2CH8A

Structure of the epstein-barr virus oncogene barf1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
199
structure length
188
Chain Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords 33 KDA EARLY PROTEIN
publication title Structure of the Epstein-Barr Virus Oncogene Barf1
pubmed doi rcsb
source organism Epstein-barr virus
total genus 40
structure length 188
sequence length 199
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ch8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ch8A02
2XY1A 3G08B 3ROLB 1P5VA 4Y4KA 1ROWA 4RGMC 1IKNA 4L5FL 5D7IE 1A14L 3GSWA 4O9HL 1B90A 4QGYA 5HYSA 3TF7C 2XKNB 4AL8L 3B9KC 5JHDB 1U93A 1CI5A 1R3KB 1I8KB 1MI5A 1URLA 3V6ZB 2VC2L 2X4NB 1YN7A 4LP4A 2ZUQC 4PRIB 3QUMB 1KPUB 3HPLA 2BSRB 1JN6B 1AD0B 2P7TA 2VXUL 3CIQA 4J4PD 3KYNA 4Y5XC 2MSPA 4HQQL 4KVCL 3FQRB 2E8ZA 4XP1L 3BKYH 3BDXA 3O8XC 4FQJH 1K8DA 2AXJA 4G3YH 3P73A 5IBTL 1EEZA 4XP5L 1WAAE 4FQLL 4JJ5B 3G5ZB 3QQ3B 1P4BL 3F7YA 3QEQA 5LCVH 1JPSL 2A9NH 3CLFH 1XF2B 1HXMA 1NAMB 1IKFH 2VLLB 5FCSH 2VDML 4ZUVB 1XGUA 2DWEA 4IBLT 1KCVH 3U9UA 5DT1L 4ZSOA 2E9WA 4HUMB 1KCRH 3UAJC 2CR6A 1FLTX 4Z8FL 4YNYA 2BDNH 1I1FB 2FD6H 4KY1H 1XH3A 1FZKB 2EH8H 2X4QA 5HHOE 2A6IB 3CUPB 4RX4D 4RGOH 1NCWH 2VDRL 1RK1B 3B6SB 2RB8A 3T0DA 4X7EC 3V4VL 3GBLA 1I9IH 5I0DA 2V6HA 5EU5B 1K4DA 4BZ1L 5CCKH 4YBLC 3MV9E 4G6KL 2O5ZH 4N0CD 1AGCB 3L5WA 1XF4B 2NXZC 3D3VA 5GJTH 4MB5A 5ICZB 3AY4C 4WUKH 4ENED 4KKBD 3AS2A 5DJ2A 4UV7H 4R97B 4JPIA 1T83A 5JW3L 2KPNA 1OP5K 4KTEL 1KJ2L 1CFSB 1H0DA 1CFBA 4KZDL 4N1EA 1U6AH 4ZNCD 5KSAB 4HMCA 1OAZH 4F9PA 3RUGA 1I3VA 2CRZA 4XAWL 4Y2DB 4K9EL 1D6EB 4PLJC 1P7QD 3SCMC 3WJJC 4PJIE 3H3BC 5IF0B 4QRPE 4EN3D 1BWWA 4Z78B 4K71C 3SE9L 1MIEH 4HCRL 3ZYIA 3HI1B 2M1KA 4JCMA 2DICA 5DQJB 5ADOL 5BO1H 3J8F7 4WGWB 1ES0B 1CE6A 3FQTA 4Y7MA 2HJFA 1QSFB 5IW3A 1ITCA 2COQA 1KTRL 3CZFB 1FFNA 3A6CL 2VLRA 3VU2A 2IANA 1X4ZA 3O2WH 4P57A 5E4IA 1RULH 1WCBB 2J2ZA 4QT5B 4LLWB 3ZYOA 1Y18A 2UWEA 1C5DB 1DVFC 3QG6B 3GSNH 1RZFH 2JJTC 3V6BR 3WXWL 3IXTB 3GRWA 3EGSA 1Q9OA 4HKXB 1IGML 3U0TA 5EZOL 2ZSWB 1YY9D 2GKIA 3VXMD 1MCJA 5D6DA 3UPRB 4ODUB 3PDOB 1CL7H 4JZNB 3MX0A 5DJ8A 1I3GH 1G7JB 3EDFA 1QG3A 5C0CB 5H35B 1KNOA 3VG0L 1HHGA 5EUOF 2ZPKH 2YD9A 5CGTA 1OAUH 3EOTL 1SJHB 3HE7B 2FEEL 4HIEB 1T0MA 4K3JH 1S7UB 5E5UB 2IQ9L 2ZUXA 1HHJA 1OTUC 3GHEH 4MAUL 5DRNB 4QOKB 3WSQL 1MCHA 4W6YB 2C3VA 4BZYA 5F9WB 2PTUA 3P4MA 2BERA 1JIBA 4HS8L 4XVUC 1S78C 2DDQL 3ES6A 4YUEH 3VMNA 5HYIA 4MSWB 1R3HA 1A3LH 2KKQA 3Q6FA 5IT2H 3KYOA 2VKWA 1XGYH 2H41A 4HHAA 4MNQB 5F1IA 2DIBA 5E9DB 3O9WD 3UTTA 4L9LA 4LSRH 3FO1B 2X1WL 1ZSDA 4M00A 4BK4A 1S9KC 3QDGD 3MGAA 3SGKA 3B9AA 4U6TA 4RNRB 5D7JD 2VZ1A 4FFVD 2JELH 5JTWA 3WFHA 4ZUUB 4Y4FA 1A0QL 5IESH 1C5BL 4N8PA 2YHGA 4QHLA 4Z7UB 3QWRA 3BW9A 5HGAA 3QJFA 3RL2B 2I27N 2ZZUT 4HW6A 2K3TA 1XCQA 3GHBH 1Q8MA 2YPLD 1MCIA 3EZ8A 2KDGA 1TVHA 2ADIB 3JTTB 3D2UA 1NBVL 4H8WC 5INCB 3IKCB 2B5IC 3KPRA 2BJML 1NC4B 1N5AB 1OGAD 1MREH 1NFDF 3L95B 3DX9A 5KVGL 1UC6A 4JZJB 4G8IB 5E1AB 3OR6B 4ZXBD 1HH6A 1GC1L 4OM0H 5I1AA 1U8HA 1KENH 1ZA3A 2B8OT 4YHKH 4MA8H 2W59A 4LPWA 4NT6A 3DI2B 4Y2OA 4C57C 4N5UA 2O5XH 3HC3H 4MB4A 5FA3A 1GSMA 4XNQA 4OF8A 4JM4L 4NHUA 1JF6A 2P5WA 1BVZA 4S1RH 4V2BA 3VCLA 3ZE1F 2R56H 3B3IA 3LKRB 3VI3E 5FO9B 4S0TD 3DLQR 1CGTA 3C5ZD 3QNYA 3FFDB 5MEPA 1U3JA 1NEZA 5F89A 1XIWD 5FO8B 1KBGH 1RURH 2PO6D 1JGEB 2VISA 3DV4A 4K3EH 3ZKXB 1AQKL 4XX1E 1IEHA 5SWQB 1CR9L 4QHMB 2PW2A 2OTUB 4ORZC 4EXPX 4HSQA 3SKOB 2GTZB 4EQ2A 3QIUA 3JTSA 3EJYC 4NBYB 3HC0A 3ZKSD 3TBVA 1HSBB 3V6FB 3UBXB 2IPTL 1T89C 4XP9L 2Y23A 4P48A 2YD1A 3PNWB 2X4RA 5CWSA 5JQHC 5IB1A 2GTWA 2BCKA 1SBBA 5TDPA 1NKRA 3ULSA 3GGWA 5I1DA 4X6EB 1YNTA 3UO1L 2GY5A 3FRUA 4G6ML 3PGCA 1ED3A 3NA9L 3DJ9A 4LQFH 5KSBE 1T1WB 4KV5F 4KK8C 4JG0H 5IHZB 3MRLB 4LHJB 3QHFH 3SGEH 3WHE0 1ADQA 5ESVB 4LQ1A 2W9EL 3FB7A 1NLDL 5FOBA 3IJSA 5FYJE 2YZ1A 2HTKD 2KL6A 4X9BA 4AMKL 4M62L 4J3OC 1KCSH 4FA8A 3KPSA 1V8HA 2NY6C 5FHBH 1ULVA 5HHVH 3MGOB 5C86A 1H3VA 4KJPC 2MKWA 2VH5L 1REIA 1JYNA 5K9OA 4M6OL 1S7SB 5FGBC 2QHRH 3P9MB 2OQJB 4QTIH 1IQWH 1UWEL 3GMLB 4PJDF 4KZEL 4HAFA 1YMMA 5HDBF 1KB5L 3SE4C 4L4JA 4LLMB 3S9DB 2K7PA 3LB6D 3VXTB 3BQUA 4N8CH 4HXAL 1P5UA 3PJSB 4MCZA 3D39E 3MR9A 4JM2A 4Q0XL 3WO4C 4K07A 3T4YA 1DEEB 3SKMA 2D4DA 4CN6A 5BV7H 5GJSH 1H3XA 1ZTXH 2N1KA 3AREC 5EBGA 3STLA 3TT3L 4BFBD 4HZLA 4U4BA 3GSVA 1YNKH 3MV7D 5EZJA 1R5WA 5D72L 4X7DC 3WJLC 1AR1D 2VUOA 1H3TA 3GM8A 4N9GA 2AEQL 1AGFA 2EH7L 3JV4A 4LEXH 4JZOA 1FL3A 5T1LD 4RMVA 4AEIH 1CLCA 1JWMB 1RZKC 3QEGH 3PV6A 1KEML 1UFUA 1KFAH 3GB7A 3VA6A 2LABA 1JZ7A 3U46B 2ZCLL 3P4OB 1NGQL 4LKCB 1EH9A 1EHXA 2WBJC 2WK2A 4M43H 2OR9H 3WDHA 1INDL 1NANI 1T7XA 5DJ6A 1E6OH 1XR8B 3IDJB 5DJDB 3P0YH 4L3CB 3MQIA 2DQEL 3UTZB 2R2CA 5A2JH 4PTTB 4N0UB 3W9EB 3IJYA 5DFWH 4APQB 1YY8B 1GOGA 2WIIA 3ZDYF 4G8EA 2HT2C 2A83A 1XEDA 1JMZA 2YC1A 1DQJB 4UNVA 1MNUH 1OVZA 1ZEAH 2V9TA 3DXAD 3FQNB 5TDNB 1MPAL 1N64H 1JCKA 2VDQH 2H3NA 1OARH 4G6FD 5JO5A 1YDPB 4AY0A 2LFGA 1A6WH 1KXTB 4JCLA 4FRWA 5JMRA 3C9NA 5I8KL 1OAYL 1YUHB 1GOFA 5GGRY 3V4PL 2FATL 4MNHA 4P5KB 3REWA 3LMJH 5DK2B 5IOPB 2GJZB 2ITCB 5FKPB 5L2KB 1X5IA 4HUUB 2EIEA 4MD0A 2IJ0C 3GBML 5AZ2H 3BP6B 1BD2E 5DUPH 1S7RB 4M7JH 4UIMB 4OQTH 3QUKA 3DMMC 4CVZA 5I74C 1FNGB 3WD5H 1HH9B 1VACB 1AJ7H 1YEFH 2IGFH 4BSJA 5F8QC 1T20B 4U1JA 4L4VA 4JFYB 5IVZB 3SDAB 5IVXF 3DVGA 2H32B 1AFVH 3FJTA 4OLUL 4U0RC 3G6DH 4XC1L 5A16A 4TNWF 4F2MA 1H8SA 3I6KA 3WKML 1ZVHA 2IALA 2XTJD 2DIJA 4B50A 3QB7C 4F3FA 1EVUA 3B83A 1RJYB 4XWGH 4HH9A 4HWEL 3M8OL 1U92B 1FPTL 3ARDC 4GQ9H 4D9RE 5LAXA 4NGHL 3HAEA 1IEAB 3QI9D 1LNUA 4O5LH 4LLYB 4U6HA 3SJVE 3TZVC 1KTKE 1IGFH 3D3VD 1AD9A 2EC9U 1WV7T 3AU1B 4HUXA 5DRZB 1NJ9A 1DUZA 4NQVA 3NCYS 5DVKA 3UBXI 2BSTB 2Q76A 4YHYB 3NIGF 2HG5A 3V52H 2HFGL 3C8HA 2K9UA 3S7GA 4FP8H 2ID5A 1ZXQA 2YUXA 1KJVA 4JHAL 1Z9MA 2VAAA 3NVQA 3MJ7A 4UINH 5KS9A 3ZKMD 5TQ0L 5GISH 4JDTL 2HKFL 3OKNB 1TQCC 4OB5L 1NCCL 4GRLB 3VFOB 1MWAB 4WV1A 1EZVY 3P30L 4Q9QL 1QSVA 4NNPL 2W60A 3BH8A 2D03L 2Z35B 3KLSA 3LKPB 2MKLC 1MRCL 3ARGA 2BOBA 3CFCL 1TQBB 2IAND 2VMFA 4OCXH 4OKVB 2YPVH 1PYWB 1VA9A 5KAQF 4ZFGH 4P5TC 2C1PB 4MD4B 2HA1A 4WW2A 1NFDB 2B0SH 2BNRE 4XCEA 1QYGH 2DQHL 4HJ0C 3BUYA 2EO1A 3RWDA 4JKKA 2W0FA 1KPRA 1LO3L 2EE6A 4H0GA 2EDNA 4JN1L 2OTPA 1MFEH 5TPWL 1MCBA 5C8JA 4MWFB 3VRLF 1FJ1A 4GBXD 4PJBB 5ID1A 5IB5B 2ZG3A 1S7QA 3VMOA 5L0QC 3QO0B 1HXYB 5I1IH 3RWIA 3AM8C 4JPWH 5KOVC 2WWMC 1TENA 1IC5L 3QUZA 1RK0A 5GS3A 3IU4H 3NCEB 3RVWC 4WI4A 4X8XA 4OFIA 3T0EC 3ZE2F 2KZWA 4WTXA 1EA9C 4JHZA 5F7DA 3C2SA 5D1QC 3VWJC 3CXHJ 3WN5C 4EI5B 2ICWJ 1J0ZA 4P4KC 4NN5B 1BJ1H 5C0BA 5HHOB 1KJ2A 2I26N 1Y0LB 3RZCB 2AK1H 3VXRA 1QSEB 4DAGH 1KLGB 3UYOD 2YKLL 4GUPA 1YEKH 5D2LA 4XBPA 3RKDC 3L3KA 4P46A 3LHPL 3B8YA 3LPWA 1G7QA 2Y5EA 4HBCH 2VDLL 1FNAA 2IAMC 3LD8B 4PJEF 4WHTA 2X4PA 1I4FB 2DIAA 1EAJA 3DRTB 3RTQD 3A0OA 3UTTD 3WFDL 1DQLL 4N9OB 5T1MA 3Q3GB 2DQUH 2FIRT 1I8LA 1WT5C 1U8QB 4YDLC 1VFBA 4GRMB 4RMRA 1WEJL 1G7IB 3QIWB 2JB6B 3QWRD 1K85A 3K1KC 2FX8H 3P77A 5CZVL 5KBNC 4YBQC 3C08H 5DD0H 5EIVA 2I60L 2IFFL 3D2UD 4PJIB 4WENB 5DJXB 3KPRD 4PRBB 5ACZA 2E7LA 3S35H 4QRPB 3T77B 3U48A 1F3RB 1FFPB 3OXSB 2V17H 2ZOKB 3L3DA 3RY4A 3STBA 1A1NB 1WUNT 3BIBX 4J23A 1TTGA 4KI1A 4QXUH 4OJFH 2NLJB 3O4LE 5B8CA 3K2UH 4XNMB 2XZCL 5C0FA 4LU5H 1FCGA 1KIUA 5T33H 4JY6A 2YR3A 2CMRL 5FUCE 5LWYH 2OL3A 1XR9A 2CKBB 3IFNL 1JF1A 5HHQA 2HLAB 4GG6A 5IFJB 1G7PA 1A6ZA 4HIHB 1C1EL 4QRRE 3ZSTA 3T0WA 4LFHD 1I9RH 1FYHB 4NOFA 1N0LA 4P5MB 4XTRD 1UYWL 3VFNA 1FDLL 4Q9BA 2LVCA 3JVGC 3OV6A 5JORA 3M45A 3U4AA 3RX7A 1QOKA 4CMMB 4L4TE 4NKIH 1S5HA 3OMZA 3O0RL 1T6VN 2JIXA 5T1KD 1CGSH 1JK8A 2DQDL 4LDOB 5GGQL 3MFFB 5T5NF 2ATKB 4FN0A 5F7EH 1GPOL 5E6IB 1FIEA 4OLZL 3ZKNC 2HRLA 2C26A 2A9MH 1MSPA 3NIDE 3QIUD 1R5IB 3BAEH 5D1ZB 4X6DB 4X7SH 4YAQB 4LIQL 4K94H 5CJOL 2EIZA 3HN3A 4QHUA 1JGLH 3EJZD 4ONHA 3DBXA 3M1BB 5J3HC 5LGKA 8FABB 3D6GA 2OK0H 1NMAL 3C8KA 4OGXH 3V0VB 5J11B 1J1XL 4X5LA 4DW2L 4PGDA 3NCMA 3VFRB 4OM1L 4ZPVA 4RAVB 2W07A 3EYSH 3QCVH 4R4BB 5T1DL 2GJ6A 3UJTH 3HCVB 5GGTA 5DFTA 4LCWE 1R24B 5CIPH 5GSVB 3WL9A 4JB9L 1QLEL 3CK0H 2P5EA 5TE7L 1MJJB 2AEIT 1YEEH 3OPZL 3UPCA 4RIRA 3HTLX 3GBNH 4M5YH 3H2WA 1QRNA 4ZOBA 2GCYB 1AY1H 4QHNA 4XPTH 1IAIM 4D0DA 4MZ2A 3L7EA 4RFEA 1FV1B 3MXVL 2NY5C 4NUJA 3TV3L 1CICC 3CSYA 5ALCL 1VFOA 3S5LA 4JRYE 5E6ZA 2F5BH 1UG9A 2XWTB 5JIHA 1D5MA 1JUFA 3ARBB 3B9VA 1WZLA 1P53A 1JHTA 4OUUA 4HXBL 3QH3B 3PWUA 4RWYL 4FNLL 5EG6C 2R4RH 2UZYB 4YHOH 1QO3B 1NQBA 4NNXB 1FNEA 3EDDA 1MUJA 3O4OB 4U1HA 4NZTL 5C0EA 5FA4B 4J12A 1WIUA 2HJLB 3KWWB 4QLRA 3KR3L 4BM7A 2R0ZH 4PREA 5FHAL 1D9KD 3QDJE 5BVJB 2F5AL 2AXHA 3QZWA 4OIIH 1T1XB 2Y72A 4Z95H 3KHQA 1N2RB 2GT9A 3CFBA 4JFFA 5IJVA 3QO1A 4HMDA 4QKXB 2Y07H 1CYGA 4QXWA 4YHPA 3UC0H 2V2WA 3VH8B 4QXTB 2X9XA 4MJ6B 3V6OE 2DWDA 1KXVC 1OSZB 1CXFA 3QP3A 4JRXE 1WBYB 3I6LD 4K8RC 3ZHLA 3QEUA 3RWEA 1CIUA 1Y6MR 1P84J 2VXQH 4R4FH 1DANT 4C59B 2Y25A 4ZFZB 5IUSA 5DEFA 1KPVB 2MPAL 4F8TA 1F4WH 3KLDA 1XZ0A 4LSSH 2AJSH 3QDME 3CSPA 5K9KA 2NW2B 1YC8A 1ITBB 1KIQA 4NRYA 4K7FB 3ZMRA 3DUUB 4EVNB 2YA0A 1CE1H 2DQCL 4H5SB 4S11A 3SBWC 1KB5A 5C2BH 4OF7A 2H9GA 5FGSA 1JGVH 2VAJA 3BI9X 1PFCA 3GUTA 3MLRH 7FABL 4YFEA 5CP3H 4NCDA 2E8YA 1LP9E 3TA3A 3RU8L 4OAWA 1JFQL 3BWAA 3VGFA 4M7LT 6FABH 1IZKA 4HJGB 4WI2A 3QA3A 2Z92A 3SPVA 4DKEH 3QUYB 1IAII 3BJLA 3BEWA 2RR3A 3N0PB 4DVBB 2IH1B 4KXZH 4MD5B 5MP6H 4DKFH 2Z93A 4GMTL 3NH7H 4L4VD 1Z2KA 2J8UE 4FMKA 4X9HA 2QADD 1JVKA 4KMLB 1HILA 3KXFB 1H5BB 2VLMD 5C92A 1BFVL 2OP4H 4LCIL 2ADGA 4PBVC 3EYVA 5IWLC 4Y5VA 3PP3H 1KELH 3CDYA 5DWUL 2QQKH 5CEYA 3LN5A 1D5XA 4K3DL 3OKDB 1E4XL 3BHBA 3G08A 3ROLA 2GY7B 3TFKD 3NPSC 3O6ML 5JR1L 2XKNA 1CFNB 1VEPA 5FM5M 5MHSD 1JJUA 1R3KA 1I8KA 4ODBD 4NO0B 1QNZL 4U31A 3GNML 5TF1H 3V6ZA 2X4NA 2EYTB 3QUMA 3L3JB 1KPUA 3SQOL 2BSRA 4HS3B 2I25N 1JN6A 1BZQK 4NQDB 4P2CG 5EIQA 3HLAB 3DX7B 3JSSA 2PYFA 3ZYZA 3N50A 4NQED 3G6JF 3HB3C 2J8HA 1RMFL 3GK8L 3V8CA 1I7RB 1EXUB 4OLVH 2PYED 3RBGA 2E9JA 4IOFD 3S37X 4U1LB 1CDYA 1MFDL 1QEWB 3EO0B 3SDDC 5E2JA 4JJ5A 1DTUA 1BJ1J 2P49B 2VLKE 3OKMB 3QQ3A 1A3RL 4RBPK 3QCTH 4KMTL 5I18L 3DYPA 1JGUL 1NAMA 1JNNL 2VLLA 4HWZB 3ZL4L 1XF2A 4UOJA 3SE8H 2AW2A 4M61B 1ZGLM 3WIIH 2FL5B 3WDJA 5FV1L 43C9B 4IJ3C 1MVFA 1RUPL 4PV9B 2H2SD 2B4CL 3J7HA 1WIPA 3SKNA 2EZ0D 5LBSL 4EUPB 3MJ8B 3EYFB 3SE3C 1FVDB 4N0FB 3FOLB 1A14H 1I1FA 1ZVYA 3HUJE 4LGPB 4AL8H 4GLRI 4PJHE 1G0DA 4XCNB 3U7WL 4NPYB 3W82A 3HAEH 3MTRA 3VFGH 1AP2B 3QNXB 4K9EC 1LEKA 1R3JB 3NPZB 3CUPA 4R9HA 1RV6X 2VC2H 3B6SA 3QXVA 3QDAA 3ZYJA 4PJAF 5IMOA 1T2QL 5IM7B 3KYKL 3SEPA 3U82B 5EU5A 1DEDA 4P9HL 1TJIL 3WNKA 4WUUA 1ZS8B 3OXRB 4NQXB 1AGCA 1XF4A 2VXUH 4M9PA 4I9WE 4NUGL 4XP1H 3QDGE 5ICZA 2G5RA 3VE0B 2AERT 2Q1EA 4HX1B 1JPFB 4AM0B 4XP5H 4LPTA 2Z4QB 1P4BH 4OZHF 2ERJC 3VH8G 4KJWD 4KAQL 4XX1G 2Y36H 3E6HB 3ETBF 3LEXB 1HN1A 5IK3B 4YIQB 3W2DH 1II4E 3KPLB 3EW3B 5KSAA 4PR5B 4LSQL 3V95A 5D7LB 4Y2DA 1D6EA 3FQXB 4X9GA 5DT1H 2A6JA 3EHBD 1X3DA 2CDEB 1OGAE 3V7MA 4I2XE 4ELME 2FHCA 1U8LB 3MRGB 4LVOB 4Z78A 1IL1B 4G5ZH 4ZTOH 2NTSP 3HI1A 4HLZH 2C3GA 5DQJA 1IGIL 4XAKE 1ES0A 4MX7B 2UV3A 5SV4A 1QSFA 2VDRH 3CZFA 4LP5A 4NN6C 1V7NH 3O45B 3SDCD 4Z18A 4RMQA 1WCBA 4BZ1H 2VE6B 4PJCA 3VG9B 4QT5A 4LLWA 5JW4N 1C5DA 2YD7A 4Y5YC 4P2QD 4KRMB 3QG6A 4WO4C 3IXTA 5E5RB 4MJIE 3T2PA 4GAGL 4HKXA 1CF8L 1LWRA 3KS0J 1A47A 5FCUL 2ZSWA 5F8RC 1KN4H 1G0XA 3NCYP 2BC4A 4XI5C 3UPRA 2ITDA 2D31B 3PDOA 4ODUA 4R7DB 1MHHB 1G7JA 5C0CA 1KJ2H 3K80A 5H35A 1EHAA 4I5BB 4KZDH 4GJTB 4F9LC 5E5MB 1GH7A 1SJHA 3F6LA 3HE7A 1FNHA 4XAWH 1S7UA 5JLZB 2F8VA 3N85H 5DRNA 4QOKA 5D1XC 5HVGB 2B39A 1MIML 1I1CA 1RZ8B 3O2DA 1IM9A 4KJYB 4PD4K 3ZE1E 2NX5E 4KI5C 4KI5F 1NSNL 1CXKA 3SE9H 4MSWA 3FMGH 4GKNB 4X80H 5E95B 3QPXL 4NFBA 5HYEA 4MNQA 2EDTA 1U3YA 3A6CH 3TVMC 1L9NA 1AXSB 3FO1A 2ZJSH 3ZTNH 1JPGB 5JDSB 2XTLA 2WLZA 5IBLD 1PJ9A 1A7RH 1U95B 3WXWH 5D7KE 1MCQA 3KYMA 3NABL 1JI2A 1WTLA 4ZUUA 4J3VA 2R0KL 1K9TA 1FG2B 1IGMH 5EZOH 4G42B 1CLYL 1FAIL 4ISVB 4N8VB 4PJGB 4BFEA 2ADIA 3JTTA 5J9PB 5C6TL 4PFEA 1F90L 5INCA 3IKCA 1XGTA 1W72L 2JF1A 4DZ8B 1NC4A 2GJ6D 1IGJB 3C2AL 4DVRL 1IGTB 4LVNC 2OL3H 2LTQC 4OD2B 5DRWB 3JV6B 3O41B 2IQ9H 3L95A 1NCNA 2P5ED 3QRGL 4JZJA 3WSQH 4G8IA 5E1AA 3OR6A 5E2TH 2OTWB 4PRHE 1MFBL 2DDQH 3GSOA 4DZBB 4CMHC 1QRND 1TPXC 1D5BA 1EGJA 2AV7B 1AGEB 3QWQB 4HGWB 4OZIE 3X12B 4A2MA 2PTVA 4YPJA 4F37K 3MV7E 3D18B 5C7XL 3ARXA 4G8GE 1FE8L 3LKRA 2MFNA 1UH2A 2BXZA 1ORQB 1SM3L 5FO9A 5HDBE 4PJ9D 4PP2A 3JUZA 4PP1C 3O4LB 1DN0B 3KPQB 4LSVL 3HG1A 1A0QH 4ZUSB 5FO8A 5JXAL 1KTLB 5D93C 1FQ9C 1ZMYA 5IV2B 2KBGA 1UM4H 1JGEA 5DMIL 4ZYKA 2NTFB 5E8EB 1ZHNB 1CDCA 5SWQA 1NUDA 1XCTA 4M7ZB 4QRRB 3SKOA 2H2PC 2GTZA 5MEND 1NBVH 4QGTA 1HDMB 4JDVB 1HSBA 3V6FA 3UBXA 1Q1JL 5IMLB 4KWUA 2UUDH 3NFSH 2JCCF 3PNWA 4JFFD 4IHOB 1F8TL 1LO4H 2A0LC 4LSDA 4P0DA 4WJ5B 5KVGH 1IT9L 5IKCB 4NQCB 1GC1H 4MNGE 3DXAE 4X6EA 3DWTA 3MLYH 4G7YL 1B0RB 3ALXA 1Q94B 2XRAL 5IHZA 3MRLA 4G9DA 3PWNB 4UTAL 1QBML 4RAUA 1JPTH 2QR0B 1QKZH 4JM4H 3QT2A 2C3WA 4I3GA 3IFPB 5HI4C 2XA8H 5I75B 1JYXA 1M7IB 3G6JB 3ESVF 4P2OB 3X17A 4F37F 3D0LB 3G04B 5HHPB 1S7SA 3B5HA 4Z6AT 1AQKH 1HI6B 2VXVL 1X5GA 4PLKD 1N6QH 2OQJA 3BDBA 2YN3A 3GMLA 1CR9H 2YPKB 3BPOC 4C4KT 4LLMA 5F9JA 1I3UA 2J5LB 2MMXA 3VXTA 3SKJH 4TSAH 1KT2B 3GMMB 4WI6A 5ISZE 2XTJE 1INQB 3PJSA 4L29A 1I8IB 3TA3D 1NBYB 1RSFA 3MBXL 2IPTH 1YEGL 4XP9H 3D9AL 5JOPE 1DEEA 2F19H 4RGNC 3RBSA 3C60C 2BVYA 1QFHA 3UO1H 5GGSY 4MA1B 3HZMB 4UT6H 3NA9H 4PG9A 5FDWB 4PGJA 3RFZC 4NZRL 3KLAB 1HCVA 2RIKA 5D4QA 2AVGA 4WDIA 5IVXE 1DL7H 2W9EH 1X6NA 4NYLB 1NLDH 1ZLVH 3BN9C 1JWMA 3T3MF 3BH9B 2Q7YB 1NMBL 3QFJA 4NRXB 3TO2B 3LSOB 5B38B 3U46A 2YA2A 3P4OA 4LKCA 1T5XB 1UZ8B 2DJ4A 2NYYD 4OTXH 5FDYA 3H9SD 4PG2C 1P4IL 1EEUA 1LK3L 4M6OH 1S5IL 3FHAA 4O2EA 1CGVA 1XR8A 2VZOA 3IDJA 5DJDA 1UWEH 3UTZA 3SDXF 4KZEH 2DLIA 1RJZB 5ELIA 1KB5H 3BPLB 4XH2B 4PTTA 4N0UA 3W9EA 5D2NC 4APQA 3OHXA 4N8VG 2ZCKL 4YC2B 1T03L 4JKLA 3S34L 1DQJA 3UTSE 4JRXB 5GRVL 4XWOD 3FQNA 4PLOB 5TDNA 3CFDB 1HQRB 5H2BA 1YDPA 4MXWL 4UT7H 4TVSa 5DQ9A 1QVOB 1YUHA 3TT3H 4UDTA 2VIRB 3Q6GL 4P5KA 3B9KB 2GJZA 2ITCA 1CGXA 2CGRL 4P49A 4UB0L 5F97E 5FKPA 5L2KA 1PGRB 4YFLI 3RVUC 4P9ML 3QDMB 1MAKA 3ZSSA 2EH7H 3D1MC 5LQBL 4WFFD 3BP6A 4OGAD 4UIMA 5J89A 2YMXL 1L6ZA 4ZS6C 1KEMH 1FNGA 1DBBL 2E3VA 1VACA 5CJ8A 2GEEA 3UROR 5I1CL 5AYUL 1T20A 4L3EA 2ZCLH 4JFYA 1P2CA 4YE4L 5D7SL 5IVZA 3SDAA 3U6RB 4LVEA 5IEKB 1KSRA 4Z76A 3IGAA 4PRAB 3SY0B 1DBJL 1LP9B 3IVKB 1INDH 3S35X 4TNVK 4FQXC 3BYYA 3EKCA 4Q6YA 4MXVF 2DQEH 5C0NC 5E8PB 1RJYA 3GSNB 4XVSL 1U92A 1X5YA 2V2TB 1KJMB 3UZVB 5F1SA 3QUMH 4WUUD 4Y4KC 1IEAA 3L5IA 4LSUL 1IKNC 5FUZL 3BPCA 2J8UB 1U58B 1MPAH 4IMLA 4X4YB 1KG0B 5E8NB 2MNUA 1L7IL 4Y16A 3AU1A 4KKAC 3ZE2E 5DRZA 4ODXB 5K9JL 5I8KH 3BGMB 1OAYH 1GGBH 3V4PH 2FATH 1CFVL 2BSTA 2EDOA 4IRJC 4MQ7A 4XMPH 5DHYB 5FUOH 5JZ7C 1SYSB 2NZ9D 4JGUA 3TT1L 2VDOH 3GBMH 4BQ6A 4HDIB 3RNKB 1P7QB 3CMGA 4KJQD 4Y2DD 1NAKL 1PEWA 5FYKE 5L6YH 4GS7B 4YDIL 2NXZB 5AAWA 4Y1AD 3OKNA 2DQGH 3P3YA 3WFBL 1AXIB 1KIPA 1MOEA 4GRLA 3VFOA 4OLUH 5KVMC 1MWAA 4XC1H 2PUQT 4CJ0A 2AQ3A 2DYPD 3WKMH 4UAOC 2Z35A 3VI4F 4F15C 1F2QA 3LKPA 1OPGH 3N9GH 2R1WB 3N1GC 1KLFA 2YRZA 1WFNA 4CADB 2AABL 1I7TB 1YNLL 5AD0A 3M8OH 5E7BA 1PYWA 1FPTH 1FRGL 2C1PA 1WAAA 4MD4A 2VLKB 4A6YL 4BQ8A 1FYTE 3CDGB 1OTTC 1TCMA 3VXMB 1B4RA 4JGMA 4MVBD 4MWFA 5BVPL 4K71B 2AGJH 3L9RB 1T2JA 4PJBA 5IB5A 1WTGT 3QO0A 1HXYA 4JY5H 1FAKT 4F7PB 2HFGH 2CUMA 3HE7D 1RQ5A 2NY1C 3VWKD 2P43B 3HUJB 4JHAH 1ZHKA 2O93L 4PJHB 3ALWA 4EI5A 3WLBB 5IG7A 3HR5B 5TQ0H 1ZA6B 5HHOA 1Y0LA 2HKFH 1IM9D 1I1AC 1QSEA 2OJEB 1KLGA 1FCCA 1CLZL 4GXUN 2ZSVB 5B38G 4ERSH 1A4JB 1F58L 1T83C 1KIRB 3P30H 4Q9QH 5CKAA 1B0WA 4NNPH 1CLOL 2I9LB 5F21B 2D03H 3RVVD 4PJ8D 3A6BH 3U30B 4F9PC 3O9WB 3OAZH 3RUGF 1I4FA 4DQOH 3DRTA 4XCCL 1G6RL 1TJHH 3CFCH 3QDGB 4GO6B 3HI5L 2XZZA 2HH0L 2R9HC 3CX2A 2CO6B 2X44D 3L3IB 1NC2B 4WW1A 2SEBA 3RPIB 1CU4H 3MRHB 2ZKHL 3MRDB 2DQHH 1EV2E 1J1OL 3MA9L 3QNZB 4GRMA 4U05A 4X4ZA 3DGGA 2WNGA 2FO4B 3QIWA 1LO3H 4YX2H 2JB6A 2NY0D 4G8FB 4JN1H 5TPWH 2GFBA 3RTQA 4G6JH 5DK0B 5FGRA 1X7QA 2XQYK 4HC1A 4PJIA 3QAZC 1K6QH 1OP3K 5D96B 3QCUL 1OGAB 5HYQB 2KQMA 4HF5L 2UWEF 4I2XB 4M3JA 4PRBA 4ELMB 4F7TB 2H45A 3RGVA 4QRPA 3T77A 1FFPA 3OXSA 2ZOKA 4JPKL 3BO8B 2H6PB 1A1NA 4IIQC 3LQZB 3BKJL 2NLJA 2CO7B 2YKLH 1TIUA 1DANU 3HZKB 3IRZA 5D6DC 3SN6N 3HPJB 1A6PA 1U41A 5JPMB 3LHPH 4F58L 2P8MB 1UEYA 2CKBA 3LH2L 3BZFA 5JMOC 3D5OF 2HLAA 2APFA 1QACA 3JWOL 5IFJA 2YEZB 2R69L 2NY3C 4HIHA 5EH1A 3VXSD 1KYOK 3TPUB 1DQLH 2P47B 4P5MA 4KFZC 3P0GB 3C5ZB 2XPGB 1HHIB 2APTA 4X9IA 2YBRB 2FYYB 1XIWB 4HUWA 1NANH 2PO6B 3MCG1 4N1CA 3HG1D 3TYGH 4G6AC 3B8SA 1WEJH 2YSSB 5FB8B 1MCWM 1C7SA 3WMSA 1AC0A 1BVLB 2DS4A 3O3DA 4NDMB 4P3WA 1VADB 2X89A 2ATKA 1LO0L 2YWYA 3O6KH 5TGBB 2G5BB 4LHQB 5E6IA 1QPXA 3EOBB 3K1DA 4DEPB 3CVIL 4L9LC 1FC2D 2I60H 1GGIL 1F45A 1ZE3C 5BV7B 3SGKC 5D1ZA 2BY0A 2R0WH 4JFOB 4YAQA 2VZTA 4Y4FC 5HJ3A 4WWKD 2F9BT 3M1BA 2PTTB 4FQ2H 3W5MA 4Y4HD 8FABA 3VXPB 1T04B 3K4ZA 4Z0XB 3LS5L 3V0VA 3QUXD 2CMRH 1IZJA 4P3DB 3VFRA 4KQ4L 5GSRA 4RAVA 4R4BA 3BD4A 5DVMA 3SDXB 3HCVA 2W0LA 3IFNH 4OIBA 1EGJH 1DQDH 1R24A 4OZGE 2CLVB 4BH8B 1C1EH 1HCFX 3MREB 4MQXD 1UYWH 5HI3D 2BHUA 3X13B 3SGJA 4OI8A 2VNCA 4IRZL 2D0GA 2MOVA 4RRPA 3QULB 2QSQA 2ZCHL 1FV1A 1UXSB 1SYVA 4N90D 1UJ3B 3S3PA 4JKMA 5T3ZD 4YWGL 3ZO0A 4R8WH 2VLME 5EZIH 3ARBA 1JYVA 1BGXL 4JO3L 1FVEB 4LVHC 1FZOB 3MRJB 4U1NB 4XBGB 3MJ9A 2EO9A 1DN2A 3QH3A 1MLCB 2VL5B 2J4WL 1G1CA 1QO3A 4LIQH 4TPRH 4NNXA 1CT8B 1QTYT 4OZIB 4U3XA 4ETYA 5DYOB 5FA4A 3MV7B 1YQVH 1NMAH 3DX8B 4NZUL 2HJLA 3KWWA 4AH2B 1OWWA 5BXFB 4PRPD 4DW2H 4HEME 4PJXB 5F7KC 5JA9A 4OM1H 4XPFL 1RUAL 3TCXA 2DI8A 5BVJA 1U3ZA 1YPZF 5T1DH 3LIZL 5T1LB 2AXFB 1N2RA 4JB9H 3VGAC 1QLEH 3OAYK 5TE7H 3ZDZF 3QFJD 3EJZC 5J57B 3OPZH 3VH8A 4O02L 1HE7A 2FLRT 4NQEE 4QXTA 2V5YA 5F1NB 1DBMH 1OQOA 1OSZA 3GSWB 4X6CE 1WBYA 3BRFA 5T5FL 4ZFZA 3KJ6L 4FQIL 3MXVH 3MUGB 1TZGL 2UVFA 1KPVA 2EIBA 1VFAB 4KKLD 1DQQB 5ALCH 4CVXB 4LRNL 2A1WH 2DM2A 3HPLB 4DGIL 2JJSA 4M1GL 5T3ZH 4APQD 2NW2A 2BRQA 2R4SL 4R26H 4XHJD 4DGYL 2BNUB 2CD0A 3AB0B 4MNGB 3DXAB 3DUUA 4HXBH 5I8EB 35C8L 4RWYH 4EVNA 4FNLH 1MLBB 2AEPH 4G6FB 4Z7OE 1AO7D 4H5SA 3FCTB 5KSBA 3WS3A 2NY2D 4NZTH 3S96B 1EEZB 1WLHA 2R8SL 2MQ3A 1FVCB 3L5XL 4POZC 3U4BL 1T66D 3KR3H 5T3XL 5FHAH 5I1JH 1EAPB 1L6XA 1RPQA 3BQUC 5HVFB 3ZDXF 1ZGLA 1UJTA 1OTSD 2DWEB 4HJGA 4RZCB 1UH4A 4JM2F 4JM2C 3QUYA 5ID0B 5BCAA 4DVBA 2IH1A 3MO1A 3WV0A 1ZT7B 4WGVB 4JQVC 4YNYB 4L3ED 1E4KA 3IETA 5L8JB 5I9QC 3KPTA 4NM8H 3EOAB 1A1MB 4XVJL 1RUML 3EDEA 4KRPC 5ISZB 2XTJB 2JB5L 1JZ4A 1E27B 5CBEB 5K9QG 5GRUL 4ONGL 5CSZB 2W9DH 3OB0K 3NMEA 5EA0L 4S1DC 3QI9B 4L1DA 4ZTPL 4MDIB 2CQVA 1NCTA 2WP3T 1T3FB 1R5VB 2HVJB 3R0NA 5I30L 4D3CL 4LEOA 3MLVL 2OZ4L 2BY1A 4Y16D 1G9EA 5IROA 3S4SB 4LBEB 3DSFL 2BFVL 4CN4A 12E8L 2B4CC 4KK6D 3O2VL 2EYTA 3UDWA 4PPTA 5CD5D 7FABH 2EC8A 3L3JA 5HSFA 1BREA 4DK6A 5I8OL 4HS3A 5BJTB 2APBA 1H0DB 2MJWA 4NQDA 3HLAA 2NZIA 3RU8H 3DX7A 1BHGA 2HT4C 3I84A 1J8HD 3RA7L 1I85A 3BDYL 1EXUA 1DBAL 1UEMA 3E3QC 3BWUC 5B4MC 4PS4L 3EO0A 3F8UB 4HWBL 2HMIC 2HP4A 2J8OA 4YFDB 5I1EL 1EIBA 3QIBA 2FCBA 4QEGA 2FWOA 4ZUWB 3S8WA 1EPFA 1NBZA 3S37L 2JE8A 3FQTB 2HJFB 1BFVH 4M61A 4QWWC 1FFNB 2FL5A 3OKOA 1R3IL 1ZKAA 43C9A 2IANB 5JUEH 4PV9A 2N7BA 4K7PX 4PB0L 1O5DT 4XMKH 5DWUH 3BFOA 4ZAKA 3H9YA 1NCAH 4LLDB 5KANI 1EX0A 4EUPA 2WZPD 3MJ8A 4N0FA 3FOLA 3O6MH 1TNMA 2YWZA 5JR1H 4KVNH 4XCNA 5F7NC 3PHOB 4NPYA 5GRZA 2Z8RA 3QNXA 2K1MA 1TQCB 4LASL 4GBXB 4G9FE 1BD2A 1CVRA 1CFTA 4EZMA 5IM7A 5FFLA 1KNOB 4J3UA 4CUCA 4HK0B 1ZS8A 4ETQB 4NQXA 4XCYB 4X8JB 5KVDL 5JHLH 1RMFH 4M93C 3VE0A 4JAMB 5EWIL 4WTZG 4HX1A 1JPFA 4EI5D 1UACL 1MFDH 4AM0A 5HHOD 1A7OH 1JL8A 4HT1L 3D85B 3LS4L 2Z4QA 5GGRB 1DQMH 2X10A 1JNNH 3E6HA 3LEXA 5IK3A 3ZL4H 3KPLA 1GGCL 3IT8D 3MV9D 4PR5A 4HHAB 4OSUH 4JQXA 2WIMA 4R4NC 1N3NB 4B7LA 3UTTB 2XN9E 5F70A 4D8PB 5SV3A 5KS9F 5LBSH 1U8LA 3INUL 1IGCL 2J88H 3TN0D 4YDKH 4HV8B 1M7DB 1IL1A 2DLTA 2QSCL 4NO5A 2XXMB 4IEFB 3MFGB 4ZD3L 4WV1C 3BW9B 4Z7WB 1ND0B 4MX7A 4YGAB 4JLRB 4JG1H 4RISL 1MRDL 1T2QH 3ARGC 1FORL 1MEXH 3O45A 3KYKH 3PGDA 1P9MC 1WK0A 2ZUSA 3D2UB 3NIFF 4QTHA 2VE6A 3VD5A 4P9HH 1TJIH 3VFMB 2AK4E 1GXEA 4XCFH 1FN4B 3RGVD 4WW2F 2UY7A 1JP5A 3DHMA 3R06B 5MI0C 2NCMA 3CLEL 3ULUC 3ULUF 1ZVSB 3GIZH 5I1AB 5DQDL 4ODSL 5LGJB 2VITB 1MVUB 4OCYL 2D31A 4NT6B 5EBWB 4M4RA 2AV1B 1MHHA 5CIPB 5DO2C 4KAQH 3T0XA 3P4LA 2YRLA 5FA3B 3TBWB 4R2GC 4I5BA 4XNQB 2ENYA 1EEQA 2HT3D 3QUZC 4LGRB 4CVUA 1LO5B 4LSQH 5I6XB 3VCLB 2X7LB 5MENE 2BNRA 3PWPD 1RHHB 4ZO8A 1DDHA 4R90H 2ARJQ 1RZ8A 4KJYA 2R0LL 5CGYD 3OKKA 1MH5B 4LLVA 1QFWM 1JV5B 2VOTA 4ZS7L 2R39A 4GKNA 1C8PA 2VISB 4OCWL 5D2LF 5T1KB 4P46C 1G6RA 4P59L 1BF8A 5L88H 1J1PL 2X89D 4JFXB 1GZPB 1AXSA 4PIRF 3S4SG 4L8CB 1JPGA 1CK0H 1J87A 3QXWA 3EZJB 3TBVB 2IBZX 2G60L 1I8LC 4NKOB 3BT2L 5IJKA 1U95A 1RZ7H 4TUKL 3B5GA 4HC1H 5IBUB 2X4RB 1CD0A 2Q8BL 4N0YL 5CWSB 5IB1B 4GAGH 1CF8H 1FG2A 2GTWB 5FCUH 2BNQE 5TDPB 3GGWB 4G42A 4XNYL 4AENB 4ISVA 2H8PB 3NCJL 3MV8E 4N8VA 2ENSA 4PRDA 4P23C 1ED3B 4POYA 4IRSC 5IB3B 5J9PA 3N1PC 1IAIH 4DZ8A 1IMHC 1IGJA 5A2LH 1QPPA 3BIKA 3NTCL 2E7LC 3MJ6A 3JV6A 2OJZL 3O41A 3L5JA 3G5XB 3ARTA 2VXTL 3MLUL 1QBLH 5HBBA 3V0WH 1FNSL 1MIMH 4ZFFA 3FN0L 5F3HB 1N59B 1VERA 1QR1B 4OGZA 4DZBA 2Z8VC 4JRWA 5B8CC 1NSNH 1OT2A 2AV7A 1AGEA 5HHXL 5K9OB 1KF9B 2DLGA 5EPMB 3QPXH 3W9DB 3D18A 1W0WA 3MBEA 4GG6F 1AIFB 4X7CC 1ORQA 5CEZL 4DTGL 5EO0A 5IQ7L 3ARBD 1BJMA 1VB9A 3MGTB 3MR9B 1WIOA 1QFUL 2KZ1B 3O4LA 4KROD 4WY7H 3QHZL 1DN0A 3KPQA 5C3TA 4WCYL 3NABH 4ZUSA 1KTLA 2R0KH 3ARUA 4OBSA 2OSLA 4GKSA 4BZ2L 2NTFA 4HZLB 1FAIH 1ZHNA 2OR7A 2EYSB 3GSVB 2IEPA 1EMTH 4RGNE 1D9KB 4Q6IB 2XNAB 4QRRA 5C6TH 1F90H 1HDMA 4N9GB 1I7ZB 1W72H 1AGFB 4JDVA 1CICB 3JV4B 2DKSA 4JZOB 1FL3B 3C2AH 5IMLA 1MCFA 3FAXA 1QFWI 3MV11 2VDNL 4IHOA 4WJ5A 3WCYA 4W4OA 4OIAA 4ZQKA 3T1WA 5DD3L 5IKCA 5DMGC 1MFBH 1LDPH 5EOQL 1B0RA 3F58H 3TH4T 3EYUL 1C16B 3DROB 2XXCB 4KQ3H 2AS5M 1G7HB 1W8NA 2QR0A 5E2UL 5C7XH 3GMPB 1AQDB 4GAFB 3D87B 5GZOD 3EBAA 2ICES 3BD5A 1SM3H 4JHWL 4OZFB 3ZZ1A 5E7FA 1M7IA 3OF6A 4GLRH 3ISWA 4HGMA 2EXWD 4LSVH 2VN4A 3R1GL 4P2OA 1S7WA 5JXAH 1E28A 3MJ9H 3D0LA 5DMIH 5I76B 3D25B 5CBAA 5AWNH 1RZKL 4JKPL 2Y6SD 2PXYC 4FG6C 5H94B 2YPKA 4LCWA 4MNHB 4I13B 3E8UH 4OZGB 1CGWA 3RY6C 2YZ8A 1XF3B 3EYOB 3ILQD 3GMMA 4F8QA 1INQA 3PGFL 1I8IA 1NBYA 4Q2ZA 4EI6B 2IC2A 1Q1JH 4WNQA 3SDYL 3IDYC 1F8TH 4QCIB 2I5YL 1IT9H 4LFHG 3ARFD 1F6AB 2QADB 4G7YH 3Q2CA 1BQLH 5FDWA 4TRPL 5A16B 1CZ8L 1NEZG 3KLAA 3F6IA 1C08B 43CAA 1EO5A 2EEBA 4HPOL 1GGUA 3D39D 1U0QA 2YA1A 4NYLA 4L9DA 2YK1L 3ARZA 2Q7YA 4NRXA 5BRZE 3TO2A 1HIMH 4QRQB 3LSOA 5GS2D 3HAEB 1LEGB 1T5XA 5B3JF 4FABL 2P48B 1AD9B 1MFAH 5TJWK 5E4EB 1RIHL 1OD7A 5IBUG 4HEPG 1NJ9B 2VXVH 3H9ZA 4TSBH 4FHBD 2B1AL 4XH2A 15C8H 2GK0B 1MI5E 4J4PA 3ZHDA 2V7NB 3THML 4NQEB 3V6OA 3MBXH 4X6CB 1YEGH 4JRXA 3QPQC 1KJVB 2PYEB 3D9AH 5F9DC 5E24E 2VAAB 1S8DB 3CFDA 3FT3B 1HQRA 5F96L 2NY4C 3WXVH 3C6LC 3EYQC 2KH2B 3AXLB 5DFVC 1QVOA 3LDBC 2XG5A 1S9XB 1L7TL 3MODL 4I3RL 3B9KA 3QIBD 1JNLH 3MNWA 1U42A 1B2WL 3PIQA 4NZRH 2W60B 1NCDH 1X4XA 3QDMA 4Z7VE 4FTVD 1FNFA 1UA6L 1X6LA 2DL9A 3QEQE 5J12B 4TOYH 4XNUL 4IS6B 1NMBH 1BPVA 3WIHL 4ZAKD 3OKEB 3SKUD 4XNZB 5L7XL 1IEBB 3JWDC 3E1F1 3U6RA 5IEKA 4WU5B 5GS2H 2OMNA 4PRAA 5HYJE 5F9OL 3OG4B 2IG2L 4MXQD 4NKQB 3SY0A 1KPRB 1LP9A 4U2ZA 1S5IH 2AI0L 4URTB 4XVTH 5GZND 2BVPA 3H9HB 1IAOB 1BD2D 3REVB 1EERB 3K4AA 2ZCKH 3LZFL 1RK0B 1T03H 1DFBL 2X1XR 3S34H 4IJ3B 4WIQA 4YHZL 1M4KA 2J8UA 1U58A 4KKCD 1NCBL 1FGNL 4X4YA 1KG0A 1U8IB 5E8NA 4ZOEA 4OFPA 4MXWH 3M17A 1Q9WB 4ODXA 1KJ2B 3BGMA 1DLFL 3WLWD 4HKZB 2V5MA 2CGRH 5DHYA 4JFDE 5FYLE 1SYSA 4P9MH 5E2WH 4HDIA 1J05B 5TQ2L 3RNKA 4D9RD 1DBKL 2YMXH 3IAGC 3SJVD 1DBBH 5T1MB 3UYRL 4FFZL 1ZANL 4HPYL 1ZT4A 5I1CH 4L8BB 2J6EL 4YE4H 3ALPA 1QD0A 3PHQB 5DR5L 4MLIA 4EDWL 1VFBB 5DVNA 1BQHB 4MCYB 4EUPH 1DBJH 3GSQB 1VGKB 4PY8I 1J18A 2R1WA 3P77B 3TEUA 5IMKB 1D3CA 3SDCB 2CLRB 3GJFH 1I7TA 1IAMA 3OX8B 4PJFE 1X4YA 1WCQA 4LCYA 4P2QB 4M03A 5D8JL 1IAKB 1YN6B 5ACZB 2YUZA 3CU1A 5DHVB 3VXSE 2WW8A 3F7PC 2VLKA 4V2CB 3VGGA 2XZAL 3WJJA 5FYKL 3QHTC 1S7VB 3DYOA 3CXDL 4LLQB 5ANMB 2UWEE 1WWWX 3VFUB 5K9JH 5C0FB 5I2IB 5E2VH 1UENA 1FH5L 3L9RA 5J06A 1N0XL 5BS0D 2D7MA 2X5PA 1NGPH 2E27L 1ERNA 1F3DH 2IPUG 4UUJB 1JF1B 3JWNC 3GSUB 4K2UL 5GIRB 3HMXL 1RZGA 2P44B 3BD3A 5DDHB 2BNRD 3HUJA 4WVRA 4PJHA 1DVFA 2A77L 2RGSA 3WLBA 3VFNB 1S7XA 2EDBA 3HR5A 1ZA6A 4YDIH 1PKQE 5JXED 2JJTA 1CXHA 5J0BA 3PP4H 1UVQA 3WFBH 4L8DA 2ZSVA 4R97C 4G9FB 3RRQA 3HAEG 1A4JA 2Y4SA 1KIRA 1S5HB 3T0AA 3TLRA 2NZ9C 3LEVL 4I77H 1T6WA 3IFLL 4TVPL 1A5FH 5L8KB 3I02B 5KSAC 3O9WA 4UILL 4X83A 1U8NB 4ESKA 2AABH 4DUWA 3QDGA 1YNLH 1KTDB 4I0CC 1HZHL 1A7QH 5EDXA 1ZLWH 1FRGH 1NC2A 2RBLA 4TUOB 3O6LL 2MCPL 3QQ9C 5A2FA 4UQ3A 3MRHA 4YXLH 4A6YH 2PN5A 5D1XB 3QNZA 1NLBL 2EIZB 2FO4A 4UOW1 3DBXB 4ZFOL 4XPGL 1LGVA 3FO0H 2PCPB 4LAQL 3ARVA 3V5KA 4GMSL 2ADFH 1RIUH 3BEVB 5DK0A 1HQ4A 3MA7B 3RX5A 2X09A 3I50H 1OGAA 5EBMB 1UKSA 5HYQA 4I2XA 4FFYH 3WFZA 1NDGB 4ELMA 4F7TA 1AXTL 3KLHD 3FONB 5KTEH 1CG9B 3S97C 3BO8A 2H6PA 5IHUL 4RIRB 1KJ3H 4KDTA 4MVBC 3B2UD 1X5JA 1CLZH 3NZHH 4WU7B 3HZKA 1IRAY 4HLZG 3L6FB 1FL6B 5HI5C 1F58H 4GW4B 1CLOH 1JRHI 5DZNA 4PRPE 4CGTA 2YEZA 4FXKB 3HE7C 2FECL 3S5LB 1FO0L 4FFWD 3MBED 5EIIB 4UTBH 1E6JH 1G6RH 2ARWA 1OHQA 4XCCH 3TPUA 1SEBA 4MJIA 3ILPB 3HI5H 5DXWA 2HH0H 3T65B 4E0RA 4Q9RL 4PJ9B 3C5ZA 2XPGA 1HHIA 1Q72L 4L3AA 3U2SB 2FYYA 2CR3A 4WTWA 1XIWA 3VRJB 3AAZB 3G6AB 2PO6A 3MA9H 5A1AA 1FNEB 3MLSL 2JJUA 2X2YA 2YSSA 5FB8A 2DQFB 4NDMA 5I1LB 1VADA 1T1ZB 4NJAL 5EFIB 2F15A 1GHFH 5TGBA 2G5BA 5MENB 5J8OA 4KUZL 1ZWIB 1W8OA 3JV0A 3QZWB 2CIKB 5M94B 3QCUH 4HF5H 1MCPL 4AEHH 2CPCA 2P24A 2NX5A 4JFOA 1OAXH 3CFBB 4JFFB 3PL6D 4WI5A 3UYPA 4M6AA 3QO1B 4JPKH 5CJBA 1YPZE 3TO4C 2OI9B 2YXFA 1RIVH 4Z7UF 4NNYB 4L4TD 3BKJH 1T04A 4Z0XA 1ONQA 3CZJA 4ODTL 3RWEB 4P3DA 3IDNB 2F53E 4MA7L 4F58H 5IEHA 3LH2H 4LCCB 4YBHA 9CGTA 1U2CA 4LLUB 3JWOH 1BQHG 3FZUC 5DF0A 2R69H 2CLVA 3LQAC 4P2YA 1DR9A 2DKMA 4WEUD 1VCAA 1RVFH 3MREA 3L3HB 3VW3H 4Z7QF 3MCLL 1MFCL 3MRRB 3BGFB 4D0BB 1KB5B 3QULA 5GPRA 1UXSA 4KDWA 4HIXL 3KPSE 1MQKL 1NGZB 2GK2A 2Z8WC 4LCWD 2JJWA 4ORGB 4WI7A 2CXGA 4BSWB 1UWXK 1HYSC 3RVXC 3TA3B 1GGIH 2K7QA 1FVEA 1FZOA 4YHML 1QR4A 4XBGA 4PRHA 1YMME 4O58L 2L4OA 2X4TB 1TJGL 4OZIA 1N7MH 5DYOA 3LS5H 3ZKXC 5BZDB 3MV7A 4E5XB 4AH2A 5BXFA 1HILB 3DVNB 2PW1A 4KQ4H 4PJXA 1SMOA 4JRYD 4TULH 4OQTA 5FGBA 1QUNA 3KAAA 3W11D 5T1LA 4XP6L 1L0XA 1KOAA 2ADGB 2AXFA 3HZVB 3BPOB 3EYVB 4S1SL 4FQQB 2WWKO 4NO3A 3MJGX 4YDJB 4YH6A 3DHJA 3BHBB 1J8HE 3WIFB 5F1NA 5BW7C 1R6VA 4B0MM 3H9SB 4ODVL 5SWSE 4UBDD 1YEJL 2X41A 5D71L 4RGNB 1UZ6F 5HGBA 3D48R 1GJIA 2PNDA 4YHLL 2IPKA 1QLFB 3MUGA 3SQBA 3QDJD 1YEHL 1VFAA 5F88B 2HLFD 1DCLA 1DQQA 3H42H 4CVXA 5AG9A 3WJLA 3P0VH 1BGXH 4JO3H 2PYFB 4X7FC 3CX5J 1PSKL 2BNUA 4MNGA 3DXAA 3ME0A 1JHLL 5I8EA 4AIXA 1T7YA 1MLBA 2J4WH 4JRXD 2NR6C 3FCTA 2Y06L 4N5EC 1MAJA 4DFIA 2B2XH 3IF1B 3S96A 2GSGB 2I07B 5IFAL 1FVCA 4RA0C 4OLYL 3SOBL 5T3XD 3TNNB 5ENWA 2BRRH 3GKZA 3E3QE 5FM5O 3B9KD 3BN3B 4XPAH 1EAPA 1RUAH 1BF2A 4ZPTB 1ACYL 2DQTL 3C5JB 4AIZA 2OCFD 3QDMD 1LE9B 3GI9H 4RZCA 3G5VB 5ID0A 4JANB 3OGCB 3HC4L 5DMJB 3S5LG 3SKNB 4G80B 1ZGLP 2FRGP 1MRFL 1ZT7A 4O02H 1PBYA 2XFXB 1JRHL 3CDFA 5T5FH 5C6PB 3O8XD 4F7EB 1LEKB 3CVHL 4JE4B 3KJ6H 3EOAA 4FQIH 4J6RL 1A1MA 5E70A 5K93A 4NQSA 5ISZA 4DK3A 1UCBL 5B22A 3NACL 1E27A 5CBEA 5IMOB 4LRNH 5CSZA 2EXYC 4OCRH 4M1GH 4WUUB 2OLDA 4U1SB 3QI9A 5DURB 5I8CB 2R4SH 3WS6C 4MDIA 4DGYH 3JXAA 3QZWG 1T3FA 1R5VA 2HVJA 3LKQB 4FQJL 3RWHB 2EDWA 4G3YL 4POUB 1LD9B 3K74B 3S4SA 3UAJD 4LBEA 3EDKA 2J3SA 3U4BH 4KHXL 1HEZB 4PTUB 2A9NL 3FOMB 4WI3A 5T3XH 3ZT6A 2P42B 5BJTA 1IKFL 4FXLA 1LO2L 2LU3A 2X4UB 1KN2L 1U36A 1F3DJ 2A6JB 1PLGH 4Y1AB 1WVZA 3OTTA 5EB9A 2Z9TA 5F9AC 3VFSB 5HD8C 3MZTA 2NXZD 4LSPH 4LK4A 4RFNC 2FD6L 4FZEH 2FZ3A 5GGSB 2DMBA 4YXKL 2DYPB 4ZUWA 2VSDA 3E2HB 4BK5A 2EH8L 1IQDB 4XVJH 1RUMH 1I3RA 2JB5H 5C0AE 3T3PF 1Z5LB 5GRUH 4ONGH 3OWEA 2FH6A 2GIYA 2HFEA 2FJFB 3PWJA 3NZ8B 4PJCB 5SX5K 1XGQB 5CCKL 2ED8A 4LLDA 5EA0H 2EYRA 4AEEA 3PWPE 4ZTPH 1LK2B 3NIFE 5I15H 3RVTC 3SDAC 2VLKD 4PLJD 1T4KA 2LE9A 5GJTL 3SCMD 4YJZL 5I30H 4D3CH 1AE6L 4K7PL 3PHOA 4D9LL 2OZ4H 4WUKL 4RWHA 4H1LH 1VPOL 5EOTB 3TIDA 4YHIB 3DSFH 4RSVA 4Z7VB 4GBXA 12E8H 2BC4B 3O2VH 2VLJE 4LKXB 4U0QB 4UV7L 2ITDB 2X1OA 3VDAA 5GS1B 3ULUE 2Z91B 5I8OH 1ETZB 4KPHL 3ZE0E 3H3PL 5DD5H 4HK0A 4ETQA 4PJ5D 3VWKB 3U83A 4XCYA 3RA7H 4X8JA 5CJQL 5TFSL 2IH3A 3CH1B 1DBAH 1QP1A 4JAMA 3ULVF 3ULVC 4M5ZL 1WICA 1DVFD 4P5TA 1IM9B 4HWBH 2HYMA 1GGYA 2VXSL 3D85A 2VQ1B 5GGRA 5I1EH 2QLVB 2QQLH 5ALBL 4YHYC 4X4MA 2MQCA 4PJ8B 3S37H 1BEYL 4R0LC 1R3IH 1AHWC 2Q87A 3A67L 3TCLB 1N3NA 4I9WD 3AM8A 3HNTL 3O2WL 4D8PA 4P4RB 3BIAX 5JNYB 1P6AB 1XT5A 2FH8A 1NC2D 4HV8A 3GSNL 4MAYC 1M7DA 1RZFL 3KYMB 3U7YL 5M7QA 5ADPL 1OTUD 5DUMH 4XC3L 5D1QA 2NY0B 4GRLC 1LQSR 3MRCB 3WUZA 4JFDB 4Z7WA 1ND0A 4XVUD 1S78D 4JLRA 4LASH 3VXUD 5FO7B 4P3CL 4HD9A 1FLRL 1RU9H 4WI9A 4F57H 1TQBC 1XGTB 2ZPKL 4F7MB 3BX7C 3O3EB 3VFMA 4MHHI 1FN4A 1WAAF 4NOBA 4Q9CA 5KVDH 3R06A 5LG1A 4KU1A 4HG4J 5EWIH 1ZVSA 3U36B 4XAKD 2Z31C 5LGJA 3GSOB 1VESA 4HT1H 1A7PL 2VITA 1MVUA 4H88L 1D5BB 3GM0A 5EBWA 2AV1A 1FL5B 4PJBF 1A3LL 5CIPA 5IT2L 3TBWA 1G7MB 4YK4B 1H15B 1YJDC 1XGYL 5F7YC 3EAKA 3HR6A 1LO5A 2X42A 1WWBX 3VXSB 2X7LA 3O3UN 4LPCA 1RHHA 3TJEL 5D5ME 1UM5H 1FYTA 4MJID 4JFZL 4PP2B 3INUH 4NN5C 5HHNB 1MH5A 2D3VA 3HG1B 3RZCC 1JV5A 2QSCH 1D5IL 3C8DA 3V7AG 1KB9J 4CAGA 5TE4H 5T1KA 4ZD3H 4IIQB 1CTOA 4ZYKB 1SEQL 5F6HI 1VENA 3VFTB 2D7OA 3BESR 1A6AA 1M71A 1XCTB 4JFXA 1MRDH 1GZPA 3T8XB 3LD8C 1J86A 3GMNB 4MGXA 4L8CA 1A6VH 1OP5H 3V2AR 3DETC 4JO4H 3CPLA 1U8PB 2GYSA 1TLKA 3CMOL 3U0WL 4NKOA 1PKQB 1L9MA 5BQ7A 1VDGA 2M26A 1MREL 2NX5D 4WWKB 4O2CA 3BE1H 5CZXC 1FC1A 4Y4HB 3QIWC 4AENA 5DQDH 1BQSA 2CJUL 3MYJA 4ODSH 2H8PA 1N4XL 2XICA 3JVGA 4U49A 5ILTH 1KENL 2W65B 4YHKL 3QUXB 4MA8L 5IB3A 4G9DB 3CFIC 4RAUB 1CGYA 4DJMA 1BOGB 4M6ML 1TVBB 4PJIF 5A3IC 4Q74A 3R0MA 2R56L 3VFWB 4G43A 3G5XA 5D7KD 4YLQT 3EJYD 5DJCB 5F3HA 1VKXB 1N59A 1QR1A 3B9DA 3ZT7A 4CRPA 2F58L 4H8WH 2FX7H 4EIGB 1G9NC 1KEGH 3GO1H 4OCWH 4K3EL 4TQEH 5EPMA 1MCOL 3W9DA 3P9WB 1CDJA 1YEDB 1BLNA 1J1PH 4ZOCA 5F9JB 1AIFA 1EBPA 2R2BA 4ODHL 1J8KA 3NCCB 1K2DB 4QO1A 4KK8D 2Q6WB 2AJZB 4S2SB 5H8DA 3U4EA 3QWOB 3MGTA 2W1NA 4L29B 4OGYH 1WBXB 3IDIB 4PRHD 4LOUD 4TUKH 4XXCA 1ZT1B 5GXBB 1FFOB 4GRWE 4N0YH 5FYJU 4BFIA 4I3SL 5CP3A 2NY6D 4E42B 5C07D 2EYSA 4PRPB 1D9KA 4Q6IA 4PG9B 4G8GD 4KJPD 2NPLX 2XNAA 3NCFB 5E6IC 3AS3A 5DLML 5F44A 2IF7A 3QHFL 1I7ZA 3B43A 5K59F 4TNWK 1CICA 4H0HB 3MOQA 4WDIB 4JVPA 1YECL 3NTCH 4YO0B 5D1ZC 3Q5TA 4K23L 2OJZH 4X6DF 4NIKB 3QFJB 4H25A 2G75B 4R3SB 3MLUH 4XGZB 5E08H 4U1MB 1FNSH 3FN0H 4WFHE 1F4AA 4RFOH 3RDTC 5HHVL 4ZO7A 1C16A 3DROA 3HFMH 5HHXH 3HNSL 3X14B 4DN3L 4O2EB 3BVNB 3ARED 3FRPG 1G7HA 4JFEE 3GMPA 3FN9A 3H6JA 1AQDA 3RX8A 3O3BB 1EO8L 3OHXB 4OZFA 2BY2A 4W4NA 5IQ7H 4I1NB 4FTVE 2DM7A 4N8CL 2AXGB 2FX9H 1S3KL 1OL0A 1QFUH 3SGJC 3DURB 1JTTA 1EVTC 3QHZH 4WCYH 1AO7B 2AP2A 3W0WD 5CAYB 1G9MC 5H2BB 2NY2B 2F53B 4BZ2H 3PE9A 5DQ9B 5FM8A 5GJSL 5I76A 4QXGH 3D25A 1ZTXL 1OQXA 4XRCB 5I1HL 1KUMA 2A6KA 4UDTB 5H94A 4YEEA 3BRDA 4OZGA 2AJXH 5F1KC 1GVIA 2WBJD 3P2TA 1XF3A 1G0YR 3EYOA 5H37H 5HDQL 4MMZC 1SY6L 1TITA 2EECA 4EI6A 3AMKA 1YMHA 3DUHA 4AEIL 1IBGL 1TVDA 2AJYH 3QEGL 4O51A 2PKDA 2VDNH 5KSVA 4QCIA 3TJHC 4CBPA 2HT2D 3MRMA 4L3EB 4LARH 3IFOA 1P2CB 4AG4L 1F6AA 1C5CL 4Z76B 3IGAB 3HRPA 3SBWA 5GS0C 4I48B 5J6HB 1Z0NA 3HE6C 3VI3F 1C08A 5ISZD 3HI6L 2JJVA 3ZLQC 3NBNA 1N26A 4JHWH 4QRQA 5JOPD 2VQTA 1LEGA 1K3IA 3BPCB 4GW1B 1ZEAL 3R1GH 5ITFB 4TTDC 3DMMD 4IMLB 2VDQL 4KUCF 3UBXG 4YZFF 4M8VA 4Y16B 1OSPL 1RZKH 3LOWA 4U7MA 4JKPH 2CDFB 1J7VR 4K55A 2GK0A 4MQ7B 5JHDE 4QNPE 1N6UA 2DLEA 1CFQA 5C09E 1RUQL 4KRPB 2V7NA 1J8HB 2QSTA 3PGFH 3T2OA 3U1SL 4NQEA 2BMKB 4PRIE 5D7IB 3PQYD 4X6CA 4P2RE 4M7JL 3SDYH 2PYEA 1S8DA 1F97A 3FT3A 5E94B 2HRPH 2I5YH 5KSBF 3ARDD 3AXLA 5LVEA 2OM5A 5GRJL 2CUIA 4XMLH 2DBJA 4Y19E 2V5RA 4ONFH 1S9XA 1KIPB 3TZVD 1P7HL 1O7SA 4TRPH 2GAZB 1QBBA 4DGVH 3X3FH 5BS0E 2A74B 2DAVA 1QFPA 3UTSD 2YK1H 4XWGL 4IS6A 3QUYC 3MRKB 5AD0B 1Z9OA 5DD1L 3BP4A 1IFHH 2ESVD 3OKEA 4GQ9L 2ZOLB 1MCNA 1IEBA 2BHYA 5D6CB 3CVHA 4FABH 4O5LL 1A6UH 1IM3B 1T7WA 4WU5A 1H3WM 1IGFL 1RIHH 1XGRA 2HTLC 4X4XB 3SDDA 1BBDH 5A43C 1H5BC 2W92A 2BVQB 1HHHB 2NMSA 1YYLL 3KG5A 5IQ9B 3H9HA 1NMCB 1IAOA 2B1AH 3DOSA 3REVA 3CFKA 1OW0C 5HHMD 5FEBA 3JZ7A 1P7KB 1ZHKB 4NFCA 4YQXL 1T80A 1U8IA 5F96H 1JZ5A 3GMQB 3LKSB 4UINL 5FXCH 5IG7B 5IW1B 1Q9WA 1ZLUH 3R4DA 4P5TD 3MODH 5CP7A 3D85D 4I3RH 4HJ0D 4M48L 4HKZA 4ZO9A 1KC5L 2Z0BA 1B2WH 4KC3B 5JPNB 1SVCP 6CGTA 3MV9B 5I16B 5ACMA 3IS1X 3FB5B 1AI1H 1LILA 1J05A 3IKKA 4OFDA 1I85C 1BFOB 2NXYC 4JDZB 3PV7A 4WEBH 4HCRA 2WWMD 3QJHB 4M1DL 2YPVL 4OCXL 3WIHH 3TN0B 4WW1B 3RVWD 1MJ7H 2SEBB 4L8BA 5L7XH 3T0ED 2FGWL 5KW9L 2B0SL 3PHQA 3L5HA 3BMVA 3WYRA 4LHUB 3DGGB 1BQHA 2IG2H 4MCYA 5D1QD 3VWJD 5EU6D 3GSQA 1VGKA 2NY7L 4P4KD 2DRUA 3UJIH 1RZIB 2GFBB 5IMKA 3RTQB 2XG4A 3SDCA 2CLRA 4HK3N 5FYLL 3OX8A 3M07A 1X7QB 4KK5C 1RZJC 5KJRL 5C70A 3CDCA 3LZFH 4I0PB 4P2QA 1ZLWK 3RHWK 3WNMA 5FYKD 2MQ0A 1IAKA 1YN6A 1XGPB 3RGVB 5DHVA 4PJ7E 1DFBH 2FHBA 2IAMD 4YHZH 4J7RA 1S7VA 1NCBH 4LLQA 5BOPA 5ANMA 5DJ0A 3VFUA 4W81A 5I2IA 2AK1L 5EZLA 2KQNA 5C0AB 1MCWW 1G6VK 1J88A 3I2CL 2XV6B 3KHOA 4DOHE 5CJXA 3BZFB 1QFWH 4UUJA 3GSUA 4HBCL 5GIRA 3PWPB 1SBSL 4H20H 4YBQD 5TQ2H 5KN5B 1DBKH 4HBQA 5DDHA 3RWJA 5C0CE 3BXNA 4R7NB 1FYTD 4FFZH 2DQUL 3UYRH 4N68A 1ZANH 1U3HB 4FZ8L 2E6PA 2J6EH 1OF2B 4WO4A 4HUWB 5DR5H 1E4XI 1TCRB 1H3UA 4G9FA 2R29H 1ACZA 4UZGA 4LRIC 3G5YB 1UKTA 3GRWL 1FZJB 3O3DB 4MS8C 2ARJB 5E56A 3I02A 3W39B 4PUBL 3ARYA 3NGBB 2FGZA 1U8NA 4JQXC 3SO5A 5DD0L 4R2GB 1KTDA 1P6FA 4F9LA 5D8JH 3UTOA 5DMYA 2UYLB 1YZZA 4EJ1C 5M95B 3IAPA 3MLZL 1GIGH 3NA4A 4TUOA 1FGVL 3TBSB 5E9DE 5C0RL 5D1XA 4UU9B 5FYKH 3KS0H 1V3LA 5HJ3B 2IMNA 1CN4A 1D7FA 2FEDC 4U1GB 1NGXB 3S36L 4V1DE 4X7TB 2PCPA 3RAJL 1FH5H 1W72B 5TF0A 5DC0A 2RJMA 5T33L 1N0XH 3B5TA 3KPOB 3BEVA 3RHWF 3I6GB 4Z7UE 5GSRB 2XN9A 3MA7A 4HMEA 5LWYL 2Q3AA 1MHPH 3VG9C 5EBMA 5DVOA 1NDGA 4HKBB 4K2UH 3FONA 2VDKL 1CG9A 3OAUH 3ZKND 3RJQB 2A77H 3V5HB 3MV01 2F54E 5EC2B 2D7NA 3OJDA 2F8XC 3E6FB 2XKSA 4WU7A 3L6FA 1KULA 1FL6A 4GW4A 5F7MC 1SYVB 2C3HA 5J3HD 3DV6B 3LEVH 1AR2A 1PG7X 1CGSL 2AJUL 3IFLH 4FXKA 1I1RA 4P23B 3C09B 4UIKH 4IRSB 5F7EL 5EIIA 3VXQA 4FQHB 5D70L 3ILPA 4NZDA 1HZHH 3T65A 4PJ9A 4KROB 3U2SA 3O6FC 2MCPH 3BAEL 3VRJA 3AAZA 3G6AA 4M1CC 4X7SL 5AYQA 3V8OA 1JGDB 1JGLL 2MHAB 1DJSA 4XPGH 4KK9C 4Y89A 4LAQH 3MRPB 2DQFA 1SHMA 5I1LA 3LKNB 2WV3A 1T1ZA 5AZEL 5EFIA 4OGXL 4D94A 5MENA 3QDHA 4QYOB 5EUKB 1ZWIA 2M2DA 3PXJA 1GZQB 5D5MB 3EYSL 3QCVL 3WNOA 2CIKA 1HOCA 1CICD 2BVTA 5F6IC 3ECBB 1F5WA 4DCQB 5IJKC 3CK0L 3IDMB 1QZ1A 5IHUH 4AJ0A 3DSNA 2WINA 4NNYA 3GBNL 5JIKA 3VXNB 5F71A 5HGDB 3QRFM 5F7LB 1DLHB 2ZWLT 3IDNA 4PJGF 3MNVB 2XWBB 5T3XE 4LCCA 4RQQA 4JY4B 4LLUA 3UXFA 1FO0H 1V05A 2QHLA 3L3HA 4JJHA 2ZUYA 3SO3B 2X6MA 3UTPE 3VA2C 3MV8A 5A2IH 3VD3A 3MRRA 4D0BA 5KSBB 1HNGA 3WS3B 5C0JB 3F12B 2FIKB 1NGZA 2E9IA 1Y6KR 4PGBB 4K8RD 4ORGA 2R0ZL 4BSWA 5EOCL 3C6SB 2IWGA 1VFMA 4OIIL 1ZGLB 4Z95L 4U6VH 2NY5H 2X4TA 3PWLB 1ADQL 3MO1B 3ARFB 1W0YT 2VRAA 4JREB 3IJHB 2YRPA 4Y88A 5BZDA 4E5XA 2XOTA 3NAAL 3LN4B 3IETB 4ODTH 1HYRC 4W6WB 3DVNA 2VXQL 4M7ZC 1BWMA 2ICEB 5I1GL 3WNLA 3N1FC 2PXYB 5I66B 2D7TH 3BSZL 3D39B 3HZVA 3F5WB 4CW1A 1A6TB 4FQQA 2DMKA 4YDJA 2ED9A 4GRWB 4LSSL 4K7PY 4WWID 1F02I 3WIFA 4IOIA 1U91B 3IRPX 2GUOA 3H9SA 4OZFH 4CJ1A 3FB8B 2VYRE 3L3GB 1MFCH 2BK8A 4LEOB 5DA4A 4LLAA 1QLFA 4HIXH 1MQKH 1M7XA 3TNMB 5F88A 2XQBH 2EEDA 5C9JB 3UZQA 4ZDHB 4JFPB 4M7LL 1SJEA 1YYML 1PW3A 4K8RH 3WFEL 3QQ4B 4YHMH 1H8OA 4O58H 3OB8A 3WKNA 2LVEA 4DKEL 4N0UE 4P2OC 3UTQB 1TJGH 3FKUS 1PKOA 2N4IA 3IF1A 2GSGA 2I07A 3TP4A 2EDYA 3TNNA 2DI7A 3QIBB 4S0SD 1NFIB 2CRMA 4PG2A 2R1XB 1F2XK 1M05B 2FWOB 2J5LC 4ZPTA 3GJEB 1Q9KB 1NBZB 1IC7L 3C5JA 4FTVB 4XP6H 4GAJL 2JLLA 1PX3A 3OKOB 4RRPG 4S1SH 1LE9A 2FDBP 3G5VA 4OQ1A 1KELL 1K8IB 2H1PH 2CLZB 4JANA 2QQKL 3OGCA 4ZAKB 1CBVL 1FSKB 4PJ5E 4G80A 5HVHB 3T3PE 5JQ6L 1XAUA 4L5FH 4JR9L 4O9HH 2XFXA 3HB3D 1YEJH 4MA1C 5D71H 3C6LB 3T1FB 2XKUA 2GQHA 3GJFB 4NM4L 4F7EA 1MAML 5TE6L 1TDQA 3MCKB 4D2NA 3SDDD 5TF1L 5IFHL 1BD2B 1CFTB 3SHSA 5DJYA 1QFOA 5IGXL 5B3NA 5HVWA 4L8SC 3AFLA 2GI7A 4U1SA 5I8CA 4TTGA 1PSKH 4HQQH 1JHLH 4KVCH 1A3QA 5EUOE 2WBWB 2Y06H 3LKQA 2EKJA 2EDXA 3RWHA 2UZIL 5IBTH 1LD9A 5IFAH 5ICXB 4FQLH 4OLYH 3SOBH 1G7LA 3KPMB 1HEZA 1JPSH 3QCTL 4PTUA 3FOMA 4LDEB 3BPLC 1XF5B 5ETUB 3DVFA 2VDMH 1MQ8A 2X4UA 3VXUE 2DQTH 4J4PC 1NCUA 3WIIL 2KUTA 3SJVB 4I18B 1UM6L 3HC4H 4Y1AA 1MRFH 3EJJX 3VFSA 4Z8FH 4O2FA 3FAWA 1OAKL 4PRNB 4NO5B 5L2JB 4XNXL 1JRHH 5GGSA 3MRQA 2XI9A 2DYPA 3VFGL 3UX9B 3CVHH 1A02N 5C09B 1IQDA 4J6RH 4WRLA 1BM3L 1SQ2N 3QXTA 1UCBH 3LPGA 3VGHA 1Z5LA 3I3BA 3NACH 5I71B 4IRJA 3PGDB 4CDHA 4P2RB 3V4VH 4E41D 1SMAA 4F80A 2FJFA 4A6YB 4QTHB 3NZ8A 1EHLL 1XGQA 4X99B 4G6KH 5JOFA 1EEYB 2IBZY 1LK2A 4Y19B 4UT9L 2Q20A 3BZ4B 4F33B 5SX4I 1LP9F 3DX6B 5EOTA 4X9FA 4YHIA 1NFDE 4Z7VA 1QSZA 5I73B 4OZ4A 5BS0B 4LKXA 4KMQA 2LAAA 4KHXH 5GS1A 5JW3H 2Z91A 4KTEH 1ETZA 4J3WA 2Y36L 3W2DL 1LO2H 5C1MB 1KN2H 4N0CC 4U1IA 4DFHA 1GOHA 3VWKA 4K9EH 3CXHK 2BNRB 4PJBE 2APXA 4Z5RB 2J8UF 4OF5A 1CIDA 1DDHB 1OGTA 3BUTA 3CH1A 5HGGS 5HYJA 4K3HA 4QY8B 3AMLA 3HZYB 4ENEC 4KKBC 4BKLB 1H3PL 3OKKB 4LLVB 2VQ1A 5JOEA 4WO4D 4G5ZL 4ZTOL 4NBXB 4HCRH 2VDPL 1JWSB 1S9VB 2VUYA 4G9FD 5ADOH 4YXKH 5FV2A 4PJ8A 1G6RB 5HDOA 4UMGA 3NFPB 4BSVB 4JFHE 3MLXL 3EO1B 1QSEE 4ZODA 3ULUL 4MMXC 4XI5D 3TCLA 5ERWA 1V7NL 2APVA 4WFEE 4P4RA 5JNYA 5B39B 1UQSA 1J10A 4GS7C 2JTDA 3I3EA 4EN3C 7CGTA 2CK2A 5AAMA 2LU7A 3FRPA 2HAZA 5C08D 5D1XD 1AE6H 4K7PH 4D9LH 3MRCA 1BX2A 5DHVH 1UKQA 2E7CA 4JFDA 1VPOH 1I1AA 1NL0L 1KN4L 3RWFB 1PZUB 5FO7A 4KI5D 2UVEA 1BMGA 1MCCA 4PRDB 1NDMB 3UP1A 1E4JA 4RBPH 3VG0H 2XN9D 4KPHH 2DM3A 3H3PH 5F7WC 5CEZE 4F7MA 3VGEA 3O3EA 3ARQA 3EOTH 2UY6A 4J8RA 2DLFL 3Q0HA 3BIKB 3TVMD 4KV5E 5CJQH 5TFSH 4MAUH 4IDJL 3N85L 2DTML 4HUKB 4ZFFB 4M5ZH 1JZ6A 3U36A 4KTYA 4CL7A 1YY9C 4HS8H 1BFSA 4NQTA 4DWHA 2VXSH 4JVUA 3FT4A 3FMGL 1FL5A 4EUPG 5J6GB 5ALBH 4PJFA 1G7MA 4X80L 3VJ6B 4NWUL 4MA3B 3BZEB 1MCLA 5C07E 1H15A 5IMMB 3GKWL 1BEYH 3CFJA 1W0WB 1DZBA 3MBEB 5HPMB 3VXSA 4PJ7B 2AK4D 3A67H 3ABZA 3KPNA 5JA8B 3GSRB 3HNTH 1AKJD 2ZJSL 5EO0B 3ZTNL 3HUJF 5CSGA 4PJDE 4PJHF 3MOAL 3F7RA 3IXAB 3MLWL 1MY5A 4XPBL 1A7RL 5HHNA 1DE4B 5E0QA 4FS0A 3U7YH 4S1QL 3X3GL 5ADPH 1C5BH 4XC3H 2OSLB 4GKSB 4EXKA 4IIQA 4DOHB 4B53A 3VFTA 3TBTA 3N06B 4P3CH 3U30C 1FLRH 3T8XA 3QFDB 3O9WC 3GMNA 2AEWA 5IW6B 4OCLC 1U8PA 1NPUA 2BJMH 5DSCB 5D7JC 4X5XB 4FFVC 1PKQA 3PL6B 3DO7B 2OL3L 2V5SA 2BY3A 4WWKA 2AQ1A 3FTGB 3O3AB 5K59E 3P4NB 4Y4HA 4E9LA 4L4TB 4ZQKB 2V9QA 5E2TL 4M8QB 3RGHA 3D0VB 4UQ2B 4NCC2 4PP1D 3W0WE 4X6DE 2W65A 3QUXA 1A7PH 4H88H 3HRZB 4XXDB 2ZP0T 1BOGA 1TVBA 5D96C 4M9OA 4OFKA 4ELMF 3VFWA 3TJEH 2H2PD 4ODWB 3IS0X 5DJCA 1B6UA 2EDRA 1VKXA 4ZXBC 4V1DB 4JFZH 1JZ8A 4ZNEA 2BNQD 4KDTC 2V7HB 1S7WB 1E28B 3MROB 3ZDYE 3MV8D 3TO4B 4KGJA 1D5IH 2A0LD 3CAFA 3K3QA 4PY8J 1UM4L 4F7CA 4MJ2A 3DPBA 2CUHA 5CBAB 1SEQH 4IMKC 3MSPA 3BP5A 1YEDA 1T22B 4OFVA 4LCWB 4M6NL 2YD8A 3EIFA 1OCWL 1K2DA 5DZOA 2Q6WA 3F62A 2AJZA 4S2SA 3QWOA 3UMTA 2F54B 3CMOH 3MNZB 4Q2ZB 5CMAB 3U0WH 1WBXA 3C5ZC 4MDJB 4WNQB 4AQ1B 3DTXA 3IDIA 5E8DL 1XIWC 3NFSL 1ZT1A 5HI4D 2PO6C 1FFOA 3VXOA 1LO4L 4C56E 5GGTL 2HJKB 2Y7QA 5IHBA 1HKLL 3DIFA 2CJUH 1CWVA 1N4XH 3MLYL 3P11L 4E42A 4PRPA 4G6MH 4JRYB 3KJ4B 1YEIL 1EUTA 2DD8L 4GH7B 2G2RA 4DEPC 1D6VL 1JPTL 4M6MH 1WGOA 1JHKL 1AH1A 3Q5OA 43CAB 1QKZL 2CKNA 1KV3A 2VZVA 5BV7C 4YO0A 4OD1L 3SGDI 5C0DB 2CIIB 2G75A 4R3SA 2XA8L 4XGZA 4U1MA 4AMKH 4M62H 4NSKB 3PQYE 4ELKB 1P84K 2F58H 5EU4B 5B39G 2VH5H 3BYTA 4RGND 3MPCA 3QXUA 3QDJB 3X14A 3BVNA 2Q7NA 3C60D 1MCOH 2FHFA 5ESAA 1ZHLB 4BFGA 1N6QL 1GYAA 1F4YL 3TM6A 4YZFE 3O3BA 1MELA 1UB5B 1W0VB 4ODHH 5J13C 3SKJL 1YPZA 4TSAL 2HTKC 4HXAH 3MRIA 2AXGA 2XIDA 4Q0XH 3WE6B 3NIGE 3DURA 1B4JL 4MQTB 1AO7A 2VZUA 3BN9D 2ESVE 5EN2B 2F19L 2F53A 4I3SH 3RJDA 5EC1B 3B2VL 4RGMB 2CSPA 4XRCA 1UJ3C 2VO5A 1B0GB 4UT6L 3MNWB 3LB6C 5D72H 2X9YA 3PIQB 5DLMH 2AEQH 5IB4B 2ZUQB 4QRSB 1DL7L 2FNBA 1YECH 5FECB 4I4WB 3NN8B 4LOUC 4K23H 1E4WL 3BISA 1OAQL 4CU6A 5HHME 3QXDB 1HHKB 4Y5XB 1F4XL 4OZIF 1NGQH 2AQ2A 3GMRB 5C6WH 2BOCB 5JW4R 4OTXL 5EO9A 32C2A 3O8XB 2P8LB 4I48A 1AR1C 3HNSH 4PJXF 5J6HA 4DN3H 1S7TB 3N1MC 2BVPB 3TH3T 3KXFE 3D69A 1EO8H 3VRLE 3RVUD 5CD3B 4UOW0 1CVSC 3IDGB 1B9ZA 1S3KH 2YS4A 5DURD 4NHCL 4H1LB 3RY5A 4GW1A 2CK0L 5CUSL 5ITFA 4PGZA 1B88A 3FB6B 4ZS6D 4XPHL 1B3JA 4XB7A 4UT7L 3M17B 2Q8AL 3T0EE 4JQVA 1ODAA 5DC4B 5I1HH 2CDFA 1LE5B 4LDLB 1NH6A 3EOYG 5CHNB 5EU6E 3JWDL 2ILLA 4OF3A 4XBEL 1R3LB 5HDQH 5BRZD 1SY6H 1J8HA 1NGYB 4FQXD 2BMKA 4GAYB 5D7IA 2OX5A 5C0ND 3AB0C 5DJZA 1PZ5B 3S3JA 5SWSA 1IBGH 3ET9F 5E94A 4YBLB 2XWJB 4NQDE 1ZLUK 4J1UB 1ZT4B 5F1OB 5AUMB 4PJEE 4QHKI 1JYWA 2FJHB 3DECA 4Y4KD 1C12A 4AG4H 1JNHB 1BP3B <