 3UJJH 1RPQA 2CRZA 2Z91B 3BP4A 4LEOA 3ULVL 2HJFB 3LSOB 5AG8A 4X80L 2QTEA 3VXQB 5IBUB 3L7EB 4YDVA 4UU9B 4BSJA 2QR0B 5IMOA 1A7BA 3NIGF 1H9VA 1OSZB 3W39A 1BREA 1T03L 4CDHA 5CEYB 3E3QC 4OZGB 1RAMA 1CICA 1Z3GL 3HHRB 1X9QA 1HWHB 3T65B 4TVSa 3BIAX 5FUCE 1I1AC 1MSPA 3U2SB 4HX1B 5I71B 4LCCB 2RR3A 1ZGLA 3QUKB 4WFHD 5C0CB 3GJFH 4U6HB 3MYZA 3DETC 4OD1H 3UJIL 5DJ8A 3K2UL 3GKWL 3F7QA 3FQNB 4NHUA 4CJ0A 2VDLL 4JFPB 4UDTB 3OF6D 3HUJB 1J8HE 1AQDA 2FX7L 2VDOL 4KV5F 4TUOB 5F88A 5I75C 3TVMD 1IKNC 4MD0A 3HMXA 5HDQL 5DT1H 3T04D 4JY4B 3R1GL 5TQ2L 1CTOA 3PDDA 1SJEB 4OLEA 3LKOB 5IFJA 1FQ9C 4L4VB 3TA3B 4ZYKA 3T0WA 3C5JB 4YK4C 5MHSD 1CIUA 3IDYB 5MENE 2XPGA 3ZZ1A 4XPAH 3ZDZF 2GK0B 4XCFH 4S1DC 5JUEH 5E2TH 3EDDA 2DAVA 2G5BA 4IRJB 3BGFB 4H1LH 1MY7A 3GRWH 3L3OB 1K9TA 1CXHA 1R3KB 2UWEE 4QRRD 4N8VG 5C0NC 4L8SB 2IPUG 3UYOD 2GUOA 4ZUWA 2GTWA 3WDIA 3MCKB 4BFIA 5J11B 3FZUC 3RDTC 1A2YB 3TNMA 3D0LB 3PP4H 3UPAA 1HH9A 4JPIB 1QNZH 3KS0H 5IWLC 2NY0B 3UJJL 5HYSB 1RSFA 1BF8A 4LPCA 1XGRA 1G9MH 3CXDH 4FXGA 1CDJA 4TULH 2VISB 2LE9A 4NCC1 3VDCA 2EDQA 2BFVH 2CKBA 1CE1L 1T6WA 4I3GA 5JDSA 3FO1A 25C8H 3UTTA 4F2MB 4Z7VA 1CGSH 1JGEA 5FHAL 4GS7B 5DEFB 3TT1H 2EYRA 4XH2A 5AYUH 5E08H 2BVOA 5AAMA 4OBSA 4G8GB 2F53A 3VW3H 1A1OA 4MZ3A 1RZKC 4X7TB 2ZP0T 5E8NB 4N0CC 2NZ9D 3RFZC 3D9AH 2APFA 4OD1L 5FA4A 4BA8A 4M1CD 1Z2KA 1ZSDB 5CEXB 4RGOH 3LS5H 3JV6B 4PLKD 4OFPA 4NRZA 3QQ4B 2VAAA 1HDMA 1MHEA 3EFFB 4U2ZA 4U2YA 1E4WH 4ZFOB 3QRFM 3OB0K 5EC2A 2VLJE 5D93B 4FQJH 5D9SB 5DUMH 4U0RB 5DT1L 2J12B 3A6OA 3IU3A 3QIWD 4ZAKB 3SDXF 1AHWA 2IWGA 5FGRA 1B4RA 4OZIB 2HAZA 3GMNA 5BO1H 2DQFB 5GRJH 5HHNA 2GFBB 4PJBA 3ILPB 3BO8A 3QEHB 4XPAL 5D2NC 2EDRA 1RJCA 4LNVA 1X4YA 1HHHB 2LTQC 5JUEL 5E2TL 3GMLB 5FECA 4AEIH 1F58H 1PVHA 3GRWL 4EDXA 4K55A 4M61B 3QG7H 4QTHA 5D7JB 5ERWA 4D0BB 4P48A 1AO7E 1IAIM 3PP4L 2F15A 1A7PL 2QJDA 4AEFA 1QNZL 1FYTE 3QXAA 5E8PB 4OM0H 1NEZB 1HXYA 1QLFB 4TTDC 3RWJA 1G9ML 1U3HB 4HMDA 3CXDL 4DUWA 5GGVH 4TULL 1OOAA 4GKZA 4WFFD 2PTUA 4GRWB 4OZFB 3CDYA 1U8IA 3NCCB 2BFVL 3IAQA 3RX5A 3P2TA 1BIIB 3TPKA 3F12A 5EFIA 4ZNCD 4LLYB 4QHMA 5KSAC 4WDIB 25C8L 1DQQB 4H0HB 3C2AH 3OGCA 5DD3H 3UCRA 3VRJA 5IJKA 4XMKH 3TT1L 4GW5B 4KKLD 2YN5A 5AYUL 3O4OC 3PUCA 4JFXB 3MLSH 4YFDB 1JIBA 1KPUB 4HJJH 1D6EB 3LAFA 3VW3L 4DUXA 3QXWA 3WKMH 4Y5YA 3LMJH 1DFBH 3D9AL 5KTEH 1JPSH 1YEKH 3VGDA 3ZT5A 3QEUA 1I7UA 3DARA 3S37H 3JTTB 4Y4FA 5CZXD 4H5SA 4RGOL 1U3ZA 3LS5L 4GG6A 1BP3B 1UCTA 5B4MD 1KTLB 3IXAB 3HG1D 2WIIB 4H20L 5ESQA 5TJWK 3UPRB 1DUYB 1E4WL 3IRZA 3DIFA 1IAOB 2IAMB 1FNEB 2HLAB 2ZKHL 3QDGB 5IUSA 5DUML 4MJID 3U48A 2HH0H 3ULSB 2JCCB 4YXLH 4OZHA 1BX2A 4TRPH 2P44B 1V3JA 5F7YC 1BZ7A 4Q9BA 3LEYH 1VKXB 2A83B 3QQ9C 1X3DA 1A1MA 3MZGB 5EU4B 4ZFFB 5DJ0B 1KG0B 2NYYD 5GRJL 3O6LH 1C16A 1T7VA 1FO0B 3SKOB 3SQOH 5D7IE 1CLYH 1HIMH 1T22B 2DQDL 1FZMA 4PJ8A 1U8MB 4G5ZH 3U6RB 4QGTA 5L6YH 3MRRB 4AEIL 5IQ9B 1F58L 3EDKA 1WWCA 4OLZH 3MROA 3HFML 4NKIH 2BRRH 3BRDA 3QG7L 2R0ZL 5L7XH 1CU4H 4CVZB 3HR6A 3BYYA 1ZVSA 2GT9B 4XVUD 1TVBA 1RV6X 2H8PB 4OM0L 3L3GB 3DX7A 1XR8A 5EO9B 4M4PA 4U4BA 4PP2A 2LV4A 3H0TA 5F7NC 4BUHA 3VXRA 2DN7A 3TO4D 3H9SE 1G0XA 5GGVL 3ET9F 4P2QD 2DLEA 2H9GB 3IFOA 2ICWJ 3TPUB 5JHLL 1CFTB 2APTA 1CVRA 1OLZA 4KI5F 4PJ9C 3HE7C 1UXWB 4MNQB 4BQBA 3C2AL 3HE6D 4OGZA 5DD3L 4I77L 4XMKL 5FEBA 1FLTX 3IDGB 1CXFA 1PDKA 2C1PB 3QIUA 4V1DA 2HWZH 2XTJD 3RGVD 4ZD3H 4F80A 3MLSL 3L3HA 2ZUUA 3D5OF 4M9PA 2NX5E 4HJJL 4JZOB 3UEZA 3BPCA 2XWJA 3WKML 2Q6WB 1CGXA 1YY9C 3PWLA 4QXUH 1T0NA 4TSCH 3WJLC 5KTEL 5J6GB 3VI4F 3S37L 4GBXC 4NOFA 2MCG1 2P5WE 1NC2B 3REVA 4FTVB 4IMLB 1INEH 1D5MB 3Q6FA 5EO0A 3FRUB 2YKLH 1IZKA 4PJHE 3LRSB 4MJ2A 1PG7X 2HH0L 1W72H 4BK5A 4YXLL 1DQTA 5IV2A 5JW3H 1MCLA 3HAEB 3LHPH 4TRPL 3DRQB 1OW0A 5I76A 4AT6B 3LEYL 4ENEC 1R24A 4K71B 2ITDA 3QDJA 4V2BA 3VFVB 3O6LL 3SQOL 1CL7I 1P7QA 2OS7A 1HIML 3D39D 4ELMB 5L6YL 3P77B 1KJ2B 2ADJB 2X44D 1A3LH 4OLZL 2CSPA 1KT2A 4LMQE 5L7XL 5BW7A 1CU4L 4KROD 3IXTB 1W0VB 2D7PA 3RZCB 3V4PH 1FN4B 3FO2A 1MFEH 3RWFB 5EULV 2MQ3A 4XHJC 1H3XA 1BZ9B 1WZMA 3GMMB 3DSNA 1JZ3A 3FQRB 3VXUE 3OF6A 1QG3A 2J88H 2JB6B 4O2CB 1AKJA 5HJ3B 4QOKB 2R0WH 1WCBA 3TVMA 1WJ3A 5F44A 1ZXQA 2OZ4A 1PKQB 2W0PA 5J6HA 2AERT 4ZPTA 4YFEA 1JPST 4NQDE 3AMKA 3ALPA 1BVKA 1LK3H 1NAMH 3T3PE 4KTDH 4CAGA 3CVHL 4ZD3L 4GRMB 4R4BA 5I6XC 2ARWA 5DUBB 4FHBD 2BOCB 4OD2B 4NC1C 5C0BD 4IIQB 2ORBH 3HNTH 5DMGD 4YAQA 2ZUYA 1D9KB 4RAUA 2CH8A 4L8SC 4TSCL 4LSPH 2NY6C 4QXUL 2X4QB 3VD7A 5C0CD 1CT8B 2P43B 1WIPA 5I16B 2O5YH 4OD3H 3RRQA 1ULVA 3MA9H 1KCSH 5JA8B 3KNBA 1N3NB 1LO5B 2NY0C 1INEL 3CD4A 4P2OD 3VRLF 2ICWI 1EEQA 2YKLL 2AJUH 2Q20A 5I1GL 5JW3L 1T1YA 4FZEH 4U1JB 1I1RA 5CIPA 5BRZB 4JVWA 3LPGA 1G7LA 2XG4A 4XNZB 2HTKD 1GHFH 4NPYA 4OV5A 4L4VD 3TA3D 3GGWB 4GS7C 5IBLC 1UVQB 5DHVH 4GAYA 3SDDB 2HRPH 4BFGA 5HD8C 5A2JH 4QLRA 3EYSH 5HHXH 1A3LL 3B8SA 5KAQG 4I2XE 1JPGB 4HHAA 3ULUC 3ARGB 3E6HB 4WI4A 5IT2L 1XCQA 3V4PL 1GYAA 3RPIB 1MFEL 4N0FB 3HMWH 3CXHJ 5JIKA 3HZVA 4P23B 5HHPB 2ICCA 2EC9U 3CVIH 3NIDF 1MLBB 1I3GH 3HI1A 1T5XB 4MD5A 1ES0A 1M7DB 3GSNB 5GJTH 4NQCE 2J88L 4OBRA 3MRIB 2EDOA 3BVNB 2R0WL 3VJ6B 3DMMC 2CIIB 3HI6H 3FL7A 1BPVA 1BJ1H 3B9VA 1YUHB 4OF5A 4U0RC 2XFXA 3PJSB 2IEPA 3BW9A 2IALB 4ZAKC 5TFSL 1MCCA 5E5MB 2VAJA 4LCUB 1LK3L 1NAML 1G6RH 3EOTH 1XGYH 1HHIA 4KTDL 3VG0H 4U05A 3J7HA 1R5IA 4L29A 3ESVF 5DXWA 5F7LB 1RZGA 2VH5H 1UM4H 3FQWB 5DRNA 3HNTL 1G7MA 2DLFL 3KPOB 4G8GD 2EDKA 4LSPL 1DP0A 4DVRH 2VLRE 4HUNB 3KPPA 2QQQA 5D7JC 1F8TH 5HPOA 4OD3L 4XCEB 5GZNC 3MA9L 2Q7YB 5BVJB 1MCJA 2BNRA 2QSQA 2ZSWA 2E27H 5JPMB 2Z92A 1CGUA 4MXVF 1HHJB 1J9CT 4X4XA 1YDPB 5KW9H 1MCSA 2AJUL 1MHPH 5IESL 3WNPA 2VIRA 1BM3H 3DXAA 4HUKB 4Z7QF 4FZEL 5FYLE 1RZIB 4Y2DA 4NO0B 4QHLB 1YMMA 1NL0H 3OXSA 1GHFL 1MLCA 3V4UL 5J3HD 1U42A 3OHXB 1G7JA 2DKUA 2QADC 5F9OH 4X6DB 2YPLD 4KK8C 5JOPD 4WVRA 4I9WE 4NZRH 3EYSL 5C09B 3V7AG 5HHXL 4JFDE 3HCVA 1NDMA 3TFKD 4WHYH 2I9LB 3MJ8B 4W6XB 1MWAA 5I8EA 1P2CB 4H0GA 3SGKA 3BUTA 1XR9B 3HMWL 3PV6A 4JQXA 1RJYB 4P5KB 3CVIL 1I3GL 2ZOLA 5GRWA 1WWAX 3T3MF 3HG1A 3AU1B 1J1XL 3RVVC 3MJ9L 4Z7NF 2KH2B 5E6IB 4RAVB 5IVXB 1U3HD 4JFFB 3HI6L 3ZDXE 1PEZA 3B5TA 4G9FB 4JHAH 3MXVH 2K7QA 1ZLWH 2X70A 1N6UA 4XCNB 3EJYD 2P8LB 1KNOB 4WO4A 3WNLA 3SDXA 1G6RL 3P11H 35C8L 3EOTL 2YD9A 1XGYL 5I1DA 3VG0L 5IKCA 2KKQA 4PJEB 2VLKA 1JK8A 5FDYA 1FVEA 1S9KC 1UM4L 2AXJA 5T1KA 5DHYA 5BVPL 4OF0A 4I48B 3O11A 4DVRL 4I0PB 5DJ2B 5FYKU 1EXUB 1KIRB 5JDJA 3NCJH 2VDQH 3R06A 5CBEA 2W91A 3HNSH 4LLMA 4KY1H 5C6WH 5JMOC 3CPLB 1P53A 2HYMA 1T04B 2XG5A 2RGSA 3TO4A 4JRXE 5KW9L 4NFBA 3SCMD 4PLOB 1MHPL 4D9QE 5BZWA 1BM3L 2IAMD 1MCQA 3QDGD 4XP4H 1K8DA 4Y88A 1MI5A 3BP7A 5F21B 4PJXE 5I17B 3MLTA 4NNYB 1YJDC 1IM9D 5D6DA 2JLLA 1NCTA 1NL0L 1QEWA 4H88H 3WFDH 3WD5H 5SV4A 1VEMA 5SX5K 4DQOL 3MGOA 4CW1B 4C57C 1WZLA 5F9OL 3C8KB 1XCTB 4G9DA 1EMTH 2BMKB 4D8PB 5ANMB 3RGVA 1YJDH 4NZRL 5J8OA 1EJOH 3EAKA 3FOLB 3VFSB 2YUXA 3MLZL 4U6YB 2FR4B 2IADA 1DLFH 1CTNA 3G5XB 4RDQG 5TF1H 2CXKA 3ILQD 4DEPB 1H8NA 1LO4H 1IGJA 3TBYB 3G5ZB 3T2QA 1E4XI 2Y36H 4BKLB 1KB9K 1INQA 3W9DA 1FNSH 1JWSA 1AP2B 1HSBB 3TN0B 3R0NA 4S0SD 4C58B 1T2JA 1G1YA 5GPRA 1U95A 3OAYH 2XV6B 2GJ6E 4KWUA 4JHAL 4Y5XB 5BZDA 3MXVL 1NGYA 2N7BA 3D3VE 4J1UA 5CD3A 5I1CL 4LOUD 5F97E 4L1DA 5CP7B 4CMMA 5GQBA 3DTXA 1JZ2A 3C5SA 5IGXH 2EKSB 2ESVB 1I8MB 3AREC 4UI2A 5FKAA 1QSEB 2Z4QB 3WLWD 1O7VA 3GDBA 2VTFA 3RNKB 4X6BA 3GSVB 3D39A 4WNQA 2VXUH 1TZHA 4L4TE 2DMBA 4Q6IA 1M71A 4M7ZB 5C0EB 1X5HA 2P5EB 1G7PA 2D7QA 5IR1A 1EVUA 2VE6B 5IHZA 3L3IB 3EGSA 1CBVH 5KOMC 5LAXA 1WWBX 4PB9H 4OCRH 4KDWA 4I4WB 2YZ1A 3BE1H 4XGZA 3UBXG 2IPKB 3MJ7B 3NCJL 3KLDA 3LQAC 5KSBB 4MDIB 3S96B 3HNSL 3T8XB 4PV8A 4KY1L 3AB0B 1CFSB 1RZFL 4FTVD 5C07A 3VXNA 4IS6A 4R0LC 1T20A 4LCYA 2CRMA 4HZLB 4X7FC 3LQAH 1RHFA 4XP4L 4NN6B 2G75B 5E1AB 2VR4A 1HKLH 3SO3B 2OI9B 1IRAY 5ICYB 4LSRH 5F3HB 1S78C 1ZS8B 5L2KA 2PW1B 2FHCA 3ARBD 4NNPH 4AEEA 2X4NA 4H88L 2R9HD 3WD5L 4LLWB 4OIAA 2NY3B 1T1WA 2JK5A 3MO1A 1EMTL 1OQOA 5E00A 1YJDL 1EJOL 1D3CA 1RI8A 2FECI 2Y5EA 5FYJE 5C0BA 1HSAA 3OJDA 2C3XA 4M93C 4S1SH 4C83A 1DLFL 3MC0A 3VU2A 4PJ5E 5TF1L 3RTQD 3GM8A 3LN5A 5JXED 2FEEI 3MNZA 5D5MF 1KELH 5FYLL 2Y36L 5JOFB 4EXPX 5IMKA 4P4KA 5DD6A 5I74B 1MCDA 1B0GB 4QNPE 5SWQA 5CEZD 4P2OA 2AXFA 1JGLH 3FTGB 5EBLA 3C08H 5HGAA 4NO5A 2D2OA 3L5WA 3BIBX 4ACPA 4W70A 4PYGA 1JTOA 1S7QB 1J8HB 1ZHBA 4TNVK 4L4JA 3FONB 1ZT4A 4URTB 3NFSH 1S9VB 1IJ9A 2CDEB 5IGXL 5DZOA 2WQRA 4J8RA 1UZ6F 3VWJC 2VLME 1QBMH 1QSFE 1I8IA 1JL8A 3DSFH 2VXUL 2FSEA 4M4RA 4MWFB 3W9EA 4HUWA 4YC2B 3TBTB 2Z8VC 1S7VA 2BNQE 5MENB 4JFEE 1D9KD 4N5EC 1KFAH 3VFPB 3KPLB 3ARGC 4LPWA 1DJSA 4PB9L 4OCRL 5GGSB 1JWMA 4Y4KB 1XGTB 2IBZY 1MEXH 4G6FD 5EUKB 3MGTB 5DTFB 2EO1A 2UWEB 4L3EE 3K4DA 5DRZA 4OLVH 5E7BA 2ZUWA 3RL2A 2A9MH 3UTSE 4OLXH 3P0GB 3LQAL 4JKKA 5E7FA 5IROA 4PG9A 4RGMC 3MREB 3O6FA 4LDLB 4YEFA 4LSRL 1J5OH 1GGUA 3PE9A 3IDNB 5F9WB 5F7UA 5BRZD 3LIZH 3GI9H 3RWCB 4L9LB 3JVGC 1F3JB 5MP6H 3SDDD 3STLA 1FE8H 4HUVB 3BISA 1HINH 4S1SL 4DAGH 2WM0A 3ZKSD 5E8EA 3NACL 3DUSA 1P6FA 2IMNA 3PWUB 4NCDA 4NZUH 3LD8C 2Q8BH 2QSCH 4BH8B 2R2BB 4MJ6A 4PP1D 1IZJA 5I66A 1CG9A 1N5AA 4YEEA 1FL5B 4P23D 4TOYH 4Z78B 4WHDA 4UQ3A 1JGLL 5CJXC 5LBSH 4C56A 3C08L 2RCSL 1MHCA 1NCBH 1BF2A 3MCLH 4OT1H 3I9GH 1UJ3B 4JG1H 5AAWA 3MRDB 1CL7H 1CQYA 1DL7H 2ARJA 1U8QA 4RIRB 1XF2B 4YZFE 1FYHB 4U1LB 3NFSL 1CFQA 2VLJB 4PTUA 3QPQC 4JREC 1OF2A 1RZJC 4F7MB 5EIIA 2XRAH 1QBML 3MV9B 3VA6A 1B88A 3AY4C 2YPLA 3DSFL 1B0RB 4JY6A 4H26B 3AM8A 2EXWD 1CGTA 2P49B 4GAFB 2J5LB 2C4FT 4Y5VB 4YIQA 1RZJH 5JORA 3ULVD 3SDYH 1KFAL 4MA1B 4G6AC 4OFIA 1PY9A 4H25B 4O4YH 2BY2A 3O41A 3BXNB 2PO6A 1CD1A 4LKCA 5HGBB 3NPSC 1TQBC 3VGGA 4FFVD 4CU7A 2VWEC 5DYOB 3BKYH 5E6IC 4FQLH 3VI3F 3MLRH 1S7WA 4OLXL 4OTXH 3CVHB 1DBML 4NO3A 3FT3A 4ZFZA 1KTKE 4X83A 4EBQH 1QFOA 1J5OL 5SWZD 1A3QA 3FB7A 5GRVL 4HWEH 4JHWH 4NO0D 4HGKC 3GI9L 3EYQD 1NBVH 3WIFB 1TFHA 4ZODA 4BH7A 2WSKA 2GJZA 4PRHA 5MP6L 2X1XR 4MVBD 4R97C 1QA9A 3GSRA 3L3KB 1R3IH 1FE8L 2VZUA 1HINL 3STBA 3VFTB 1L6XA 2BX5A 3OKKA 1MCKA 4ZFGH 3CC5B 5CINH 4I0PC 4NZUL 3QUXC 3HS0B 2JJSA 1C8PA 3RI5K 1GOGA 2Q8BL 2QSCL 4FMFA 4BUGA 3CUPA 1LE9A 5MEOA 2HP4A 4TOYL 2HLFC 4QWWD 1C5CH 1FVDB 1KB5B 5GZOC 5LBSL 2DBJA 1FNGA 3H7BA 1NBZA 2CLRA 3SCMA 4DZ8B 3MCLL 1NCBL 1NKRA 4OT1L 3I9GL 5DJYA 2ICEA 4JQIH 4I5BA 4JG1L 1CL7L 1DL7L 4G9FD 4MNGA 4NO2B 5K9KB 1NCNA 1CGYA 1QO3B 2KDGA 5JA9A 1MRFL 1IM9A 3MZTA 5DJCA 1A4JB 3PWJA 3ZTNH 3IAGC 4KUCD 4FA8A 2EECA 3FAWA 3U9UB 4XTRD 3QNZB 2OTUA 4P5TB 4DKDC 1RZJL 3NN8B 5C1MB 5HDOA 5D7IB 3SDYL 2OQJA 3D25A 4X5XA 5E56A 4DEPC 2RBLA 1F90H 4O4YL 3WUWA 1A1NB 2EC8A 2NMSA 1T21A 3PNWB 4IDJH 1VADA 3KGRA 3BKYL 5EBMB 4FQLL 4M02A 1HXMB 3MLRL 1IC7H 1YPZA 1OGAB 3QHFH 4OTXL 1F5WA 5CUSH 5FV1L 4HK0A 4Y5XC 3DO7A 3QZWA 2E7LA 4EBQL 3DOSA 4JANB 2DIJA 3H9SB 1RHHA 3FFDA 2VZTA 4HWEL 4JHWL 2ENYA 4YFLI 2Y6SD 4FQ2H 4HEME 2A73B 3KPNB 1L9NA 4LP4A 4P57A 1RUQH 4L5FH 3ZYIA 5EOTA 3QFDB 3QWQB 2VSCA 1YNLL 2Q76B 3T1WA 1T2QH 5JQHC 4M7ZC 1JF5A 4XNUH 3BQUC 2IH3A 4ZFGL 5CINL 5DK0A 2UV3A 3FQTB 1JZ6A 5EUOB 2YEZB 5HSFA 3CSYB 1N59A 1HZHH 3MRJB 1YEDA 3TJHD 2BERA 4FG6D 1Q9LB 2F9BT 1WFUA 2IC2A 1C5CL 4NSKA 4DN3H 4FXKB 5H8DA 3SDAB 3TN0D 1U36A 3ZKXB 3D85B 2JKXA 2P5WB 1SEBA 4I3RH 3C60C 3VFGH 1JNLL 4JQIL 4P49A 4HWNA 4A6YA 4UOW1 4O2EA 4ODXB 4TYUA 1IGYB 3T2OA 1U93B 2OYPA 1J7VR 3DX6B 2XWBB 4PJHB 4DZBB 5F1NB 4I3SH 4P3CH 4H8WH 5KS9B 1ZANH 3ZDYE 3V4VH 2ATKA 4I8DA 2HVJB 1CD0A 3Q48A 3UTTE 4RAHA 4HK3J 3U30C 4EN3B 1IARB 2BSTA 4NQSA 3SJVE 5CKGA 1ZE3C 5HYQB 4GQPH 4GRLB 2DLIA 5FA3A 1JHKH 4JFZL 4AZ8A 5E99H 4U6VH 1ORQA 2F53E 4F7TB 3DGGA 5I1AB 1FHGA 1F90L 1Z9SA 1JNHA 3V0WL 3S98A 1K8IB 2YRPA 1PLGH 5IVZA 1G7QB 2AV7B 1CVSC 1V7NH 2R1YB 5FDWB 4JEGB 3ZTJG 3D2UB 3WLBA 1ND0A 1A6VH 1EEZA 1ITBB 1LO3L 3CU7A 5ACMA 4OCMC 1BD2B 4KRPB 3QHFL 1IC7L 2WUCL 5CUSL 1NH6A 3PHQB 4HKZA 2DJ4A 3VXUB 2ZSVB 1BQUA 1XF5A 4CADB 1Q9KB 4CUCA 3NCYS 2CMRH 1C5BH 4HEPG 4FQ2L 1XGPB 1MY5A 1DZBA 1RUQL 4L5FL 2NY3D 4FQXA 3SDCC 2FD6H 3FHAA 1P4LA 3RZWA 2FIKA 4NQDB 4PJBE 4S2SB 1T2QL 4OI8A 4MZ2A 3VA2C 4HXAL 1I3RB 4XNUL 1H3VA 3ARFB 4XPGH 3RPKA 1RUML 2BSRB 5I19H 1KULA 2RFXB 1CIDA 3MFFB 2DKMA 1JGVH 3EUUA 1LE5B 1JF6A 1JI2A 3SY0A 2FGWL 5E9DB 1BJMA 3AS2A 2Z35B 1YN6A 2DKSA 4DN3L 4X9HA 3QUZA 4M7KH 2HN7A 4I3RL 2NY5C 4U1MA 2IQAB 2VC2L 3VFGL 3HB3C 1IM3B 4N68A 4AY0A 2NTFB 2H6PA 4NZJA 2P7TA 1OTTD 1J8HD 2XXCB 3LKNB 1KJ3H 1ZLVK 3E2HC 4F9LC 4H8WL 5T5NF 1S7UB 1ZANL 5F9WC 3C9NA 4XZUA 4DOHE 3V4VL 4HKBB 1YMHB 2BY0A 5JPNB 2ZCHH 3K1DA 4Y16B 1E4XH 2HT4C 4M43H 1TJHH 3I02A 1JHKL 1CN4A 4W4OA 3SGJC 4U6VL 4F15C 5E24E 4J3TA 3MLUL 3BP6A 3QUYC 2EEAA 1VERA 3T4AA 4Y4KD 1DVFB 5D5MA 1V7NL 4O58H 5GGUB 1QFWI 1A6VL 2CKBH 3QH3B 4I1NB 2FYYA 4GG6E 3J8F7 3ZO0A 1HNFA 4DCQA 5DJDA 1U8OB 2MHAA 2XNAB 3F6LA 1EAPA 2AJ3A 1UJ3C 4NT6B 4NQCB 3EDEA 3KWWA 4HMCA 4WFGE 1F4XH 5CSBA 2CMRL 4XXCA 5E2VH 2X1QA 2MFNA 4JVPA 3KDMB 2FD6L 2PF6A 5FO9A 1LWRA 1ZHNB 4E42A 1T7WA 3W82A 2J5LC 1DE4A 3ARDD 2APWA 4XPGL 3H7LA 1X7QB 1HCVA 1RIHH 2R23A 4MA1C 5I19L 2BVQB 2B4CH 1JGVL 2X42A 3V8CA 4WI7A 1IT9H 3ZSSA 1A9EB 3RVUC 4YHPB 1JGDA 2VLRB 2DWEB 2A6DA 3ARVA 2AVGA 32C2A 5BMFH 3MUJA 3QI9A 4M7KL 4KRNA 3WL9B 5EZLA 3MRKA 4JE4B 1V3KA 3V6BR 4RNRB 5D1XB 3VXRE 2E7CA 1D5XA 3HC0B 1U92B 4CRPA 1KJ3L 2FX9H 5KANG 1GGYA 4GLRI 3BOVA 2X41A 4Z5RB 2VLJD 2ZCHL 1P7KA 1YEHH 1E4XL 4OAWA 4M43L 3EYFB 1NUDA 1TJHL 2H2PD 4NKMA 4JZNA 5FFLA 3M1BB 1CD8A 3S4SG 2X2YA 1T4KB 3O3BA 4NN5C 4YHNA 3IJHB 4QXTA 1IVLA 4YDLC 1QR4A 1NCAH 1CDGA 2VZVA 5DJZB 1EDQA 2UY6A 1YEEL 2I26N 4O58L 1MJUH 5F9DC 2CKBL 3IFLH 3L3DA 4R3SA 2XZAL 4JRWA 4N0UA 1AO7D 2YBRA 5EOQH 4JGMA 4MAYD 4P3DA 1DEDA 4LLQA 1Q9OA 1FYTD 3H9HA 1Q1JH 4X0KB 3D48R 3MRHB 1F4XL 2ZNWA 3PHOA 4OB5H 3F7YA 1JYNA 4HG4K 4XXDA 2ED8A 2J7LA 1XZ0B 1J05B 2Y72A 5E2VL 3KXFB 5L0QB 1KTRL 5EB9A 1TVDA 1DN0B 5DFWH 1NSNH 3QDJE 3V0VA 2VZSA 5EU5B 3U0WL 3GBMH 1HEZB 4G42B 3N50A 4JHZA 3S4SA 5IK3A 4KH2A 1F4AA 4JB9H 2UYLB 3L6FB 4UNVA 1QRNA 1RIHL 1ZVYA 3OX8B 3GSQB 2B4CL 2YA0A 1SMAA 5FM8A 3UBXI 4LLAA 1M6OB 4R90H 4WFHE 2ENSA 1IT9L 2J8UE 1EK3A 3WO4B 3ROLA 1P9MC 4GSDH 5KVEL 5BMFL 1XF4A 1JUFB 3W0WE 5A16A 4KHTL 2WWMC 3VGEA 2E9BA 1YC7A 5GGRB 1RURH 1YQVL 5TGBB 1S7SB 3FKUS 4XNYH 1F6AB 3O3EA 3DURA 3QWRA 4GKSA 3UZEA 3ZYZA 1L4IA 5E2UH 3P73B 4GMTH 2FCBA 4DGYH 2FX9L 1FAIL 2FECL 4JRXB 3G5YB 5E0QA 1OAZH 2C1OB 3V5DB 3GJFA 2FJHA 3SKMB 2GSGA 1AIFB 4HUUA 3BHBB 2FEEL 1YEHL 1GZQB 3GFUA 3MRFB 3ULUF 1UWXH 4IOIA 4LFHG 1F2QA 2E6JA 1QVOA 2YK1H 4R7DB 1J1PL 1IQDA 1UA6H 4JO4H 4KDTA 1OTSD 4P99A 4PRPA 1PYWB 2DYPA 4PGBB 1NCAL 5I8CA 2ADIA 1ORSA 1MJJB 4ZS7H 1KJVB 5AG9A 1MJUL 4L8BB 2L7UA 1S9YA 4PGCA 3SDAC 1IKNA 3E6FA 5EOQL 1YYML 2AXGB 1FNLA 4GO6B 4FFYH 5DGRA 3LCYA 4OZIF 4RRPA 4BK4A 2IH1A 3SO5A 5E8DL 1Q1JL 3IDMA 1MRCH 4OB5L 3H9SD 4HGMA 3GRWA 4MB4A 3MRGA 4HDIB 2NW2A 3V5HA 2PW2A 4PRNA 3L5HA 1D5IH 3X11A 3D3VB 5LG1A 1L9MA 3NIGE 1JF1A 4I18C 3PP3H 1NSNL 3KYOA 3GBML 4NWUH 2OP4H 3BI9X 3WKNA 4U7MA 4JB9L 3F62A 4P2RB 3RDTA 2R2HB 5ICXB 3G6AB 3QDHA 1YECL 5CCKH 1AGBA 3V6FB 2OR7A 3QJHB 4R90L 5CMAA 1BZQK 2B1AH 2X05A 2OTWA 5IWLA 3RKDC 2NX5D 4MMZC 4ZUSB 3LN4B 4GSDL 4MCZB 4G80B 3TZVB 3U1SH 2EDXA 5C08A 1FSKC 3P4NA 1DUZA 3R0MA 4KVNH 5J12B 2R1WA 1CZ8H 1G9EA 2P5WD 4F33A 1RIUH 1RURL 1OM3L 3BKML 3GMOB 4PR5B 5I18H 3ZSTA 4XNYL 4U31A 1EFQA 4KV5E 4CN6A 5E2UL 4GMTL 2AV1A 1A9BA 1JZ4A 1OAZL 4GQ9H 2DD8H 1T5WB 4MHHG 1CXIA 4QHKJ 2JB5H 5JIHA 5HD8D 3HPLA 4YDJB 2UZIH 1WFOA 4EN3D 1TCRB 5GIRA 2EXYD 3NCMA 4GRLD 5FKPB 3MBEC 4PFEA 1I9RH 3ZDZE 3CSGA 1T1ZB 1UA6L 1X5FA 4JO4L 4OQ1A 1Z9MA 5HDLA 2Z31B 3DRTB 1EJ6A 3TT3H 3UTPE 1HQRA 4JR9H 1NGZB 3MRCA 4J6RH 1ZT1B 4ZS7L 3IETB 1Z0MA 1EH9A 4PJ5B 4UDUA 4X5WB 3RWIB 1HH6B 2V7HB 3PL6B 3D2UD 3DMMD 4N9GB 1NANH 2BNRE 2CIKA 5E4EB 4KRPD 1OGTA 4GKNA 5EC1B 5BQ7A 3D18A 3VXUD 2RQ8A 4PJFF 3QHZH 4XPTL 1N8ZA 1MRCL 3DXAE 3KPRD 2AJVH 4K3EL 8FABA 4Y4HC 5I73C 2VRAA 3IFPB 4M5YH 1AXSB 1D5IL 5D2NA 3WXWH 1YMME 3FQXB 1X4ZA 4UMGA 4ZO6A 2SEBA 4O2FB 1AC6A 3S5LA 4NWUL 2OP4L 3MRLA 1EHLH 4NQDD 2X4TB 3DV6B 2ED7A 4IJ3B 2I9TA 1FFOA 3ARFD 4PY8J 3VFRA 3VGAB 4B53A 5J0BA 4LK4A 5CCKL 5DI8B 4LQ1A 2B1AL 1OAQH 4WEMB 4L3CA 1JZ5A 3NFNB 4ZUVA 2BNQB 1VGKA 2JELH 4JFEB 4ZOCA 5FO8A 2D7NA 3KYNB 4G8IA 3VXSA 1N64H 2E8ZA 4E9LA 3U1SL 2F5AH 4XHQA 1TXKA 3BN9C 4KVNL 4W68A 2C9AA 3BGMA 1CZ8L 3PWNA 4G43B 3EJJX 1RIUL 4L3EB 4X6EA 1I7TA 1YNTB 3OMZA 1JRHH 1TTUA 4JM2C 1W8NA 2NXYB 2YD1A 4X8JB 5TQ0H 2DD8L 4D0CB 1TENA 2JB5L 1TITA 2J6EH 1OP5K 2LABA 1WGOA 3B2UD 1HNGA 3MNWA 4HS6B 4AM0A 3SDXE 1T3FB 4YE4H 3BD4A 4Y16D 5IW6B 3OQ3B 2C3WA 2VLKE 4YHML 3DUUA 2X7LA 2VITB 2YD5A 3G5VB 3V7AE 2AGJL 4JFQA 3KLHD 3W81A 2FGZA 2AK4A 1OT1A 1JPTL 3TT3L 3CX5J 3SGEI 3IDIB 1GC1C 5J9PA 4J6RL 3EYVB 4WWID 1FFNB 3OB0H 1DVFD 3C6SB 5EO1A 3X12A 4F7CA 4QRPB 5ADPH 2KQNA 2VZ1A 3W5NA 1KN4H 3MQIA 3VMPA 1OWRM 5EZOH 2FATH 4XPFL 2BVUA 3LZFH 4KJQC 5D1XC 4C4KO 2M1KA 1A6WH 3QHZL 4NQCD 1E6JL 1FZJB 2AJVL 5JZ7D 3I85A 3REWB 4M00A 1UENA 1MI5E 4M5YL 3LKRB 1IGIL 1KPVB 5ID0B 4DKEH 3WXWL 4OQTH 5KSVB 3P9LA 3NBNA 3NPZB 2X1WL 4NGHH 2NR6D 2XQYG 2DICA 2W9DH 1EHLL 1QP1A 4UILH 5I9QC 2V2XA 3LEXA 3EO9H 4CMHB 4G8FA 2DQTH 3CFDB 4WU5A 43CAB 4HJGA 1OAQL 1UB6B 3WS3B 3KPSA 5HYEA 1UWEH 2B2XH 2JELL 2ADGB 4QY8B 1JZ8A 1N64L 4XP9H 1U2CA 2VMFA 2F5AL 4QHNA 1NEUA 3Q5TA 3ELAT 1AY1H 5HYFA 3M17A 1Z6JT 3BEWA 5IBUG 4K3GA 3VRIA 4ZTOH 2V6HA 1FYTA 3O3DA 1JRHL 3HE7A 4XRCB 4PIRF 5KVFL 4MLIA 5TQ0L 3D69A 4IOFC 1A6PA 2PCPA 1HYSD 5L0QC 4QEGA 2J6EL 4PJXF 3P4MB 3VFOB 4G7VH 1JGUH 1MWAH 2GKIA 5FYLD 4UIMA 5I1LA 4YE4L 1BECA 4PY8I 1S7RB 3MXWH 4L8DB 5FM4A 2DQEH 4OCYL 5HDBF 3EO0A 3MV7A 4NJ9L 5D2LF 2VLLB 4KDVA 3HRPA 2PTTB 3HLAA 5TH2B 3EJZD 2P8PA 2BXYA 4I9WD 5GRZA 1JN6B 1KIQA 1W72A 3B2VH 3TEUA 4LGSB 3EOBB 4JFDD 1DQDH 3WO4C 4WUKH 5GSRA 1I7RB 2H1PH 1IEBB 3H9ZA 1XF3B 4D3CH 5ADPL 5C0IA 1NGWB 1ZWIA 5F71A 3VXQA 4CNIA 2FATL 4ODBD 5CAYB 2VXQL 5C07E 3LZFL 3ARRA 3C6LD 2R29H 1A6WL 4LLVB 4RFNB 5L8JB 1H5BB 4HW6A 3BP4B 4LEOB 4HQQH 4MXQC 4DKEL 4D94A 1ZHKA 2BCKB 2V5MA 3QFJB 2CUIA 5L2KE 4OQTL 3QULB 3GJEA 4YDVB 1Q0XH 4KI5E 4NGHL 1FC2D 2W9DL 5IMOB 2GYSA 3EO9L 1DQJA 2VKXA 5T3ZE 5I15L 4PYHA 3W39B 3PQYA 4PGZA 3OG4B 1QFWH 3T2PA 3U4BH 3GSWB 1CE6A 1YEJL 2DQTL 4HPOH 4OGAC 4NIKB 1CICB 2ARJQ 4NP4H 3GSUA 2B2XL 4ESKA 2H41A 3RY4A 5HYSG 4XP9L 3VI4E 1ZGLB 1NAMA 5ISZE 4JN1H 3RHWF 1AY1L 4JY4A 3U83A 3IGAA 4ZTOL 5DJ8B 3RNQA 2VN7A 4X4MA 4NHUB 2X4OB 1P7HL 2FLBT 4PD4J 2MQ0A 5DRXA 4JRXD 1NCCH 1AQDB 3V6OC 4D9QD 5F88B 3BPOB 1YY8A 2J1KA 4G7VL 4KK5C 1KN2H 1JGUL 1MWAL 5L9DH 4DWHA 2HJLA 3DX9A 3OAZH 4YHYB 4Z77A 3MXWL 5EA0H 4AIXA 2CJUH 1S7TA 2AW2A 3TYGH 3UPCA 1KJMA 5JR1H 4CDGC 5IFJB 4ZYKB 3WFBH 4R4NC 4JPIA 1OSPH 2MJWA 2XPGB 3B2VL 5HI4C 5AD0A 2NX5A 4MS8D 5HYSA 1DQDL 1A4KA 4WUKL 1HN1A 2G5BB 1WV7T 2H1PL 4R6UA 4D3CL 1KPRB 4ETQB 4JN2A 4YH6A 2FL5B 4K23H 1WAAF 4GLRH 2OL3H 2CPCA 2GUOB 3AC0A 4BFIB 4XMPL 5K59F 1PD6A 1A21A 1LDPH 3RJDA 5L8LB 5DHVA 3TNMB 2ZOKA 3FOMA 5DQ9A 5IM7A 1HH9B 2R29L 1DDHA 3BPNB 2AQ2A 2EZ0D 4X6DF 5DQDH 2DMKA 4XVSH 2XTLA 1ZGLP 4HQQL 1XGRB 2GJ6D 4FXGB 5F9JA 3D3VD 1Q0XL 5DRWA 3LN9A 4LPTA 2EIZA 4POZC 5IVNA 1JZ7A 1EZVX 2IANA 4N5ED 2EE9A 4BQ6A 3FO1B 4OKVA 5JDSB 1QFWL 3U4BL 3UTTB 4HPOL 4Z7VB 1JGEB 2EDBA 4POUB 1IGTA 4L4TD 4W81A 4NP4L 3JWOC 3QQ4A 2EYRB 4XH2B 4HKXA 4OF7A 1KLGA 2MPAH 2BVOB 4I0KA 5I1KH 1JTPA 1U8NA 2F53B 1NEZG 2L7JA 3RWHA 5D1QC 1GRWA 3P9MA 3U7WH 3VWKB 3DMMA 1G6RA 5HTSA 3TZVD 4JN1L 3TYFA 5E4EC 3JWOH 1JNNH 1IGCH 4ZAKA 5FA4B 3UAJD 1E27B 4C56E 1XAUA 2CR6A 4OZIA 2C5DC 4XB7A 3VFMA 3WBDA 1CYGA 2D31A 2DQCL 3TCXA 4NRZB 3ARPA 3JUYA 3KPRA 3L5JA 2VAAB 1NCCL 1MHEB 3BKCH 3TO2A 3I84A 5JQ6H 2ZNXA 3K8LA 3ZKMD 2GTZA 1KN2L 4WW1A 3GMLA 5L9DL 5EC2B 3SE9H 1J0JA 3IU3B 2NXZB 3KHOA 5EA0L 1B0WA 2XZQH 2CJUL 5E6YA 2YPLE 3G6JF 4IJ3C 3TYGL 1AHWB 4Y1AA 3VGAC 3GMNB 3RA7H 4NQXA 3WFBL 3F8UB 4PJBB 5HHNB 1GOFA 3BO8B 5GS2H 2Z31D 5FYJD 5B38A 1QLFA 3I6LE 5TE7H 4PJ5D 5ITFA 4Z7UF 1YEGH 4EDXB 4K23L 4AEHH 2OL3L 4ZQKB 4WTWA 3PL6D 2IGFH 4QTHB 4WU7A 1J8KA 1KXTB 2YPKA 5HI3C 1LDPL 3F65A 3NIDE 3TGXA 3H3PH 5KANI 3A67L 4LASH 2E7BA 2FBJH 2NXYC 3QXAB 4M1GH 5DQDL 1NMAL 2PN5A 4RGNE 1E4JA 1HXYB 4XVSL 1QACA 2HTLD 3QCVH 4DN4H 3RWJB 1ZA6A 4NUJA 1MF2H 4YBQD 3TJEH 1LEGA 3OR7A 1HHGA 3FB6A 1VFAA 4GKZB 1UM5H 5EU6D 1U8IB 1AJ7H 4PRHE 1EO7A 3F12B 5EFIB 4QHMB 1GAFH 4NRYA 4FRWA<