2CH2A

Structure of the anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
387
structure length
387
Chain Sequence
FTPPPASLRNPLIIPEKIMMGPGPSNCSKRVLTAMTNTVLSNFHAELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYLYGFKESLKATHPDYIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-HYDROXYKYNURENINE TRANSAMINASE
publication title Crystal Structure of the Anopheles Gambiae 3-Hydroxykynurenine Transaminase
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transferase
total genus 135
structure length 387
sequence length 387
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ch2A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ch2A01
2ZYJA 3QHXA 3MKJA 3ZRRA 1AICA 4ZM4A 3D6KA 4AO4A 3VAXA 1MDOA 2OATA 1AIBA 1ASGA 2JGTA 2XH1A 5JAYA 3P6KA 1VEFA 4F5KA 4R5FA 4AO9A 3COGA 4FL0A 4ZDLA 2C7TA 1S06A 2WK7A 2HUFA 4Y0DA 2ZY4A 3LY1A 1BJWA 4A0HA 2VYCA 1EJIA 4K2BA 3RI6A 3CAIA 2YKYA 3BCBA 4ITGA 1IX6A 2QB3A 8AATA 4L0OA 3DYDA 5G4IA 4IYOB 3FSLA 2W8WA 1C4KA 3LVJA 2QLRA 4JF1A 3G0TA 4CXQA 4WYGA 4WP0A 2D65A 4H51A 4RLGA 5M46A 4EMYA 3K7YA 1WYTB 1ASBA 3UWCA 3I4JA 3DR7A 4WYFA 5E5IA 3MAFA 3BWNA 4MQPA 4HF8A 2EZ1A 4E3QA 2CJGA 3DXVA 1UU0A 2D63A 2Z1YA 3H7FA 3JZLA 3M5UA 4TV7A 4WBTA 4XJLA 3DC1A 3ELEA 5EUNA 1CS1A 1ARGA 1LC8A 1AHFA 2R5EA 2YRIA 2HORA 2DGMA 3UE8A 4FFCA 1QIRA 5G0AA 2VGTA 1FG3A 1TOGA 2VIAA 3NUIA 1QISA 1Z7DA 3NYSA 4CVQA 5FT5A 4IXZA 2DGLA 3GZCA 1V2FA 1AMAA 1SPAA 2QA3A 3VK2A 1C9CA 1W7LA 1ASEA 1PG8A 2GQNA 2ZY5A 3FTBA 2Z9UA 4JEYA 3FVSA 4WB0A 4AOAA 3BC8A 1CQ8A 3RBFA 3MADA 3NNKA 1GC0A 4W91A 1RV4A 4B98A 2EO5A 4LW4A 3GWPA 1WYUA 4A6UA 2Q7WA 4W8IA 4JE5D 1KKPA 1PFFA 2VI9A 2W7HA 4B9BA 4Y0IA 1BW0A 1LC5A 5DX5A 5TF5A 2X5FA 1GCKA 2FN6A 2W7FA 3AEJC 4ZASA 3BS8A 3PJ0A 2VMUA 4PFFA 4JEXA 1ZODA 5EFSA 3CQ4A 3EUCA 4PVFA 3TATA 2VMPA 4LNJA 3FD0A 2D66A 1G7XA 4GE9A 4KAMA 2BI9A 3CQ6A 1S09A 4IY7A 3K40A 2CY8A 1YJSA 1J04A 2EGYA 2VMSA 4JEWA 2FM1A 2D61A 1CQ6A 2VGVA 4RJYA 3H14A 1G7WA 3ELPA 4UHOA 2R5CB 2AY2A 2YHKA 1OXPA 3GBXA 1DJEA 1DKAA 2E54A 4ZM3A 2BI3A 1XEYA 2X3LA 2CTZA 3FCRA 3FFRA 3LV2A 3MC6C 4K2MA 3NRAA 4ZAHA 5F9SA 4BMKA 1DGDA 1IX8A 4F5IA 2HUIA 4WXFA 4A6RA 2O7CA 5HXXA 2VMOA 2VGZA 3NX3A 3JU7A 4CXRA 3N0LA 4J5UA 1QZ9A 1JS3A 4LW2A 3AATA 2YKUA 3E9KA 3B1DA 5AX8A 1JG8A 3MC6A 1TARA 2WK8A 1GC4A 3B8XA 3KKIA 3PDBA 3HT4A 3EI8A 3E2YA 3VK4A 1ARHA 1ELQA 1TOKA 4XEWA 3HL2A 4BQ0A 3P1TA 4UQVA 4ZSYA 2VMVA 1TOEA 2BIEA 1Z3ZA 2YKVA 3TFTA 3PA9A 1ASAA 1X0MA 2C81A 3ZZJA 3F9TA 4Q31A 1E5EA 1UU1A 2VLFA 1M0QA 4E77A 3E2ZB 4P7YA 1U08A 1EG5A 3RCHA 1D2FA 4W5KA 1QITA 2AEUA 4RAEA 3LWSA 4WD2A 3WCNA 4W1XA 4BA4A 1SVVA 2PB2A 1B9IA 3FQ8A 3L44A 1ASMA 5BJ4A 2OQXA 1OXOA 1M0OA 1BT4A 3A8UX 3FZ7A 4PFNA 2OKJA 2W8TA 3CBFA 1V2EA 5G4JA 2Z61A 3AEOA 1O69A 4WYCA 1JS6A 2VGWA 2QBTA 2DKBA 2BIGA 2R5CA 2AY5A 5EQCA 1MGVA 3BWNC 1B8GA 3E77A 4WYEA 4XJOA 3NYTA 4GRXA 1GEXA 2VGUA 1SZKA 4WLHA 1AHYA 1IBJA 1RVUA 2GMUA 4ZSWA 3WGCA 5EUDA 3FQ7A 2VMNA 1UU2A 1DTYA 5F8VA 3EI7A 4ATPA 1AY4A 1B4XA 2HZPA 3MEBA 2W7IA 3EIAA 1AMSA 1MAQA 1ASFA 3AENB 2FQ6A 2ZY3A 3N75A 1BJOB 4Q6RA 1PMOA 3AEMA 1YJZA 2RFVA 3WLXA 1AJSB 4Y0HA 1J32A 3DODA 3QI6A 1Y4IA 2VMWA 1TOIA 3DZZA 1LW4A 1VJOA 1AKCA 3HDOA 4MQRA 3MAUA 4WYDA 4K2IA 1B5PA 3NU8A 1TPLA 1AMQA 3F6TA 4ZWVA 2WK9A 4IX8A 2HUUA 3K28A 1G4XA 5J8QA 1DJUA 1SF2A 1MLZA 2DKJA 4RIZA 4M2JA 1LC7A 4AH3A 5M4BA 3TQXA 1EQBA 2JJEA 4ADDA 2BWNA 4N0WA 4ZDPA 3AV7A 3LVMA 1AHGA 2AY4A 2Z67A 3W1HA 3BCAA 4TN4A 1FG7A 4WXGA 3EZ1A 3WGBA 5DB5A 3WCOA 1AKAA 2VLHA 1ARIA 5LH9A 1GDEA 1I48A 1WKHA 2W7GA 3A9ZA 1W7NA 1M6SA 3FVUA 1O62A 2CH2A 1ZOBA 2EPJA 1MDXA 2CSTA 2ZUKA 3CQ5A 4IXOA 2DGKA 3QGUA 4IYOA 4AZKA 4F5FA 2HOZA 2BYJA 1KKJA 1O61A 3JW9A 4IW7A 2PO3A 1N8PA 1ELUA 2CFBA 2O1BA 1DGEA 4J8LA 4W1WA 1AY8A 5DJ9A 2W8UA 1I41A 1WYTA 3G8MA 1AAMA 2BYLA 5EAVA 3QPGA 4UOYA 2JG2A 2YCNA 5FT4A 1WYVB 3VK3A 3JWBA 1FC4A 3ASAA 4UHNA 4U1TA 3A9XA 3ECDA 1MLYA 3PD6B 4KYOA 4GEBA 4R2NA 4ADCA 1DFOA 1QGNA 2Z9XA 3IF2A 1TASA 1H1CA 2D5YA 3II0A 4F5JA 1WSTA 3I16A 1AJRA 1IAYA 1ASCA 3NTJA 5EUEA 2ZP7A 2W7JA 3W1IA 3UAKA 4OMAA 2FNUA 2NMPA 1LS3A 1O4SA 5G09A 2VMQA 4EB5A 3EIBA 3B46A 1OATA 4O6ZA 1GD9A 2AATA 4RITA 1C7GA 3Q8NA 3RQ1A 1D7VA 1BQAA 5HDMA 3BB8A 1ASNA 3R9AA 2FNIA 3NU7A 4XJPA 3EI9A 2C0RA 1N2TA 4W1VA 2BWPA 5M4DA 3WZFA 3BN1A 5IWQA 1LKCA 3BV0A 4OYTA 3NDNA 1D7SA 1RVYA 1VP4A 2YCPA 2AY3A 3LVKA 2D7YA 2E7UA 2JISA 3I5TA 3PDXA 1IVRA 4HVKA 1G4VA 1M4NA 3B1EA 3G7QA 2OGAA 3ZZKA 1XI9A 4E1OA 1KL1A 3MAFB 2W7KA 3EI6A 3FQAA 5E3KA 1BJ4A 4MY5A 1YOOA 2YKXA 2CJHA 4OBVA 2D7ZA 3FKDA 4ZLVA 2BI1A 3TCMA 3B1CA 1OHVA 1SZSA 1N31A 4DBCA 3GZDA 1MDZA 2BKWA 2AY1A 1D7RA 4RM1A 3FVXA 4RJ0A 3ZRQA 1WKGA 3LG0A 2ZY2A 3AOWA 2AY9A 1IX7A 4WLJA 5C6UA 4GSAA 5BJ3A 1SFFA 3KE3A 2GSAA 5M49A 4GE4A 4Q75A 4Q76A 3VP6A 1QJ5A 4F5LA 2AEVA 3KGXA 4EU1A 2C44A 2G6WA 4OCAA 2TPLA 4JF0A 4ATQA 4IXSA 1M0PA 3W1JA 1ORDA 2R0TA 3ISLA 3QBOA 4ZDOA 1AY5A 4OT8A 1M0NA 4WB0B 1QJ3A 2Z1ZA 4E3RA 3AEPA 4P3MA 3HLMA 4EFFA 2VMZA 4WYAA 2O0RA 9AATA 3AEMC 1GC2A 1WYUB 1BS0A 4NOGA 3OKSA 3FFHA 1V2DA 2DR1A 2VMRA 3IHJA 4MGRA 4F5HA 1LW5A 2FYFA 2HOXA 1I29A 2QB2A 2VMTA 4BHDA 5EIGB 3RUYA 2ORDA 1AIAA 3ASBA 1BJNA 3FZ8A 2CB1A 2W8VA 3PGYA 3QM2A 3R4TA 1M7YA 4RKCA 4CBSA 1IJIA 2VI8A 5LHAA 3AELA 3BCXA 4A0GA 4MQQA 2VIBA 4MKJA 1C7NA 3GR9A 3E2ZA 5HHYA 1E5FA 3N5MA 2D64A 4GE7A 4LC3A 1I43A 2GB3A 3T32A 1ARSA 3WKSA 1MAPA 4LNLA 3MBBA 2VGSA 2Z20A 4UHMA 4XQ2A 4F5GA 3DRDA 4LNMA 2R2NA 2E7JA 3OP7A 5I92A 1SZUA 3ATHA 2VMYA 5EAAA 3A9YA 3QN6A 4KXKA 4R8DA 2HP1A 2E7IA 4RKDA 3ZRPA 1X29A 2OKKA 4TMRA 2BHXA 4XJMA 5DJ1A 1CZEA 3EI5A 3DR4A 3JTXA 3NUBA 1RV3A 4GDYA 1AMRA 1GEYA 5K8BA 1W23A 1S07A 5D95A 1CQ7A 2PB0A 2AY7A 3FRKA 3PDBB 1IUGA 2DOUA 2OGEA 2W7DA 2CANA 4QGRA 1TOJA 3TFUA 2Z9WA 3WY7A 4A0RA 4N0BA 1OHYA 2CINA 2ZJGA 4A00A 4EB7A 4OC9A 3RBLA 3VOMA 3FDDA 3HQTA 4OBUA 2HOYA 5D5SA 4A72A 3L8AA 2ZSMA 2YRRA 3AENA 3FDBA 1C7OA 1ASLA 2YOBA 4JE5A 2HP2A 1H0CA 1T3IA 1BJOA 4M2KA 3GETA 1AHXA 1LK9A 3DU4A 1V72A 2YCTA 2W7LA 3RCHB 1C0NA 3FZ6A 5EIGA 1AJSA 3F0HA 2V1PA 3E6GA 4ISYA 1D7UA 1BKGA 4MKKA 1PMMA 4OTLA 1GBNA 3HMUA 1DJ9A 3WKRA 4XAUA 1ASDA 5FT8A 1P3WA 1W7MA 3AEJA 1YJYA 2BI2A 1UKJA 2EZ2A 4R5ZA 1X2AA 4CBRA 3NYUA 1ECXA 2W8JA 2Z9VA 3WX9A 4AZJA 4BA5A 3GSBA 1KMJA 1B5OA 4ZWMA 3USFA 2CJDA 1B9HA 2JJGA 4F5MA 1ZC9A 2AY8A 2W7MA 2BI5A 2EH6A 2GMSA 3AOVA 4I8AA 1JF9A 1YIYA 2WKAA 4ADEA 5G2QA 1CL1A 1AAWA 3JWAA 2QMAA 3PIUA 4ADBA 1IAXA 1S0AA 4JEZA 1CJ0A 2JJFA 3BWOA 3A2BA 1BQDA 4M2MA 4U2HA 5E4ZA 1X28A 3GZDC 4A6TA 3PPLA 2F8JA 1AHEA 1GC3A 1YNUA 3HBXA 3KGWA 4MSOA 1KL2A 1KMKA 1CZCA 4F4EA 1OHWA 3LVLB 1S08A 1ARTA 1YIZA 2V0YA 2ZC0A 3DXWA 1M32A 1AX4A 2X8UA 4WXBA 2ZSLA 1YAAA 4JEVA 2VMXA 3EZSA 4DQ6A 1W3UA 4ITXA 1GEWA 3GJUA 3E2FA 3HVYA 1WYVA 2AY6A 3PAAA 5FT6A 4DGTA 7AATA 4A0FA 2W7EA 4PIWA 2X5DA 3ACZA 1CL2A 2JJHA 2CH1A 5G2PA 2BIAA 2XBNA 3PD6A 1AKBA 4XK1A 2BWOA 1TATA
chains in the Genus database with same CATH superfamily
2ZYJA 3QHXA 3MKJA 3ZRRA 1AICA 4ZM4A 3D6KA 4AO4A 3VAXA 1MDOA 2OATA 1AIBA 1ASGA 2JGTA 2XH1A 5JAYA 3P6KA 1VEFA 4F5KA 4R5FA 4AO9A 3COGA 4FL0A 4ZDLA 2C7TA 1S06A 2WK7A 2HUFA 4Y0DA 2ZY4A 3LY1A 1BJWA 4A0HA 2VYCA 1EJIA 4K2BA 3RI6A 3CAIA 2YKYA 3BCBA 4ITGA 1IX6A 2QB3A 8AATA 4L0OA 3DYDA 5G4IA 4IYOB 3FSLA 2W8WA 1C4KA 3LVJA 2QLRA 4JF1A 3G0TA 4CXQA 4WYGA 4WP0A 1KAFA 2D65A 4H51A 4RLGA 5M46A 4EMYA 3K7YA 1WYTB 1ASBA 3UWCA 3I4JA 3DR7A 4WYFA 5E5IA 3MAFA 3BWNA 4MQPA 4HF8A 2EZ1A 4E3QA 2CJGA 3DXVA 1UU0A 2D63A 2Z1YA 3H7FA 3JZLA 3M5UA 4TV7A 4WBTA 4XJLA 3DC1A 3ELEA 5EUNA 1CS1A 1ARGA 1LC8A 1AHFA 2R5EA 2YRIA 2HORA 2DGMA 3UE8A 4FFCA 1QIRA 5G0AA 2VGTA 1FG3A 1TOGA 2VIAA 3NUIA 1QISA 1Z7DA 3NYSA 4CVQA 5FT5A 4IXZA 2DGLA 3GZCA 1V2FA 1AMAA 1SPAA 2QA3A 3VK2A 1C9CA 1W7LA 1ASEA 1PG8A 2GQNA 2ZY5A 3FTBA 2Z9UA 4JEYA 3FVSA 4WB0A 4AOAA 3BC8A 1CQ8A 3RBFA 3MADA 3NNKA 1GC0A 4W91A 1RV4A 4B98A 2EO5A 4LW4A 3GWPA 1WYUA 4A6UA 2Q7WA 4W8IA 4JE5D 1KKPA 1PFFA 2VI9A 2W7HA 4B9BA 4Y0IA 1BW0A 1LC5A 5DX5A 5TF5A 2X5FA 1GCKA 2FN6A 2W7FA 3AEJC 4ZASA 3BS8A 3PJ0A 2VMUA 4PFFA 4JEXA 1ZODA 5EFSA 3CQ4A 3EUCA 4PVFA 3TATA 2VMPA 4LNJA 3FD0A 2D66A 1G7XA 4GE9A 4KAMA 2BI9A 3CQ6A 1S09A 4IY7A 3K40A 2CY8A 1YJSA 1J04A 2EGYA 2VMSA 4JEWA 2FM1A 2D61A 1CQ6A 2VGVA 4RJYA 3H14A 1G7WA 3ELPA 4UHOA 2R5CB 2AY2A 4K05A 2YHKA 1OXPA 3GBXA 1DJEA 1DKAA 2E54A 4ZM3A 2BI3A 1XEYA 2X3LA 2CTZA 3FCRA 3FFRA 3LV2A 3MC6C 4K2MA 3NRAA 4ZAHA 5F9SA 4BMKA 1DGDA 1IX8A 4F5IA 2HUIA 4WXFA 4A6RA 2O7CA 2A1VA 5HXXA 2VMOA 2VGZA 3NX3A 3JU7A 4CXRA 3N0LA 4J5UA 1QZ9A 1JS3A 4LW2A 3AATA 2YKUA 3E9KA 3B1DA 5AX8A 1JG8A 3MC6A 1TARA 2WK8A 1GC4A 3B8XA 3KKIA 3PDBA 3HT4A 3EI8A 3E2YA 3VK4A 1ARHA 1ELQA 1TOKA 4XEWA 3HL2A 4BQ0A 3P1TA 4UQVA 4ZSYA 2VMVA 1TOEA 2BIEA 1Z3ZA 2YKVA 3TFTA 3PA9A 1ASAA 1X0MA 2C81A 3ZZJA 3F9TA 4Q31A 1E5EA 1UU1A 2VLFA 1M0QA 4E77A 3E2ZB 4P7YA 1U08A 1EG5A 3RCHA 1D2FA 4W5KA 2G7JA 1QITA 2AEUA 4RAEA 3LWSA 4WD2A 3WCNA 4W1XA 4BA4A 1SVVA 2PB2A 1B9IA 3FQ8A 3L44A 1ASMA 5BJ4A 2OQXA 1OXOA 1M0OA 1BT4A 3A8UX 3FZ7A 4PFNA 2OKJA 2W8TA 3CBFA 1V2EA 3N4RA 5G4JA 2Z61A 3AEOA 1O69A 4WYCA 1JS6A 2VGWA 2QBTA 2DKBA 2BIGA 2R5CA 2AY5A 5EQCA 1MGVA 3BWNC 1B8GA 3E77A 4WYEA 4XJOA 3NYTA 4GRXA 1GEXA 2VGUA 1SZKA 4WLHA 1AHYA 1IBJA 1RVUA 2GMUA 4ZSWA 3WGCA 4H63Q 5EUDA 3FQ7A 2VMNA 1UU2A 1DTYA 5F8VA 3EI7A 4ATPA 1AY4A 1B4XA 2HZPA 3MEBA 2W7IA 2QSRA 3EIAA 1AMSA 1MAQA 1ASFA 3AENB 2FQ6A 2ZY3A 3N75A 1BJOB 4Q6RA 1PMOA 3AEMA 1YJZA 2RFVA 3WLXA 1AJSB 4Y0HA 1J32A 3DODA 3QI6A 1Y4IA 2VMWA 1TOIA 3DZZA 1LW4A 1VJOA 1AKCA 3HDOA 4MQRA 3MAUA 4WYDA 4K2IA 1B5PA 3NU8A 1TPLA 1AMQA 3F6TA 4ZWVA 2WK9A 4IX8A 2HUUA 3K28A 1G4XA 5J8QA 5KTBA 1DJUA 1SF2A 1MLZA 2DKJA 4RIZA 4M2JA 1LC7A 4AH3A 5M4BA 2EYQA 3TQXA 3N4SA 1EQBA 2JJEA 4ADDA 2BWNA 4N0WA 4ZDPA 3AV7A 3LVMA 1AHGA 2AY4A 2Z67A 3W1HA 3BCAA 4TN4A 1FG7A 4WXGA 3EZ1A 3WGBA 5DB5A 3WCOA 1AKAA 2VLHA 1ARIA 5LH9A 1GDEA 1I48A 1WKHA 2W7GA 3A9ZA 1W7NA 1M6SA 3FVUA 1O62A 2CH2A 1ZOBA 2EPJA 1MDXA 2CSTA 2ZUKA 2FKIA 3CQ5A 4IXOA 2DGKA 3QGUA 4IYOA 4AZKA 4F5FA 2HOZA 2BYJA 1KKJA 1O61A 3JW9A 4IW7A 2PO3A 1N8PA 1ELUA 2CFBA 2O1BA 1DGEA 4J8LA 4W1WA 1AY8A 5DJ9A 2W8UA 1I41A 1WYTA 3G8MA 1AAMA 2BYLA 5EAVA 3QPGA 4UOYA 2JG2A 2YCNA 5FT4A 1WYVB 3VK3A 3JWBA 1FC4A 3ASAA 4UHNA 4U1TA 3A9XA 3ECDA 1MLYA 3PD6B 4KYOA 4GEBA 4R2NA 4ADCA 1DFOA 1QGNA 2Z9XA 3IF2A 1TASA 1H1CA 2D5YA 3II0A 4F5JA 1WSTA 3I16A 1AJRA 1IAYA 1ASCA 3NTJA 5EUEA 2ZP7A 2W7JA 3W1IA 3UAKA 4OMAA 2FNUA 2NMPA 1LS3A 1O4SA 5G09A 2VMQA 4EB5A 3EIBA 3B46A 1OATA 4O6ZA 1GD9A 2AATA 4RITA 1C7GA 3Q8NA 3RQ1A 1D7VA 1BQAA 5HDMA 3BB8A 1ASNA 3R9AA 2FNIA 3NU7A 4XJPA 3EI9A 2C0RA 1N2TA 4W1VA 2BWPA 5M4DA 3WZFA 3BN1A 5IWQA 1LKCA 3BV0A 4OYTA 3NDNA 1D7SA 1RVYA 1VP4A 2YCPA 2AY3A 3LVKA 2D7YA 2E7UA 2JISA 3I5TA 3PDXA 1IVRA 4HVKA 1G4VA 1M4NA 3B1EA 3G7QA 2OGAA 3ZZKA 1XI9A 4E1OA 1KL1A 3MAFB 2W7KA 3EI6A 3FQAA 5E3KA 1BJ4A 4MY5A 1YOOA 2YKXA 2CJHA 4OBVA 2D7ZA 3FKDA 4ZLVA 2BI1A 3TCMA 3B1CA 1OHVA 1SZSA 1N31A 4DBCA 3GZDA 1MDZA 2BKWA 2AY1A 1D7RA 4RM1A 3FVXA 4RJ0A 3ZRQA 1WKGA 3LG0A 2ZY2A 3AOWA 2AY9A 1IX7A 4WLJA 5C6UA 4GSAA 5BJ3A 1SFFA 3KE3A 2GSAA 5M49A 4GE4A 4Q75A 4Q76A 3VP6A 1QJ5A 4F5LA 2AEVA 3KGXA 4EU1A 2C44A 2G6WA 4OCAA 2TPLA 4JF0A 4ATQA 4IXSA 1M0PA 3W1JA 1ORDA 2R0TA 3ISLA 3QBOA 4ZDOA 1AY5A 4OT8A 1M0NA 4WB0B 1QJ3A 2Z1ZA 4E3RA 3AEPA 4P3MA 3HLMA 4EFFA 2VMZA 4WYAA 2O0RA 9AATA 3AEMC 1GC2A 1WYUB 1BS0A 4NOGA 3OKSA 3FFHA 1V2DA 2DR1A 2VMRA 3IHJA 4MGRA 3H9XA 4F5HA 1LW5A 2FYFA 2HOXA 1I29A 2QB2A 2VMTA 4BHDA 5EIGB 3RUYA 2ORDA 1AIAA 3ASBA 1BJNA 3FZ8A 2CB1A 2W8VA 3PGYA 3QM2A 3R4TA 1M7YA 4RKCA 4CBSA 1IJIA 3N4XA 2VI8A 5LHAA 3AELA 3BCXA 4A0GA 4MQQA 2VIBA 4MKJA 1C7NA 3GR9A 3E2ZA 5HHYA 1E5FA 3N5MA 2D64A 4GE7A 4LC3A 1I43A 2GB3A 3T32A 1ARSA 3WKSA 1MAPA 4LNLA 3MBBA 2VGSA 2Z20A 4UHMA 4XQ2A 4F5GA 3DRDA 4LNMA 2R2NA 2E7JA 3OP7A 5I92A 1SZUA 3ATHA 2VMYA 5EAAA 3A9YA 3QN6A 4KXKA 4R8DA 2HP1A 2E7IA 4RKDA 3ZRPA 1X29A 2OKKA 4TMRA 2BHXA 4XJMA 5DJ1A 1CZEA 3EI5A 3DR4A 3JTXA 3NUBA 1RV3A 4GDYA 1AMRA 1GEYA 5K8BA 1W23A 1S07A 5D95A 1CQ7A 2PB0A 2AY7A 3FRKA 3PDBB 1IUGA 2DOUA 2OGEA 2W7DA 2CANA 4QGRA 1TOJA 3TFUA 2Z9WA 3WY7A 4A0RA 4N0BA 1OHYA 2CINA 2ZJGA 4A00A 4EB7A 4OC9A 3RBLA 3VOMA 3FDDA 3HQTA 4OBUA 2HOYA 5D5SA 2KFPA 4A72A 3L8AA 2ZSMA 2YRRA 3N7NA 3AENA 3FDBA 1C7OA 1ASLA 2YOBA 4JE5A 2HP2A 1H0CA 1T3IA 1BJOA 4M2KA 3GETA 1AHXA 1LK9A 3DU4A 1V72A 2YCTA 2W7LA 3RCHB 1C0NA 3FZ6A 5EIGA 1AJSA 3F0HA 2V1PA 3E6GA 4ISYA 1D7UA 1BKGA 4MKKA 1PMMA 4OTLA 1GBNA 3HMUA 1DJ9A 3WKRA 4XAUA 1ASDA 5FT8A 1P3WA 1W7MA 3AEJA 1YJYA 2BI2A 1UKJA 2EZ2A 4R5ZA 1X2AA 4CBRA 3NYUA 1ECXA 2W8JA 2Z9VA 3WX9A 4AZJA 4BA5A 3GSBA 1KMJA 1B5OA 4ZWMA 3USFA 2CJDA 1B9HA 2JJGA 4F5MA 1ZC9A 2AY8A 2W7MA 2BI5A 2EH6A 2GMSA 3AOVA 4I8AA 1JF9A 1YIYA 2WKAA 4ADEA 5G2QA 1CL1A 1AAWA 3JWAA 2QMAA 3PIUA 4ADBA 1IAXA 1S0AA 4JEZA 1CJ0A 2JJFA 3BWOA 3A2BA 1BQDA 4M2MA 4U2HA 5E4ZA 1X28A 3GZDC 4A6TA 3PPLA 2F8JA 1AHEA 1GC3A 1YNUA 3HBXA 3KGWA 4MSOA 1KL2A 1KMKA 1CZCA 4F4EA 1OHWA 3LVLB 1S08A 1ARTA 1YIZA 2V0YA 2ZC0A 3DXWA 1M32A 1AX4A 2X8UA 4WXBA 2ZSLA 1YAAA 4JEVA 2VMXA 3EZSA 4DQ6A 1W3UA 4ITXA 1GEWA 3GJUA 3E2FA 3HVYA 1WYVA 2AY6A 3PAAA 5FT6A 4DGTA 7AATA 4A0FA 2W7EA 4PIWA 2X5DA 3ACZA 2WB6A 1CL2A 2JJHA 2CH1A 5G2PA 2BIAA 2XBNA 3PD6A 1AKBA 4XK1A 2BWOA 1TATA
chains in the Genus database with same CATH topology
2ZYJA 3QHXA 3MKJA 3ZRRA 1AICA 4ZM4A 3D6KA 4AO4A 3VAXA 1MDOA 2OATA 1AIBA 1ASGA 2JGTA 2XH1A 5JAYA 3P6KA 1VEFA 4F5KA 4R5FA 4AO9A 3COGA 4FL0A 4ZDLA 2C7TA 1S06A 2WK7A 2HUFA 4Y0DA 2ZY4A 3LY1A 1BJWA 4A0HA 2VYCA 1EJIA 4K2BA 3RI6A 3CAIA 2YKYA 3BCBA 4ITGA 1IX6A 2QB3A 8AATA 4L0OA 3DYDA 5G4IA 4IYOB 3FSLA 2W8WA 1C4KA 3LVJA 2QLRA 4JF1A 3G0TA 4CXQA 4WYGA 4WP0A 2D65A 4H51A 4RLGA 5M46A 4EMYA 3K7YA 1WYTB 1ASBA 3UWCA 3I4JA 3DR7A 4WYFA 5E5IA 3MAFA 3BWNA 4MQPA 4HF8A 2EZ1A 4E3QA 2CJGA 3DXVA 1UU0A 2D63A 2Z1YA 3H7FA 3JZLA 3M5UA 4TV7A 4WBTA 4XJLA 3DC1A 3ELEA 5EUNA 1CS1A 1ARGA 1LC8A 1AHFA 2R5EA 2YRIA 2HORA 2DGMA 3UE8A 4FFCA 1QIRA 5G0AA 2VGTA 1FG3A 1TOGA 2VIAA 3NUIA 1QISA 1Z7DA 3NYSA 4CVQA 5FT5A 4IXZA 2DGLA 3GZCA 1V2FA 1AMAA 1SPAA 2QA3A 3VK2A 1C9CA 1W7LA 1ASEA 1PG8A 2GQNA 2ZY5A 3FTBA 2Z9UA 4JEYA 3FVSA 4WB0A 4AOAA 3BC8A 1CQ8A 3RBFA 3MADA 3NNKA 1GC0A 4W91A 1RV4A 4B98A 2EO5A 4LW4A 3GWPA 1WYUA 4A6UA 2Q7WA 4W8IA 4JE5D 1KKPA 1PFFA 2VI9A 2W7HA 4B9BA 4Y0IA 1BW0A 1LC5A 5DX5A 5TF5A 2X5FA 1GCKA 2FN6A 2W7FA 3AEJC 4ZASA 3BS8A 3PJ0A 2VMUA 4PFFA 4JEXA 1ZODA 5EFSA 3CQ4A 3EUCA 4PVFA 3TATA 2VMPA 4LNJA 3FD0A 2D66A 1G7XA 4GE9A 4KAMA 2BI9A 3CQ6A 1S09A 4IY7A 3K40A 2CY8A 1YJSA 1J04A 2EGYA 2VMSA 4JEWA 2FM1A 2D61A 1CQ6A 2VGVA 4RJYA 3H14A 1G7WA 3ELPA 4UHOA 2R5CB 2AY2A 4K05A 2YHKA 1OXPA 3GBXA 1DJEA 1DKAA 2E54A 4ZM3A 2BI3A 1XEYA 2X3LA 2CTZA 3FCRA 3FFRA 3LV2A 3MC6C 4K2MA 3NRAA 4ZAHA 5F9SA 4BMKA 1DGDA 1IX8A 4F5IA 2HUIA 4WXFA 4A6RA 2O7CA 2A1VA 5HXXA 2VMOA 2VGZA 3NX3A 3JU7A 4CXRA 3N0LA 4J5UA 1QZ9A 1JS3A 4LW2A 3AATA 2YKUA 3E9KA 3B1DA 5AX8A 1JG8A 3MC6A 1TARA 2WK8A 1GC4A 3B8XA 3KKIA 3PDBA 3HT4A 3EI8A 3E2YA 3VK4A 1ARHA 1ELQA 1TOKA 4XEWA 3HL2A 4BQ0A 3P1TA 4UQVA 4ZSYA 2VMVA 1TOEA 2BIEA 1Z3ZA 2YKVA 3TFTA 3PA9A 1ASAA 1X0MA 2C81A 3ZZJA 3F9TA 4Q31A 1E5EA 1UU1A 2VLFA 1M0QA 4E77A 3E2ZB 4P7YA 1U08A 1EG5A 3RCHA 1D2FA 4W5KA 2G7JA 1QITA 2AEUA 4RAEA 3LWSA 4WD2A 3WCNA 4W1XA 4BA4A 1SVVA 2PB2A 1B9IA 3FQ8A 3L44A 1ASMA 5BJ4A 2OQXA 1OXOA 1M0OA 1BT4A 3A8UX 3FZ7A 4PFNA 2OKJA 2W8TA 3CBFA 1V2EA 3N4RA 5G4JA 2Z61A 3AEOA 1O69A 4WYCA 1JS6A 2VGWA 2QBTA 2DKBA 2BIGA 2R5CA 2AY5A 5EQCA 1MGVA 3BWNC 1B8GA 3E77A 4WYEA 4XJOA 3NYTA 4GRXA 1GEXA 2VGUA 1SZKA 4WLHA 1AHYA 1IBJA 1RVUA 2GMUA 4ZSWA 3WGCA 4H63Q 5EUDA 3FQ7A 2VMNA 1UU2A 1DTYA 5F8VA 3EI7A 4ATPA 1AY4A 1B4XA 2HZPA 3MEBA 2W7IA 2QSRA 3EIAA 1AMSA 1MAQA 1ASFA 3AENB 2FQ6A 2ZY3A 3N75A 1BJOB 4Q6RA 1PMOA 3AEMA 1YJZA 2RFVA 3WLXA 1AJSB 4Y0HA 1J32A 3DODA 3QI6A 1Y4IA 2VMWA 1TOIA 3DZZA 1LW4A 1VJOA 1AKCA 3HDOA 4MQRA 3MAUA 4WYDA 4K2IA 1B5PA 3NU8A 1TPLA 1AMQA 3F6TA 4ZWVA 2WK9A 4IX8A 2HUUA 3K28A 1G4XA 5J8QA 5KTBA 1DJUA 1SF2A 1MLZA 2DKJA 4RIZA 4M2JA 1LC7A 4AH3A 5M4BA 2EYQA 3TQXA 3N4SA 1EQBA 2JJEA 4ADDA 2BWNA 4N0WA 4ZDPA 3AV7A 3LVMA 1AHGA 2AY4A 2Z67A 3W1HA 3BCAA 4TN4A 1FG7A 4WXGA 3EZ1A 3WGBA 5DB5A 3WCOA 1AKAA 2VLHA 1ARIA 5LH9A 1GDEA 1I48A 1WKHA 2W7GA 3A9ZA 1W7NA 1M6SA 3FVUA 1O62A 2CH2A 1ZOBA 2EPJA 1MDXA 2CSTA 2ZUKA 2FKIA 3CQ5A 4IXOA 2DGKA 3QGUA 4IYOA 4AZKA 4F5FA 2HOZA 2BYJA 1KKJA 1O61A 3JW9A 4IW7A 2PO3A 1N8PA 1ELUA 2CFBA 2O1BA 1DGEA 4J8LA 4W1WA 1AY8A 5DJ9A 2W8UA 1I41A 1WYTA 3G8MA 1AAMA 2BYLA 5EAVA 3QPGA 4UOYA 2JG2A 2YCNA 5FT4A 1WYVB 3VK3A 3JWBA 1FC4A 3ASAA 4UHNA 4U1TA 3A9XA 3ECDA 1MLYA 3PD6B 4KYOA 4GEBA 4R2NA 4ADCA 1DFOA 1QGNA 2Z9XA 3IF2A 1TASA 1H1CA 2D5YA 3II0A 4F5JA 1WSTA 3I16A 1AJRA 1IAYA 1ASCA 3NTJA 5EUEA 2ZP7A 2W7JA 3W1IA 3UAKA 4OMAA 2FNUA 2NMPA 1LS3A 1O4SA 5G09A 2VMQA 4EB5A 3EIBA 3B46A 1OATA 4O6ZA 1GD9A 2AATA 4RITA 1C7GA 3Q8NA 3RQ1A 1D7VA 1BQAA 5HDMA 3BB8A 1ASNA 3R9AA 2FNIA 3NU7A 4XJPA 3EI9A 2C0RA 1N2TA 4W1VA 2BWPA 5M4DA 3WZFA 3BN1A 5IWQA 1LKCA 3BV0A 4OYTA 3NDNA 1D7SA 1RVYA 1VP4A 2YCPA 2AY3A 3LVKA 2D7YA 2E7UA 2JISA 3I5TA 3PDXA 1IVRA 4HVKA 1G4VA 1M4NA 3B1EA 3G7QA 2OGAA 3ZZKA 1XI9A 4E1OA 1KL1A 3MAFB 2W7KA 3EI6A 3FQAA 5E3KA 1BJ4A 4MY5A 1YOOA 2YKXA 2CJHA 4OBVA 2D7ZA 3FKDA 4ZLVA 2BI1A 3TCMA 3B1CA 1OHVA 1SZSA 1N31A 4DBCA 3GZDA 1MDZA 2BKWA 2AY1A 1D7RA 4RM1A 3FVXA 4RJ0A 3ZRQA 1WKGA 3LG0A 2ZY2A 3AOWA 2AY9A 1IX7A 4WLJA 5C6UA 4GSAA 5BJ3A 1SFFA 3KE3A 2GSAA 5M49A 4GE4A 4Q75A 4Q76A 3VP6A 1QJ5A 4F5LA 2AEVA 3KGXA 4EU1A 2C44A 2G6WA 4OCAA 2TPLA 4JF0A 4ATQA 4IXSA 1M0PA 3W1JA 1ORDA 2R0TA 3ISLA 3QBOA 4ZDOA 1AY5A 4OT8A 1M0NA 4WB0B 1QJ3A 2Z1ZA 4E3RA 3AEPA 4P3MA 3HLMA 4EFFA 2VMZA 4WYAA 2O0RA 9AATA 3AEMC 1GC2A 1WYUB 1BS0A 4NOGA 3OKSA 3FFHA 1V2DA 2DR1A 2VMRA 3IHJA 4MGRA 3H9XA 4F5HA 1LW5A 2FYFA 2HOXA 1I29A 2QB2A 2VMTA 4BHDA 5EIGB 3RUYA 2ORDA 1AIAA 3ASBA 1BJNA 3FZ8A 2CB1A 2W8VA 3PGYA 3QM2A 3R4TA 1M7YA 4RKCA 4CBSA 1IJIA 3N4XA 2VI8A 5LHAA 3AELA 3BCXA 4A0GA 4MQQA 2VIBA 4MKJA 1C7NA 3GR9A 3E2ZA 5HHYA 1E5FA 3N5MA 2D64A 4GE7A 4LC3A 1I43A 2GB3A 3T32A 1ARSA 3WKSA 1MAPA 4LNLA 3MBBA 2VGSA 2Z20A 4UHMA 4XQ2A 4F5GA 3DRDA 4LNMA 2R2NA 2E7JA 3OP7A 5I92A 1SZUA 3ATHA 2VMYA 5EAAA 3A9YA 3QN6A 4KXKA 4R8DA 2HP1A 2E7IA 4RKDA 3ZRPA 1X29A 2OKKA 4TMRA 2BHXA 4XJMA 5DJ1A 1CZEA 3EI5A 3DR4A 3JTXA 3NUBA 1RV3A 4GDYA 1AMRA 1GEYA 5K8BA 1W23A 1S07A 5D95A 1CQ7A 2PB0A 2AY7A 3FRKA 3PDBB 1IUGA 2DOUA 2OGEA 2W7DA 2CANA 4QGRA 1TOJA 3TFUA 2Z9WA 3WY7A 4A0RA 4N0BA 1OHYA 2CINA 2ZJGA 4A00A 4EB7A 4OC9A 3RBLA 3VOMA 3FDDA 3HQTA 4OBUA 2HOYA 5D5SA 2KFPA 4A72A 3L8AA 2ZSMA 2YRRA 3N7NA 3AENA 3FDBA 1C7OA 1ASLA 2YOBA 4JE5A 2HP2A 1H0CA 1T3IA 1BJOA 4M2KA 3GETA 1AHXA 1LK9A 3DU4A 1V72A 2YCTA 2W7LA 3RCHB 1C0NA 3FZ6A 5EIGA 1AJSA 3F0HA 2V1PA 3E6GA 4ISYA 1D7UA 1BKGA 4MKKA 1PMMA 4OTLA 1GBNA 3HMUA 1DJ9A 3WKRA 4XAUA 1ASDA 5FT8A 1P3WA 1W7MA 3AEJA 1YJYA 2BI2A 1UKJA 2EZ2A 4R5ZA 1X2AA 4CBRA 3NYUA 1ECXA 2W8JA 2Z9VA 3WX9A 4AZJA 4BA5A 3GSBA 1KMJA 1B5OA 4ZWMA 3USFA 2CJDA 1B9HA 2JJGA 4F5MA 1ZC9A 2AY8A 2W7MA 2BI5A 2EH6A 2GMSA 3AOVA 4I8AA 1JF9A 1YIYA 2WKAA 4ADEA 5G2QA 1CL1A 1AAWA 3JWAA 2QMAA 3PIUA 4ADBA 1IAXA 1S0AA 4JEZA 1CJ0A 2JJFA 3BWOA 3A2BA 1BQDA 4M2MA 4U2HA 5E4ZA 1X28A 3GZDC 4A6TA 3PPLA 2F8JA 1AHEA 1GC3A 1YNUA 3HBXA 3KGWA 4MSOA 1KL2A 1KMKA 1CZCA 4F4EA 1OHWA 3LVLB 1S08A 1ARTA 1YIZA 2V0YA 2ZC0A 3DXWA 1M32A 1AX4A 2X8UA 4WXBA 2ZSLA 1YAAA 4JEVA 2VMXA 3EZSA 4DQ6A 1W3UA 4ITXA 1GEWA 3GJUA 3E2FA 3HVYA 1WYVA 2AY6A 3PAAA 5FT6A 4DGTA 7AATA 4A0FA 2W7EA 4PIWA 2X5DA 3ACZA 2WB6A 1CL2A 2JJHA 2CH1A 5G2PA 2BIAA 2XBNA 3PD6A 1AKBA 4XK1A 2BWOA 1TATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYJ A;  3QHX A;  3MKJ A;  3ZRR A;  1AIC A;  4ZM4 A;  3D6K A;  4AO4 A;  3VAX A;  1MDO A;  2OAT A;  1AIB A;  1ASG A;  2JGT A;  2XH1 A;  5JAY A;  3P6K A;  1VEF A;  4F5K A;  4R5F A;  4AO9 A;  3COG A;  4FL0 A;  4ZDL A;  2C7T A;  1S06 A;  2WK7 A;  2HUF A;  4Y0D A;  2ZY4 A;  3LY1 A;  1BJW A;  4A0H A;  2VYC A;  1EJI A;  4K2B A;  3RI6 A;  3CAI A;  2YKY A;  3BCB A;  4ITG A;  1IX6 A;  2QB3 A;  8AAT A;  4L0O A;  3DYD A;  5G4I A;  4IYO B;  3FSL A;  2W8W A;  1C4K A;  3LVJ A;  2QLR A;  4JF1 A;  3G0T A;  4CXQ A;  4WYG A;  4WP0 A;  2D65 A;  4H51 A;  4RLG A;  5M46 A;  4EMY A;  3K7Y A;  1WYT B;  1ASB A;  3UWC A;  3I4J A;  3DR7 A;  4WYF A;  5E5I A;  3MAF A;  3BWN A;  4MQP A;  4HF8 A;  2EZ1 A;  4E3Q A;  2CJG A;  3DXV A;  1UU0 A;  2D63 A;  2Z1Y A;  3H7F A;  3JZL A;  3M5U A;  4TV7 A;  4WBT A;  4XJL A;  3DC1 A;  3ELE A;  5EUN A;  1CS1 A;  1ARG A;  1LC8 A;  1AHF A;  2R5E A;  2YRI A;  2HOR A;  2DGM A;  3UE8 A;  4FFC A;  1QIR A;  5G0A A;  2VGT A;  1FG3 A;  1TOG A;  2VIA A;  3NUI A;  1QIS A;  1Z7D A;  3NYS A;  4CVQ A;  5FT5 A;  4IXZ A;  2DGL A;  3GZC A;  1V2F A;  1AMA A;  1SPA A;  2QA3 A;  3VK2 A;  1C9C A;  1W7L A;  1ASE A;  1PG8 A;  2GQN A;  2ZY5 A;  3FTB A;  2Z9U A;  4JEY A;  3FVS A;  4WB0 A;  4AOA A;  3BC8 A;  1CQ8 A;  3RBF A;  3MAD A;  3NNK A;  1GC0 A;  4W91 A;  1RV4 A;  4B98 A;  2EO5 A;  4LW4 A;  3GWP A;  1WYU A;  4A6U A;  2Q7W A;  4W8I A;  4JE5 D;  1KKP A;  1PFF A;  2VI9 A;  2W7H A;  4B9B A;  4Y0I A;  1BW0 A;  1LC5 A;  5DX5 A;  5TF5 A;  2X5F A;  1GCK A;  2FN6 A;  2W7F A;  3AEJ C;  4ZAS A;  3BS8 A;  3PJ0 A;  2VMU A;  4PFF A;  4JEX A;  1ZOD A;  5EFS A;  3CQ4 A;  3EUC A;  4PVF A;  3TAT A;  2VMP A;  4LNJ A;  3FD0 A;  2D66 A;  1G7X A;  4GE9 A;  4KAM A;  2BI9 A;  3CQ6 A;  1S09 A;  4IY7 A;  3K40 A;  2CY8 A;  1YJS A;  1J04 A;  2EGY A;  2VMS A;  4JEW A;  2FM1 A;  2D61 A;  1CQ6 A;  2VGV A;  4RJY A;  3H14 A;  1G7W A;  3ELP A;  4UHO A;  2R5C B;  2AY2 A;  2YHK A;  1OXP A;  3GBX A;  1DJE A;  1DKA A;  2E54 A;  4ZM3 A;  2BI3 A;  1XEY A;  2X3L A;  2CTZ A;  3FCR A;  3FFR A;  3LV2 A;  3MC6 C;  4K2M A;  3NRA A;  4ZAH A;  5F9S A;  4BMK A;  1DGD A;  1IX8 A;  4F5I A;  2HUI A;  4WXF A;  4A6R A;  2O7C A;  5HXX A;  2VMO A;  2VGZ A;  3NX3 A;  3JU7 A;  4CXR A;  3N0L A;  4J5U A;  1QZ9 A;  1JS3 A;  4LW2 A;  3AAT A;  2YKU A;  3E9K A;  3B1D A;  5AX8 A;  1JG8 A;  3MC6 A;  1TAR A;  2WK8 A;  1GC4 A;  3B8X A;  3KKI A;  3PDB A;  3HT4 A;  3EI8 A;  3E2Y A;  3VK4 A;  1ARH A;  1ELQ A;  1TOK A;  4XEW A;  3HL2 A;  4BQ0 A;  3P1T A;  4UQV A;  4ZSY A;  2VMV A;  1TOE A;  2BIE A;  1Z3Z A;  2YKV A;  3TFT A;  3PA9 A;  1ASA A;  1X0M A;  2C81 A;  3ZZJ A;  3F9T A;  4Q31 A;  1E5E A;  1UU1 A;  2VLF A;  1M0Q A;  4E77 A;  3E2Z B;  4P7Y A;  1U08 A;  1EG5 A;  3RCH A;  1D2F A;  4W5K A;  1QIT A;  2AEU A;  4RAE A;  3LWS A;  4WD2 A;  3WCN A;  4W1X A;  4BA4 A;  1SVV A;  2PB2 A;  1B9I A;  3FQ8 A;  3L44 A;  1ASM A;  5BJ4 A;  2OQX A;  1OXO A;  1M0O A;  1BT4 A;  3A8U X;  3FZ7 A;  4PFN A;  2OKJ A;  2W8T A;  3CBF A;  1V2E A;  5G4J A;  2Z61 A;  3AEO A;  1O69 A;  4WYC A;  1JS6 A;  2VGW A;  2QBT A;  2DKB A;  2BIG A;  2R5C A;  2AY5 A;  5EQC A;  1MGV A;  3BWN C;  1B8G A;  3E77 A;  4WYE A;  4XJO A;  3NYT A;  4GRX A;  1GEX A;  2VGU A;  1SZK A;  4WLH A;  1AHY A;  1IBJ A;  1RVU A;  2GMU A;  4ZSW A;  3WGC A;  5EUD A;  3FQ7 A;  2VMN A;  1UU2 A;  1DTY A;  5F8V A;  3EI7 A;  4ATP A;  1AY4 A;  1B4X A;  2HZP A;  3MEB A;  2W7I A;  3EIA A;  1AMS A;  1MAQ A;  1ASF A;  3AEN B;  2FQ6 A;  2ZY3 A;  3N75 A;  1BJO B;  4Q6R A;  1PMO A;  3AEM A;  1YJZ A;  2RFV A;  3WLX A;  1AJS B;  4Y0H A;  1J32 A;  3DOD A;  3QI6 A;  1Y4I A;  2VMW A;  1TOI A;  3DZZ A;  1LW4 A;  1VJO A;  1AKC A;  3HDO A;  4MQR A;  3MAU A;  4WYD A;  4K2I A;  1B5P A;  3NU8 A;  1TPL A;  1AMQ A;  3F6T A;  4ZWV A;  2WK9 A;  4IX8 A;  2HUU A;  3K28 A;  1G4X A;  5J8Q A;  1DJU A;  1SF2 A;  1MLZ A;  2DKJ A;  4RIZ A;  4M2J A;  1LC7 A;  4AH3 A;  5M4B A;  3TQX A;  1EQB A;  2JJE A;  4ADD A;  2BWN A;  4N0W A;  4ZDP A;  3AV7 A;  3LVM A;  1AHG A;  2AY4 A;  2Z67 A;  3W1H A;  3BCA A;  4TN4 A;  1FG7 A;  4WXG A;  3EZ1 A;  3WGB A;  5DB5 A;  3WCO A;  1AKA A;  2VLH A;  1ARI A;  5LH9 A;  1GDE A;  1I48 A;  1WKH A;  2W7G A;  3A9Z A;  1W7N A;  1M6S A;  3FVU A;  1O62 A;  2CH2 A;  1ZOB A;  2EPJ A;  1MDX A;  2CST A;  2ZUK A;  3CQ5 A;  4IXO A;  2DGK A;  3QGU A;  4IYO A;  4AZK A;  4F5F A;  2HOZ A;  2BYJ A;  1KKJ A;  1O61 A;  3JW9 A;  4IW7 A;  2PO3 A;  1N8P A;  1ELU A;  2CFB A;  2O1B A;  1DGE A;  4J8L A;  4W1W A;  1AY8 A;  5DJ9 A;  2W8U A;  1I41 A;  1WYT A;  3G8M A;  1AAM A;  2BYL A;  5EAV A;  3QPG A;  4UOY A;  2JG2 A;  2YCN A;  5FT4 A;  1WYV B;  3VK3 A;  3JWB A;  1FC4 A;  3ASA A;  4UHN A;  4U1T A;  3A9X A;  3ECD A;  1MLY A;  3PD6 B;  4KYO A;  4GEB A;  4R2N A;  4ADC A;  1DFO A;  1QGN A;  2Z9X A;  3IF2 A;  1TAS A;  1H1C A;  2D5Y A;  3II0 A;  4F5J A;  1WST A;  3I16 A;  1AJR A;  1IAY A;  1ASC A;  3NTJ A;  5EUE A;  2ZP7 A;  2W7J A;  3W1I A;  3UAK A;  4OMA A;  2FNU A;  2NMP A;  1LS3 A;  1O4S A;  5G09 A;  2VMQ A;  4EB5 A;  3EIB A;  3B46 A;  1OAT A;  4O6Z A;  1GD9 A;  2AAT A;  4RIT A;  1C7G A;  3Q8N A;  3RQ1 A;  1D7V A;  1BQA A;  5HDM A;  3BB8 A;  1ASN A;  3R9A A;  2FNI A;  3NU7 A;  4XJP A;  3EI9 A;  2C0R A;  1N2T A;  4W1V A;  2BWP A;  5M4D A;  3WZF A;  3BN1 A;  5IWQ A;  1LKC A;  3BV0 A;  4OYT A;  3NDN A;  1D7S A;  1RVY A;  1VP4 A;  2YCP A;  2AY3 A;  3LVK A;  2D7Y A;  2E7U A;  2JIS A;  3I5T A;  3PDX A;  1IVR A;  4HVK A;  1G4V A;  1M4N A;  3B1E A;  3G7Q A;  2OGA A;  3ZZK A;  1XI9 A;  4E1O A;  1KL1 A;  3MAF B;  2W7K A;  3EI6 A;  3FQA A;  5E3K A;  1BJ4 A;  4MY5 A;  1YOO A;  2YKX A;  2CJH A;  4OBV A;  2D7Z A;  3FKD A;  4ZLV A;  2BI1 A;  3TCM A;  3B1C A;  1OHV A;  1SZS A;  1N31 A;  4DBC A;  3GZD A;  1MDZ A;  2BKW A;  2AY1 A;  1D7R A;  4RM1 A;  3FVX A;  4RJ0 A;  3ZRQ A;  1WKG A;  3LG0 A;  2ZY2 A;  3AOW A;  2AY9 A;  1IX7 A;  4WLJ A;  5C6U A;  4GSA A;  5BJ3 A;  1SFF A;  3KE3 A;  2GSA A;  5M49 A;  4GE4 A;  4Q75 A;  4Q76 A;  3VP6 A;  1QJ5 A;  4F5L A;  2AEV A;  3KGX A;  4EU1 A;  2C44 A;  2G6W A;  4OCA A;  2TPL A;  4JF0 A;  4ATQ A;  4IXS A;  1M0P A;  3W1J A;  1ORD A;  2R0T A;  3ISL A;  3QBO A;  4ZDO A;  1AY5 A;  4OT8 A;  1M0N A;  4WB0 B;  1QJ3 A;  2Z1Z A;  4E3R A;  3AEP A;  4P3M A;  3HLM A;  4EFF A;  2VMZ A;  4WYA A;  2O0R A;  9AAT A;  3AEM C;  1GC2 A;  1WYU B;  1BS0 A;  4NOG A;  3OKS A;  3FFH A;  1V2D A;  2DR1 A;  2VMR A;  3IHJ A;  4MGR A;  4F5H A;  1LW5 A;  2FYF A;  2HOX A;  1I29 A;  2QB2 A;  2VMT A;  4BHD A;  5EIG B;  3RUY A;  2ORD A;  1AIA A;  3ASB A;  1BJN A;  3FZ8 A;  2CB1 A;  2W8V A;  3PGY A;  3QM2 A;  3R4T A;  1M7Y A;  4RKC A;  4CBS A;  1IJI A;  2VI8 A;  5LHA A;  3AEL A;  3BCX A;  4A0G A;  4MQQ A;  2VIB A;  4MKJ A;  1C7N A;  3GR9 A;  3E2Z A;  5HHY A;  1E5F A;  3N5M A;  2D64 A;  4GE7 A;  4LC3 A;  1I43 A;  2GB3 A;  3T32 A;  1ARS A;  3WKS A;  1MAP A;  4LNL A;  3MBB A;  2VGS A;  2Z20 A;  4UHM A;  4XQ2 A;  4F5G A;  3DRD A;  4LNM A;  2R2N A;  2E7J A;  3OP7 A;  5I92 A;  1SZU A;  3ATH A;  2VMY A;  5EAA A;  3A9Y A;  3QN6 A;  4KXK A;  4R8D A;  2HP1 A;  2E7I A;  4RKD A;  3ZRP A;  1X29 A;  2OKK A;  4TMR A;  2BHX A;  4XJM A;  5DJ1 A;  1CZE A;  3EI5 A;  3DR4 A;  3JTX A;  3NUB A;  1RV3 A;  4GDY A;  1AMR A;  1GEY A;  5K8B A;  1W23 A;  1S07 A;  5D95 A;  1CQ7 A;  2PB0 A;  2AY7 A;  3FRK A;  3PDB B;  1IUG A;  2DOU A;  2OGE A;  2W7D A;  2CAN A;  4QGR A;  1TOJ A;  3TFU A;  2Z9W A;  3WY7 A;  4A0R A;  4N0B A;  1OHY A;  2CIN A;  2ZJG A;  4A00 A;  4EB7 A;  4OC9 A;  3RBL A;  3VOM A;  3FDD A;  3HQT A;  4OBU A;  2HOY A;  5D5S A;  4A72 A;  3L8A A;  2ZSM A;  2YRR A;  3AEN A;  3FDB A;  1C7O A;  1ASL A;  2YOB A;  4JE5 A;  2HP2 A;  1H0C A;  1T3I A;  1BJO A;  4M2K A;  3GET A;  1AHX A;  1LK9 A;  3DU4 A;  1V72 A;  2YCT A;  2W7L A;  3RCH B;  1C0N A;  3FZ6 A;  5EIG A;  1AJS A;  3F0H A;  2V1P A;  3E6G A;  4ISY A;  1D7U A;  1BKG A;  4MKK A;  1PMM A;  4OTL A;  1GBN A;  3HMU A;  1DJ9 A;  3WKR A;  4XAU A;  1ASD A;  5FT8 A;  1P3W A;  1W7M A;  3AEJ A;  1YJY A;  2BI2 A;  1UKJ A;  2EZ2 A;  4R5Z A;  1X2A A;  4CBR A;  3NYU A;  1ECX A;  2W8J A;  2Z9V A;  3WX9 A;  4AZJ A;  4BA5 A;  3GSB A;  1KMJ A;  1B5O A;  4ZWM A;  3USF A;  2CJD A;  1B9H A;  2JJG A;  4F5M A;  1ZC9 A;  2AY8 A;  2W7M A;  2BI5 A;  2EH6 A;  2GMS A;  3AOV A;  4I8A A;  1JF9 A;  1YIY A;  2WKA A;  4ADE A;  5G2Q A;  1CL1 A;  1AAW A;  3JWA A;  2QMA A;  3PIU A;  4ADB A;  1IAX A;  1S0A A;  4JEZ A;  1CJ0 A;  2JJF A;  3BWO A;  3A2B A;  1BQD A;  4M2M A;  4U2H A;  5E4Z A;  1X28 A;  3GZD C;  4A6T A;  3PPL A;  2F8J A;  1AHE A;  1GC3 A;  1YNU A;  3HBX A;  3KGW A;  4MSO A;  1KL2 A;  1KMK A;  1CZC A;  4F4E A;  1OHW A;  3LVL B;  1S08 A;  1ART A;  1YIZ A;  2V0Y A;  2ZC0 A;  3DXW A;  1M32 A;  1AX4 A;  2X8U A;  4WXB A;  2ZSL A;  1YAA A;  4JEV A;  2VMX A;  3EZS A;  4DQ6 A;  1W3U A;  4ITX A;  1GEW A;  3GJU A;  3E2F A;  3HVY A;  1WYV A;  2AY6 A;  3PAA A;  5FT6 A;  4DGT A;  7AAT A;  4A0F A;  2W7E A;  4PIW A;  2X5D A;  3ACZ A;  1CL2 A;  2JJH A;  2CH1 A;  5G2P A;  2BIA A;  2XBN A;  3PD6 A;  1AKB A;  4XK1 A;  2BWO A;  1TAT A; 
#chains in the Genus database with same CATH topology
 2ZYJ A;  3QHX A;  3MKJ A;  3ZRR A;  1AIC A;  4ZM4 A;  3D6K A;  4AO4 A;  3VAX A;  1MDO A;  2OAT A;  1AIB A;  1ASG A;  2JGT A;  2XH1 A;  5JAY A;  3P6K A;  1VEF A;  4F5K A;  4R5F A;  4AO9 A;  3COG A;  4FL0 A;  4ZDL A;  2C7T A;  1S06 A;  2WK7 A;  2HUF A;  4Y0D A;  2ZY4 A;  3LY1 A;  1BJW A;  4A0H A;  2VYC A;  1EJI A;  4K2B A;  3RI6 A;  3CAI A;  2YKY A;  3BCB A;  4ITG A;  1IX6 A;  2QB3 A;  8AAT A;  4L0O A;  3DYD A;  5G4I A;  4IYO B;  3FSL A;  2W8W A;  1C4K A;  3LVJ A;  2QLR A;  4JF1 A;  3G0T A;  4CXQ A;  4WYG A;  4WP0 A;  1KAF A;  2D65 A;  4H51 A;  4RLG A;  5M46 A;  4EMY A;  3K7Y A;  1WYT B;  1ASB A;  3UWC A;  3I4J A;  3DR7 A;  4WYF A;  5E5I A;  3MAF A;  3BWN A;  4MQP A;  4HF8 A;  2EZ1 A;  4E3Q A;  2CJG A;  3DXV A;  1UU0 A;  2D63 A;  2Z1Y A;  3H7F A;  3JZL A;  3M5U A;  4TV7 A;  4WBT A;  4XJL A;  3DC1 A;  3ELE A;  5EUN A;  1CS1 A;  1ARG A;  1LC8 A;  1AHF A;  2R5E A;  2YRI A;  2HOR A;  2DGM A;  3UE8 A;  4FFC A;  1QIR A;  5G0A A;  2VGT A;  1FG3 A;  1TOG A;  2VIA A;  3NUI A;  1QIS A;  1Z7D A;  3NYS A;  4CVQ A;  5FT5 A;  4IXZ A;  2DGL A;  3GZC A;  1V2F A;  1AMA A;  1SPA A;  2QA3 A;  3VK2 A;  1C9C A;  1W7L A;  1ASE A;  1PG8 A;  2GQN A;  2ZY5 A;  3FTB A;  2Z9U A;  4JEY A;  3FVS A;  4WB0 A;  4AOA A;  3BC8 A;  1CQ8 A;  3RBF A;  3MAD A;  3NNK A;  1GC0 A;  4W91 A;  1RV4 A;  4B98 A;  2EO5 A;  4LW4 A;  3GWP A;  1WYU A;  4A6U A;  2Q7W A;  4W8I A;  4JE5 D;  1KKP A;  1PFF A;  2VI9 A;  2W7H A;  4B9B A;  4Y0I A;  1BW0 A;  1LC5 A;  5DX5 A;  5TF5 A;  2X5F A;  1GCK A;  2FN6 A;  2W7F A;  3AEJ C;  4ZAS A;  3BS8 A;  3PJ0 A;  2VMU A;  4PFF A;  4JEX A;  1ZOD A;  5EFS A;  3CQ4 A;  3EUC A;  4PVF A;  3TAT A;  2VMP A;  4LNJ A;  3FD0 A;  2D66 A;  1G7X A;  4GE9 A;  4KAM A;  2BI9 A;  3CQ6 A;  1S09 A;  4IY7 A;  3K40 A;  2CY8 A;  1YJS A;  1J04 A;  2EGY A;  2VMS A;  4JEW A;  2FM1 A;  2D61 A;  1CQ6 A;  2VGV A;  4RJY A;  3H14 A;  1G7W A;  3ELP A;  4UHO A;  2R5C B;  2AY2 A;  4K05 A;  2YHK A;  1OXP A;  3GBX A;  1DJE A;  1DKA A;  2E54 A;  4ZM3 A;  2BI3 A;  1XEY A;  2X3L A;  2CTZ A;  3FCR A;  3FFR A;  3LV2 A;  3MC6 C;  4K2M A;  3NRA A;  4ZAH A;  5F9S A;  4BMK A;  1DGD A;  1IX8 A;  4F5I A;  2HUI A;  4WXF A;  4A6R A;  2O7C A;  2A1V A;  5HXX A;  2VMO A;  2VGZ A;  3NX3 A;  3JU7 A;  4CXR A;  3N0L A;  4J5U A;  1QZ9 A;  1JS3 A;  4LW2 A;  3AAT A;  2YKU A;  3E9K A;  3B1D A;  5AX8 A;  1JG8 A;  3MC6 A;  1TAR A;  2WK8 A;  1GC4 A;  3B8X A;  3KKI A;  3PDB A;  3HT4 A;  3EI8 A;  3E2Y A;  3VK4 A;  1ARH A;  1ELQ A;  1TOK A;  4XEW A;  3HL2 A;  4BQ0 A;  3P1T A;  4UQV A;  4ZSY A;  2VMV A;  1TOE A;  2BIE A;  1Z3Z A;  2YKV A;  3TFT A;  3PA9 A;  1ASA A;  1X0M A;  2C81 A;  3ZZJ A;  3F9T A;  4Q31 A;  1E5E A;  1UU1 A;  2VLF A;  1M0Q A;  4E77 A;  3E2Z B;  4P7Y A;  1U08 A;  1EG5 A;  3RCH A;  1D2F A;  4W5K A;  2G7J A;  1QIT A;  2AEU A;  4RAE A;  3LWS A;  4WD2 A;  3WCN A;  4W1X A;  4BA4 A;  1SVV A;  2PB2 A;  1B9I A;  3FQ8 A;  3L44 A;  1ASM A;  5BJ4 A;  2OQX A;  1OXO A;  1M0O A;  1BT4 A;  3A8U X;  3FZ7 A;  4PFN A;  2OKJ A;  2W8T A;  3CBF A;  1V2E A;  3N4R A;  5G4J A;  2Z61 A;  3AEO A;  1O69 A;  4WYC A;  1JS6 A;  2VGW A;  2QBT A;  2DKB A;  2BIG A;  2R5C A;  2AY5 A;  5EQC A;  1MGV A;  3BWN C;  1B8G A;  3E77 A;  4WYE A;  4XJO A;  3NYT A;  4GRX A;  1GEX A;  2VGU A;  1SZK A;  4WLH A;  1AHY A;  1IBJ A;  1RVU A;  2GMU A;  4ZSW A;  3WGC A;  4H63 Q;  5EUD A;  3FQ7 A;  2VMN A;  1UU2 A;  1DTY A;  5F8V A;  3EI7 A;  4ATP A;  1AY4 A;  1B4X A;  2HZP A;  3MEB A;  2W7I A;  2QSR A;  3EIA A;  1AMS A;  1MAQ A;  1ASF A;  3AEN B;  2FQ6 A;  2ZY3 A;  3N75 A;  1BJO B;  4Q6R A;  1PMO A;  3AEM A;  1YJZ A;  2RFV A;  3WLX A;  1AJS B;  4Y0H A;  1J32 A;  3DOD A;  3QI6 A;  1Y4I A;  2VMW A;  1TOI A;  3DZZ A;  1LW4 A;  1VJO A;  1AKC A;  3HDO A;  4MQR A;  3MAU A;  4WYD A;  4K2I A;  1B5P A;  3NU8 A;  1TPL A;  1AMQ A;  3F6T A;  4ZWV A;  2WK9 A;  4IX8 A;  2HUU A;  3K28 A;  1G4X A;  5J8Q A;  5KTB A;  1DJU A;  1SF2 A;  1MLZ A;  2DKJ A;  4RIZ A;  4M2J A;  1LC7 A;  4AH3 A;  5M4B A;  2EYQ A;  3TQX A;  3N4S A;  1EQB A;  2JJE A;  4ADD A;  2BWN A;  4N0W A;  4ZDP A;  3AV7 A;  3LVM A;  1AHG A;  2AY4 A;  2Z67 A;  3W1H A;  3BCA A;  4TN4 A;  1FG7 A;  4WXG A;  3EZ1 A;  3WGB A;  5DB5 A;  3WCO A;  1AKA A;  2VLH A;  1ARI A;  5LH9 A;  1GDE A;  1I48 A;  1WKH A;  2W7G A;  3A9Z A;  1W7N A;  1M6S A;  3FVU A;  1O62 A;  2CH2 A;  1ZOB A;  2EPJ A;  1MDX A;  2CST A;  2ZUK A;  2FKI A;  3CQ5 A;  4IXO A;  2DGK A;  3QGU A;  4IYO A;  4AZK A;  4F5F A;  2HOZ A;  2BYJ A;  1KKJ A;  1O61 A;  3JW9 A;  4IW7 A;  2PO3 A;  1N8P A;  1ELU A;  2CFB A;  2O1B A;  1DGE A;  4J8L A;  4W1W A;  1AY8 A;  5DJ9 A;  2W8U A;  1I41 A;  1WYT A;  3G8M A;  1AAM A;  2BYL A;  5EAV A;  3QPG A;  4UOY A;  2JG2 A;  2YCN A;  5FT4 A;  1WYV B;  3VK3 A;  3JWB A;  1FC4 A;  3ASA A;  4UHN A;  4U1T A;  3A9X A;  3ECD A;  1MLY A;  3PD6 B;  4KYO A;  4GEB A;  4R2N A;  4ADC A;  1DFO A;  1QGN A;  2Z9X A;  3IF2 A;  1TAS A;  1H1C A;  2D5Y A;  3II0 A;  4F5J A;  1WST A;  3I16 A;  1AJR A;  1IAY A;  1ASC A;  3NTJ A;  5EUE A;  2ZP7 A;  2W7J A;  3W1I A;  3UAK A;  4OMA A;  2FNU A;  2NMP A;  1LS3 A;  1O4S A;  5G09 A;  2VMQ A;  4EB5 A;  3EIB A;  3B46 A;  1OAT A;  4O6Z A;  1GD9 A;  2AAT A;  4RIT A;  1C7G A;  3Q8N A;  3RQ1 A;  1D7V A;  1BQA A;  5HDM A;  3BB8 A;  1ASN A;  3R9A A;  2FNI A;  3NU7 A;  4XJP A;  3EI9 A;  2C0R A;  1N2T A;  4W1V A;  2BWP A;  5M4D A;  3WZF A;  3BN1 A;  5IWQ A;  1LKC A;  3BV0 A;  4OYT A;  3NDN A;  1D7S A;  1RVY A;  1VP4 A;  2YCP A;  2AY3 A;  3LVK A;  2D7Y A;  2E7U A;  2JIS A;  3I5T A;  3PDX A;  1IVR A;  4HVK A;  1G4V A;  1M4N A;  3B1E A;  3G7Q A;  2OGA A;  3ZZK A;  1XI9 A;  4E1O A;  1KL1 A;  3MAF B;  2W7K A;  3EI6 A;  3FQA A;  5E3K A;  1BJ4 A;  4MY5 A;  1YOO A;  2YKX A;  2CJH A;  4OBV A;  2D7Z A;  3FKD A;  4ZLV A;  2BI1 A;  3TCM A;  3B1C A;  1OHV A;  1SZS A;  1N31 A;  4DBC A;  3GZD A;  1MDZ A;  2BKW A;  2AY1 A;  1D7R A;  4RM1 A;  3FVX A;  4RJ0 A;  3ZRQ A;  1WKG A;  3LG0 A;  2ZY2 A;  3AOW A;  2AY9 A;  1IX7 A;  4WLJ A;  5C6U A;  4GSA A;  5BJ3 A;  1SFF A;  3KE3 A;  2GSA A;  5M49 A;  4GE4 A;  4Q75 A;  4Q76 A;  3VP6 A;  1QJ5 A;  4F5L A;  2AEV A;  3KGX A;  4EU1 A;  2C44 A;  2G6W A;  4OCA A;  2TPL A;  4JF0 A;  4ATQ A;  4IXS A;  1M0P A;  3W1J A;  1ORD A;  2R0T A;  3ISL A;  3QBO A;  4ZDO A;  1AY5 A;  4OT8 A;  1M0N A;  4WB0 B;  1QJ3 A;  2Z1Z A;  4E3R A;  3AEP A;  4P3M A;  3HLM A;  4EFF A;  2VMZ A;  4WYA A;  2O0R A;  9AAT A;  3AEM C;  1GC2 A;  1WYU B;  1BS0 A;  4NOG A;  3OKS A;  3FFH A;  1V2D A;  2DR1 A;  2VMR A;  3IHJ A;  4MGR A;  3H9X A;  4F5H A;  1LW5 A;  2FYF A;  2HOX A;  1I29 A;  2QB2 A;  2VMT A;  4BHD A;  5EIG B;  3RUY A;  2ORD A;  1AIA A;  3ASB A;  1BJN A;  3FZ8 A;  2CB1 A;  2W8V A;  3PGY A;  3QM2 A;  3R4T A;  1M7Y A;  4RKC A;  4CBS A;  1IJI A;  3N4X A;  2VI8 A;  5LHA A;  3AEL A;  3BCX A;  4A0G A;  4MQQ A;  2VIB A;  4MKJ A;  1C7N A;  3GR9 A;  3E2Z A;  5HHY A;  1E5F A;  3N5M A;  2D64 A;  4GE7 A;  4LC3 A;  1I43 A;  2GB3 A;  3T32 A;  1ARS A;  3WKS A;  1MAP A;  4LNL A;  3MBB A;  2VGS A;  2Z20 A;  4UHM A;  4XQ2 A;  4F5G A;  3DRD A;  4LNM A;  2R2N A;  2E7J A;  3OP7 A;  5I92 A;  1SZU A;  3ATH A;  2VMY A;  5EAA A;  3A9Y A;  3QN6 A;  4KXK A;  4R8D A;  2HP1 A;  2E7I A;  4RKD A;  3ZRP A;  1X29 A;  2OKK A;  4TMR A;  2BHX A;  4XJM A;  5DJ1 A;  1CZE A;  3EI5 A;  3DR4 A;  3JTX A;  3NUB A;  1RV3 A;  4GDY A;  1AMR A;  1GEY A;  5K8B A;  1W23 A;  1S07 A;  5D95 A;  1CQ7 A;  2PB0 A;  2AY7 A;  3FRK A;  3PDB B;  1IUG A;  2DOU A;  2OGE A;  2W7D A;  2CAN A;  4QGR A;  1TOJ A;  3TFU A;  2Z9W A;  3WY7 A;  4A0R A;  4N0B A;  1OHY A;  2CIN A;  2ZJG A;  4A00 A;  4EB7 A;  4OC9 A;  3RBL A;  3VOM A;  3FDD A;  3HQT A;  4OBU A;  2HOY A;  5D5S A;  2KFP A;  4A72 A;  3L8A A;  2ZSM A;  2YRR A;  3N7N A;  3AEN A;  3FDB A;  1C7O A;  1ASL A;  2YOB A;  4JE5 A;  2HP2 A;  1H0C A;  1T3I A;  1BJO A;  4M2K A;  3GET A;  1AHX A;  1LK9 A;  3DU4 A;  1V72 A;  2YCT A;  2W7L A;  3RCH B;  1C0N A;  3FZ6 A;  5EIG A;  1AJS A;  3F0H A;  2V1P A;  3E6G A;  4ISY A;  1D7U A;  1BKG A;  4MKK A;  1PMM A;  4OTL A;  1GBN A;  3HMU A;  1DJ9 A;  3WKR A;  4XAU A;  1ASD A;  5FT8 A;  1P3W A;  1W7M A;  3AEJ A;  1YJY A;  2BI2 A;  1UKJ A;  2EZ2 A;  4R5Z A;  1X2A A;  4CBR A;  3NYU A;  1ECX A;  2W8J A;  2Z9V A;  3WX9 A;  4AZJ A;  4BA5 A;  3GSB A;  1KMJ A;  1B5O A;  4ZWM A;  3USF A;  2CJD A;  1B9H A;  2JJG A;  4F5M A;  1ZC9 A;  2AY8 A;  2W7M A;  2BI5 A;  2EH6 A;  2GMS A;  3AOV A;  4I8A A;  1JF9 A;  1YIY A;  2WKA A;  4ADE A;  5G2Q A;  1CL1 A;  1AAW A;  3JWA A;  2QMA A;  3PIU A;  4ADB A;  1IAX A;  1S0A A;  4JEZ A;  1CJ0 A;  2JJF A;  3BWO A;  3A2B A;  1BQD A;  4M2M A;  4U2H A;  5E4Z A;  1X28 A;  3GZD C;  4A6T A;  3PPL A;  2F8J A;  1AHE A;  1GC3 A;  1YNU A;  3HBX A;  3KGW A;  4MSO A;  1KL2 A;  1KMK A;  1CZC A;  4F4E A;  1OHW A;  3LVL B;  1S08 A;  1ART A;  1YIZ A;  2V0Y A;  2ZC0 A;  3DXW A;  1M32 A;  1AX4 A;  2X8U A;  4WXB A;  2ZSL A;  1YAA A;  4JEV A;  2VMX A;  3EZS A;  4DQ6 A;  1W3U A;  4ITX A;  1GEW A;  3GJU A;  3E2F A;  3HVY A;  1WYV A;  2AY6 A;  3PAA A;  5FT6 A;  4DGT A;  7AAT A;  4A0F A;  2W7E A;  4PIW A;  2X5D A;  3ACZ A;  2WB6 A;  1CL2 A;  2JJH A;  2CH1 A;  5G2P A;  2BIA A;  2XBN A;  3PD6 A;  1AKB A;  4XK1 A;  2BWO A;  1TAT A; 
#chains in the Genus database with same CATH homology
 2ZYJ A;  3QHX A;  3MKJ A;  3ZRR A;  1AIC A;  4ZM4 A;  3D6K A;  4AO4 A;  3VAX A;  1MDO A;  2OAT A;  1AIB A;  1ASG A;  2JGT A;  2XH1 A;  5JAY A;  3P6K A;  1VEF A;  4F5K A;  4R5F A;  4AO9 A;  3COG A;  4FL0 A;  4ZDL A;  2C7T A;  1S06 A;  2WK7 A;  2HUF A;  4Y0D A;  2ZY4 A;  3LY1 A;  1BJW A;  4A0H A;  2VYC A;  1EJI A;  4K2B A;  3RI6 A;  3CAI A;  2YKY A;  3BCB A;  4ITG A;  1IX6 A;  2QB3 A;  8AAT A;  4L0O A;  3DYD A;  5G4I A;  4IYO B;  3FSL A;  2W8W A;  1C4K A;  3LVJ A;  2QLR A;  4JF1 A;  3G0T A;  4CXQ A;  4WYG A;  4WP0 A;  2D65 A;  4H51 A;  4RLG A;  5M46 A;  4EMY A;  3K7Y A;  1WYT B;  1ASB A;  3UWC A;  3I4J A;  3DR7 A;  4WYF A;  5E5I A;  3MAF A;  3BWN A;  4MQP A;  4HF8 A;  2EZ1 A;  4E3Q A;  2CJG A;  3DXV A;  1UU0 A;  2D63 A;  2Z1Y A;  3H7F A;  3JZL A;  3M5U A;  4TV7 A;  4WBT A;  4XJL A;  3DC1 A;  3ELE A;  5EUN A;  1CS1 A;  1ARG A;  1LC8 A;  1AHF A;  2R5E A;  2YRI A;  2HOR A;  2DGM A;  3UE8 A;  4FFC A;  1QIR A;  5G0A A;  2VGT A;  1FG3 A;  1TOG A;  2VIA A;  3NUI A;  1QIS A;  1Z7D A;  3NYS A;  4CVQ A;  5FT5 A;  4IXZ A;  2DGL A;  3GZC A;  1V2F A;  1AMA A;  1SPA A;  2QA3 A;  3VK2 A;  1C9C A;  1W7L A;  1ASE A;  1PG8 A;  2GQN A;  2ZY5 A;  3FTB A;  2Z9U A;  4JEY A;  3FVS A;  4WB0 A;  4AOA A;  3BC8 A;  1CQ8 A;  3RBF A;  3MAD A;  3NNK A;  1GC0 A;  4W91 A;  1RV4 A;  4B98 A;  2EO5 A;  4LW4 A;  3GWP A;  1WYU A;  4A6U A;  2Q7W A;  4W8I A;  4JE5 D;  1KKP A;  1PFF A;  2VI9 A;  2W7H A;  4B9B A;  4Y0I A;  1BW0 A;  1LC5 A;  5DX5 A;  5TF5 A;  2X5F A;  1GCK A;  2FN6 A;  2W7F A;  3AEJ C;  4ZAS A;  3BS8 A;  3PJ0 A;  2VMU A;  4PFF A;  4JEX A;  1ZOD A;  5EFS A;  3CQ4 A;  3EUC A;  4PVF A;  3TAT A;  2VMP A;  4LNJ A;  3FD0 A;  2D66 A;  1G7X A;  4GE9 A;  4KAM A;  2BI9 A;  3CQ6 A;  1S09 A;  4IY7 A;  3K40 A;  2CY8 A;  1YJS A;  1J04 A;  2EGY A;  2VMS A;  4JEW A;  2FM1 A;  2D61 A;  1CQ6 A;  2VGV A;  4RJY A;  3H14 A;  1G7W A;  3ELP A;  4UHO A;  2R5C B;  2AY2 A;  4K05 A;  2YHK A;  1OXP A;  3GBX A;  1DJE A;  1DKA A;  2E54 A;  4ZM3 A;  2BI3 A;  1XEY A;  2X3L A;  2CTZ A;  3FCR A;  3FFR A;  3LV2 A;  3MC6 C;  4K2M A;  3NRA A;  4ZAH A;  5F9S A;  4BMK A;  1DGD A;  1IX8 A;  4F5I A;  2HUI A;  4WXF A;  4A6R A;  2O7C A;  2A1V A;  5HXX A;  2VMO A;  2VGZ A;  3NX3 A;  3JU7 A;  4CXR A;  3N0L A;  4J5U A;  1QZ9 A;  1JS3 A;  4LW2 A;  3AAT A;  2YKU A;  3E9K A;  3B1D A;  5AX8 A;  1JG8 A;  3MC6 A;  1TAR A;  2WK8 A;  1GC4 A;  3B8X A;  3KKI A;  3PDB A;  3HT4 A;  3EI8 A;  3E2Y A;  3VK4 A;  1ARH A;  1ELQ A;  1TOK A;  4XEW A;  3HL2 A;  4BQ0 A;  3P1T A;  4UQV A;  4ZSY A;  2VMV A;  1TOE A;  2BIE A;  1Z3Z A;  2YKV A;  3TFT A;  3PA9 A;  1ASA A;  1X0M A;  2C81 A;  3ZZJ A;  3F9T A;  4Q31 A;  1E5E A;  1UU1 A;  2VLF A;  1M0Q A;  4E77 A;  3E2Z B;  4P7Y A;  1U08 A;  1EG5 A;  3RCH A;  1D2F A;  4W5K A;  2G7J A;  1QIT A;  2AEU A;  4RAE A;  3LWS A;  4WD2 A;  3WCN A;  4W1X A;  4BA4 A;  1SVV A;  2PB2 A;  1B9I A;  3FQ8 A;  3L44 A;  1ASM A;  5BJ4 A;  2OQX A;  1OXO A;  1M0O A;  1BT4 A;  3A8U X;  3FZ7 A;  4PFN A;  2OKJ A;  2W8T A;  3CBF A;  1V2E A;  3N4R A;  5G4J A;  2Z61 A;  3AEO A;  1O69 A;  4WYC A;  1JS6 A;  2VGW A;  2QBT A;  2DKB A;  2BIG A;  2R5C A;  2AY5 A;  5EQC A;  1MGV A;  3BWN C;  1B8G A;  3E77 A;  4WYE A;  4XJO A;  3NYT A;  4GRX A;  1GEX A;  2VGU A;  1SZK A;  4WLH A;  1AHY A;  1IBJ A;  1RVU A;  2GMU A;  4ZSW A;  3WGC A;  4H63 Q;  5EUD A;  3FQ7 A;  2VMN A;  1UU2 A;  1DTY A;  5F8V A;  3EI7 A;  4ATP A;  1AY4 A;  1B4X A;  2HZP A;  3MEB A;  2W7I A;  2QSR A;  3EIA A;  1AMS A;  1MAQ A;  1ASF A;  3AEN B;  2FQ6 A;  2ZY3 A;  3N75 A;  1BJO B;  4Q6R A;  1PMO A;  3AEM A;  1YJZ A;  2RFV A;  3WLX A;  1AJS B;  4Y0H A;  1J32 A;  3DOD A;  3QI6 A;  1Y4I A;  2VMW A;  1TOI A;  3DZZ A;  1LW4 A;  1VJO A;  1AKC A;  3HDO A;  4MQR A;  3MAU A;  4WYD A;  4K2I A;  1B5P A;  3NU8 A;  1TPL A;  1AMQ A;  3F6T A;  4ZWV A;  2WK9 A;  4IX8 A;  2HUU A;  3K28 A;  1G4X A;  5J8Q A;  5KTB A;  1DJU A;  1SF2 A;  1MLZ A;  2DKJ A;  4RIZ A;  4M2J A;  1LC7 A;  4AH3 A;  5M4B A;  2EYQ A;  3TQX A;  3N4S A;  1EQB A;  2JJE A;  4ADD A;  2BWN A;  4N0W A;  4ZDP A;  3AV7 A;  3LVM A;  1AHG A;  2AY4 A;  2Z67 A;  3W1H A;  3BCA A;  4TN4 A;  1FG7 A;  4WXG A;  3EZ1 A;  3WGB A;  5DB5 A;  3WCO A;  1AKA A;  2VLH A;  1ARI A;  5LH9 A;  1GDE A;  1I48 A;  1WKH A;  2W7G A;  3A9Z A;  1W7N A;  1M6S A;  3FVU A;  1O62 A;  2CH2 A;  1ZOB A;  2EPJ A;  1MDX A;  2CST A;  2ZUK A;  2FKI A;  3CQ5 A;  4IXO A;  2DGK A;  3QGU A;  4IYO A;  4AZK A;  4F5F A;  2HOZ A;  2BYJ A;  1KKJ A;  1O61 A;  3JW9 A;  4IW7 A;  2PO3 A;  1N8P A;  1ELU A;  2CFB A;  2O1B A;  1DGE A;  4J8L A;  4W1W A;  1AY8 A;  5DJ9 A;  2W8U A;  1I41 A;  1WYT A;  3G8M A;  1AAM A;  2BYL A;  5EAV A;  3QPG A;  4UOY A;  2JG2 A;  2YCN A;  5FT4 A;  1WYV B;  3VK3 A;  3JWB A;  1FC4 A;  3ASA A;  4UHN A;  4U1T A;  3A9X A;  3ECD A;  1MLY A;  3PD6 B;  4KYO A;  4GEB A;  4R2N A;  4ADC A;  1DFO A;  1QGN A;  2Z9X A;  3IF2 A;  1TAS A;  1H1C A;  2D5Y A;  3II0 A;  4F5J A;  1WST A;  3I16 A;  1AJR A;  1IAY A;  1ASC A;  3NTJ A;  5EUE A;  2ZP7 A;  2W7J A;  3W1I A;  3UAK A;  4OMA A;  2FNU A;  2NMP A;  1LS3 A;  1O4S A;  5G09 A;  2VMQ A;  4EB5 A;  3EIB A;  3B46 A;  1OAT A;  4O6Z A;  1GD9 A;  2AAT A;  4RIT A;  1C7G A;  3Q8N A;  3RQ1 A;  1D7V A;  1BQA A;  5HDM A;  3BB8 A;  1ASN A;  3R9A A;  2FNI A;  3NU7 A;  4XJP A;  3EI9 A;  2C0R A;  1N2T A;  4W1V A;  2BWP A;  5M4D A;  3WZF A;  3BN1 A;  5IWQ A;  1LKC A;  3BV0 A;  4OYT A;  3NDN A;  1D7S A;  1RVY A;  1VP4 A;  2YCP A;  2AY3 A;  3LVK A;  2D7Y A;  2E7U A;  2JIS A;  3I5T A;  3PDX A;  1IVR A;  4HVK A;  1G4V A;  1M4N A;  3B1E A;  3G7Q A;  2OGA A;  3ZZK A;  1XI9 A;  4E1O A;  1KL1 A;  3MAF B;  2W7K A;  3EI6 A;  3FQA A;  5E3K A;  1BJ4 A;  4MY5 A;  1YOO A;  2YKX A;  2CJH A;  4OBV A;  2D7Z A;  3FKD A;  4ZLV A;  2BI1 A;  3TCM A;  3B1C A;  1OHV A;  1SZS A;  1N31 A;  4DBC A;  3GZD A;  1MDZ A;  2BKW A;  2AY1 A;  1D7R A;  4RM1 A;  3FVX A;  4RJ0 A;  3ZRQ A;  1WKG A;  3LG0 A;  2ZY2 A;  3AOW A;  2AY9 A;  1IX7 A;  4WLJ A;  5C6U A;  4GSA A;  5BJ3 A;  1SFF A;  3KE3 A;  2GSA A;  5M49 A;  4GE4 A;  4Q75 A;  4Q76 A;  3VP6 A;  1QJ5 A;  4F5L A;  2AEV A;  3KGX A;  4EU1 A;  2C44 A;  2G6W A;  4OCA A;  2TPL A;  4JF0 A;  4ATQ A;  4IXS A;  1M0P A;  3W1J A;  1ORD A;  2R0T A;  3ISL A;  3QBO A;  4ZDO A;  1AY5 A;  4OT8 A;  1M0N A;  4WB0 B;  1QJ3 A;  2Z1Z A;  4E3R A;  3AEP A;  4P3M A;  3HLM A;  4EFF A;  2VMZ A;  4WYA A;  2O0R A;  9AAT A;  3AEM C;  1GC2 A;  1WYU B;  1BS0 A;  4NOG A;  3OKS A;  3FFH A;  1V2D A;  2DR1 A;  2VMR A;  3IHJ A;  4MGR A;  3H9X A;  4F5H A;  1LW5 A;  2FYF A;  2HOX A;  1I29 A;  2QB2 A;  2VMT A;  4BHD A;  5EIG B;  3RUY A;  2ORD A;  1AIA A;  3ASB A;  1BJN A;  3FZ8 A;  2CB1 A;  2W8V A;  3PGY A;  3QM2 A;  3R4T A;  1M7Y A;  4RKC A;  4CBS A;  1IJI A;  3N4X A;  2VI8 A;  5LHA A;  3AEL A;  3BCX A;  4A0G A;  4MQQ A;  2VIB A;  4MKJ A;  1C7N A;  3GR9 A;  3E2Z A;  5HHY A;  1E5F A;  3N5M A;  2D64 A;  4GE7 A;  4LC3 A;  1I43 A;  2GB3 A;  3T32 A;  1ARS A;  3WKS A;  1MAP A;  4LNL A;  3MBB A;  2VGS A;  2Z20 A;  4UHM A;  4XQ2 A;  4F5G A;  3DRD A;  4LNM A;  2R2N A;  2E7J A;  3OP7 A;  5I92 A;  1SZU A;  3ATH A;  2VMY A;  5EAA A;  3A9Y A;  3QN6 A;  4KXK A;  4R8D A;  2HP1 A;  2E7I A;  4RKD A;  3ZRP A;  1X29 A;  2OKK A;  4TMR A;  2BHX A;  4XJM A;  5DJ1 A;  1CZE A;  3EI5 A;  3DR4 A;  3JTX A;  3NUB A;  1RV3 A;  4GDY A;  1AMR A;  1GEY A;  5K8B A;  1W23 A;  1S07 A;  5D95 A;  1CQ7 A;  2PB0 A;  2AY7 A;  3FRK A;  3PDB B;  1IUG A;  2DOU A;  2OGE A;  2W7D A;  2CAN A;  4QGR A;  1TOJ A;  3TFU A;  2Z9W A;  3WY7 A;  4A0R A;  4N0B A;  1OHY A;  2CIN A;  2ZJG A;  4A00 A;  4EB7 A;  4OC9 A;  3RBL A;  3VOM A;  3FDD A;  3HQT A;  4OBU A;  2HOY A;  5D5S A;  2KFP A;  4A72 A;  3L8A A;  2ZSM A;  2YRR A;  3N7N A;  3AEN A;  3FDB A;  1C7O A;  1ASL A;  2YOB A;  4JE5 A;  2HP2 A;  1H0C A;  1T3I A;  1BJO A;  4M2K A;  3GET A;  1AHX A;  1LK9 A;  3DU4 A;  1V72 A;  2YCT A;  2W7L A;  3RCH B;  1C0N A;  3FZ6 A;  5EIG A;  1AJS A;  3F0H A;  2V1P A;  3E6G A;  4ISY A;  1D7U A;  1BKG A;  4MKK A;  1PMM A;  4OTL A;  1GBN A;  3HMU A;  1DJ9 A;  3WKR A;  4XAU A;  1ASD A;  5FT8 A;  1P3W A;  1W7M A;  3AEJ A;  1YJY A;  2BI2 A;  1UKJ A;  2EZ2 A;  4R5Z A;  1X2A A;  4CBR A;  3NYU A;  1ECX A;  2W8J A;  2Z9V A;  3WX9 A;  4AZJ A;  4BA5 A;  3GSB A;  1KMJ A;  1B5O A;  4ZWM A;  3USF A;  2CJD A;  1B9H A;  2JJG A;  4F5M A;  1ZC9 A;  2AY8 A;  2W7M A;  2BI5 A;  2EH6 A;  2GMS A;  3AOV A;  4I8A A;  1JF9 A;  1YIY A;  2WKA A;  4ADE A;  5G2Q A;  1CL1 A;  1AAW A;  3JWA A;  2QMA A;  3PIU A;  4ADB A;  1IAX A;  1S0A A;  4JEZ A;  1CJ0 A;  2JJF A;  3BWO A;  3A2B A;  1BQD A;  4M2M A;  4U2H A;  5E4Z A;  1X28 A;  3GZD C;  4A6T A;  3PPL A;  2F8J A;  1AHE A;  1GC3 A;  1YNU A;  3HBX A;  3KGW A;  4MSO A;  1KL2 A;  1KMK A;  1CZC A;  4F4E A;  1OHW A;  3LVL B;  1S08 A;  1ART A;  1YIZ A;  2V0Y A;  2ZC0 A;  3DXW A;  1M32 A;  1AX4 A;  2X8U A;  4WXB A;  2ZSL A;  1YAA A;  4JEV A;  2VMX A;  3EZS A;  4DQ6 A;  1W3U A;  4ITX A;  1GEW A;  3GJU A;  3E2F A;  3HVY A;  1WYV A;  2AY6 A;  3PAA A;  5FT6 A;  4DGT A;  7AAT A;  4A0F A;  2W7E A;  4PIW A;  2X5D A;  3ACZ A;  2WB6 A;  1CL2 A;  2JJH A;  2CH1 A;  5G2P A;  2BIA A;  2XBN A;  3PD6 A;  1AKB A;  4XK1 A;  2BWO A;  1TAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...