2CH8A

Structure of the epstein-barr virus oncogene barf1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
199
structure length
188
Chain Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Epstein-Barr Virus Oncogene Barf1
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Viral protein
molecule keywords 33 KDA EARLY PROTEIN
total genus 40
structure length 188
sequence length 199
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ch8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ch8A02
1JPGA 1ZGLP 3I9GH 2YA1A 4G7VL 1MLBB 1FFNB 2BNQB 3UTPD 4LSSL 3KAAA 2V7NA 2EYSB 3GMRA 3C2AL 3OKMA 4OM0L 3JWOH 1YDPA 1UYWH 2DI9A 1WT5A 3OAYK 1G7IA 4HJ0D 1NBZA 1WZ1L 3E6HB 4JRXE 4NRZB 1CLZL 2R69H 2HKHH 1FQ9C 2VXTH 1A6UH 2ICCA 2AJSH 4EDWH 5CJOL 2VISA 1ZA3A 4XCNA 4HZLB 5JUEH 1RIVL 3S3SA 5J89A 3QWRD 4ZNEE 4OQTL 4MXQD 1JHTB 5T1DL 4PB0H 5ILTH 32C2A 3TVMB 3BHBB 4WFFE 1WAAF 1MCSA 3LH2H 5DJ6A 4BH7A 1D6EA 5DSCA 3N1PC 3QEQA 4RGMC 3IFPB 5IEKB 5J1TC 2EXWD 3CFJA 2VMFA 5FYJU 4I5BB 4DWHA 4POUB 4O51A 1Q72H 3CAFA 1PY4A 1U9KA 2WWMC 3D39E 1PG7L 5D1QC 2EC8A 5GS1C 3DBXA 3RWJA 5CEXB 1NFDF 2JJVA 5TDOA 3NACL 1IC4H 4OCLC 4G6AC 1KOAA 3FN3A 1O0VA 4YE4L 5E5UB 5ICXA 4OZIA 3HE7A 5B4MD 3DYPA 1P4BH 2MCG1 3WNPA 5HVWA 5D7SL 4OJFL 5I1LA 1YY9D 2BRRH 2YKLL 2Z8VC 3KYOA 4DZBB 3R06B 5JOEA 4PJ8C 3KPLA 4NC0B 5IB3A 4LSSH 5FECB 5T1LB 3P9LA 4OV6F 2A0LC 4QGYA 5GGUA 4ZPTA 3K81A 5HVHC 3W0WB 4KXZH 4P2YA 2FR4A 3RWIB 4O2EA 4K3DL 1ZHLB 4HS8L 3PDGA 5FO7A 2AEIT 3WN5B 3GJEA 3FL7A 1QKZL 4Y5XA 4BH7B 4UQ2A 4Y5XC 5C9JB 2Y5TA 2DQEL 4K7FB 5EU6D 2QHLA 3HE6C 4LU5H 4K71B 5C86A 1BQHG 2HVJA 4HKZA 2UV3A 4BFIB 5CEZD 5I16A 3S6CA 4Q6IA 4G8FB 2EZ0C 4JN2A 1RSFA 3FMGL 1QPXA 3ZT5A 4QRPA 2DTSA 1IL1A 4UV7H 4FFWC 2VWEE 3T0EC 2DOCA 1T7VA 4MDJA 3WLWC 4CW1B 3JTSB 1IEAB 3MLZL 5AYUL 4HEPG 1WK0A 2PYFB 3BD4A 5DZLA 3PHQB 2JB6A 4KKLC 4NO2B 4KJWC 1FFNA 1TJHL 4DGYH 4QNPE 4HMDA 2R2BB 1HDMB 2BY3A 3AUVA 2M2DA 1HHKB 1N7MH 5CWSB 3K1DA 2B0SL 3B3IA 4Y5YA 4OF7A 4M7ZC 3HI5L 4KMTL 1BLNB 4FXGA 4YHIB 3VRIB 3U4AA 2OR8A 4G3YL 4G5ZL 4R3SB 4M7LH 3QR2A 4PJ5D 1JRHL 1AQKH 2AXGA 5F1IA 2ITCB 1AKJA 1IEAA 3VD9A 1QSEA 1TENA 4JRXA 1MI5A 4JHWL 1FCGA 1G0DA 5FUCC 5HYJA 1XIWC 4PREB 2EH7L 4FQQB 5IV2A 12E8L 5I1IL 4WDIB 4QHUA 3FO9B 5D2NA 3X12B 3O41A 4Z7VA 4BJLA 6FABH 1KGCE 1UADC 5E2TL 5CD5C 2WWMD 3QDMB 4X6BA 1ZLWH 3V0VB 2I9TB 3MQIA 4HKZB 1XIWB 3KXFE 5EU3A 3L6FA 1QYGL 1M6OA 3RUGF 1FL3B 4O5LL 2V2XB 5GGSB 2R0LH 1NANH 1T04B 1AGDB 4HK3J 3OAUH 3HLAB 3J8F7 1OM3L 2WZPD 1LHZA 3FQTA 4RGOL 5KOMC 3HRPA 3ULVE 2MSPA 1J05A 3JZ7A 1CGSL 1OTTD 4E41A 2X1PA 1MRFL 5CSZA 1U2HA 5DO2C 3CZJA 1AD0B 3HI1A 1P9MA 3I75B 4YHKL 3BEVB 2OSLA 5MERA 5FA4A 4EN3A 3SE8H 3KS0H 3RWIA 3K7UA 3LEVH 3BW9B 4QCIA 5EOQL 2PO6A 1JGUL 2PO6C 4NN6C 4OJFH 1ZT7A 4H1LG 4WO4C 3ARFB 5INDB 2IPUG 4KPHH 2HRLA 5HYJE 4P0DA 4Y16D 2NQCA 5EBLA 3WJJA 2N1KA 3UYPA 5FECA 1TETH 1WTGT 4HWZA 2YPKA 3MRBA 4YX2L 4ONFH 3KJ4B 3KYOB 2GAZA 4WWID 2WINB 4GKZA 1H5BC 4L3CA 4XAWH 4OGAD 1N6QH 4XC1L 1FZOA 3TO2A 4N8VG 3L7EA 3V5DB 5C0BE 5ICXB 4OZIB 3HC4H 5J7CC 2WK2A 1DE4A 3W82A 2ADFH 4AG4H 3O6ML 2CIIA 1ITCA 3F7RA 3I6GB 4M8VA 3O2DH 5CIPA 3STZA 3SE3A 4XC1H 4HDIB 5KAQG 1EGJL 1RZ7L 3MGAA 3GSOB 4CU6A 3CFIC 2P8MA 5D93B 5JXAH 2X10A 1KCVL 3WFEH 4QF1A 4KRMB 3QIWA 3CC5B 1QO3A 3GIZL 3ILQD 1HXMA 1PX3A 2VLRB 2ZCHL 4PRBA 4D0BA 2H3NB 3DI2B 5KS9A 4AENB 2CPCA 3OXSB 2COQA 3NCEB 1AI1L 3KPSE 3ISWA 1SYSB 4UBDC 4OZFA 3IU3B 1JHTA 3PL6B 3BEVA 1P7KA 5DUMH 3VFGH 1CDCA 4LLUB 4PGEB 1MF2L 1OW0C 2FX8H 2XQBH 4LLQA 5SWSB 1KPRA 3UJJH 1W72A 1P2CB 4ELMB 2DQDH 1WC7B 1HWHB 4XMLL 1V7MH 1ZEAL 1TZGH 1ZVHA 4L5FL 1IFHH 4HWEH 3IFNL 4ZFZB 1BECA 3QUMB 2EYSA 4HIJA 3WDIA 3MJ9L 2AK4B 4MNQB 4XX1G 5A3ID 4YC2C 2MFNA 3ZDXF 1QSEB 3OZ9H 3DXAE 3FFDA 3CVIH 2D7PA 4WEMB 3O2WH 4HLJA 5IT2L 4KV5F 3PL6A 1U91A 1OARL 3PQYB 2UWEE 2X6MA 1DQQB 3FN0H 3KPPA 5BOZG 1LO4H 4I3SL 4RAUB 1OF2B 1G7HB 5E4EB 1YMMA 4MCYB 4D0BB 4JY5L 2AJVH 3HMXL 1C7SA 3VGGA 1EO5A 1AXSB 1TJHH 1B0GB 1KCRH 4DGYL 1F3DJ 4M61B 1CG9A 4APQC 3MRCB 3OXRA 4EQ3A 4KUCF 5SWZB 4GKNB 2BVPB 1PDKA 1WWAX 3BP7A 4OT1H 1CD1A 2JK5B 2XY1A 2BCKB 3I85A 3BYTA 1ZHBB 3LKRA 5FA3B 4XCEB 1FV1B 3KPNB 5EOCH 4KI5E 1IAIH 1VEPA 4PJFB 3K2UH 4XNYH 1K4DA 4QHNB 2J4WL 3H9SA 4L8SB 4B5EA 2PCPA 4JAMA 1YNKH 3GO1H 5EFIB 4P2RA 1QBBA 1UJ3B 5SX4I 5C0BD 3WFCL 4X4ZA 5F44A 4HQQH 4JY4B 5EZJB 2A9NL 3WE6B 1PY9A 2UY6A 3CDFA 5IJVB 4RGNB 4X6EB 3FB8A 4FZEL 1IKNA 4FZ8L 1EAJA 5GQBA 3U48A 5C9JA 1Q0XL 1HEZB 2EIZA 1MRCL 3VMPA 1WWBX 4N1HB 2ZUTA 3VFRA 2F54D 2HT4C 4IBLT 3HNSL 4KK6C 3CFEB 4LIQL 4ZPVB 3X14B 3ARWA 5KSVA 2CRYA 4CNIB 4JB9L 3CGTA 4FFVD 4HKBA 3IF1B 3VXSA 2CR3A 3MJ9A 4LSDA 1HILA 2FGWL 3QRFM 1JHLL 3GMNB 1JZ2A 2BVOB 4U1MB 3QXWA 3S5LB 5J9PB 4A2LA 3MV8B 4ORGB 3AFLA 1FSKB 3P4MB 3T3PF 1HOCA 1WIUA 5EOCL 3S96B 4IS6B 3PG2A 4OZHA 4XRCB 3RA7H 4KJYA 1CFQB 5BO1L 1NCDL 1N6UA 5ELIA 1UENA 4I9WD 4EN3D 1MLCA 3UC0L 3ILPB 1DQLL 3ARFD 2GK0A 5DVMA 4A6YH 4PB9H 1NLBL 4IDJH 2PNDA 4RGND 2NY1D 4Y8DC 3UZEA 3TYGL 4M4PA 1CCZA 4JFHD 3D69B 5SV4A 2DQEH 1TZHB 5T5FH 3V8CA 3H3KA 4CDHA 1AR1D 1LO5B 2GIYA 4PBVC 5C0GB 3CVIL 1PSKL 3M1BA 1CLYL 1UXWB 1NH6A 3KLAA 1AGFA 3IETB 1A47A 2P48B 1F4WH 3HRZA 4L3CB 2FJFB 4L1DA 3QUZA 1GPOH 1EO8L 1MCBA 2Z93B 4JQVC 4LCWD 3MLVH 3JTSA 4NC1C 2Y23A 3TGXA 2IBGA 4RA0C 1HHIA 1VGKB 1YEIH 4MVBD 5EUOA 2FJGA 3EHBD 1RJLA 2WUBH 4P59L 3EO0A 3UROR 2DIJA 3LKOB 2R56L 4LSUL 4K07A 4K7PY 5GS2H 3KPOB 4U1JA 1CXEA 5DI8B 1E4XH 2FD6L 1A1NB 1H9VA 3U9UA 2H2SC 1A6TA 2R0ZL 2NLJB 4LCUB 5EZIH 1HK6A 3NH7L 1PD6A 4AT6A 1I8KB 5DHVB 5FKAA 1FZKB 3DMMD 2AK4D 4MNQD 1MJUH 1ZHLA 3O3AB 1YYML 2VIRA 3GRWL 5HI4C 5JDSB 1H3TA 3HS0A 2V9QA 3TM6A 3O4LA 1JNLH 1D5BB 2ZOKB 1S7SA 4GH7B 3OX8B 5D7KE 3U7WL 1NL0L 1RIUH 2GQHA 5D5ME 7FABH 2EC9T 2AJYL 4QTHA 3HCVB 4LPWA 1XF5B 4D0DB 5AG9A 4YHNA 4BQCA 3WFDL 5A2JH 2Y36H 1GJIA 2E7HA 3X13B 3F6LA 2E5EA 3SKNA 2ITCA 3C87A 3E2HC 1R6VA 2G2RB 2KQNA 4F58L 3L9RA 3S35X 1IARB 4XP9L 5DGRA 4WFED 3OKKA 4XPTH 2KZWA 1I8KA 2X4SA 1A6VH 2X70B 3QIWC 3PL6D 1VFUA 1QR1A 5HDQH 3DJ9A 4TNWF 1DLFL 3DROB 3NIDE 4P46B 4O2CB 4ZUVB 4PG2C 4FQ1L 1HH9A 1RZJH 1T0MA 5FV2A 3ZT7A 1W72L 4B7LA 1NEZB 4S1DD 3V4VH 3KNBB 4ACPA 4JPVH 4OQTA 2QQNH 5D5MB 3MGOA 5ESQB 5EOQH 4KY1H 2EEDA 3PP3K 2VOTA 3LPWA 4WNQB 1CS6A 3QFDB 3W0WD 3HR5B 3P4OB 2YC1A 2BJMH 3OAZK 3V52H 1NCCL 5EO0B 4XB7A 4Q0XH 1U2CA 4GMTH 5D1ZA 5IR1B 2J6EL 5KSAB 3X17A 4URTB 4X4XA 3WS6A 4ODHH 3BIBX 4PRID 5BOPA 4BK4A 3ARUA 1VFOA 2A6JA 4X80L 4NWUH 1JMZA 4NKOB 3DUUB 1U8LA 3ZKND 1M71B 2P5EE 5DJCA 2EE9A 3JV4B 3NZHH 5HYEA 3REWA 4BSWA 2IH1B 4LARL 3MV7D 4IJ3B 4OUUA 5BVJB 4HIXH 3DGCR 1T83A 1FORH 3X11A 4OCNC 1BQSA 1QFHA 5ISZA 5DHYA 2XWBA 4C55A 5T3ZD 4BFBD 3O3EB 2IAMB 1HQRA 4ZFGH 4OLWL 4R8WL 5T33H 4H20H 4OFVA 3DROA 1G9NC 3IFLH 3GIVB 2J8UF 3LQAC 3O4OC 5JOPE 4H0HB 2B1HL 5FM4A 1S7RA 3P77A 1MFDH 4XPGL 1G6RB 5B38G 1ZVSA 3VFSB 3LPGA 1ZLUH 1DQDH 4G42A 1T1ZB 3K74B 4RFNC 5ANMB 1PAMA 1RZGB 1UGNA 1K8IA 3QEGL 2QHRL 3RWFA 2VAAB 3WKMH 3F12A 5DEFA 3UPAA 1NGWB 3OL2A 2PXYB 1M7IB 4M8QA 2YD9A 4R7DA 4NN6B 1T5XB 3HB3D 4OIIH 2WV3A 1BX2A 4CJ1A 1RUAH 5GSRA 5GS1B 5FDWA 2APXA 2HMIC 3MA7A 4FTVD 4LRNL 4JJ5B 4NRYB 5DLML 3ZKXB 4Z77B 4Z7OE 3RP1A 2A2QT 4RDQG 4W6XB 1KCUL 4LLYB 1HYSC 1KIQA 4F33B 4MAUH 1OGTA 1L4IA 4LRIC 4WUKL 2HA1A 4U1IB 7CGTA 1G7QA 4XP9H 1QACA 3MFFB 1GIGL 5FFLA 5FOBA 3SGEI 2ILLA 3RHWK 1O7VA 1N64H 2BHYA 3EO0B 4LL9A 5I1HL 4PTTB 1H3WM 4OZ4B 4CAGA 2F53D 1CK0H 4K9EC 2GSGA 4LCWA 2WSKA 3CMGA 2VDPH 4ENED 1SY6H 2D7TH 4F7EB 3B9KB 1CLOL 3R1GL 4XPFL 2W07A 1YA5A 4U31A 1ULVA 5DUPL 3P0VL 5FOJA 5IG7B 5TQ0L 3MLTA 2FECL 4WTZA 4NP4H 3DHMA 5H2BA 4L9LA 1CFTB 4WHTB 5DRNA 3TO4B 1WWWX 2VB5A 1CFVH 5IFJA 5BV7H 3MXWL 4ELME 4FNLH 3BZ4B 4MD0B 2XKUA 4OIBA 1CDGA 4ODTH 2VXUH 4YK4C 3VGDA 4N90D 4ZO8A 1DN0B 3C60D 1RZ8A 3KPRA 4HCRA 3C08H 3P0YH 4WHYG 4FQXC 3T2QA 5J13C 1F97A 4D9LH 2R15A 5CINL 4EBQL 3O8XB 5F96H 2X1WL 3OKLA 1T5WB 3L95A 4HS6A 4PV9B 1GIGH 3LEYL 1GZPA 4QGTA 1V3MA 3NFSH 3QDGE 3SCMD 1AE6H 3CH8A 4RIRA 1MCOL 3MRMB 3C2SA 3TYGH 3KLHD 2DYPB 3OR7B 5D70L 4Y1AD 3LAFA 1NPUA 1XH3B 4JPKH 4M6OH 1I1FA 2EH7H 3WUZA 1WFNA 1IZJA 3STLB 4KRPB 2NX5D 3LKNB 5GIRA 2DLGA 4G9DA 3JXAA 4DTGL 1OAYH 5HPOA 3CVHA 5C70A 2SEBB 3TV3L 4P9ML 1DQJA 5IB1A 2YR3A 1DCLA 1DSFH 2VABA 3DUUA 1Q1JH 5DVLA 3TESA 1A6PA 5KG9B 5CBAB 4X4YA 1NGPH 4LGRB 5HHQB 4NNXA 1L6XA 2I07B 4MA1B 5E00B 5I8CA 5J1AB 3T0AA 1CIDA 2HAZA 1FAKT 4K7PL 1JGVH 5DFVC 5EORH 3SDXB 3VFWB 3MO1B 2IG2H 4ODWB 4S1DC 3V6BR 3IYLW 5ISZD 5E7BA 4OI9A 4I8DA 4UOJA 5K59F 2RGSA 3PJSA 1CN4A 2D9QB 1DZBA 5KANI 4OCSL 5DJYA 3QIWD 4NN5C 1JGEB 2R2HB 5H94A 1W8OA 4TRPL 4JHAL 4KHTL 3WE6A 3I2CL 2V5MA 3ARPA 5FM8A 4YDJA 4OF5A 5GS3A 1EZVX 2GKIA 5D1ZD 1HYRC 5FGSA 5DFWH 4WGWB 3FZUD 3GSOA 3H2WA 2H1PL 2XACC 2EXWC 4OD2A 5I2IA 2NY4C 2FECI 2P49B 4X6FB 2MHAB 2PYEB 5EOTB 4LU5L 5JXEC 2A0LD 4LFHG 1AR1C 3PGCA 3SGDI 2X4SB 3UAJD 4HS3A 4WUUA 2Y72A 4GLRH 1G7LB 4L1HA 5ESAB 1UWGH 2XQYK 5I8EA 3DYMA 4GJTB 5TH2B 1T21B 2QADC 1V8HA 3MRCA 3OXRB 1A6ZA 1QD0A 1F5WA 2E9JA 1MRCH 3WFHA 5I76A 1HCVA 3BD5A 1IZKA 3BPLC 3DVNA 3Q3GA 3TBVA 3L3DB 2H2SD 1N4XH 4HC1L 5F21B 3ARFA 1G7MA 4IM8A 3BPOC 5EU5A 5LCVH 1I1AC 3BW9A 2VR9A 4PYHA 4KKBD 2ICWJ 4MD5B 3G6JE 2C3XA 3CUPA 4Z7NE 2VDLH 1UA6H 5CP7A 2R8SL 3L5WB 4MAYB 1T3FB 4OFKA 2R0KL 1CTOA 2C3VA 2JJWA 4A2MA 3JSSA 3EYSL 5DWUL 4AZ8A 4RSVA 4Y2DD 1I1CA 4P4KA 2AK4A 4MNQA 2H2PC 1YMMD 4DFIA 5LQBL 4KTDL 3ES6A 1AGDA 2ADGB 4I1NB 5T33L 3QUMA 5E99L 3T0BA 3THML 3ULSB 2BDNL 5E7FA 2FATL 1TPXC 5IF0A 1BVZA 5CILL 3TT1H 5DD5L 3O6LH 4NHUB 5B38B 2OP4H 1W72B 3B5HA 4B0MM 2DBLL 1G0YR 1U8QB 1IRAY 4HIEA 1J8HA 1N5AB 3J7HA 4TSAH 4F80A 1CDIA 5DURD 4ODXA 5KVFL 1X5FA 3CDGA 4F9LC 4HPOH 2IJ0C 3B43A 1T1XA 3ZL4H 4NQVB 3ARBA 5DQ9B 1AHWC 3BP6A 3AXLA 2BVQB 3PV6A 4HKJA 3N85H 4LSTL 1IQWL 2BNQE 3EDJA 4OQTH 4PRBB 4OZGB 1RZKC 4E41D 3CX2A 4I3GA 1QO3B 3MRQB 3NFPA 4U7KA 1CDYA 4M1CD 3VFGL 5ETUA 1I1YB 2QADD 2BJML 3D2UD 3E6FA 3MLUH 5B3JF 3BRDA 3P3YA 1EAPB 2FDBP 4NNYB 4W4OC 2BY0A 2ARWA 2ZUWA 3VXMD 1KULA 4XMLH 2LTQB 3E2HB 3H9HA 4ETYA 1NKRA 3DPBA 3BIKB 4WRLA 2DTML 4MD4A 4PJIB 4YO0B 2J8OA 2AJZA 5TQ0H 3DURA 1P84K 1E27B 3C5SA 5C07B 1ZLWK 4QRPB 4JRWA 2O61B 4X7TA 4IOIA 3VXSD 2CRZA 1TXKA 5T3XE 2Y5EA 1CZ8H 3S8WA 4JM4L 4PR5B 3V0WH 4OTXH 4CVUA 3HB3C 3ELAT 2CDFB 2ARJB 1BAFH 4OV5B 4WIQA 5DJXA 3T09A 1EIBA 3K0WA 4YDLC 2EIBA 4GBXB 2F5BH 4KJPD 4KKCD 4JFDB 5A16A 4QY8A 5KSVB 2X41A 3LH2L 1Z6JT 2EDLA 4R2GC 2OS7A 1A6WH 2A1WL 3NFSL 2NY3B 3QUYB 1FL5A 4G8GE 4KK9D 1PKQA 1MWAB 1NUGA 2HWZL 1FRGL 4AEHH 1CL7I 4WTXA 4E0RA 3W0WA 2NY5H 4RNRB 5JHDA 2E7MA 3NAAH 5GGUB 3RPIA 4HJJH 4UV4H 4HWUA 1RU9H 1F4YL 1ZOXA 3WXWH 1NDGB 2VXQL 4XNQB 2X09A 3ZHDA 4LEOA 8CGTA 1W0YT 5SWSE 4AIOA 4ZD3L 2FSEA 3H42H 1X6NA 3VGAB 1AGCA 2CMRL 4PG2A 5C92A 1OWRM 1JNJA 1FO0B 5L0QC 2VZUA 4TTDD 4MJIB 4BFEA 4GRWF 2XQYG 1P7QB 4FMFA 4L8SA 4UT7L 3DUHA 1N3NA 1LO3H 2ZCKL 3MV9B 1U58B 4EI5A 5DMYA 3BN9C 2WQ8A 1EERB 2XA3A 3HMXA 2BNUB 5FA3A 1R3IH 1P7QA 5KSAC 1AY1H 1UJTA 4I9WE 3L3HA 2PW1B 4KK8C 3ZDYE 4KVCL 2BOCB 1KXQE 1MRFH 5T1KD 3AC0A 3FB5A 3QIUA 4YHIA 5F7EL 1PBYA 1NBYB 3VRIA 1B0GA 2W60A 3I3DA 1OAZH 3PGFL 1INDH 4XWGH 1XF3A 2JCCE 4POYA 5JIIA 1KBGL 1FNHA 2XFXB 5JIKA 1SM3L 2O26U 5DMGD 2NR6C 2HLFC 3VG9B 2H41A 5E8NB 3FJTA 5D7IE 2DM7A 5E56A 5HHOB 1S9KC 2E7BA 3CDGB 1ZA3B 1F8TH 1LEGA 4Z7UA 4C54A 4WFHD 4CVXA 1SHMA 4ERSH 2J2ZA 1J1PL 3MV7E 3FCTB 3GSNL 4X6DB 2R1YA 1FLRH 3RZCD 5I15H 1EUTA 2VQUA 4BH8A 3TIDB 2DQIH 4PBXA 1PZUB 2AJ3A 1IM9B 5TE6L 5EUKA 4XMKL 2Z91B 5E0QA 4E9LA 4W6WB 1DVFA 2YPLD 4PRHD 2DQIL 2A6KB 4CVZA 3X3FL 3V79C 5C6WH 5D7LB 2D0HA 4HCRH 5DMKA 4NUGH 4H0IA 4PJBB 2XN9B 4JCMA 1DQDL 5CJXA 4PV8A 3GJEB 2EDFA 5TFSH 4N0UE 3OV6A 4MD4B 4PJIA 4P2RD 1ZAGA 5FO7B 5ITFB 3BE1H 5GXBB 1F42A 1C08B 1XR8A 3GSWA 4OIAA 4M3KB 4UNTA 5HHXL 3E6FB 2D7MA 5TDNB 1WBXB 2W92A 4WVRA 3MFGB 2VC2H 4JZOB 5FGBA 5FGBC 5GGQL 2AS5M 4XC3H 3DGGA 2HT2D 5IMMA 2V9RA 1FGNL 1OLLA 3QDAA 5FYJH 3RWCA 3MRFA 5CGMA 5IB3B 1MVFA 4K3EH 4AIXA 5GGQH 3TZVD 5D7IF 1R3KB 5CEYA 4JR9L 5DRWA 4NSKA 5KTEL 3WXVH 3MJ9H 3RNQA 1K6QH 5BV7B 1CDBA 2QV2A 5D7JC 3RX7A 4P2OB 4PJ9B 3FT2A 4NDMB 3A0OA 3PGCB 1AFVL 4H8WH 1JI1A 3IJSA 4ZOBA 3EFFB 1U8NA 4I0PC 2MHAA 2FO4A 3RWDA 2VTFA 1F6LL 2R0WL 1FZOB 3TO2B 1RAMA 5DS8A 3ARZA 5M94B 2GFBB 2B20A 1KIRA 4X5LA 1MF2H 2QQLH 5E4IA 1VFAA 2EE3A 4PY7A 5EH1A 4ZAKC 1OT1A 4UDTA 4Z76A 3CFJB 2AAVA 2X9XA 2Z8RA 4RBPK 4HC1A 4IEFB 4HLZG 3QQ9C 1CU4H 5IUSA 4DTGH 2IG2L 1DN2A 3VE0B 3L5XH 4QRQB 4F7PA 1UH2A 2DKMA 3OHXB 5EZOL 5IROC 2A6IB 5IQ7L 2WLYA 3P4NA 1YZZA 5I8KL 1T3FA 2EH8L 1I8MA 4FQIH 4E42B 2PW2B 1NMBL 4OCWH 2Y06L 3DX7A 4YNYB 3OSKA 2DJSA 4Q7DA 5BJTB 4IRSD 3LN4B 3W11D 4YXLH 1JPTH 3PWPE 4NQEB 5IVNA 4UAOC 2O5ZH 3LQAH 1FL3A 4NYLB 5C0FA 2JIXA 5C0AE 5GIRB 1RK0A 5DYOB 5DJ2B 1I1FB 4Z0BL 4XZUB 4GKSA 2IANA 5T5NG 3X12A 4O4YL 3S88L 2F58L 5K59E 4JQVA 3LIZH 3G04A 3FO1B 4ZUWA 3EGSB 4NO0A 1G7HA 2OX5A 2EDDA 2FLBT 1Q38A 2NY7H 2L0DA 3L3OB 2BVQA 4KUZH 4OGAC 2VXSL 3IDUA 3M45A 2WBJD 2E7LA 3GJFH 1RULH 4XXCC 3VU2A 5SWQA 1UM6H 5DTFA 2WIIB 3BKMH 4P23D 1UZ8A 5AWNL 4CMHC 4MCZB 1OT2A 4ODUB 4OLZH 3BSZH 2BC4B 1NFKA 3WMSA 4JGMA 3QI9A 5IFAL 3PJSB 3QI9C 4NN7C 5DQDL 4J3TA 2I9LB 2PN5A 4KWUA 3OPZH 3CU1A 2NTFB 4G9FB 4IDLA 1C16B 4N0FA 3SQBA 1RZKH 3TBWB 3R4DA 4WHYH 5D6DC 1N0LA 4N1CA 1MFCL 4UDUB 3SY0B 5TPWL 1L0XA 2RJMA 2P5WB 2X1QA 4Y5VB 4XHQA 4NZTL 1HXYA 5L8LB 1Y6KR 1QLEL 3MNWB 1TLKA 1J8KA 4LLUA 4EXPX 1KPUB 1BQHB 1BWWA 3EBAA 3NZHL 1T1WA 2FL5B 3FKUS 1JZ7A 4G80B 4Y4KC 2DICA 3GBMH 3TEUA 4Y7MA 4RAVB 4TTGA 1U8HB 4B41A 1A4KA 1OGTB 2ZKHL 4NQSB 4BSVA 3U4BH 1G7MB 1KLUB 4UOW1 1J87A 4DN4L 1QSED 3OKNB 5I1GH 5IB5A 4TULL 3SDAD 2BNRA 5E1HB 1YY9C 1OCWH 3L95B 1J10A 4U1GC 1EHAA 2K7PA 2OTWB 2YSSB 1QG3A 2JLLA 5CJQH 4W70A 2B1HH 3TA3C 5DDHB 3IFOB 3VDBA 3RGVB 2VH5L 3MMEA 2FO4B 1OGAA 5DURB 3RWDB 3QZWG 3UZQA 2GEEA 5GJTL 1PX4A 1KPVB 4MSWA 4FP8H 5D9SA 1RQ5A 3FFCE 4JG1L 1IGFL 1D5MB 1I8LA 1GYAA 4OFYD 1E4JA 1FBIL 1SBSH 4KI5D 4LP5A 2L7JA 2CIKA 2EKSB 5AAMA 4UUJB 3EJZD 3PV7A 2NY5C 1G6RA 4XNUL 3EFDH 1TVHB 3QPXH 3UCRA 2LU4A 4IHOB 3HE7B 5SWZE 3WN5C 1VADB 3RVXD 4JVPA 3BJ91 3A6OA 3D5OF 1FFQA 4X8JA 2AK4E 1HINH 4MNQE 5T1MA 3U0WL 1FZJB 4G6AD 4PRDA 2GY5A 3O6LL 1H8SA 4M5YL 4G80A 3P40A 2G9HB 4NZTH 2GCYA 1Q0XH 1KELL 1W0VB 5FOBB 1D5IH 1TZIB 2Z31B 4PLJD 1F13A 1AD0A 3K80A 4JRYD 1CGUA 1A5FH 3I3EA 4G3YH 4NNXB 5E8PB 3Q0HA 1NMAL 3CVHH 4N0CC 4P2QB 4WY7L 2AV7B 4UU9A 25C8H 1Y18B 3LSOA 2P5WA 4Y5VA 4Z7WE 5DVNA 4BZ1L 4OB5H 3VDAA 4NT6B 5GGRB 4L4VB 3L6FB 2AEQH 3BQUD 3ULVD 2J5LB 2O5XL 5AYUH 3MRMA 3H9ZA 4X6DA 3CSYB 4XCYB 1B88A 4LPYA 5CJQL 2BERA 1A6AA 15C8H 2ITDB 4F7TA 4R26H 4LASH 1FSKC 5MENA 1MHEB 1MAJA 4XGZA 3FMGH 5L2JB 1B3JA 2FBJH 3V4UH 5F1IB 3OMZA 4YEEA 2IMNA 4HXBH 3D0VB 1P69B 1KT2A 4NJAH 3BPCA 4U6HA 4XBEL 4HF5L 4MNGE 4MLSA 2Q87A 4GW4A 4DGVL 1W0WB 4X6CE 5L9DL 3AREA 2F5BL 3QXUA 3BDYH 2X4UA 3G04B 1A9BA 1QFPA 3IGAA 5JW5B 3N50A 2F74A 4HUWA 3O3EA 3VCLA 4L3EE 1CICB 3C9NA 4U1NA 3SKMB 3U4EA 4YLQT 4RFOH 3JWDH 4IRJA 1QLEH 4MNHB 1YEDA 4KDVA 2HTLC 3DO3A 3D6GA 1T03L 4YXHL 3NTCH 4ZDHB 4YHLH 1RUKH 2Y7QB 4XTRD 2XZQH 5DJCB 3BN9D 1UKTA 5HHME 5JIHA 1UCBL 1NLDH 5B8CC 4MQSB 3HZMA 2QKIB 1J8HD 2DTMH 3MR9A 3MNZA 5F7KC 4FXKA 4NJ9L 3UTTE 3LKQB 3V6FA 2XZCH 4DFHA 2IPKA 3BSZL 4EZMA 5FHAL 4H1LH 4HUNB 1PG7W 3IJYB 3B9AA 2BVUA 3P0VH 2ZSVA 1YEJL 1PQZB 4EDXB 4JREC 1UZ6E 4FFZH 4GXUN 3ROLA 5DZOA 1EX0A 3DI3B 3H42L 3RVTC 1DUYA 1KIQB 2XI9A 3SDAA 3KPRD 1U95B 2VDOL 3BKJH 1FYTE 5CMAA 4D94A 4GRMA 3PXJA 4WI4A 1DEEA 5DS8B 3AS0A 1LE9A 1E6OL 4ZPTB 3TZVA 3UAJC 4MJ5B 2J88H 1U3JA 3DSFL 4ORZC 4OV5A 4AYFA 4JANA 1Q9KA 4JKPH 2PTUA 4J4PA 1CE1L 1PQZA 2RBLA 3IDMB 4HUXB 1KFAH 4L4VD 5EO1B 2DBLH 3O2DL 2VZ1A 1HQ4B 2ADFL 5DO2D 3QEHB 4HSQA 2EDEA 4DVBA 1DVFD 3L3IA 1UVQB 4GXVH 3WSQL 5I9QB 3OG4B 3SKOB 1E4KC 2O61A 5D7KD 2UZIL 2W65B 3L3JA 1CXKA 2OL3H 3C5SB 3ARXA 5C07A 3MJGX 4YPJA 3BX7C 3QUKB 3ROOB 1MCRA 3TT3H 1HQRB 4NQDE 4JRYB 1TNMA 2CUMA 1II4E 3AMKA 5HGAB 3KPSA 1PYWB 4P3DB 3M17B 3BH8A 3ZKMC 5JDSA 1TTGA 1D9KD 4XNMB 3I6KA 1QSEE 1FVCB 2F54A 4YJZL 1FZKA 1IGFH 2O5YL 4I5BA 2IH1A 4LASL 4AT6B 4UQ3B 2VLLB 4XWOC 4OGZA 4LCUA 4XH2B 1UQSB 1R24A 4K94C 2KL6A 3QXDA 2XTLA 4DVBB 1JZ8A 1HQ4A 1AHWB 3OKOA 5FK9A 2CRMA 3RBSA 1KJ2H 1OQXA 4IS6A 3VRJA 3P4MA 2P47B 1KN4L 3IAGC 3QFJD 3RWEB 5F93C 5GGVL 4PY8J 3MV9E 4FQLL 2DL9A 2PETA 4JHZA 5KVDL 3RAJH 4K9EL 1ND0B 1QP1A 1MFEL 2PXYD 3WFCH 5IHBA 4WFFD 4M03A 3EYUH 12E8H 4KKNA 4MA7L 2OP4L 2J4WH 3QIBB 4JDVA 4HIHA 1MCHA 3VA6A 3TO4C 8FABB 3WNNA 1S7VA 1AQKL 5CCKL 4HQQL 4D0CB 1XF3B 3VFPA 4LSPH 1D5XB 4L3EA 1C1EH 3DRTA 5I30L 3UTSD 1HZHH 1S9WB 5AZ2L 1J5OL 1F11A 4KRPC 1GGTA 1QFUL 5HHOE 5TE7L 4NFDA 2HVKB 1B4JL 1NC2B 1OCWL 1G6RL 2AJVL 2YD2A 2BY1A 3MV7B 3LRGA 3S4SB 5K9OA 3WUWG 1QFUH 5TE7H 4QHKJ 3Q5YA 5F9AC 5AZ2H 3T08A 4XMKH 1BVLB 1KN2H 1T66C 5DMJB 1QRKA 2E27H 3F62A 4F7MA 5I15L 2X4RA 2EXYD 4UV7L 3Q6FA 2W0PA 3SKMA 4WUUB 5I8EB 4ONGL 3QFJB 4YIQB 2KKQA 2D03L 4WI2A 1MJJA 4KZEH 4G8EA 5EIQA 5FUOH 2VAJA 2QTEA 4L4VE 1KPVA 4MSWB 3VI4F 3C8HA 1MY5A 4RWYL 4LHUG 5CHNB 4OGYH 3W9EA 3OB0K 3F7VB 3MACH 1QEWA 3U7WH 3CXHK 2ZNXA 3QRGL 3WSQH 5EU4A 1FL5B 4ZPVA 1QA9A 4LEXH 4GRMB 3R8BB 1KBGH 5EBWA 5EBGA 5C09E 3NIGE 5I71C 1IGTB 3O6MH 5GS0H 4F9LA 2CUIA 4GRLC 1A6AB 1LNUA 3ORJA 4IIQC 4BZ2L 4P3CH 1IQDA 1F6FB 3U0TB 5IHLB 2X89A 4Q58C 1IKFL 3TJEH 4HIJB 5J11C 4TPRL 1EDQA 4L4VA 3CLFL 2KPNA 1S7WA 2AGJH 5ITBL 3GNMH 5J1AA 4LSVL 4NT6A 3QQ3B 4YGVA 4LDEB 1YPZA 4AM0B 4BSJA 4LOUC 2R23A 2FH8A 4OFYA 4NJ9H 2HJKB 3SGKC 4NP4L 3SGKA 1OTUC 1SJHB 1JGVL 3IAPA 1MUJB 1HWGB 3DXAA 4ZFOB 1NCUA 5FYLH 5F89B 4PYGA 5C0BA 2HFGL 1BM3H 4Y8AA 5D1QA 4U2ZA 1LK2A 4U1SA 3D39B 2GTWA 5C0DA 4EOWL 3DMMB 4NKIL 1MHHB 2BRQA 1KTKE 5ESVA 1CGYA 3LD8C 2Z4QB 4OD1H 4QXTB 3RX5A 2WAHA 3QRGH 4MCZA 4YZFF 3ZKNC 1JN6B 1JNNH 4KI1A 3VD7A 3QG7H 1I3VA 7FABL 1GHFH 2FB4L 1XMWA 3VGEA 4U6HB 3NTCL 1DDHA 3C6SA 4MAUL 4ZUUB 1JNNL 1FFOB 5KZCD 5EZOH 3TJHD 4Q74A 2O5ZL 5C8JB 4JZNA 2IF7A 1KIUA 3AS2A 1OTSD 3U6RA 2YEZA 4D8PA 3OQ3B 2PF6A 4ZOCA 4XAWL 1CGXA 4HBCL 5DRXB 3IFOA 4UT6H 4Y16A 4JM2C 5J12C 4KROC 3MRNA 3HAEH 5HDBE 4CNIA 2EE6A 4Y89A 1JVKA 4OSUH 1A9EA 5BQ7A 5GGTL 2GUOB 3O6FC 3VWJD 2FHFA 5K9KA 2V9TA 2XZCL 1KLGB 1J1OL 1T1YB 3PWPA 3UTTB 5BJTA 5E2JA 1J5OH 3RVWC 1UA6L 2R8SH 1LP9F 5KZCB 4K7PX 2C1PA 4NM4H 4YHKH 3MBXL 2PR4H 4IMLA 3RGHA 1U8PB 2V2TA 1I85A 3LRSB 2C3VB 4M6NH 4WY7H 1I8MB 3NCYP 1JF1B 4LNRA 4XVUC 3VWKA 4DVRL 3GMLA 5FUZH 5DJ8A 4G7VH 3DUSB 3PWJA 3WEXA 3RU8H 1IAOB 3UBXA 3V4PH 4IMLB 1Z2KA 1EH9A 5ACZB 1QRNB 3ARDA 5LJYH 3ZHKA 2XZZA 4N8VA 1VGEL 3ARGC 3QJHA 4WENB 5HGHB 4C56D 3G08A 1NGQH 4PY7B 3QQNA 3BDYL 1XIWA 5EU3B 5JOFA 3BQUA 1B9ZA 3STBA 5TJWK 3QDMA 5C09B 5F9JB 3TNMA 5A2KH 3UJIL 4Z7VB 5D2NB 4PB9L 4HXBL 2X4OA 3OR6A 5DLMH 4M8QB 5TF1L 3FQNB 2AXJA 4CN6A 1WWCA 3U6RB 2JJSC 4XTRC 1OF2A 5H35A 1TCMA 3VXRE 3JUYA 2AXGB 2B5IB 1NMCB 1B6UA 5F9OH 1R5WA 1OOAA 5JPMB 1U91B 1ZVSB 1JYVA 2YSSA 5MI0C 1RPQA 2OZ4A 2NY0C 4F8QA 5KSBA 4NM4L 1LP9E 2ID5A 2MJWA 5TFSL 1KCRL 3ETBF 2ESVB 4I4WA 3GSVA 3B8SA 1JGEA 2ORBL 5ADPL 5B3JE 3RL2A 4QHLB 4P48A 3WO3B 4C57C 5DEGA 5HGBA 2ZNWA 3TVMC 4JFFA 2V5YA 1NGZA 4KJQC 4GAFB 3B5TA 3PHQA 2VLKD 5CLTA 1PGRB 1I7RA 1WVZA 1ACZA 5C0BB 1BQHA 5E2VL 3QJFB 2VXQH 3T2OA 4KHXL 3L5HA 1HHGA 5T1LD 1KIPB 4XBGA 3EIFA 2E9WA 1M71A 1CBVL 1KFAL 1I9IL 5DFTA 2Q6WB 3ZE1F 4X5XA 3MPCA 1YEFH 2AEPL 4OCYL 4MA7H 2DQUL 5IQ9A 4OLUL 3BP4A 4MJID 4E42A 2HWZH 2BHUA 2R29H 3ULVC 4S1SL 3DSFH 5EUKB 5E6IB 1G0XA 5D1QD 3VH8G 5HI4D 3ZKMD 5ALCH 4QRPE 3GMOB 2J8UE 3OHXA 4K3JL 4PS4L 3LZFH 3TIDA 2P24B 3OZ9L 1LWRA 1QHPA 1ZEAH 4DGIH 2DKSA 3FO9A 5CGYD 4EBQH 5KS9B 3BUTA 4PTUB 1Q9WA 4MDIA 1GZPB 2QQQA 5J11B 3LQZB 4H25B 3UTSB 4U6XA 3X3GH 2NY3D 5AWNH 1HSBB 3MCG1 1QSFA 4MXQC 4R3SA 5GGRY 4GBXD 1DQML 1WISA 1XFPA 4R96B 3HKFA 1E6JH 4HH9B 4KAQL 3TVMD 2NY6D 3QUXA 3DV4B 5DJDA 1QNZL 1TCRA 4K7PH 3MNVB 1YJDC 1FP5A 2P5WD 3LIZL 4G43A 2EO1A 1UM5H 1DLFH 2X4RB 2BOCA 4L9LB 1JTPA 1FC2D 4YR6B 2M1KA 2AQ3A 3GMPB 2HT4D 3DNKA 3QXVA 4ZUTB 1T89C 4Y4HA 3OTTA 5L6YH 2ZUXA 4HEME 3LPFA 2GJJA 4XAKD 1M1SA 2VRAA 1IC1A 3VFMB 4O00A 4LK4A 4I13B 1MCIA 1WZKA 1RK1A 3MLYH 2OLDA 4OTXL 4UNUA 4BUHA 5L6YL 3EYOA 5FA4B 3WFDH 3VGFA 1MFCH 4WUKH 4MXVF 4YBLB 5EUOE 5FKAB 2QSCH 2GI7A 2A6IA 1MCOH 3NPSC 1TZGL 3DX9B 5DQJB 5EBMA 1UB5A 4IOFD 3S4SG 2X05A 1HYSD 1JGLH 3JWNC 4UQ2B 35C8L 2YD7A 4C56A 4TQEH 5D1XB 1SY6A 1R5IA 2ED7A 1V3KA 4HFUL 1FPTL 1FJ1B 4KVNL 3HNVH 4WV1A 5IB2A 3RUGE 1S78C 4XCNB 1K4CA 5FV1L 3WS3A 1BVKB 2ESVE 3X3GL 3CFKA 5CEZL 3T0DA 1BJ1J 1LMKA 4G6JL 4KUZL 2FJGB 2XKSA 4DN3H 2CDEA 4X6DF 1HH6A 4ZQKA 2VDNH 1EEYA 1G6RH 4MJ6A 1ADQA 2Z92B 2BXZA 3GIZH 1LEGB 4Z7UB 1PLGL 3OAUL 1OM3H 1OD7A 2F19L 1U3HD 3T0EB 5M95B 5DR5L 1K8IB 4FFVC 1CLOH 3O81A 4YR6A 3UYOD 5HPMB 3OKOB 5DUPH 4PRPE 2O93L 3TF7C 4WCYH 5E8EA 4U1HB 1LEIB 1MWAH 3O2VL 3VXQA 2ICWI 1SEBB 1X7QB 2P8PB 3HA0A 1HIMH 3QNYA 4MJIE 3RIAF 4WW2A 4FQ2H 2VWEC 3T0EE 5C6PB 5EC2B 1HHKA 3BIKA 1F6AA 4NBYB 5I1HH 5KSUB 5J6HB 1WBXA 2CKBA 2JB6B 1M4KA 3DBXB 2XKNB 1EMTL 4H8WL 4RBPH 1TQCC 5HHNB 4MA3B 2DS4A 1GOFA 3NCCB 1UWXK 5F7DB 2DLFL 1CFNB 3DARA 5FO9A 4S1SH 1JBJA 1K6QL 4MQ7B 4ZAKB 2R29L 2V2WB 5IEKA 1KJMB 2HT3D 4I3RL 3T1FB 1A1OA 2NXZD 2IFGA 3HAEB 4QNPF 1RJZB 1DFBH 3O9WA 3L3IB 1X5JA 4U33A 2DI8A 1T4KA 3D3VB 5IVZA 4OZHB 4JO4L 3VXPB 4H0GA 1NGYA 5L2KD 1MJ7L 3B2UD 15C8L 1CT8B 4X7SH 4NRXA 1OGAD 5LCVL 5F9OL 2QQLL 3KDMB 2VJXA 4X5XB 2PYED 4Y4FD 5F3BA 4NHUA 1A1MA 5B38A 3K8MA 2ZUQC 5IBTH 2XIDA 4TSCL 3IF1A 2AEQL 3MXVH 5F7UA 2R0KH 3FRUA 2E6JA 1JZ5A 2LQRA 4UI2A 5D7JD 3RJQB 4I3SH 1WEJL 4NQCA 1JWUA 1U3YA 4N0YL 5E8NA 5J4MA 4O2EB 4NZUH 1MFDL 1VENA 3MGOB 4P5MA 5ESQA 4LVHC 3IRPX 5I9QC 2BVEA 1ZXQA 4ESKA 4NNPH 2GTZA 1HH9B 5D96C 2XFXA 4E5XA 4AQOA 4ETQA 4XP6H 4WU5A 3MUJA 4ZS6D 1CF8L 4I2XA 3SQOL 1IAIM 1WBZB 2FWOB 1IJ9A 5K33A 4JY4A 3KPLB 4L4JA 1NBYA 2BSED 4XWGL 4XP5H 4ERSL 3DVFA 3SN6N 5HYSB 1S7XA 3EYOB 3BQUC 2XA8L 4FZEH 4KK5D 5IB4B 3EDDA 1MH5B 3A6CH 2CK2A 5C0RL 3GSXA 1IM9D 3QDHA 1BFOB 3DURB 3KPNA 3DVNB 1F2QA 3BGAA 1ZT1A 1S9YB 1S8DB 3RZCB 3CNKA 2FZ3A 4U05A 5EZLA 1MCCA 3MRKA 3F7QA 5CEXA 4NN7B 5FB8B 4Q9BA 4UINL 4AEIH 5LGHH 2CDGB 3X3FH 2EIEA 4G43B 3RUGB 4Y1AB 2DYPD 4KI5F 1RURH 1XGPA 3C5JA 3W39B 3NPSB 3JWDC 1AO7B 4GT7A 3UPCA 3GHEL 1QSFD 4X99A 5C0EA 5D7LE 4JDZA 2VXSH 2Z31D 3FT3B 1A6TB 5E08L 4QRUA 3UDWA 5ACZA 32C2B 3TVMA 2HFTA 3G5ZB 4E0RB 3RVXC 2XWJB 3P9WB 1MREL 2EYRA 3MRHA 3SDCA 3QIBC 4UT7H 2GYSA 3LKOA 2QQKL 1GSMA 2OMNA 3PNWA 4YUEL 1MAKA 3OBAA 4MXVE 3GUTA 1UC6A 3GSUB 3WL9B 3CXDH 5BMFH 1SVCP 1KENL 3O3DA 4W6YB 1CDHA 4GQ9H 3TO4D 1MHPL 4L4TA 4JFEB 2YXMA 4OF0A 5JPNB 4XVJH 3SKJH 1OP5H 1RJCA 4R2GB 1KB9J 3ULSA 1FNFA 4FQ2L 1P7QD 3ET9F 1WZLA 5B22A 5JUEL 3ZYJA 5E24E 4DW2L 1P4IL 2HFFA 3LSOB 5CBEB 3D85A 5E8PA 4XH2A 3AU1B 4GG6A 1DBKL 1JPGB 2F53B 1E4WH 3MJ8A 1S7QB 3LEXB 1JTOA 1DBJL 3FOLA 2DQHH 5I75B 1AJ7H 3OJ2C 1JE6A 1QBML 1MJ8H 3VWKD 4TNVF 4FFYH 4ZMAT 1PYWA 3QHFH 2P8LB 2HLFD 1HN1A 2X4NB 5IOPA 1RZFL 2DQGL 2WP3O 2WP3T 4LKXA 3WNMA 4JFFD 2MQ3A 3ARQA 4JCLA 3AGVA 2Y9RT 4X8JB 1MLCB 1OTUD 5ADOH 4QXTA 3HG1A 5E9DB 5LWYL 1CXHA 4R9HA 2RQ8A 1LK3H 3BP6B 1CGSH 1Z5LA 5TH2A 1RZJC 2EDWA 1OSPH 4GRLB 3IDMA 5I1AB 4JKLA 4GAJH 1DL7H 2C4FT 4WEBH 5CIPB 3MJ8B 3GSNA 3DX8B 2R1XA 4NOBA 4QT5A 1I7ZB 3NABL 3K8LA 2DQJH 1JUFB 3VXSB 4NM8L 4PJXE 4PP1D 4GRLD 1AH1A 1CFTA 3JBG7 4LSTH 1C5CH 2G5BA 2NY3C 1CF8H 1PSKH 4D9QE 3BD3A 3TC9A 5JPNA 3VFRB 1YQ2A 3IT8D 2ZG1A 5CJOH 3W5NA 4BK5A 5IB5B 1YMHB 1XF1A 3W0WE 3KYNB 3W9DA 3IDXH 2QADB 3D2UB 5D96B 2D9CA 3VD3A 3CCHA 2I5YH 3HNTL 3GSUA 4DUVA 5MP6L 2P44B 2XPGA 4C58B 1TVBB 1XEDA 1N7ML 3O9WD 2W0LA 1KTDB 2F53E 2IBBA 2VDQL 1JF1A 3LKQA 5CUSH 4A6YL 4JO3H 5HHPB 2ZG2A 1ZMYA 1UCTA 2C4FU 2EICA 4NUJA 1IBGH 4LBEA 1L9MA 4OKDA 1AXIB 2IALB 4KDWA 1AP2B 4NGHH 2PTVA 5IB1B 5DC4B 3G5VB 4KQ4H 4M7JL 3PE9A 5K9KB 2HN7A 4P4RA 5D4QA 2VKWA 1AO7A 3QEGH 1RURL 3RRQA 4RGNE 4YBQD 2JF1A 4JFOA 5I71B 1H15A 3EKCA 4Y4FA 2IBZX 4JJ5A 4NRYA 4Z77A 4R2GD 2FNBA 3HMXH 4X6BB 5FDWB 3U4EB 4IRSB 3V4VL 5FHBH 1NSNL 4F8TA 2RIKA 1RUML 1KNOA 4PJCB 2PXYA 1B0RB 4D8PB 1QQDB 2VE6A 1YMMB 3OKDB 1UB6A 2MPAH 3GSQA 3RAJL 1DVFC 2EEAA 2K3TA 5DK2A 4OZHE 4TUOB 1INQB 4XBPA 3P77B 3OKDA 1D5ZB 3CDYA 4OLVL 4JJHA 4I2XB 4YAQA 2FJHA 4C59B 4K3DH 5CGYC 1BF2A 4I0PA 1EEZB 1NL0H 1RIUL 3H9YA 5D71H 2MQCA 3TO4A 1ETZB 4IRSA 1LK2B 3AVEA 3UO1L 1EZVY 3SPVB 2VL4A 1NCAH 3A6BH 4NYLA 5C0FB 1T0NA 2G75A 4OLXH 1MI5E 4C4KO 4TSCH 5LWYH 4MA8L 4ZD3H 5HI5C 4JO2L 1P4BL 4LBEB 2IQAA 3BXNA 3NACH 3UTOA 4PTTA 4NRXB 1TZIA 2Z31A 4EI6B 2DLEA 3G6JB 2W0FB 3QIUD 3LKNA 3SE9H 2P5EA 4JFQA 2RCSH 4P59H 1RMFL 3CX5K 3ZE0F 1GGUA 2WBJA 1NCWL 4XPAL 4XVTH 1Z3GH 3MRIB 3K2MC 5DT1H 1BEYH 1MFBH 3QO1B 1A6VL 1G6VK 2VLME 3FAXA 1NGXB 1ZV5A 3MLWL 4Z0BH 4ZAKA 3QIWB 5F71A 1DR9A 3I02A 1HHHA 4I18A 1BAFL 2P8MB 1ZWIB 2NW3A 4LLWA 1JI2A 4YXLL 3F7VA 1GOHA 4HUVB 2XTJD 4GRWE 4M6OL 1X5YA 3TN0B 3GK8H 5F7EH 1XGYL 2VLRE 1MJJB 4GRLA 5IFJB 5CJ8A 1A7PH 5I1LB 2ADJA 4HLZH 2BSRA 3SDXF 3D0LA 1JFQL 5GRJH 3RDTD 4Z7VF 1KYOK 1YUHA 3FQUA 2NX5B 3RWCB 5MEPB 5D72H 1BVLA 2NXZB 1UEMA 5HJ3A 2CDEB 3GNML 3LKPB 1T80A 5C3TA 1U8HA 1RULL 3LN5B 2KZ1B 3GHEH 1RZFH 1UXSB 1Z9SA 1RJYA 1FG2B 2DD8H 5GRVK 1FYTA 2ZCHH 3UP1A 2R0WH 1KPUA 3FO0L 1FG9C 2DQHL 5MHSD 4MB4A 4H88L 3G6DL 5F88A 1KENH 5MEQA 1PG7H 1QYGH 5K9JH 2X2YA 2YPVL 3S34H 5FXCH 1NMCC 1G9ML 1XZ0A 3MYJA 4S2SB 3A6CL 4U6YB 1Z3GL 2AEPH 3RVVD 3WFZA 5JORA 3F5WB 1JPTL 5IVXA 4GAGH 3TWCL 1AQDB 2VZOA 5DD3L 4CADB 4ONGH 3VFMA 5IJKA 4PREA 5T5FL 1G7IB 3DYOA 4U7MA 5FF6B 3F12B 2PUQT 1NFDA 3H9SD 4Y4HB 1YPZF 2VQ1B 4V2CB 3QH3A 4IRZH 4WHDA 3QP3A 5I74B 1C5DB 1JK8B 5DD1L 3QT2A 1KJVA 1YNKL 2XZAH 3G5ZA 2J1KA 5D1XD 5AD0A 1U92B 4Y16C 4KI5C 3IETA 4ZSOB 2HH0H 3S36X 2VDRH 4ENEC 4QXWA 1WAAA 2H8PA 2OJEB 4HK0B 2R2BA 5CZXD 1XGPB 2XTJC 2KQMA 1W0WA 4KRLB 4OCXL 4JO2H 4XZUA 2YD1A 4FMKA 3QEQD 4MA8H 5ERWA 3BISA 5D1ZC 4JFHE 1MAML 5EZLB 4OI8A 4BKLA 1T22A 4OQ1A 2XXCB 1DBAL 4XCCH 2JB5H 1TNNA 3MV9A 2OM5A 5E2UL 4YHNB 5F9WC 1A14L 2ZUVA 3V9FA 2OQJA 4NNPL 4PS4H 4M7KH 4X9IA 4MXWH 2F9BT 3WIIL 2HRPH 2E8YA 4Y4KD 3WD5L 1S7XB 3VXUA 4JO1L 5SWZD 3GGWB 1UH4A 4TSAL 3GO1L 4WI5A 1YY8A 3S3PA 3DETC 4OCYH 2NXYD 4X7CC 4G6MH 1YPZE 4Q9QH 3EJYC 3C5ZB 4OZGF 4PJ7A 4PJGF 1MSPA 5DHVH 5EA0H 3BEWA 1MWAL 5DI8A 4ZAKD 1JRHH 3L5JA 4NWUL 3NCFB 2ZUYA 3ZT6A 4R4NC 2MCPH 4CKVX 4KMTH 1NBQA 5M7QA 4RMVA 3NZ8B 3FB6A 3HUJE 2FR4B 4WGVB 3BGMA 1IC5L 1RJLB 1Z9LA 3C6LB 4R90H 3QI9D 4JPVL 3P9LB 4OSUL 3QXTA 4PJ8D 2FEDD 3FQUB 2NY4D 2ZKHH 4J8RB 4PD4J 4G8IB 4N9GB 3D0LB 3TP4A 4PJXA 1NGYB 5E6ID 3TT3L 2W9DH 5GRXG 2UZYB 1REIA 5F7HA 3EYFB 1AI1H 1VERA 4UUJA 4WFEE 1U8IB 4PRIB 1R3KA 5E2WH 2R4SH 1X5KA 3KLAB 4KY1L 5H35B 1RFDL 1A1OB 2MTPA 4PGZA 4V1DA 3FQNA 4BZYA 4H26A 4PRPD 4NQEE 2OK0H 4QYOA 1AGEB 5I1AA 1ZK9A 2YD4A 4KQ3H 2NW2B 3L3KA 2JK5A 4MNHA 1U8JB 4D9RD 1ZE3C 3HZYA 2NNAB 2HTKD 3H6JA 4Z9KB 3EYQD 3LEYH 3U30B 1XGTA 4N5UA 5JTWA 1INEH 5D7JA 4NQCD 1OQOA 1MVUB 3KXFD 3Q5TA 1NGQL 5DK0B 5E8OA 5CINH 4Z78B 1MCWW 3IFPA 1C5CL 2XXMB 5CFHA 5DJ6B 3VFUB 1ZT4B 4ZTOH 3C8KA 4OCMC 4S1RL 4CVZB 3QUML 1MIMH 2VZSA 4K2UL 2DM2A 3KPOA 2Z35B 4U1JB 2RFXB 5GS2D 4LKCB 2DF3A 1HOCB 1A3RH 3SGDH 1S9XB 2VLJE 1PLGH 4YDKL 4MLIA 2IQAB 3S36H 2QQNL 4WO4D 3PP3H 4EJ1C 1MJ8L 4MQXD 3OJDA 4YBHA 4XBGB 3CLFH 3SY0A 5BS0B 1KLGA 1T1YA 3PWPB 4KAQH 3VFVB 5IROA 5IB2B 4N0FB 1SY6L 2NY2D 3QJFA 3FRPA 2NTFA 5LAXB 4K94H 2XOTA 4PJ8B 4Y16B 3LMJL 1FYTD 3LHPL 3LS4H 5IIEB 1B2WL 1P4LB 5C0GA 1UB5B 4LEXL 1IGCH 4GAGL 3CZFA 3BPLB 2AV1B 3O0RH 1RUQH 5C8JA 2Y06H 4O58H 4XCFH 1UJ3A 5A43C 4F37K 1ZHNA 2XWJA 4OBRA 5F9DC 4JPIB 3FB7A 1RK1B 1Z0NA 3QDJE 4NBZB 3GSQB 4XCFL 4PFEA 4OLUH 4YHOH 3EOTH 1BOGB 4XBEH 4MAYC 5L7XH 3S35L 5JR1L 1KF9B 1NFIB 3GKWL 5B8CB 3SJVE 1UEYA 4FQXA 3VXUD 5D1QB 2DLIA 2CIKB 1RK0B 5DYOA 5EC1A 3KYAA 5JA9A 4OLYH 5HGHA 4AMKH 1ZHKA 1BPVA 1DE4B 5FHAH 4XI5C 3OG6B 5I73C 1MFAL 1N0XH 4ZUSA 3HHRB 4LHJB 4X6FA 3V5DA 5J12B 3AB0C 4OFIA 4QHKI 4W68A 5IB4A 4HHAA 3QQ3A 4PJ5B 2ATKA 1HSBA 4WTWA 1D7FA 3MUY1 2NTSP 5F3HB 1IKFH 1FLTX 4S1QL 4HFWB 1DLHB 3RIFK 3WHXB 3VGBA 1OP5K 4HX1A 1FORL 2XG4A 5IP4A 5JW4M 2HG5B 3UXFA 5JO5A 4XP5L 4LHUD 5A2LH 1GOGA 4N5ED 3MX0A 5DA0B 2CDFA 3EO9H 4PJ8A 4D9QD 3U7YL 3JV6A 1ZANH 1EHNA 2WM0A 3C60B 4K3JH 4UNVA 4XP6L 4M6ML 1A9EB 5C0CA 2G5BB 4RWHA 3ZE0E 3HI1B 3TPUB 3MACL 4Y4KA 3HI5H 5C0AD 2ZSWA 4X8XA 1J05B 1TFHA 3QPXL 4LLQB 5SWSA 5IJKC 1YJDL 3GSNB 4OI7A 5ENWB 3QCVH 4NDMA 5I1EH 2VERN 3OAYH 3RY6A 3LKRB 4JE4B 4ZFFA 1AC6A 1P7KB 4HAFA 4NGHL 4KHTH 1SYSA 1FC1A 1WUNT 5CEYB 1CR9L 3T3ME 4YPGA 4QOKD 1JL8A 5E9DA 1MJ7H 3BDBA 4M7ZB 2FLRT 3NPZB 4ODUA 1KJMA 4MCYA 4ZO9A 3ZDYF 1OSZA 1LE5A 5D1XC 2H32H 4GQPH 1YEGH 4LAQH 4W81A 1I3UA 5MI0B 5HDQL 5MP6H 1EO7A 4LCCC 1F4AA 2DM3A 1KB9K 4C83B 3MV8E 1NGPL 1XGQA 3QNZA 1C1EL 4JY6A 3BOVA 1NANI 1MCFA 4WW1A 5EC2A 3MROB 1FE8H 1DBMH 1F90L 5EUOF 1MUJA 3ARFC 1NAMA 3BZ4A 2JCCA 1TMCB 3TWCH 1SJXA 1YN6A 2WBJC 4LCYB 3UJIH 3HC3H 4HIHB 5FCUH 3ULUH 2EE2A 5IG7A 5I0ZA 4J1UB 1JJUA 3SHSA 3ZTJG 4CW1A 1MIEH 4LLDB 2WQRA 1K5NB 4R4BA 3LDBC 3WIIH 4KMQA 3A67H 1Q9LB 4L5FH 1ND0A 4U3XA 1TJIL 2X4QB 1EK3A 5F72S 5I17B 3BGMB 3V5KA 1CICD 4WI9A 1BZ9B 2OSLB 5MERB 2A9MH 5A1AA 4ALAL 2DIAA 2BVYA 3SE4A 5C08B 4X7EC 4K7FA 3CIQA 2P43B 3WIFB 1B90A 4RFEA 3OXSA 4PJ7B 4RMQA 1JWMA 4WW2F 5DR5H 2VLRA 1XR9B 5F7FA 5CSGA 1M05A 4XXCA 2LFGA 1T2QH 2DDQL 3QG6B 1YY8B 1U36A 3WHE0 4Z0XB 1G7JA 3WFHB 5I76B 2GITA 4DN3L 1FYTB 5D8JH 1LD9B 4G8GA 2GY7B 3V0VA 2CDGA 5GS1A 3MUZ1 4ISVB 2B2XL 5L0QB 3E8UH 1S9YA 1EJOH 4JRYA 5IT2H 2ICWA 2X7LA 3SGJC 5TE4L 5HJ3B 4EN3C 3GSXB 4ZODA 5BS0D 5BRZD 1JRHI 5CP3H 5KANG 3OB8A 1KYOJ 4PRIA 1FFOA 1H3PL 3GI9L 2DJ4A 3LHPH 3RVUC 2DMBA 5GZOC 4DQOH 3V0AC 1A7BA 4UTAH 1VA9A 4LEOB 3QG7L 4KKCC 5K93A 3MNVA 5I66A 3KWWA 4X7FC 3T4AB 4HWEL 1IFHL 3DV4A 4IDJL 1CQYA 2IH3B 3VFOA 5TQ2H 5TDOB 1JNLL 3BWAA 5BS0E 3C6LA 3RIAK 3F65A 1OB1A 4XB8A 4PLOB 2VLKE 4HGWA 3BZFA 5ALBL 3FQXB 4L8BA 5C6TL 1MCDA 2EC9U 1NGXA 4GXUM 2DQFA 3RWHB 3VFTB 3CXHJ 1IL1B 3QPQC 4ZG1A 2I26N 1GAFH 5F3BB 4YHPB 1FNGA 5LGHL 4Z18A 3ZYOA 4PRPB 2CRIA 5GGSA 2H9GA 1VESA 4DOHB 1JGDB 4RGOH 3VD5A 4JHBA 2FEEL 4FXKB 1XH3A 5BCAA 2WWKO 3MLUL 4PRPA 2IGFH 5C0ND 3O8XC 3QQ9D 5EO0A 2LU3A 3TBSB 1U8KA 3FCTA 3QZWA 3MLVL 1MCPL 1MCLA 1HHGB 2DMKA 5GJSL 4WNQA 4Z8FH 1EBAA 3MOQA 2EDYA 4LHUA 1GH7A 2OZ4L 4HGWB 3VXRB 5HY9B 2HJFA 1RZ8B 3KPRB 5BMFL 1QLFB 1T0MB 5C0CD 1X4XA 2OXHA 4M7LL 3WD5H 3VI4E 4HV8A 5HHXH 1JNHA 2R39A 1S5HA 5C1MB 2C3GA 5T1LA 5D2LB 1YNTB 4P4KD 3VXSE 3CH1A 2APWA 1T7WA 4JM2B 3T65A 3N1FC 4PLKD 3AXLB 1HKFA 3QNXA 1I9IH 3GKZA 3KHOA 2XRAH 5HPMA 3D0VA 4U49A 3B83A 1HNGA 4RX4A 3GMQA 4XPBH 1UB6B 4UIMA 4Q97A 2BNUA 4M7JH 1C5BL 4MHHG 2X44D 5IW3A 1MHEA 1RI8A 4JANB 3GMMB 4ZQKB 2ITDA 4F7TB 4LLAA 3TBSA 4KH2A 3FN9A 4DUXA 3CSYA 4JQXA 5EIIA 2VO5A 3IDIA 4OBSA 1FDLH 1S7SB 2O5YH 3OX8A 5T3XL 2OTUB 4NPYB 4R90L 4M7LT 3F5WA 1FLRL 3VXOA 2VZ3A 3O2DA 5CIPH 2R2EB 1HZHL 2WMPA 4OB5L 3T77B 2FX7H 1KTLB 2H9GB 3QEQB 3VJ6A 1XGUB 4U1IA 5ACMA 2ZUQB 4I77H 3VA2C 1EMTH 3ARDB 2WBJB 4H1LA 4Y19D 1IE5A 4MS8C 3Q1SL 4R0LC 3WEXB 5HHPA 3HMWH 3T77A 2HMID 4JHWH 4LNRB 1MI5D 2W59A 5IW6B 4XVUD 2VN4A 2D31B 4NM8H 1U8PA 4UBDD 2ICEB 4KJQD 1BX2B 1CE1H 4PRDB 5KS9E 4WO4A 4XP1L 1F3JA 4NRZA 3W9DB 2W1NA 4X0KA 4YHYB 1DL7L 2DBJA 1WITA 2W9LA 2GUOA 4UIMB 4GOSA 4PR5A 4M9PA 2A38A 4QHMA 1KEGH 1YDPB 2X42A 3LN9A 3GMPA 1IKNC 3QUZB 1I9JH 3NH7H 3FOMA 2FJFA 4PUBL 5DJAB 4G7YH 5FYKD 4LSQL 4PJAB 3T65B 3UPRB 1AGFB 2I25N 1F02I 1NAMB 4K8RH 5I19H 4P2QD 2D3VA 2IC2A 3DX8A 5EU6B 3TN0A 3ARYA 4MX7B 3MMEB 2FIKA 2BOBB 4WW1B 4F15B 2IAMA 5HBBA 1OHQA 1SVZA 3TV3H 3VXNB 3C6SB 1INQA 1RU9L 2IPTH 3SEPA 3QULB 4FRWA 3BWUC 4JREB 4LHUB 1FVDA 5KJRH 1X5IA 2Z8SA 5B39A 3CPLA 1MFNA 1K8DA 4ZNEA 1QQDA 2YN5A 3SDYH 1UM4L 1B0WA 1RZIA 1VHPA 4PJCA 4M3JA 4YFEA 4JFYA 3MJ7B 4KXZI 3BHBA 5JW4Q 4P5TB 2XICA 5IOPB 1Y6NR 1BZ7A 3MODL 4ZTPH 2GTWB 1G9NH 3BAEH 3GMOA 1L7IH 3OF6A 5AUMB 4BQBA 5DD3H 1WCBB 3TCLB 5I73B 3G6DH 1IGCL 4CN4A 4HUXA 5DF0A 1JGDA 4ORGA 3V5KB 1OW0A 4EVNB 3BP4B 2F53A 3LCYA 3C08L 2QSVA 3P0YL 4K23H 4Z8FL 5I17A 5HHQA 1FNGB 4Z7WF 4OZIE 2FB4H 3SCMC 3NCJL 1PZ5A 5DGQA 1GRWA 1LE9B 5F1SA 4DEPC 3P11H 2R23B 1A7RH 4JEGB 1E6OH 2DQCL 1A2YB 4J1UA 4MJ2A 3RDTA 3ZMRA 4PGDB 3SDAB 2XPGB 4P9HH 1NEZG 1UCBH 1SBBA 1D6VH 2HG5A 3W81A 2B8OT 2EDQA 5DMIH 4P46C 4ZUVA 4PJGB 3GUTB 1EFXA 3PDOB 5F3HA 4MNGA 5EZJA 2EDBA 5EBWB 1IC4L 5BV7L 5D72L 5AZEH 4A6YA 4KRNA 3VXRD 4S1RH 4HHAB 4PJ5A 1FVEA 5J8OA 4DZ8A 5D6CA 3PP4H 1L0YA 3DV6B 3IXAB 1F3DH 4LLVB 1Q72L 2HLAB 4X4ME 1OAXL 4JB9H 2X4OB 3OR6B 1FV1A 1KNOB 3G6AA 4YPGB 3IAQA 3T8XA 3QQ4A 4NFBA 4K23L 5DRNB 4JKMA 3S9DB 4GKNA 1LVEA 4AH2B 4HKXA 3D3VD 3QO0A 1FH5H 1FGNH 4PJDB 4RMSA 2E9IA 1H3PH 5LGKA 1OLZA 3G6AB 2FBJL 3SDXE 1C7TA 1G9NL 3BAEL 3HG1B 5EO9B 1RUAL 3G5VA 5ISZE 3B9KA 1ONQA 4LLMB 5E6YA 1S5IL 43CAB 2A9NH 4L8CA 4FXLA 4DZ8B 3WIFA 4DOHE 3CK0H 3KG5A 3WJLC 4ELKA 3EO1A 3BP5B 5JNYA 5J1SC 1EJ6A 1W8NA 3RVVC 3GRWA 1S7QA 4CU7A 2CKBH 3ECBA 3ZTNH 3TBTB 2OBGA 1HXYB 1S7VB 3NIFE 2D7QA 4X83A 1YN7A 5HYJD 1GGBH 5I19L 3NN8A 3I3BA 4Z76B 3H3PH 3GM0A 3WKML 3SDXA 4JKKA 1YEKH 1JZ4A 5EU7C 4I2XE 5BQ7B 2FIRT 5EA0L 5GGRA 4HIIA 1CFSB 1BIIB 1KIRB 3CFDA 5E00A 3O3DB 2ED9A 3EZ8A 4AEIL 4BZ1H 5J06A 4XPGH 3UO1H 4P2RE 4IIQB 3IRZA 5KW9H 3RKDD 1INEL 3D25A 4TVPE 5GRYA 1GC1L 1R3HA 1Q8MA 3T2NH 1QBAA 4QXGL 1FL6A 1CWVA 3H8NA 4LIQE 4R4ND 3QISA 1A14H 4LPVA 5DRWB 1BZ7B 4UT9H 3HC3L 5DRZA 3BZEA 3O9WB 4AENA 2GK0B 2VR5A 3ULUC 4LQ1A 3T1FA 1DUZA 3ILPA 5L8JB 2NXZC 2V2WA 3NFNB 4YQXH 5A40E 5F7DA 5DRZB 2IANB 1Q94A 3TA3B 5IM7A 3G5XB 1IBGL 1CIUA 5FM5M 1CYGA 4Y5VC 3VXNA 2ZCLL 3D9AL 4L4TD 2EDOA 1A4JB 1ORSB 1VACA 3U1SH 3TFKC 1B4RA 1N0XL 1MFAH 3FOLB 3HC0B 1G7PB 4CRPA 5EU6A 4D2NA 3BN3B 4NKOA 5DMKB 3L7EB 3QPQD 5DHXB 4Y4KB 1HI6B 1C5BH 2EECA 2DQGH 2Y4SA 1N4XL 3MRBB 4L4TE 2AJ3B 1C12B 1I4FB 5JW4N 1BGXL 2FYYA 4JO4H 3OB0H 4R7NB 2UVEA 1HH6B 4X0KB 2XWTA 1WSST 2EIZB 4AIZA 3F8UB 1ZLUK 1KCVH 4LVOC 3FO2B 1OAQH 4NO0D 1QBLL 3DRQA 1K4CB 5T1KA 1ZA6B 1T7XA 1P4IH 1FFRA 3ZSSA 1BFVL 2H32A 4Z6AT 3WNKA 2Z35A 5FDYA 2V5RA 1JV5B 2DN7A 1SM3H 2PCPB 3HUJF 1FH5L 4FFWD 2R9HD 5F9WB 1JWSA 3VJ6B 3FO0H 4L3AA 5EU6E 43C9B 1INDL 4HS8H 3BKML 1WBYB 2Q86A 1MCEA 1ZS8A 4BELD 1FAIL 1M6OB 2BNRE 2IPKB 3HPJA 4AH2A 1RIHH 3S34L 3U2SB 1GGIH 1U8JA 2OR9H 2Y07L 4QTIL 2IFFL 4GKOA 2CGRH 1ACYH 1KCSL 1S8DA 3RZCA 4QYOB 4LDOB 3AM8A 5BXFA 3QUXC 1BOGA 2BY2A 5CEZE 4LLVA 5DTFB 1H0DB 1XF5A 1JIBA 1URLA 4Q6YA 1AKJB 4YHZH 4CMMA 4MA1C 5HHOD 5D5MF 4MJIA 1DQQA 1E4XL 1NCTA 3KPPB 4J3OC 5TGBB 5DMIL 5ABDE 4X6CA 1CICA 3O3AA 1ZLSH 4ZS7H 3ARTA 2VKXA 3FFDB 1I85C 4HFUH 4HK0A 2ADIB 3IVKA 4Z7QF 3ARBD 43C9A 3JWDL 3BGFC 3O45A 4LMQI 4RRPA 4HV8B 4CU8A 2XN9A 3MLRL 4O02L 1HDMA 2NY5L 1WGOA 4OFDA 4X98B 3M8OL 5IMOB 1U92A 3NA9L 5FKPA 3U0PA 4YFDB 4PD4K 4RMTA 1C5DA 1JK8A 4KTEH 3KPRE 1A7OH 4YBQC 2R1WB 3JUZA 3R0NA 5DT1L 4KU1A 4TVPH 5A2FA 5FEBA 4YXKH 5FCUL 3DRQB 3MYZA 3ULUL 3GI9H 1NLBH 4K3EL 1N8ZA 3JV4A 1U8MB 1MHPH 3SBWA 2BZDA 3C5ZA 5EUOB 4WJ5A 3KDMA 5K9QG 4OCWL 1QTYT 4MJ4A 2C3WA 5HGDA 2B1AL 2EDRA 3VWKC 4X4XB 3WKNA 2AJSL 3BO8B 1MFBL 1MY7A 2NY1C 1WCBA 3TCLA 1R5IB 4V1DE 2NY2C 3VXUB 4I48A 1QFOA 2YHGA 1H5BB 2CSPA 3B2VL 2FH6A 3TNNA 3CMOL 4X7TB 5IW1A 1HXMB 1VEOA 1N59B 5C0IB 5GHWH 4CMHB 2DQFB 4J4PC 1NCAL 4P49A 3TPKA 2IFFH 3HPLA 4YDKH 2R1WA 3MREB 4BKLB 2NY0B 1BQUA 1QFWI 1XCTA 5FYJD 3H9SE 3M17A 3KNBA 4JFDD 4ZOAA 1UKQA 5J6HA 1BFTA 5IMOA 1T2XA 1T20B 2P4AB 3HFML 3I50H 3ROOA 3IJSB 1QR1B 4R4FH 3EOBA 3IVKB 1IGMH 5LXGH 3SKOA 1YUHB 3N85L 3H3BC 2WUCH 4UT9L 4WI8A 2IPUK 5KSBB 1U8IA 25C8L 3KPTA 1F3RB 5DC0A 3A67L 3RNQB 2EKSA 5CJXC 5EO1A 3M07A 3FQRA 4PJXB 4XVSH 4PJHA 1KCKA 4LCWE 4CL7A 1FNLA 1NFDB 1QPPA 4N0YH 1ZANL 3WLBB 4LPUA 4Y4FC 5FYKH 3ZKXC 5KSBE 2H1PH 4ODHL 1ZT7B 3HCVA 4WO4B 3RGVA 4PJDE 4HUVA 3CFKB 1ED3B 5AAWA 2VC2L 3TT1L 1IAIL 4HKBB 4ONHB 2F54E 1CFSA 2MMXA 4NQDB 1FFPB 1HINL 3SOBL 1LD9A 1YMME 3TA3D 2Q20A 4M1GL 4U1GB 4M00A 4Z0XA 2Q86B 1OP3H 5HYIA 2YPLA 4PRHA 4ZSOE 5I18H 1AR2A 1YEGL 4LAQL 2B7DT 4JPWL 1G1YA 5EORL 2P7TB 1J1PH 5F1NA 5C08A 4OLYL 3MBEA 4G6JH 5F97E 5CEZH 4ZXBA 4ZXBC 3C60C 2VDKL 1DJSA 1RJYB 3MRJA 1AXTL 2GJZA 5GISH 3HNVL 2AVGA 5EIIB 2X4TB 4GG6F 5EU5B 2A74B 2DMCA 1MRDH 1BQLH 2AJZB 1T89A 3BZDA 3O3BA 3MA9L 3H9HB 3MRRB 1MCWM 4I18C 5I8OL 1X5XA 4K55A 2XG5A 1T21A 5JW3L 3GI8H 4C4KT 4L9DA 1G9MH 2VLMD 4JGJA 1GC1H 3C9NB 1YN6B 1BLNA 4FXGB 3T8XB 3BUYA 1EEZA 3VFNA 4BQ6A 3O0RL 1WAAE 2Z31C 3CH1B 2YUZA 4HG4J 1IGIH 5JQHC 5A3IC 5F96L 1UZ8B 3GRWH 1TZHA 4HGKC 3L3GA 3DV6A 4KGLA 5E03A 5SWQB 4KKLD 1DBAH 4XCCL 1XGQB 3FAWA 2I24N 3AB0B 3G6JF 5HY9A 3G5XA 5TPWH 1ZWIA 2NW3B 4MZ2A 4OFPA 4YFLF 5LGJA 1ZTXL 2VXTL 5JQ6L 1Q9OB 2A73A 4YHZL 5J3HD 4NO0B 4JFZH 2VE6B 1VKXA 3VI3F 2BNRD 3ULVL 3CJJA 4PRNB 4WV1C 3C5ZD 1U8KB 4JFDE 5CUSL 2NYYC 2PO6D 4FFYL 2VXVH 3ZLQC 3O4LE 3NGBB 4ODWA 1E6JL 5JORB 2FSEB 5ADOL 4EI6A 2D7NA 2L7UA 3K1KC 4UMGA 3ES6B 1GGYA 3ZE1E 1JWSB 5B21A 4EXKA 3QHFL 2VLJD 1QRNA 5L2KE 1U0QA 4OCRH 2DQTH 1IQWH 1F2XK 2ZPKL 1LO0L 1S3KL 4HJGB 1P9MC 2YK1L 3KPSD 1FNSL 4TNVK 1RHHA 3WIHL 3NN8B 1OP9A 2IAND 3MRGA 2Q8BH 3RBGA 4JFEE 4GLRI 1KV3A 5DJXB 2GHWB 5EOCJ 4UTAL 3VW3H 3PWUA 4LRNH 3HI6L 2ESVA 1I4FA 4I4WB 4LQFL 4KZEL 2C5DC 4H88H 1XF2B 2DWDA 4RGMB 4XBPB 4OZHF 5EU4B 3VG9C 5GZOD 2BSRB 4MYWB 2R0ZH 3H0TB 3MODH 1DBBH 2YWZA 4JAMB 4MS8D 3PWNA 3OJMB 3EJJX 5TDPB 1K3IA 1K4DB 2KDGA 2RAMA 4NWTL 5EOTA 4K3GA 4L29B 4IJ3C 2OI9B 4YO0A 1X5GA 2CQVA 4QWWC 4G8EB 2FHBA 2BCKA 1QRNE 1A7QL 3QWOA 5DDHA 1IC5H 5F9JA 1DDHB 4ZUUA 1BD2B 2VUYA 4G8GB 2FGWH 5DXWA 4KZDH 4O51B 1A7PL 5ETUB 2DWDB 4HWZB 5IHZB 4OUOA 3NFNA 3O4OB 4YHMH 3CDCA 3PWUB 4L8DB 3JVGA 5HYQB 2HLAA 5ESVB 3DGGB 3HNSH 2Q7YB 4PRAA 4NKMA 1QSVA 5CSBA 5D6CB 2Q7NA 3MLXH 1NCBH 3FB7B 1FN4B 2NXYC 4Q9CA 5IVOA 4U1SB 5CS7A 2YZ1A 4FQCL 5FYKL 3ARGA 4ZYKA 3GMLB 3VMOA 4ZTPL 1QHOA 4U4BA 1EFXB 2G5RA 1UACL 2H45A 3BKYH 3BXNB 1P4LA 5H37H 5DVOA 4X4YB 4XNUH 2LU7A 2NY6C 2M8XA 4ZFOL 3C5ZC 3FTGA 2HT3C 2XA8H 4DGVH 2QQKH 3UTTA 3LOWA 3HLAA 1KCUH 5IF0B 4G9DB 2Z91A 4Q9RH 5IK3A 3QUZD 4FP8L 2J6EH 2QR0B 3HE6B 5CZVL 1OWWA 2I9LA 1L7TH 5D7IA 4G5ZH 1GGBL 4DVRH 4EUPG 4FTVA 4XPHL 5CZXC 2JCCB 4FA8A 1KUMA 5MEOA 4CN1A 4OM1L 4QT5B 1KTRL 1MQ8A 4M43L 3WNOA 1NGWA 4GFTB 2XTJB 5T3XD 2CKBL 4HJ0C 4PUBH 1DTUA 4OLXL 1MPAL 4J12A 4JPWH 3N0PB 1JHLH 1AHWA 4PRIE 1FDLL 4JQXC 3QNXB 1MEXL 5CLWA 4PJIF 1R3JB 4U3HA 3W9EB 3L3GB 3MLZH 3T1WA 4LLMA 5I6XC 1RZIB 5DEZA 2FRGP 1V3LA 4JDZB 1I3GH 4Z78A 1K8DB 2FO1A 5BVPH 5E8OB 4H5SB 4P9MH 4D3CH 1QKZH 4Y1AA 5D7JB 2XV6B 3GSNH 3QULA 4FN0A 4LCIL 2IMMA 4OZFG 2NNAA 3QYCA 4NC1E 3UYRL 2F15A 1ZT1B 4JKPL 1CI5A 5ENWA 2MPAL 3PIQB 5FUZL 2A6DB 3RVWD 4M7KL 5IGXL 4J4PD 1A7OL 4JO1H 3T2PA 1Y6MR 1ZSDB 2VLJA 1U8LB 1AP2A 4CBPA 4LCWB 1OSPL 1K3ZA 3DX7B 1U8OB 3HTLX 1RUMH 1CVSC 4NQUA 1YPZB 4AM0A 4F7CB 5GGVH 3PWLA 1LO3L 2ZCKH 1BJ1H 1U93B 4EEEA 4HULB 3WO4C 4MNGB 4L4TB 1D5XA 3KS0J 2X4PA 5FIEA 4D0CA 1NUFA 3K4DA 5KS9F 3VE0A 4LNVA 1KJ3H 2IAMD 5IBLC 1U41A 4P9HL 4PGDA 3FB6B 1DLHA 1A7NH 2ERJC 1I1RA 3IXTB 3PWVA 5KVGH 5GRJL 5IVXE 2YZ8A 3S35H 4ODSL 5E70A 1J0IA 1G84A 4UZGA 2BP3A 5CD3B 1DFBL 4AMKL 4F37F 4QY8B 2FEEI 5D5MA 1W72H 2DL2A 4WI6A 1JUFA 5CBAA 4H8WC 4HUKB 4MMZC 4QRUB 1TQCB 3BPOB 4QRSB 4XT1C 2VABB 3RVTD 3EFFA 4R97B 1T03H 1T04A 1WZMA 2X70A 4XPTL 1PEWA 3W39A 2DLHA 4LSRL 1J0ZA 4OZGE 4DKDC 3U82B 4GG6E 1T1ZA 4DJMA 3PWLB 4OKVA 4PLNC 4IRJD 3SJVB 5I1JH 5ID1A 3MSPA 1J11A 3LB6C 1I9RH 5HYSG 4F7MB 3CXDL 4FHBD 2BMKA 5GJSH 5KSAD 3QDME 5EIVA 1KXVC 2CR6A 3SKNB 5TF0A 4LSRH 1R24B 4NZJA 4FQJH 1FVDB 1NCWH 1OAXH 3I6KB 4ISVA 5FGRA 2DJUA 4MA3A 3O4LB 3U36A 5JHDD 4U1NB 3QIUC 4NFCA 4M48L 4Y4HC 3V6OC 2AJUL 5GRZA 3HPLB 4LVNC 5EB9A 5I1DB 1A9BB 4TSBH 3S37L 2JTDA 2GW5A 1LP9A 3L3JB 4JFXB 1XR9A 4M1DH 4OZGA 4PJ7F 4Y2DA 4Y19B 1X7QA 2P8PA 3SE8L 3TNNB 4XX1E 2HFFB 5LBSH 2WW8A 4M1DL 1KJVB 2Z8WC 5ID0B 3QUZC 1I8IA 3DTXB 5J0BA 4KKAD 4U2YA 2VQ1A 1QNZH 4HZLA 4WUUD 3IJHA 1T2QL 3MOBH 5BRZB 4P5KB 2WUBL 3FRUB 1Q9KB 4BH8B 4TPRH 3KYMB 4O4YH 3ULUF 2HYMA 3E6HA 3JV0A 1TITA 3MRJB 1CGVA 4CVXB 4BZ2H 4YHLL 2J12B 1U95A 4LAJH 2EYRB 1HHJB 3E1F1 3HE7C 3LV3B 3HRZB 5KVMC 3Q1SH 4GQ9L 3O11A 1DUYB 3E3QE 1Y18A 1P84J 3GJFB 1J0KA 5H37G 4OF8A 5IFHH 1I75A 1XGUA 2LAGB 3HUJA 1A8JH 4Y2OA 3RWHA 4EDXA 4FQIL 1UZ6F 4HW6A 4GS7B 4ZNCD 3P73A 4WHCA 5EU7E 4C83A 3TIEB 5TGBA 4MD5A 2QJDA 5GRUH 2NYYD 3CLEH 4J6RL 1KJ2L 4GMSH 1R0AL 1YECH 1A7NL 3LKPA 2MCPL 2H6PB 4BQ8A 5TE6H 2DWEB 3RY5A 3VXQB 4D0DA 1UVQA 2J3SA 4XPHH 3QEHA 4GMSL 4TVPD 2YUVA 3AS3A 3HS0B 1AGCB 3QFJE 5HYSA 1A21A 1ZLVK 1VEMA 4RMRA 3EOAA 3QCVL 4J8RA 3FT4B 3ULUE 4PJAF 3B4NA 4GW1B 4XI5D 1J8HE 2N7AA 5I30H 3RKDC 4YC2B 3RWGA 2DLFH 4QRSA 4AJ0A 3PDDA 5C7XH 4DUWA 1EEUA 3DO7B 1QZ1A 2EYTA 5IKCB 4FABH 3MC0A 3BPCB 4HC1H 4NHCL 1UACH 4OD3H 2W9EL 2NY1B 4FQLH 2Q76B 1KB5H 1VPOH 1HHHB 4I18B 1L0QA 3MREA 3U46B 1XF2A 3IXTA 3PWVB 5FYJL 5D1XA 5H94B 1N26A 2ESVD 4CGTA 1ZGLB 5IW1B 3U30C 4I0CC 5EG6C 2VSCA 2N7BA 1QLRA 4KHXH 3RJDA 4KVCH 4NKQB 3NCBB 3ZZ1A 3MRGB 4RZCA 5BZWA 2FL5A 3QA3B 2P5EB 4JFQB 4I77L 4PJEE 3WO4B 4OF3A 5DJZB 4OCSH 1ROWA 3OGCB 3VXPA 1H3GA 1CXFA 3UMTA 2AABH 3MCLH 2AV7A 4UU9B 5T3XH 3QHZL 4HPYH 4JLRB 3LS5H 4JQIH 1FGVL 2AXFA