2CH9A

Crystal structure of dimeric human cystatin f
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
TCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN F
publication title Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
pubmed doi rcsb
molecule tags Inhibitor
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ch9A01
4N6NB 1FA3A 1LXEA 1NB3I 5ELUA 1M9GA 4ZM8A 4CCVA 1MOLA 1EQKA 2OCTA 1G96A 1IV9A 3GAXA 1ROAA 1FUWA 3SVAA 1A67A 3S67A 1NB5I 1RN7A 2BO9B 3KSED 5LC6A 1IV7A 3PS8A 3PYJA 2O9UX 1KWIA 3UL6A 1DVCA 1GD3A 3LH4A 1CEWI 3Q2PA 1WNHA 3QRDA 4LZIA 1CYUA 4EYCA 1PFPA 3NX0A 5ELJA 4N6UA 4N6V0 1TIJA 1N9JA 3PXMA 3KFQC 5EQLA 4N6OB 3MWZA 3UL5A 4N6TA 1GD4A 4N6MA 2KXGA 1STFI 2CH9A 3IMAB 1DVDA 4IT7A 5A0OB 1N5PA 2W9PA 2W9QA 5LC7A 3L0RA 4N6LA 1N5HA 1YVBI 3K9MC 4TX4A 1A90A 1MNLA 1R4CA 1CYVA
chains in the Genus database with same CATH superfamily
4RZMA 2GU1A 3MSOA 1KQS2 1IQXA 2F56A 5KP4A 1GOYA 4ORLA 3UJMA 3BLZA 1K28A 1OHPA 2HMMB 3LTAA 4R9KA 5ELUA 1RGCA 3BNDA 3CCS3 1A2VA 3FG1A 4MJDA 3V92A 2UGIA 3SX1A 2HMLB 3OX9A 4J8TA 3U1WA 4MEIA 4R9LA 4ZM8A 4G1MB 1O7WB 4XBXA 1VQ93 4FCJA 1BNFA 1MOLA 3CC43 3DMCA 1UCKA 3SOYA 4XB5A 1RGKA 3Q3FA 5BVBA 1DYUA 1MWRA 3FG3A 1RCKA 1BSBA 1I2GA 3GAXA 3WA3A 3GZXB 1U8CB 1YNVX 3EJVA 3F14A 3EHCA 3S28A 2W56A 4RNYA 3I553 1IDPA 1X1WA 1DETA 2BO9B 2RGQA 5STDA 3CCQ3 4FMDA 3CME3 5LC6A 1IV7A 1NU3A 2LQVA 2Y74A 4WYKB 4BIRA 1F8NA 4LMIA 3PYJA 3WODG 3JUPA 1LOVA 5AEWB 9RNTA 3WA2X 3DGNA 3NUVA 1Q7HA 2YFJB 3GSPA 1IQYA 8CHOA 4OK0A 1BNJA 3M8CA 2CW9A 3MKIA 1WMPA 1W6CA 1BRIA 4WYKA 1S5AA 5AYSC 1N9EA 1IYYA 1K9M4 3V98A 4LZIA 1CYUA 3X3YA 1EUIC 4J5GA 3NX0A 1K41A 2OTL3 3DM8A 3S29A 1RDSA 1KSIA 1RGHA 3NBBA 3PCSA 1TIJA 4N6V0 4XBYA 3S5CA 1UW1A 1OF5A 2HMJB 3KFQC 3X40A 2BIRA 3T8NA 4HM4B 2CHCA 2HMOB 1YIJ3 5AI1A 1Q40B 1UDII 5CK6A 4GSPA 3CC23 1IVUA 4XBTA 4N6TA 5DRVA 3DH2A 3KSPA 1Q814 5CXOA 6RNTA 2XEPA 4R80A 3IMAB 3G6E3 4CJNA 3NQYA 1BRNL 1X1UA 3S27A 2OOVA 1W6YA 1YJN3 1DVDA 3A76A 1EG9B 1A2PA 1UUGB 2FXTA 1B2UA 1BVIA 3F9SA 3LZAA 3LOYA 1OH0A 3RGRA 1BRHA 2FGTA 1RHLA 2UUGC 4QWTA 1SQWA 1ULIB 2W2CA 3OW22 4H61A 3PCRA 1B3SA 4LGQA 5HGRA 2Z77A 1I3FA 1JBRA 5AIHA 1BU4A 1WTHA 2CG1A 1I8VA 3KN4A 1IT7A 4FR9A 3NV0B 4NHFA 1TRPA 4K1VA 2IYJA 1I0VA 1HU9A 3OWSA 1IK3A 1FW7A 1BGSA 3NBJA 4FMAA 1RN1A 5GSPA 2QIYA 1AVKA 1LRAA 4OUQA 3AMOB 1NJI4 3Q1CA 1N8QA 1Q9EA 2XRXB 1VQ53 3NV0A 2F4YA 2H0IA 1A90A 2Z6BA 1VQ63 2XF3A 1ZO2A 2E2VA 3DY5A 5AIIA 4U13A 6GSPA 1M904 3ZFZA 1CYVA 4MMZB 3FKAA 1OHSA 4K90B 4N6NB 3SEDA 2XGNA 2J8XB 4GL6A 4HM6B 2B24B 4K1UA 3VF1A 5IERA 1JJ22 2F99A 4L8OA 1RSNA 4NPBA 2PZVA 5G1KA 3WDGB 1LQMB 5JPPA 1MGWA 3PZWA 1GMQA 1TUHA 1JKGA 3G16A 2CFLA 5IF6A 3LT9A 4CCVA 2RCDA 2SARA 4AEQA 2Y73A 1EQKA 2OCTA 3D5GA 1RGEA 3AGOA 3NQZA 4BU4A 1G96A 4BTWA 3J7Yd 2IY2A 3FCSB 4FMBA 3EB8A 1NNVA 4I5QA 3JUMA 2E2TA 4HVNA 2CX0A 1GMRA 1ROAA 1FUWA 2L1SA 3SVAA 1FUTA 2WGQA 3S67A 1BRJA 2XR8B 1FGRA 1RLSA 1NB5I 1OHOA 5IG0A 4BTXA 1DMQA 3KSED 5M1AA 1GS3A 2F86B 5I97A 1JNQA 1YHQ3 5AIFA 1BRSA 3MPHA 3CCE3 1Q824 1IQ8A 1TFOA 2O9UX 2WOHA 1RRLA 3JUOA 4FCZA 1B20A 3WMDA 3X42A 4HOHA 1T2HA 1T3BA 2GXFA 4J9AA 2W56B 3EC9A 1DVCA 2KF6A 4XDWA 3LH4A 1PY3A 4FCMA 3CMA3 4HKVB 2BMQB 4XDVA 1STDA 2CIUA 1B27A 1ULJB 2CC3A 1AR0A 3QRDA 5D83A 5TGNA 1BSAA 1FUSA 1RJOA 1WMNA 4EYCA 3NM2A 3NBRA 2D42A 1B2SA 3EN1B 3A5EA 2R41A 1ROVA 2XFSA 3E99A 2AADA 3X3ZA 5M19A 2ZHXB 3KIIA 1VQ43 4N6OB 1JB2A 2C10A 3FF0A 3G0KA 4HM0B 1N8R4 3HIGA 3UNLA 3LTCA 2XH9A 2OQEC 2W03A 1C7HA 3CCL3 1Q42A 4X2OA 3SXXA 2RSXA 5FGOA 5IG3A 3ECFA 5JBSA 2O3OA 1RTUA 2CWVA 1GOUA 2KXGA 4PEJA 4STDA 3F7SA 1BSDA 2HMNB 1OF5B 3LXUX 1RGFA 2OQEA 1GOVA 4I4KA 1E3RA 2F98A 4JF8A 5A0OB 2CFDA 3WHOA 1J2BA 2P38A 1I0XA 3EBTA 3LT8A 3BU4A 1Q7Y4 1K8A4 1V58A 2BMOB 1LNIA 2RBIA 3HI7A 1SJWA 4O2HA 3T0UA 2IMJA 1B2XA 2W9QA 1U5OA 3D79A 5LC7A 3UB1A 1BUQA 3D4AA 3HX8A 7GSPA 6STDA 1O7NB 3G8ZA 2BU4A 3FZWA 3L0RA 4HYZA 3ZG5A 3NHXA 2JDIH 1L5GB 1VQP3 1V74A 1RGAA 1ASKA 2OOVC 2BT3A 2YX9A 5G2GA 1QJGA 3DGLA 3N9HA 3AHSA 3IPTA 3X3XA 4O8SA 1BSEA 2CFGA 1AQZA 1YVBI 3D9RA 3K63A 2B1XB 4HZ9B 3VSYA 2ZL8A 3JUQA 3WOFB 3LYGA 1GSPA 1IVVA 3FH1A 4HM8B 1YGWA 1I2FA 3ALAA 5BXQA 2MF7A 5CLKA 2W6JH 1M1XB 3OWYA 3ZG0A 1R4CA 1C54A 1JB5A 1W01A 1V57A 1HKXA 1QAKA 1W00A 1WQLB 5KP3A 3B7CA 2C4BA 3BIRA 2HOHA 3BB9A 1NB3I 2YFIB 3LTBA 4EV2A 1AY7A 2CG0A 1VQ73 2HMKB 2Z76A 1O7GB 3G713 3EX9A 3NM7A 1UI8A 3RNTA 1B2MA 1O7PB 4AKZA 1UCLA 2L4VA 4RNTA 3CPW2 3RDEA 5IG4A 1IV9A 3AGNA 3MG2A 2MC8A 1OGXA 3U97A 1Z1SA 1JKGB 3JVCA 4KFDA 5AIGA 3OWUA 3N8BA 4HBRA 2CX1A 2KF3A 1RN7A 3GZRA 1DMNA 1MGRA 1SIHA 3RGAA 2OWPA 2QA43 1FYSA 2QEX3 3GZYB 2K54A 1BOXA 1RMSA 3BNEA 3PS8A 2PNCA 2UX0A 1BIRA 1GYBA 1VQQA 2P0MA 2W0QA 3B4PA 3AHWA 3UL6A 1TJDA 2GBXB 4RNZA 3SYUA 1B2ZA 3CCM3 1GY7A 4NREA 1US1A 4EW5A 1FA3A 1JBSA 1CEWI 2ZDJA 3F40A 4WP5A 1I2EA 1O7MB 1WNHA 3KCHA 1VQ83 1FGOA 2ML5A 4K61A 1GMPA 1EKMA 3CCU3 1QVF2 3CNXA 1PFPA 4L8PA 3FGYA 3HZPA 4EBGA 2F5MA 2GU3A 1RKYA 2Q07A 1W6GA 4N6UA 3SOAA 2E2UA 1I3IA 1N9JA 1TP6A 1DMMA 2XGLA 1FGMA 3PXMA 1IT8A 5M18A 1VQM3 3CD63 2CK3H 5BU4A 1BRGA 1D6YA 3SLUA 3DGOA 1BNGA 1JV2B 4OVMA 3FLJA 3UL5A 1CH0A 2IUJA 4N6MA 4HZBB 1PYLA 1STFI 2CH9A 2W04A 3NXJA 1YVSA 1M1K4 1IVXA 1UCIA 3CCV3 2A15A 3DUKA 1WMOA 1OUNA 3EN8A 1O7HB 1HZ1A 3EF8A 1N5PA 4X2HA 2CFWA 2CFKA 3DXOA 2W9PA 1UI7A 2KRTA 1K734 1DE3A 1B21A 4N3VA 2QGUA 3QK9A 3K5TA 1VQO3 2XSOB 1KC84 4LYLB 3FSDA 2GSPA 1LNHA 1W4NA 2M7OA 4N6LA 4CPKA 5JPUA 1MWSA 3EE1A 3ER7A 5DREA 4JRFA 8RNTA 1QVG2 3LTDA 3EQQB 3H51A 4R4KA 3WOEB 1GY6A 4Q53A 3F8HA 1BAOA 4HM5B 3K9MC 3T8UA 3URPA 3GWRA 1AV4A 1BNIA 1CQSA 1D6ZA 2BMRB 3CC73 1MNLA 1YJ93 5G1LA 1JB4A 2XFTA 4AKYA 1YJW3 3N54B 1QMAA 5CF1A 2RNTA 1FGTA 1TTOA 5AEUB 2ZA4A 2P0XA 3CU3A 4KT3B 1W02A 3BNBA 1LXEA 2H0GA 1OCVA 1R4YA 3EBYA 1BNRA 1OPYA 1EA2A 1M9GA 3OV4A 3OXAA 4R1KA 4EV5A 1S723 1T2IA 3JUNA 3DGYA 1ISKA 1G02A 2BNGA 1ZGXA 5IEOA 2GEYA 2XSHB 4FMCA 3VGNA 1KD14 3V99A 4LSOA 1YIT3 1IVWA 1GY5A 4O02B 3H3HA 4GHOA 1LOWA 3DGMA 1UGIA 1E97A 5AYRB 5CF2A 3IJEB 1A67A 4WWUC 3KZTA 1QALA 1SIIA 3D5IA 1LQGC 3KKGA 1A2KA 1UUWB 1VQK3 1ZX2A 1FGQA 4RBNA 3MHEA 4BL2A 3HOHA 3CXC2 3DZLA 1JN5B 2D1WA 2R4IA 3MYTA 5IENA 5HOHA 2K0MA 1KWIA 4HAAA 7RNTA 3FF2A 3F7XA 4IIAA 1BUJA 2P09A 2ML6A 1QAFA 1GD3A 1RNTA 4KFFA 3Q2PA 4BTYA 3B8LA 4HM3B 2RFRA 1HYFA 1JN5A 2INXA 4H3UA 4HM2B 4KVHA 1BNSA 1VQN3 1RGGA 1SARA 1LOYA 3STDA 4BL3A 2KCDA 1TU5A 1YI23 2KF4A 2GBWB 4KZ1A 5FW5A 3D3LA 1Q40A 1JZDA 1JZOA 1NO3A 1BANA 4J5KA 2WOFA 1MWTA 1JBTA 1UCJA 3HIIA 1YGEA 5ELJA 2F5WA 1MWUA 4WFOA 1LVNA 5IEPA 2CKFB 4XM4A 1NWWA 1NDOB 3FG4A 1OACA 1BSCA 2CWTA 5EQLA 1OGZA 4CDLA 1UGHI 5EVHA 1AVLA 5RNTA 2C11A 1X1XA 1ZS7A 1RGLA 2AAEA 2I9WA 5KP1A 3KE7A 3MWZA 4EC6A 4IPBA 2FNQA 1W2ZA 1GD4A 5BIRA 1W2B2 1SPUA 2IUKA 3CPOA 3GZBA 3K7CA 3I563 2Z7AA 3I0YA 1D6UA 1Y4KA 3LMLA 1IU7A 2GEXA 3WR2A 4ILFA 2OTJ3 3HK4A 4IT7A 3TDGA 4DKIA 1EEJA 1LOXA 4HM1B 2IA7A 2JQ5A 2KAAA 2LYXA 3X41A 3F8XA 2K3DA 3MG3A 4GB5A 4O3VA 3B4OA 2H0HA 2WGOA 3K0ZA 5EEOA 1T5YA 1VQL3 5IG5A 3AMOA 4EXRA 1I70A 4MMXB 3GRDA 2SBLA 3CCJ3 4WHAA 3O8YA 2KF5A 4MMYB 1PU4A 1FZUA 1VZZA 1N5HA 3Q90A 1W7CA 5D82A 1X1YA 7STDA 1E3VA 4KFEA 3CNMA 1G0TA 1BNEA 1RN4A 1TRQA 3ROBA 1RNBA 3BNCA 1RCLA 3CCR3 1UUVB 2WO0A 1BRKA 2STDA 4HJLB 4L7KA 4TX4A 5D81A 4HM7B 3PGBA 2P05A 3G4S3 3MG1A 1JRQA 2YFLB 5IW9A 2BHMA 1RRHA 2CWUA 4LEHA 1TFKA 1Q864 1W5ZA 2V1LA
chains in the Genus database with same CATH topology
4RZMA 2GU1A 3MSOA 1KQS2 1IQXA 5KP4A 4ORLA 3UJMA 3BLZA 1K28A 1OHPA 2HMMB 3LTAA 4R9KA 5ELUA 3BNDA 3CCS3 1A2VA 3FG1A 4MJDA 3V92A 3SX1A 2HMLB 3OX9A 4J8TA 3U1WA 4MEIA 4R9LA 4ZM8A 4G1MB 1O7WB 4XBXA 1VQ93 4FCJA 1MOLA 3CC43 3DMCA 3SOYA 4XB5A 5BVBA 1DYUA 3FG3A 3WA3A 3GAXA 3GZXB 1U8CB 3EJVA 3F14A 3EHCA 3S28A 2W56A 4RNYA 3I553 1IDPA 2BO9B 2RGQA 5STDA 3CCQ3 4FMDA 3CME3 5LC6A 1IV7A 1NU3A 2LQVA 2Y74A 4WYKB 5AEWB 1F8NA 4LMIA 3PYJA 3WODG 3JUPA 3WA2X 3DGNA 3NUVA 2YFJB 1IQYA 8CHOA 4OK0A 3M8CA 2CW9A 3MKIA 1WMPA 1W6CA 4WYKA 1S5AA 5AYSC 1N9EA 1K9M4 3V98A 4LZIA 1CYUA 3X3YA 3NX0A 1K41A 2OTL3 3DM8A 3S29A 1KSIA 3NBBA 3PCSA 1TIJA 4N6V0 4XBYA 3S5CA 1UW1A 1OF5A 2HMJB 3KFQC 3X40A 3T8NA 4HM4B 2CHCA 2HMOB 1YIJ3 5AI1A 1Q40B 5CK6A 3CC23 1IVUA 4XBTA 4N6TA 5DRVA 3KSPA 1Q814 5CXOA 2XEPA 4R80A 3IMAB 3G6E3 3NQYA 3S27A 2OOVA 1W6YA 1YJN3 1DVDA 3A76A 1EG9B 2FXTA 3LZAA 3F9SA 3RGRA 3LOYA 1OH0A 2FGTA 4QWTA 3OW22 1SQWA 1ULIB 2W2CA 4H61A 3PCRA 4LGQA 5HGRA 2Z77A 5AIHA 1WTHA 2CG1A 3KN4A 1IT7A 4FR9A 3NV0B 4NHFA 4K1VA 1HU9A 3OWSA 1IK3A 3NBJA 4FMAA 2QIYA 1AVKA 4OUQA 1NJI4 3AMOB 3Q1CA 1N8QA 2XRXB 1VQ53 3NV0A 1A90A 2Z6BA 1VQ63 2XF3A 1ZO2A 2E2VA 3DY5A 5AIIA 4U13A 1M904 1CYVA 4MMZB 3FKAA 1OHSA 4K90B 4N6NB 3SEDA 2XGNA 4HM6B 4GL6A 3VF1A 2B24B 4K1UA 5IERA 1JJ22 1FA3A 2F99A 4L8OA 2PZVA 3WDGB 5JPPA 3PZWA 1TUHA 1JKGA 3G16A 2CFLA 5IF6A 3LT9A 4CCVA 2RCDA 4AEQA 2Y73A 1EQKA 2OCTA 3NQZA 4BTWA 1G96A 3J7Yd 3FCSB 4FMBA 3EB8A 3JUMA 2E2TA 4HVNA 1ROAA 1FUWA 3SVAA 2WGQA 3S67A 2XR8B 1FGRA 1NB5I 1OHOA 5IG0A 4BTXA 1DMQA 3KSED 1GS3A 2F86B 5I97A 1JNQA 1YHQ3 5AIFA 3MPHA 3CCE3 1Q824 1IQ8A 1TFOA 2O9UX 2WOHA 1RRLA 3JUOA 4FCZA 3WMDA 3X42A 2GXFA 4J9AA 2W56B 3EC9A 1DVCA 4XDWA 3LH4A 3CMA3 4FCMA 4HKVB 2BMQB 4XDVA 1STDA 2CIUA 1ULJB 2CC3A 1AR0A 3QRDA 5D83A 5TGNA 1RJOA 1WMNA 4EYCA 3NM2A 3NBRA 2D42A 3EN1B 3X3ZA 1ROVA 2XFSA 3E99A 3KIIA 1VQ43 4N6OB 1JB2A 2C10A 3FF0A 3G0KA 4HM0B 1N8R4 3HIGA 3UNLA 3LTCA 2XH9A 2OQEC 2W03A 1C7HA 3CCL3 1Q42A 4X2OA 3SXXA 2RSXA 5FGOA 5IG3A 3ECFA 5JBSA 2O3OA 2CWVA 2KXGA 4PEJA 4STDA 3F7SA 2HMNB 1OF5B 3LXUX 2OQEA 4I4KA 4JF8A 1E3RA 2F98A 5A0OB 1J2BA 2CFDA 2P38A 3EBTA 3LT8A 1K8A4 1Q7Y4 2BMOB 3HI7A 1SJWA 4O2HA 3T0UA 2IMJA 2W9QA 1U5OA 5LC7A 3UB1A 1BUQA 3HX8A 6STDA 1O7NB 3G8ZA 3L0RA 3FZWA 4HYZA 3NHXA 2JDIH 1L5GB 1VQP3 1V74A 1ASKA 2OOVC 2BT3A 2YX9A 5G2GA 1QJGA 3DGLA 3N9HA 3IPTA 3X3XA 4O8SA 2CFGA 3D9RA 1YVBI 3K63A 2B1XB 4HZ9B 3VSYA 2ZL8A 3JUQA 3WOFB 3LYGA 1IVVA 3FH1A 4HM8B 3ALAA 5BXQA 2MF7A 5CLKA 2W6JH 1M1XB 3OWYA 1R4CA 1JB5A 1W01A 1HKXA 1QAKA 1W00A 1WQLB 5KP3A 3B7CA 3BB9A 1NB3I 2YFIB 3LTBA 4EV2A 2CG0A 1VQ73 2HMKB 2Z76A 1O7GB 3G713 3EX9A 3NM7A 1UI8A 1O7PB 4AKZA 2L4VA 3CPW2 3RDEA 5IG4A 1IV9A 3MG2A 2MC8A 1OGXA 3U97A 1Z1SA 1JKGB 3JVCA 4KFDA 5AIGA 3OWUA 3N8BA 4HBRA 1RN7A 3GZRA 1DMNA 1SIHA 3RGAA 2OWPA 2QA43 2QEX3 3GZYB 2K54A 3BNEA 3PS8A 2PNCA 2UX0A 1GYBA 2P0MA 2W0QA 3B4PA 3UL6A 2GBXB 4RNZA 3CCM3 1GY7A 4NREA 1US1A 1CEWI 2ZDJA 3F40A 4WP5A 1O7MB 1WNHA 1VQ83 1FGOA 2ML5A 4K61A 3CCU3 1EKMA 1QVF2 3CNXA 1PFPA 4L8PA 3FGYA 3HZPA 4EBGA 2GU3A 1RKYA 2Q07A 1W6GA 4N6UA 3SOAA 2E2UA 1N9JA 1TP6A 1DMMA 2XGLA 1FGMA 3PXMA 1IT8A 1VQM3 3CD63 2CK3H 1D6YA 3SLUA 3DGOA 1JV2B 4OVMA 3FLJA 3UL5A 2IUJA 4N6MA 4HZBB 3NXJA 1STFI 2CH9A 2W04A 1M1K4 1IVXA 3CCV3 2A15A 3DUKA 1WMOA 1OUNA 3EN8A 1O7HB 3EF8A 1N5PA 4X2HA 2CFWA 2CFKA 3DXOA 2W9PA 1UI7A 2KRTA 1K734 4N3VA 2QGUA 3QK9A 3K5TA 1VQO3 2XSOB 1KC84 3FSDA 1LNHA 1W4NA 2M7OA 4N6LA 5JPUA 3EE1A 3ER7A 5DREA 4JRFA 1QVG2 3LTDA 3EQQB 3H51A 4R4KA 3WOEB 1GY6A 4Q53A 3F8HA 4HM5B 3K9MC 3T8UA 3GWRA 1AV4A 1CQSA 1D6ZA 2BMRB 3CC73 1MNLA 1YJ93 1YJW3 1JB4A 2XFTA 4AKYA 3N54B 1QMAA 5CF1A 1FGTA 5AEUB 2P0XA 3CU3A 1W02A 3BNBA 1LXEA 1OCVA 3EBYA 1OPYA 1EA2A 1M9GA 3OV4A 3OXAA 4R1KA 4EV5A 1S723 3JUNA 1ISKA 2BNGA 5IEOA 1KD14 2GEYA 2XSHB 4FMCA 3VGNA 3V99A 4LSOA 1YIT3 1IVWA 1GY5A 4O02B 3H3HA 3DGMA 1E97A 5AYRB 5CF2A 3IJEB 1A67A 4WWUC 3KZTA 1QALA 1SIIA 3KKGA 1VQK3 1A2KA 1UUWB 1ZX2A 1FGQA 4RBNA 3MHEA 3CXC2 3DZLA 1JN5B 2D1WA 2R4IA 3MYTA 5IENA 2K0MA 1KWIA 3FF2A 3F7XA 4IIAA 2P09A 2ML6A 1QAFA 1GD3A 4KFFA 3Q2PA 4BTYA 3B8LA 4HM3B 2RFRA 4KVHA 1JN5A 2INXA 4H3UA 4HM2B 1VQN3 3STDA 1TU5A 2KCDA 1YI23 4KZ1A 2GBWB 5FW5A 3D3LA 1Q40A 1NO3A 2WOFA 3HIIA 5ELJA 1YGEA 4WFOA 1LVNA 5IEPA 2CKFB 4XM4A 1NWWA 1NDOB 3FG4A 1OACA 2CWTA 5EQLA 1OGZA 4CDLA 5EVHA 1AVLA 2C11A 2I9WA 5KP1A 3KE7A 3MWZA 4EC6A 4IPBA 2FNQA 1W2ZA 1GD4A 1W2B2 1SPUA 2IUKA 3CPOA 3GZBA 3K7CA 3I563 2Z7AA 3I0YA 1D6UA 1Y4KA 3LMLA 1IU7A 2GEXA 2OTJ3 3HK4A 4IT7A 3TDGA 1LOXA 4HM1B 2IA7A 2JQ5A 2LYXA 3X41A 3F8XA 3MG3A 4GB5A 4O3VA 3B4OA 5EEOA 2WGOA 3K0ZA 1T5YA 1VQL3 5IG5A 3AMOA 4EXRA 4MMXB 3GRDA 2SBLA 3CCJ3 4WHAA 3O8YA 4MMYB 1PU4A 1VZZA 3Q90A 1N5HA 1W7CA 5D82A 7STDA 1E3VA 4KFEA 3CNMA 3ROBA 3BNCA 3CCR3 1UUVB 2WO0A 2STDA 4HJLB 4L7KA 4TX4A 5D81A 4HM7B 3PGBA 2P05A 3G4S3 3MG1A 1JRQA 2YFLB 5IW9A 2BHMA 1RRHA 2CWUA 4LEHA 1TFKA 1Q864 1W5ZA 2V1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6N B;  1FA3 A;  1LXE A;  1NB3 I;  5ELU A;  1M9G A;  4ZM8 A;  4CCV A;  1MOL A;  1EQK A;  2OCT A;  1G96 A;  1IV9 A;  3GAX A;  1ROA A;  1FUW A;  3SVA A;  1A67 A;  3S67 A;  1NB5 I;  1RN7 A;  2BO9 B;  3KSE D;  5LC6 A;  1IV7 A;  3PS8 A;  3PYJ A;  2O9U X;  1KWI A;  3UL6 A;  1DVC A;  1GD3 A;  3LH4 A;  1CEW I;  3Q2P A;  1WNH A;  3QRD A;  4LZI A;  1CYU A;  4EYC A;  1PFP A;  3NX0 A;  5ELJ A;  4N6U A;  4N6V 0;  1TIJ A;  1N9J A;  3PXM A;  3KFQ C;  5EQL A;  4N6O B;  3MWZ A;  3UL5 A;  4N6T A;  1GD4 A;  4N6M A;  2KXG A;  1STF I;  2CH9 A;  3IMA B;  1DVD A;  4IT7 A;  5A0O B;  1N5P A;  2W9P A;  2W9Q A;  5LC7 A;  3L0R A;  4N6L A;  1N5H A;  1YVB I;  3K9M C;  4TX4 A;  1A90 A;  1MNL A;  1R4C A;  1CYV A; 
#chains in the Genus database with same CATH topology
 4RZM A;  2GU1 A;  3MSO A;  1KQS 2;  1IQX A;  2F56 A;  5KP4 A;  1GOY A;  4ORL A;  3UJM A;  3BLZ A;  1K28 A;  1OHP A;  2HMM B;  3LTA A;  4R9K A;  5ELU A;  1RGC A;  3BND A;  3CCS 3;  1A2V A;  3FG1 A;  4MJD A;  3V92 A;  2UGI A;  3SX1 A;  2HML B;  3OX9 A;  4J8T A;  3U1W A;  4MEI A;  4R9L A;  4ZM8 A;  4G1M B;  1O7W B;  4XBX A;  1VQ9 3;  4FCJ A;  1BNF A;  1MOL A;  3CC4 3;  3DMC A;  1UCK A;  3SOY A;  4XB5 A;  1RGK A;  3Q3F A;  5BVB A;  1DYU A;  1MWR A;  3FG3 A;  1RCK A;  1BSB A;  1I2G A;  3GAX A;  3WA3 A;  3GZX B;  1U8C B;  1YNV X;  3EJV A;  3F14 A;  3EHC A;  3S28 A;  2W56 A;  4RNY A;  3I55 3;  1IDP A;  1X1W A;  1DET A;  2BO9 B;  2RGQ A;  5STD A;  3CCQ 3;  4FMD A;  3CME 3;  5LC6 A;  1IV7 A;  1NU3 A;  2LQV A;  2Y74 A;  4WYK B;  4BIR A;  1F8N A;  4LMI A;  3PYJ A;  3WOD G;  3JUP A;  1LOV A;  5AEW B;  9RNT A;  3WA2 X;  3DGN A;  3NUV A;  1Q7H A;  2YFJ B;  3GSP A;  1IQY A;  8CHO A;  4OK0 A;  1BNJ A;  3M8C A;  2CW9 A;  3MKI A;  1WMP A;  1W6C A;  1BRI A;  4WYK A;  1S5A A;  5AYS C;  1N9E A;  1IYY A;  1K9M 4;  3V98 A;  4LZI A;  1CYU A;  3X3Y A;  1EUI C;  4J5G A;  3NX0 A;  1K41 A;  2OTL 3;  3DM8 A;  3S29 A;  1RDS A;  1KSI A;  1RGH A;  3NBB A;  3PCS A;  1TIJ A;  4N6V 0;  4XBY A;  3S5C A;  1UW1 A;  1OF5 A;  2HMJ B;  3KFQ C;  3X40 A;  2BIR A;  3T8N A;  4HM4 B;  2CHC A;  2HMO B;  1YIJ 3;  5AI1 A;  1Q40 B;  1UDI I;  5CK6 A;  4GSP A;  3CC2 3;  1IVU A;  4XBT A;  4N6T A;  5DRV A;  3DH2 A;  3KSP A;  1Q81 4;  5CXO A;  6RNT A;  2XEP A;  4R80 A;  3IMA B;  3G6E 3;  4CJN A;  3NQY A;  1BRN L;  1X1U A;  3S27 A;  2OOV A;  1W6Y A;  1YJN 3;  1DVD A;  3A76 A;  1EG9 B;  1A2P A;  1UUG B;  2FXT A;  1B2U A;  1BVI A;  3F9S A;  3LZA A;  3LOY A;  1OH0 A;  3RGR A;  1BRH A;  2FGT A;  1RHL A;  2UUG C;  4QWT A;  1SQW A;  1ULI B;  2W2C A;  3OW2 2;  4H61 A;  3PCR A;  1B3S A;  4LGQ A;  5HGR A;  2Z77 A;  1I3F A;  1JBR A;  5AIH A;  1BU4 A;  1WTH A;  2CG1 A;  1I8V A;  3KN4 A;  1IT7 A;  4FR9 A;  3NV0 B;  4NHF A;  1TRP A;  4K1V A;  2IYJ A;  1I0V A;  1HU9 A;  3OWS A;  1IK3 A;  1FW7 A;  1BGS A;  3NBJ A;  4FMA A;  1RN1 A;  5GSP A;  2QIY A;  1AVK A;  1LRA A;  4OUQ A;  3AMO B;  1NJI 4;  3Q1C A;  1N8Q A;  1Q9E A;  2XRX B;  1VQ5 3;  3NV0 A;  2F4Y A;  2H0I A;  1A90 A;  2Z6B A;  1VQ6 3;  2XF3 A;  1ZO2 A;  2E2V A;  3DY5 A;  5AII A;  4U13 A;  6GSP A;  1M90 4;  3ZFZ A;  1CYV A;  4MMZ B;  3FKA A;  1OHS A;  4K90 B;  4N6N B;  3SED A;  2XGN A;  2J8X B;  4GL6 A;  4HM6 B;  2B24 B;  4K1U A;  3VF1 A;  5IER A;  1JJ2 2;  2F99 A;  4L8O A;  1RSN A;  4NPB A;  2PZV A;  5G1K A;  3WDG B;  1LQM B;  5JPP A;  1MGW A;  3PZW A;  1GMQ A;  1TUH A;  1JKG A;  3G16 A;  2CFL A;  5IF6 A;  3LT9 A;  4CCV A;  2RCD A;  2SAR A;  4AEQ A;  2Y73 A;  1EQK A;  2OCT A;  3D5G A;  1RGE A;  3AGO A;  3NQZ A;  4BU4 A;  1G96 A;  4BTW A;  3J7Y d;  2IY2 A;  3FCS B;  4FMB A;  3EB8 A;  1NNV A;  4I5Q A;  3JUM A;  2E2T A;  4HVN A;  2CX0 A;  1GMR A;  1ROA A;  1FUW A;  2L1S A;  3SVA A;  1FUT A;  2WGQ A;  3S67 A;  1BRJ A;  2XR8 B;  1FGR A;  1RLS A;  1NB5 I;  1OHO A;  5IG0 A;  4BTX A;  1DMQ A;  3KSE D;  5M1A A;  1GS3 A;  2F86 B;  5I97 A;  1JNQ A;  1YHQ 3;  5AIF A;  1BRS A;  3MPH A;  3CCE 3;  1Q82 4;  1IQ8 A;  1TFO A;  2O9U X;  2WOH A;  1RRL A;  3JUO A;  4FCZ A;  1B20 A;  3WMD A;  3X42 A;  4HOH A;  1T2H A;  1T3B A;  2GXF A;  4J9A A;  2W56 B;  3EC9 A;  1DVC A;  2KF6 A;  4XDW A;  3LH4 A;  1PY3 A;  4FCM A;  3CMA 3;  4HKV B;  2BMQ B;  4XDV A;  1STD A;  2CIU A;  1B27 A;  1ULJ B;  2CC3 A;  1AR0 A;  3QRD A;  5D83 A;  5TGN A;  1BSA A;  1FUS A;  1RJO A;  1WMN A;  4EYC A;  3NM2 A;  3NBR A;  2D42 A;  1B2S A;  3EN1 B;  3A5E A;  2R41 A;  1ROV A;  2XFS A;  3E99 A;  2AAD A;  3X3Z A;  5M19 A;  2ZHX B;  3KII A;  1VQ4 3;  4N6O B;  1JB2 A;  2C10 A;  3FF0 A;  3G0K A;  4HM0 B;  1N8R 4;  3HIG A;  3UNL A;  3LTC A;  2XH9 A;  2OQE C;  2W03 A;  1C7H A;  3CCL 3;  1Q42 A;  4X2O A;  3SXX A;  2RSX A;  5FGO A;  5IG3 A;  3ECF A;  5JBS A;  2O3O A;  1RTU A;  2CWV A;  1GOU A;  2KXG A;  4PEJ A;  4STD A;  3F7S A;  1BSD A;  2HMN B;  1OF5 B;  3LXU X;  1RGF A;  2OQE A;  1GOV A;  4I4K A;  1E3R A;  2F98 A;  4JF8 A;  5A0O B;  2CFD A;  3WHO A;  1J2B A;  2P38 A;  1I0X A;  3EBT A;  3LT8 A;  3BU4 A;  1Q7Y 4;  1K8A 4;  1V58 A;  2BMO B;  1LNI A;  2RBI A;  3HI7 A;  1SJW A;  4O2H A;  3T0U A;  2IMJ A;  1B2X A;  2W9Q A;  1U5O A;  3D79 A;  5LC7 A;  3UB1 A;  1BUQ A;  3D4A A;  3HX8 A;  7GSP A;  6STD A;  1O7N B;  3G8Z A;  2BU4 A;  3FZW A;  3L0R A;  4HYZ A;  3ZG5 A;  3NHX A;  2JDI H;  1L5G B;  1VQP 3;  1V74 A;  1RGA A;  1ASK A;  2OOV C;  2BT3 A;  2YX9 A;  5G2G A;  1QJG A;  3DGL A;  3N9H A;  3AHS A;  3IPT A;  3X3X A;  4O8S A;  1BSE A;  2CFG A;  1AQZ A;  1YVB I;  3D9R A;  3K63 A;  2B1X B;  4HZ9 B;  3VSY A;  2ZL8 A;  3JUQ A;  3WOF B;  3LYG A;  1GSP A;  1IVV A;  3FH1 A;  4HM8 B;  1YGW A;  1I2F A;  3ALA A;  5BXQ A;  2MF7 A;  5CLK A;  2W6J H;  1M1X B;  3OWY A;  3ZG0 A;  1R4C A;  1C54 A;  1JB5 A;  1W01 A;  1V57 A;  1HKX A;  1QAK A;  1W00 A;  1WQL B;  5KP3 A;  3B7C A;  2C4B A;  3BIR A;  2HOH A;  3BB9 A;  1NB3 I;  2YFI B;  3LTB A;  4EV2 A;  1AY7 A;  2CG0 A;  1VQ7 3;  2HMK B;  2Z76 A;  1O7G B;  3G71 3;  3EX9 A;  3NM7 A;  1UI8 A;  3RNT A;  1B2M A;  1O7P B;  4AKZ A;  1UCL A;  2L4V A;  4RNT A;  3CPW 2;  3RDE A;  5IG4 A;  1IV9 A;  3AGN A;  3MG2 A;  2MC8 A;  1OGX A;  3U97 A;  1Z1S A;  1JKG B;  3JVC A;  4KFD A;  5AIG A;  3OWU A;  3N8B A;  4HBR A;  2CX1 A;  2KF3 A;  1RN7 A;  3GZR A;  1DMN A;  1MGR A;  1SIH A;  3RGA A;  2OWP A;  2QA4 3;  1FYS A;  2QEX 3;  3GZY B;  2K54 A;  1BOX A;  1RMS A;  3BNE A;  3PS8 A;  2PNC A;  2UX0 A;  1BIR A;  1GYB A;  1VQQ A;  2P0M A;  2W0Q A;  3B4P A;  3AHW A;  3UL6 A;  1TJD A;  2GBX B;  4RNZ A;  3SYU A;  1B2Z A;  3CCM 3;  1GY7 A;  4NRE A;  1US1 A;  4EW5 A;  1FA3 A;  1JBS A;  1CEW I;  2ZDJ A;  3F40 A;  4WP5 A;  1I2E A;  1O7M B;  1WNH A;  3KCH A;  1VQ8 3;  1FGO A;  2ML5 A;  4K61 A;  1GMP A;  1EKM A;  3CCU 3;  1QVF 2;  3CNX A;  1PFP A;  4L8P A;  3FGY A;  3HZP A;  4EBG A;  2F5M A;  2GU3 A;  1RKY A;  2Q07 A;  1W6G A;  4N6U A;  3SOA A;  2E2U A;  1I3I A;  1N9J A;  1TP6 A;  1DMM A;  2XGL A;  1FGM A;  3PXM A;  1IT8 A;  5M18 A;  1VQM 3;  3CD6 3;  2CK3 H;  5BU4 A;  1BRG A;  1D6Y A;  3SLU A;  3DGO A;  1BNG A;  1JV2 B;  4OVM A;  3FLJ A;  3UL5 A;  1CH0 A;  2IUJ A;  4N6M A;  4HZB B;  1PYL A;  1STF I;  2CH9 A;  2W04 A;  3NXJ A;  1YVS A;  1M1K 4;  1IVX A;  1UCI A;  3CCV 3;  2A15 A;  3DUK A;  1WMO A;  1OUN A;  3EN8 A;  1O7H B;  1HZ1 A;  3EF8 A;  1N5P A;  4X2H A;  2CFW A;  2CFK A;  3DXO A;  2W9P A;  1UI7 A;  2KRT A;  1K73 4;  1DE3 A;  1B21 A;  4N3V A;  2QGU A;  3QK9 A;  3K5T A;  1VQO 3;  2XSO B;  1KC8 4;  4LYL B;  3FSD A;  2GSP A;  1LNH A;  1W4N A;  2M7O A;  4N6L A;  4CPK A;  5JPU A;  1MWS A;  3EE1 A;  3ER7 A;  5DRE A;  4JRF A;  8RNT A;  1QVG 2;  3LTD A;  3EQQ B;  3H51 A;  4R4K A;  3WOE B;  1GY6 A;  4Q53 A;  3F8H A;  1BAO A;  4HM5 B;  3K9M C;  3T8U A;  3URP A;  3GWR A;  1AV4 A;  1BNI A;  1CQS A;  1D6Z A;  2BMR B;  3CC7 3;  1MNL A;  1YJ9 3;  5G1L A;  1JB4 A;  2XFT A;  4AKY A;  1YJW 3;  3N54 B;  1QMA A;  5CF1 A;  2RNT A;  1FGT A;  1TTO A;  5AEU B;  2ZA4 A;  2P0X A;  3CU3 A;  4KT3 B;  1W02 A;  3BNB A;  1LXE A;  2H0G A;  1OCV A;  1R4Y A;  3EBY A;  1BNR A;  1OPY A;  1EA2 A;  1M9G A;  3OV4 A;  3OXA A;  4R1K A;  4EV5 A;  1S72 3;  1T2I A;  3JUN A;  3DGY A;  1ISK A;  1G02 A;  2BNG A;  1ZGX A;  5IEO A;  2GEY A;  2XSH B;  4FMC A;  3VGN A;  1KD1 4;  3V99 A;  4LSO A;  1YIT 3;  1IVW A;  1GY5 A;  4O02 B;  3H3H A;  4GHO A;  1LOW A;  3DGM A;  1UGI A;  1E97 A;  5AYR B;  5CF2 A;  3IJE B;  1A67 A;  4WWU C;  3KZT A;  1QAL A;  1SII A;  3D5I A;  1LQG C;  3KKG A;  1A2K A;  1UUW B;  1VQK 3;  1ZX2 A;  1FGQ A;  4RBN A;  3MHE A;  4BL2 A;  3HOH A;  3CXC 2;  3DZL A;  1JN5 B;  2D1W A;  2R4I A;  3MYT A;  5IEN A;  5HOH A;  2K0M A;  1KWI A;  4HAA A;  7RNT A;  3FF2 A;  3F7X A;  4IIA A;  1BUJ A;  2P09 A;  2ML6 A;  1QAF A;  1GD3 A;  1RNT A;  4KFF A;  3Q2P A;  4BTY A;  3B8L A;  4HM3 B;  2RFR A;  1HYF A;  1JN5 A;  2INX A;  4H3U A;  4HM2 B;  4KVH A;  1BNS A;  1VQN 3;  1RGG A;  1SAR A;  1LOY A;  3STD A;  4BL3 A;  2KCD A;  1TU5 A;  1YI2 3;  2KF4 A;  2GBW B;  4KZ1 A;  5FW5 A;  3D3L A;  1Q40 A;  1JZD A;  1JZO A;  1NO3 A;  1BAN A;  4J5K A;  2WOF A;  1MWT A;  1JBT A;  1UCJ A;  3HII A;  1YGE A;  5ELJ A;  2F5W A;  1MWU A;  4WFO A;  1LVN A;  5IEP A;  2CKF B;  4XM4 A;  1NWW A;  1NDO B;  3FG4 A;  1OAC A;  1BSC A;  2CWT A;  5EQL A;  1OGZ A;  4CDL A;  1UGH I;  5EVH A;  1AVL A;  5RNT A;  2C11 A;  1X1X A;  1ZS7 A;  1RGL A;  2AAE A;  2I9W A;  5KP1 A;  3KE7 A;  3MWZ A;  4EC6 A;  4IPB A;  2FNQ A;  1W2Z A;  1GD4 A;  5BIR A;  1W2B 2;  1SPU A;  2IUK A;  3CPO A;  3GZB A;  3K7C A;  3I56 3;  2Z7A A;  3I0Y A;  1D6U A;  1Y4K A;  3LML A;  1IU7 A;  2GEX A;  3WR2 A;  4ILF A;  2OTJ 3;  3HK4 A;  4IT7 A;  3TDG A;  4DKI A;  1EEJ A;  1LOX A;  4HM1 B;  2IA7 A;  2JQ5 A;  2KAA A;  2LYX A;  3X41 A;  3F8X A;  2K3D A;  3MG3 A;  4GB5 A;  4O3V A;  3B4O A;  2H0H A;  2WGO A;  3K0Z A;  5EEO A;  1T5Y A;  1VQL 3;  5IG5 A;  3AMO A;  4EXR A;  1I70 A;  4MMX B;  3GRD A;  2SBL A;  3CCJ 3;  4WHA A;  3O8Y A;  2KF5 A;  4MMY B;  1PU4 A;  1FZU A;  1VZZ A;  1N5H A;  3Q90 A;  1W7C A;  5D82 A;  1X1Y A;  7STD A;  1E3V A;  4KFE A;  3CNM A;  1G0T A;  1BNE A;  1RN4 A;  1TRQ A;  3ROB A;  1RNB A;  3BNC A;  1RCL A;  3CCR 3;  1UUV B;  2WO0 A;  1BRK A;  2STD A;  4HJL B;  4L7K A;  4TX4 A;  5D81 A;  4HM7 B;  3PGB A;  2P05 A;  3G4S 3;  3MG1 A;  1JRQ A;  2YFL B;  5IW9 A;  2BHM A;  1RRH A;  2CWU A;  4LEH A;  1TFK A;  1Q86 4;  1W5Z A;  2V1L A; 
#chains in the Genus database with same CATH homology
 4RZM A;  2GU1 A;  3MSO A;  1KQS 2;  1IQX A;  5KP4 A;  4ORL A;  3UJM A;  3BLZ A;  1K28 A;  1OHP A;  2HMM B;  3LTA A;  4R9K A;  5ELU A;  3BND A;  3CCS 3;  1A2V A;  3FG1 A;  4MJD A;  3V92 A;  3SX1 A;  2HML B;  3OX9 A;  4J8T A;  3U1W A;  4MEI A;  4R9L A;  4ZM8 A;  4G1M B;  1O7W B;  4XBX A;  1VQ9 3;  4FCJ A;  1MOL A;  3CC4 3;  3DMC A;  3SOY A;  4XB5 A;  5BVB A;  1DYU A;  3FG3 A;  3WA3 A;  3GAX A;  3GZX B;  1U8C B;  3EJV A;  3F14 A;  3EHC A;  3S28 A;  2W56 A;  4RNY A;  3I55 3;  1IDP A;  2BO9 B;  2RGQ A;  5STD A;  3CCQ 3;  4FMD A;  3CME 3;  5LC6 A;  1IV7 A;  1NU3 A;  2LQV A;  2Y74 A;  4WYK B;  5AEW B;  1F8N A;  4LMI A;  3PYJ A;  3WOD G;  3JUP A;  3WA2 X;  3DGN A;  3NUV A;  2YFJ B;  1IQY A;  8CHO A;  4OK0 A;  3M8C A;  2CW9 A;  3MKI A;  1WMP A;  1W6C A;  4WYK A;  1S5A A;  5AYS C;  1N9E A;  1K9M 4;  3V98 A;  4LZI A;  1CYU A;  3X3Y A;  3NX0 A;  1K41 A;  2OTL 3;  3DM8 A;  3S29 A;  1KSI A;  3NBB A;  3PCS A;  1TIJ A;  4N6V 0;  4XBY A;  3S5C A;  1UW1 A;  1OF5 A;  2HMJ B;  3KFQ C;  3X40 A;  3T8N A;  4HM4 B;  2CHC A;  2HMO B;  1YIJ 3;  5AI1 A;  1Q40 B;  5CK6 A;  3CC2 3;  1IVU A;  4XBT A;  4N6T A;  5DRV A;  3KSP A;  1Q81 4;  5CXO A;  2XEP A;  4R80 A;  3IMA B;  3G6E 3;  3NQY A;  3S27 A;  2OOV A;  1W6Y A;  1YJN 3;  1DVD A;  3A76 A;  1EG9 B;  2FXT A;  3LZA A;  3F9S A;  3RGR A;  3LOY A;  1OH0 A;  2FGT A;  4QWT A;  3OW2 2;  1SQW A;  1ULI B;  2W2C A;  4H61 A;  3PCR A;  4LGQ A;  5HGR A;  2Z77 A;  5AIH A;  1WTH A;  2CG1 A;  3KN4 A;  1IT7 A;  4FR9 A;  3NV0 B;  4NHF A;  4K1V A;  1HU9 A;  3OWS A;  1IK3 A;  3NBJ A;  4FMA A;  2QIY A;  1AVK A;  4OUQ A;  1NJI 4;  3AMO B;  3Q1C A;  1N8Q A;  2XRX B;  1VQ5 3;  3NV0 A;  1A90 A;  2Z6B A;  1VQ6 3;  2XF3 A;  1ZO2 A;  2E2V A;  3DY5 A;  5AII A;  4U13 A;  1M90 4;  1CYV A;  4MMZ B;  3FKA A;  1OHS A;  4K90 B;  4N6N B;  3SED A;  2XGN A;  4HM6 B;  4GL6 A;  3VF1 A;  2B24 B;  4K1U A;  5IER A;  1JJ2 2;  1FA3 A;  2F99 A;  4L8O A;  2PZV A;  3WDG B;  5JPP A;  3PZW A;  1TUH A;  1JKG A;  3G16 A;  2CFL A;  5IF6 A;  3LT9 A;  4CCV A;  2RCD A;  4AEQ A;  2Y73 A;  1EQK A;  2OCT A;  3NQZ A;  4BTW A;  1G96 A;  3J7Y d;  3FCS B;  4FMB A;  3EB8 A;  3JUM A;  2E2T A;  4HVN A;  1ROA A;  1FUW A;  3SVA A;  2WGQ A;  3S67 A;  2XR8 B;  1FGR A;  1NB5 I;  1OHO A;  5IG0 A;  4BTX A;  1DMQ A;  3KSE D;  1GS3 A;  2F86 B;  5I97 A;  1JNQ A;  1YHQ 3;  5AIF A;  3MPH A;  3CCE 3;  1Q82 4;  1IQ8 A;  1TFO A;  2O9U X;  2WOH A;  1RRL A;  3JUO A;  4FCZ A;  3WMD A;  3X42 A;  2GXF A;  4J9A A;  2W56 B;  3EC9 A;  1DVC A;  4XDW A;  3LH4 A;  3CMA 3;  4FCM A;  4HKV B;  2BMQ B;  4XDV A;  1STD A;  2CIU A;  1ULJ B;  2CC3 A;  1AR0 A;  3QRD A;  5D83 A;  5TGN A;  1RJO A;  1WMN A;  4EYC A;  3NM2 A;  3NBR A;  2D42 A;  3EN1 B;  3X3Z A;  1ROV A;  2XFS A;  3E99 A;  3KII A;  1VQ4 3;  4N6O B;  1JB2 A;  2C10 A;  3FF0 A;  3G0K A;  4HM0 B;  1N8R 4;  3HIG A;  3UNL A;  3LTC A;  2XH9 A;  2OQE C;  2W03 A;  1C7H A;  3CCL 3;  1Q42 A;  4X2O A;  3SXX A;  2RSX A;  5FGO A;  5IG3 A;  3ECF A;  5JBS A;  2O3O A;  2CWV A;  2KXG A;  4PEJ A;  4STD A;  3F7S A;  2HMN B;  1OF5 B;  3LXU X;  2OQE A;  4I4K A;  4JF8 A;  1E3R A;  2F98 A;  5A0O B;  1J2B A;  2CFD A;  2P38 A;  3EBT A;  3LT8 A;  1K8A 4;  1Q7Y 4;  2BMO B;  3HI7 A;  1SJW A;  4O2H A;  3T0U A;  2IMJ A;  2W9Q A;  1U5O A;  5LC7 A;  3UB1 A;  1BUQ A;  3HX8 A;  6STD A;  1O7N B;  3G8Z A;  3L0R A;  3FZW A;  4HYZ A;  3NHX A;  2JDI H;  1L5G B;  1VQP 3;  1V74 A;  1ASK A;  2OOV C;  2BT3 A;  2YX9 A;  5G2G A;  1QJG A;  3DGL A;  3N9H A;  3IPT A;  3X3X A;  4O8S A;  2CFG A;  3D9R A;  1YVB I;  3K63 A;  2B1X B;  4HZ9 B;  3VSY A;  2ZL8 A;  3JUQ A;  3WOF B;  3LYG A;  1IVV A;  3FH1 A;  4HM8 B;  3ALA A;  5BXQ A;  2MF7 A;  5CLK A;  2W6J H;  1M1X B;  3OWY A;  1R4C A;  1JB5 A;  1W01 A;  1HKX A;  1QAK A;  1W00 A;  1WQL B;  5KP3 A;  3B7C A;  3BB9 A;  1NB3 I;  2YFI B;  3LTB A;  4EV2 A;  2CG0 A;  1VQ7 3;  2HMK B;  2Z76 A;  1O7G B;  3G71 3;  3EX9 A;  3NM7 A;  1UI8 A;  1O7P B;  4AKZ A;  2L4V A;  3CPW 2;  3RDE A;  5IG4 A;  1IV9 A;  3MG2 A;  2MC8 A;  1OGX A;  3U97 A;  1Z1S A;  1JKG B;  3JVC A;  4KFD A;  5AIG A;  3OWU A;  3N8B A;  4HBR A;  1RN7 A;  3GZR A;  1DMN A;  1SIH A;  3RGA A;  2OWP A;  2QA4 3;  2QEX 3;  3GZY B;  2K54 A;  3BNE A;  3PS8 A;  2PNC A;  2UX0 A;  1GYB A;  2P0M A;  2W0Q A;  3B4P A;  3UL6 A;  2GBX B;  4RNZ A;  3CCM 3;  1GY7 A;  4NRE A;  1US1 A;  1CEW I;  2ZDJ A;  3F40 A;  4WP5 A;  1O7M B;  1WNH A;  1VQ8 3;  1FGO A;  2ML5 A;  4K61 A;  3CCU 3;  1EKM A;  1QVF 2;  3CNX A;  1PFP A;  4L8P A;  3FGY A;  3HZP A;  4EBG A;  2GU3 A;  1RKY A;  2Q07 A;  1W6G A;  4N6U A;  3SOA A;  2E2U A;  1N9J A;  1TP6 A;  1DMM A;  2XGL A;  1FGM A;  3PXM A;  1IT8 A;  1VQM 3;  3CD6 3;  2CK3 H;  1D6Y A;  3SLU A;  3DGO A;  1JV2 B;  4OVM A;  3FLJ A;  3UL5 A;  2IUJ A;  4N6M A;  4HZB B;  3NXJ A;  1STF I;  2CH9 A;  2W04 A;  1M1K 4;  1IVX A;  3CCV 3;  2A15 A;  3DUK A;  1WMO A;  1OUN A;  3EN8 A;  1O7H B;  3EF8 A;  1N5P A;  4X2H A;  2CFW A;  2CFK A;  3DXO A;  2W9P A;  1UI7 A;  2KRT A;  1K73 4;  4N3V A;  2QGU A;  3QK9 A;  3K5T A;  1VQO 3;  2XSO B;  1KC8 4;  3FSD A;  1LNH A;  1W4N A;  2M7O A;  4N6L A;  5JPU A;  3EE1 A;  3ER7 A;  5DRE A;  4JRF A;  1QVG 2;  3LTD A;  3EQQ B;  3H51 A;  4R4K A;  3WOE B;  1GY6 A;  4Q53 A;  3F8H A;  4HM5 B;  3K9M C;  3T8U A;  3GWR A;  1AV4 A;  1CQS A;  1D6Z A;  2BMR B;  3CC7 3;  1MNL A;  1YJ9 3;  1YJW 3;  1JB4 A;  2XFT A;  4AKY A;  3N54 B;  1QMA A;  5CF1 A;  1FGT A;  5AEU B;  2P0X A;  3CU3 A;  1W02 A;  3BNB A;  1LXE A;  1OCV A;  3EBY A;  1OPY A;  1EA2 A;  1M9G A;  3OV4 A;  3OXA A;  4R1K A;  4EV5 A;  1S72 3;  3JUN A;  1ISK A;  2BNG A;  5IEO A;  1KD1 4;  2GEY A;  2XSH B;  4FMC A;  3VGN A;  3V99 A;  4LSO A;  1YIT 3;  1IVW A;  1GY5 A;  4O02 B;  3H3H A;  3DGM A;  1E97 A;  5AYR B;  5CF2 A;  3IJE B;  1A67 A;  4WWU C;  3KZT A;  1QAL A;  1SII A;  3KKG A;  1VQK 3;  1A2K A;  1UUW B;  1ZX2 A;  1FGQ A;  4RBN A;  3MHE A;  3CXC 2;  3DZL A;  1JN5 B;  2D1W A;  2R4I A;  3MYT A;  5IEN A;  2K0M A;  1KWI A;  3FF2 A;  3F7X A;  4IIA A;  2P09 A;  2ML6 A;  1QAF A;  1GD3 A;  4KFF A;  3Q2P A;  4BTY A;  3B8L A;  4HM3 B;  2RFR A;  4KVH A;  1JN5 A;  2INX A;  4H3U A;  4HM2 B;  1VQN 3;  3STD A;  1TU5 A;  2KCD A;  1YI2 3;  4KZ1 A;  2GBW B;  5FW5 A;  3D3L A;  1Q40 A;  1NO3 A;  2WOF A;  3HII A;  5ELJ A;  1YGE A;  4WFO A;  1LVN A;  5IEP A;  2CKF B;  4XM4 A;  1NWW A;  1NDO B;  3FG4 A;  1OAC A;  2CWT A;  5EQL A;  1OGZ A;  4CDL A;  5EVH A;  1AVL A;  2C11 A;  2I9W A;  5KP1 A;  3KE7 A;  3MWZ A;  4EC6 A;  4IPB A;  2FNQ A;  1W2Z A;  1GD4 A;  1W2B 2;  1SPU A;  2IUK A;  3CPO A;  3GZB A;  3K7C A;  3I56 3;  2Z7A A;  3I0Y A;  1D6U A;  1Y4K A;  3LML A;  1IU7 A;  2GEX A;  2OTJ 3;  3HK4 A;  4IT7 A;  3TDG A;  1LOX A;  4HM1 B;  2IA7 A;  2JQ5 A;  2LYX A;  3X41 A;  3F8X A;  3MG3 A;  4GB5 A;  4O3V A;  3B4O A;  5EEO A;  2WGO A;  3K0Z A;  1T5Y A;  1VQL 3;  5IG5 A;  3AMO A;  4EXR A;  4MMX B;  3GRD A;  2SBL A;  3CCJ 3;  4WHA A;  3O8Y A;  4MMY B;  1PU4 A;  1VZZ A;  3Q90 A;  1N5H A;  1W7C A;  5D82 A;  7STD A;  1E3V A;  4KFE A;  3CNM A;  3ROB A;  3BNC A;  3CCR 3;  1UUV B;  2WO0 A;  2STD A;  4HJL B;  4L7K A;  4TX4 A;  5D81 A;  4HM7 B;  3PGB A;  2P05 A;  3G4S 3;  3MG1 A;  1JRQ A;  2YFL B;  5IW9 A;  2BHM A;  1RRH A;  2CWU A;  4LEH A;  1TFK A;  1Q86 4;  1W5Z A;  2V1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...