2CH9A

Crystal structure of dimeric human cystatin f
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
TCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN F
publication title Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
pubmed doi rcsb
molecule tags Inhibitor
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ch9A01
1EQKA 4IT7A 1FUWA 2W9PA 4CCVA 3K9MC 5LC7A 4N6TA 3QRDA 1WNHA 1MNLA 4EYCA 1CYVA 1LXEA 3S67A 1ROAA 1NB3I 1G96A 4ZM8A 5EQLA 3KFQC 2W9QA 5LC6A 1DVCA 3PXMA 3NX0A 1PFPA 1CEWI 1GD4A 1TIJA 3UL6A 1M9GA 1IV7A 4N6V0 1IV9A 1A67A 3GAXA 3KSED 2O9UX 3PYJA 4TX4A 2BO9B 1GD3A 4LZIA 3MWZA 4N6NB 1YVBI 3UL5A 4N6LA 3Q2PA 1RN7A 2KXGA 5ELUA 1KWIA 2CH9A 3L0RA 3IMAB 4N6UA 3PS8A 5A0OB 1N9JA 1FA3A 1R4CA 3LH4A 1DVDA 1N5HA 1CYUA 1STFI 1NB5I 1N5PA 1A90A 3SVAA 4N6OB 5ELJA 2OCTA 1MOLA 4N6MA
chains in the Genus database with same CATH superfamily
1BRJA 1EKMA 1STDA 3JUMA 2CWUA 1YVSA 3RDEA 3V98A 1EUIC 5CF2A 2OTL3 3DM8A 4MMYB 1NO3A 1BVIA 3AHSA 4IT7A 1BRGA 4HM7B 1ULIB 4XDWA 2UGIA 5STDA 3JUPA 1OGXA 1JRQA 3OXAA 1OACA 4KFDA 1LOYA 3MKIA 3EJVA 1GYBA 1RGGA 1OCVA 1OHSA 1X1XA 3LT9A 4O02B 2MC8A 3CCL3 3I553 3K0ZA 1QVG2 1IK3A 1DMQA 3GSPA 7STDA 1ZX2A 1MNLA 1Q864 1RJOA 1B2MA 2CK3H 4KFEA 1LNIA 2GU1A 1R4YA 2ML6A 3AHWA 2BU4A 3ZG0A 1IVWA 3ER7A 3NXJA 4EV2A 3Q90A 1IQ8A 4FCMA 3LMLA 2YFLB 3Q3FA 4LMIA 3T8UA 3WODG 3A5EA 1A2KA 3JUOA 3CXC2 5LC6A 1FGMA 5CF1A 1EG9B 5JPUA 5M1AA 3VSYA 3BNBA 1BAOA 1GOUA 4CPKA 1BNRA 1K41A 1RGKA 1M1XB 1CEWI 6GSPA 3X41A 3UL6A 1M9GA 3FG3A 3CCQ3 2HOHA 1ZS7A 2XF3A 3SOAA 3BIRA 2H0GA 3PGBA 3S28A 3CC73 4XDVA 2FXTA 1I2GA 1T3BA 3GAXA 4K61A 3ROBA 1I8VA 1T5YA 1VQL3 2O9UX 1W6GA 4IPBA 3T8NA 3ECFA 1YIT3 3PZWA 3KIIA 5CXOA 5AYRB 3CCM3 1V74A 4HM3B 4HM1B 4OVMA 2XFTA 3U1WA 5AIHA 1QAKA 1IYYA 2W56A 2BO9B 1GD3A 4WP5A 1O7MB 4K1UA 5EEOA 2HMNB 3FG4A 5JBSA 1LOVA 3SEDA 3EC9A 4N6NB 1F8NA 1W4NA 5AIIA 3K7CA 3U97A 7GSPA 5FW5A 1GS3A 3GZRA 5DRVA 1FGRA 2H0HA 1BU4A 2K3DA 3URPA 3CMA3 3G0KA 1O7WB 1RN7A 8CHOA 5AYSC 1VQ63 4FMDA 2KXGA 5ELUA 2XH9A 5HOHA 2SARA 1Q824 2P0MA 3BB9A 3HOHA 1RGAA 5G1KA 1AV4A 3FCSB 5IG3A 1OHPA 4FMBA 1G0TA 2V1LA 2XGNA 3MG3A 3RGAA 1A2VA 3CU3A 1GMQA 3F8XA 4OK0A 1YJW3 1FYSA 1B2XA 1O7GB 3KCHA 3WMDA 1R4CA 2RCDA 3H51A 1RGFA 3JUQA 4HM8B 4EW5A 1CH0A 1I3IA 3DGOA 2CHCA 3EX9A 3N9HA 1K734 4XBTA 3CD63 1O7NB 1HZ1A 2GBXB 4AKZA 4EXRA 1YGEA 2KAAA 3A76A 3G4S3 2RFRA 4WYKA 5IF6A 3WHOA 5ELJA 1LVNA 1ROVA 2OCTA 3D4AA 1Q7Y4 1VQ43 1Q7HA 2F5MA 3AMOA 2CWVA 3SYUA 4H61A 6STDA 4KVHA 3F7XA 3FF2A 1JKGA 2XRXB 2KCDA 4J9AA 3X3XA 4GL6A 4RZMA 2OOVA 1BSEA 2KF3A 1EQKA 2W0QA 3CPW2 1JBTA 3VF1A 2HMKB 4WWUC 1WMPA 2W9PA 3G713 2Y73A 1Q814 1JBRA 1TJDA 2OQEA 5M19A 2JQ5A 4N3VA 3EN8A 1SQWA 3CCR3 4H3UA 1BSBA 4XM4A 5G1LA 1HKXA 3LTBA 1YI23 1DMMA 1VZZA 3BNDA 1WNHA 2CX0A 1UI7A 1TP6A 3NQYA 3NM2A 1U5OA 1CYVA 3GWRA 3X3ZA 3F7SA 1LXEA 1BNIA 2GSPA 1DYUA 3S67A 4FMCA 1ROAA 4X2OA 3WDGB 2CC3A 4GB5A 5IENA 2D1WA 3LTDA 2W03A 4R9KA 1I2EA 1NB3I 1G96A 1Q40A 2CG0A 2P05A 3KFQC 5EQLA 1FZUA 2GU3A 1W7CA 2QA43 1IVVA 4HKVB 5AIGA 5D83A 2XSOB 4L7KA 3MSOA 3PXMA 3NX0A 4U13A 3I0YA 1NU3A 2W56B 1GOYA 1VQQA 2CFKA 3DXOA 2INXA 1RGLA 2FGTA 3WA2X 4BTYA 1GD4A 2ZA4A 1IU7A 4FCZA 4J5GA 3CME3 3DGLA 1RCKA 1SPUA 3BNEA 1YJN3 1IV7A 1RGEA 3PCRA 3K5TA 2RGQA 5AEUB 3LOYA 3X40A 2J8XB 3KSED 1K9M4 3S5CA 1V58A 1SARA 3F14A 4XBXA 1M1K4 2LYXA 4J5KA 2P0XA 1BANA 1RRLA 1JN5A 1OHOA 3CCU3 1TFKA 1BNGA 1OH0A 1ZO2A 4MJDA 3OWUA 1VQO3 1I0VA 1BNJA 3D9RA 3NHXA 3NBBA 2K0MA 1PY3A 2K54A 3MWZA 1BNSA 3D5IA 2HMMB 1NJI4 3N8BA 4HM4B 3FH1A 2KRTA 3NV0A 4GHOA 1JZDA 2CG1A 5BVBA 1OUNA 1RTUA 3Q2PA 1UUVB 1FUTA 2IYJA 3D3LA 1B21A 1N9EA 2CH9A 4GSPA 9RNTA 3GZBA 3AGOA 3BLZA 3L0RA 4EV5A 1C54A 4WYKB 5TGNA 1QALA 1IQXA 1Q9EA 2BMQB 2RSXA 1SIHA 2F99A 1B2UA 3IMAB 2M7OA 3AMOB 2C10A 5AEWB 1BGSA 1W00A 5AIFA 1SIIA 2OTJ3 1N9JA 1FA3A 2WGQA 4KZ1A 4BU4A 1JKGB 1I2FA 1VQ83 2KF5A 3MG2A 1W2ZA 3AGNA 5D82A 3B4PA 3V99A 1LNHA 1UW1A 1LRAA 3N54B 4MMXB 1Y4KA 3HX8A 1AQZA 2CFLA 3DZLA 3DGYA 2BNGA 3D79A 1AVLA 1NB5I 1E3RA 1QJGA 3B7CA 1ISKA 1N5PA 3CPOA 3LZAA 3KZTA 4X2HA 1IT8A 2GBWB 2XSHB 3B8LA 4N6OB 2ZDJA 2Z76A 1N8QA 4R80A 1Q42A 2CFDA 2L1SA 4JF8A 1A2PA 1IQYA 5IEOA 3STDA 3ZG5A 2RBIA 1US1A 1MGWA 1Z1SA 3TDGA 1O7HB 4CDLA 2CFGA 2ZHXB 3X42A 2PZVA 4HVNA 1JB5A 4J8TA 1YIJ3 7RNTA 3K9MC 1Q40B 4HJLB 1MGRA 5M18A 3NBJA 2P09A 2YX9A 2GEXA 1BNFA 4CJNA 1I70A 5LC7A 3OX9A 3DGNA 2W6JH 4XB5A 5CK6A 3ZFZA 1E97A 3Q1CA 1K8A4 1LOWA 2MF7A 2W2CA 1FUSA 1D6UA 1RRHA 2BMOB 1GY6A 2IMJA 3S27A 4EYCA 1L5GB 1SJWA 3IPTA 3MHEA 1IT7A 3DY5A 3F40A 1DMNA 3KKGA 1M904 1AY7A 5IG5A 2AADA 3EBYA 8RNTA 1CQSA 2SBLA 1KD14 4WFOA 1BRIA 4ZM8A 1RKYA 4O8SA 2FNQA 2W9QA 4MMZB 1JB4A 4FMAA 1MWTA 1RNTA 1BRSA 2Z7AA 4AKYA 1JN5B 2WGOA 3DH2A 5HGRA 3UJMA 3E99A 3KE7A 2UUGC 4JRFA 1QVF2 2YFIB 1BIRA 1E3VA 1YGWA 2GEYA 4HM0B 2QEX3 5BU4A 1I0XA 4HZBB 1GY7A 3H3HA 4N6V0 3VGNA 1B27A 1BUJA 3NV0B 3NQZA 1PYLA 2Z77A 3MG1A 5IW9A 1BRHA 1A67A 2B1XB 4OUQA 1BSDA 1UI8A 1K28A 1IDPA 3F8HA 4KT3B 4LGQA 2CX1A 3CC23 1RDSA 1KSIA 3FKAA 4NREA 1TU5A 1UUGB 3CCV3 5KP4A 1T2IA 3HZPA 3PYJA 1VQN3 1BSCA 4PEJA 1HYFA 1W01A 4AEQA 2GXFA 2P38A 1YJ93 3X3YA 4LEHA 5CLKA 3CC43 2A15A 2E2UA 4LZIA 1C7HA 1PU4A 4WHAA 1V57A 2UX0A 1JV2B 2YFJB 4O3VA 5IG0A 1BUQA 4I4KA 5IG4A 2BHMA 3OV4A 2WOHA 3FF0A 3UL5A 1DE3A 4N6LA 4STDA 3SX1A 5GSPA 2KF4A 1HU9A 1G02A 2F98A 2OQEC 2QGUA 2W04A 1MWRA 2D42A 2JDIH 1BSAA 2XR8B 3EQQB 2CIUA 3BU4A 3DMCA 3FSDA 4FR9A 1S5AA 4LYLB 1LQGC 1W6YA 1WMOA 4R1KA 2Y74A 3JUNA 4QWTA 3MPHA 4XBYA 1U8CB 5BXQA 1RNBA 3EHCA 3GZYB 5BIRA 2CFWA 1OGZA 1W2B2 1O7PB 3EF8A 3O8YA 1JZOA 1IVUA 3WOEB 3KSPA 1W6CA 3DUKA 5I97A 1J2BA 2CW9A 1DVDA 1N5HA 5IERA 3DGMA 1STFI 2CWTA 1OF5A 1UUWB 4NHFA 2I9WA 1LQMB 1TFOA 4BL2A 1RGCA 3D5GA 3FZWA 2HMJB 3SVAA 2IY2A 1X1WA 1NDOB 3EB8A 1VQP3 2ML5A 3EN1B 3LT8A 4ORLA 1I3FA 1MOLA 1MWSA 3FG1A 4N6MA 1BNEA 1BRKA 2IA7A 5RNTA 1UCLA 2F56A 3IJEB 1VQ73 4HYZA 3NUVA 4BTWA 1JNQA 1T2HA 2E2TA 2BIRA 2O3OA 3KN4A 4HBRA 4I5QA 3F9SA 4R9LA 3CCS3 1FUWA 4CCVA 4KFFA 1YNVX 4RNTA 4RNYA 2QIYA 1B2ZA 1B3SA 4HM5B 4LSOA 2E2VA 4BTXA 1X1UA 3PCSA 1WTHA 2ZL8A 4N6TA 2XFSA 2C11A 5EVHA 4NPBA 1BRNL 2WOFA 4L8PA 1QAFA 1ZGXA 1TTOA 3B4OA 1OPYA 2Z6BA 3QRDA 1GSPA 1LOXA 2L4VA 3LYGA 2OWPA 1TRPA 5DREA 1FGTA 4BL3A 2F5WA 1B2SA 2F4YA 2CKFB 3SXXA 3NM7A 2AAEA 3V92A 1GMPA 3OWYA 1VQ53 3RGRA 5IEPA 2STDA 4HM6B 1DVCA 4HZ9B 1RN4A 5KP1A 1KC84 1N8R4 1EA2A 1WQLB 2HMOB 3G8ZA 1PFPA 4R4KA 4IIAA 4MEIA 2PNCA 3RNTA 2KF6A 1BOXA 3G16A 4EC6A 1TIJA 4ILFA 1IVXA 3LXUX 1FGOA 3I563 4FCJA 3FLJA 5G2GA 3BNCA 3M8CA 1UGHI 1IV9A 1RGHA 2B24B 2C4BA 3GZXB 3WA3A 1VQ93 3LTCA 1D6YA 1GY5A 1X1YA 1RN1A 1GOVA 1JB2A 3MYTA 2XEPA 1S723 4TX4A 1GMRA 1MWUA 3EE1A 4K1VA 2XGLA 2IUKA 4DKIA 4L8OA 2R41A 1WMNA 5AI1A 5D81A 3FGYA 1DETA 1YVBI 3UB1A 4Q53A 2RNTA 1RHLA 3CCJ3 1ASKA 1W02A 1B20A 1UDII 3CCE3 2BT3A 1UCKA 2Q07A 3QK9A 1YHQ3 3GRDA 3WOFB 4RNZA 1FGQA 1KWIA 1OF5B 3ALAA 1EEJA 3LTAA 1RSNA 3EBTA 3T0UA 1JJ22 1RMSA 1KQS2 6RNTA 1RLSA 3HIGA 1AR0A 4O2HA 3S29A 4N6UA 2IUJA 4BIRA 3PS8A 4RBNA 3OW22 5A0OB 3JVCA 5FGOA 3CNXA 2H0IA 1VQK3 1UCJA 5JPPA 3J7Yd 1NWWA 2HMLB 1VQM3 1JBSA 3SLUA 3LH4A 3G6E3 4EBGA 1NNVA 2R4IA 1UCIA 3K63A 1AVKA 4HAAA 4K90B 3CNMA 1CYUA 2OOVC 1W5ZA 1ULJB 1TUHA 3NBRA 1A90A 2F86B 3HIIA 3OWSA 3WR2A 1UGIA 2WO0A 1TRQA 2BMRB 4HOHA 4HM2B 1RCLA 3SOYA 3HK4A 3UNLA 5KP3A 1D6ZA 2LQVA 1FW7A 4G1MB 1QMAA 3HI7A
chains in the Genus database with same CATH topology
1EKMA 1STDA 3JUMA 2CWUA 3RDEA 3V98A 5CF2A 2OTL3 3DM8A 4MMYB 1NO3A 4IT7A 4HM7B 1ULIB 4XDWA 5STDA 3JUPA 1OGXA 1JRQA 3OXAA 1OACA 4KFDA 3MKIA 3EJVA 1GYBA 4O02B 1OCVA 1OHSA 3LT9A 2MC8A 3CCL3 3I553 3K0ZA 1QVG2 1IK3A 1DMQA 7STDA 1ZX2A 1MNLA 1Q864 1RJOA 2CK3H 4KFEA 2GU1A 2ML6A 1IVWA 3ER7A 3NXJA 4EV2A 3Q90A 1IQ8A 4FCMA 3LMLA 2YFLB 3T8UA 4LMIA 3CXC2 3WODG 1A2KA 3JUOA 5LC6A 1FGMA 5CF1A 1EG9B 5JPUA 3VSYA 3BNBA 1K41A 1M1XB 1CEWI 3X41A 3UL6A 1M9GA 3FG3A 3CCQ3 2XF3A 3SOAA 3S28A 3PGBA 3CC73 4XDVA 2FXTA 3GAXA 3ROBA 4K61A 1VQL3 2OTJ3 1T5YA 2O9UX 1W6GA 4IPBA 3T8NA 3ECFA 1YIT3 3PZWA 3KIIA 5CXOA 5AYRB 3CCM3 1V74A 4HM3B 4HM1B 4OVMA 2XFTA 3U1WA 5AIHA 1QAKA 2W56A 2BO9B 1GD3A 4WP5A 1O7MB 4K1UA 5EEOA 2HMNB 3FG4A 5JBSA 3SEDA 3EC9A 4N6NB 1F8NA 1W4NA 5AIIA 3K7CA 3U97A 5FW5A 1GS3A 3GZRA 5DRVA 1FGRA 3CMA3 3G0KA 1O7WB 1RN7A 8CHOA 5AYSC 1VQ63 4FMDA 2KXGA 5ELUA 2XH9A 1Q824 2P0MA 3BB9A 1AV4A 3FCSB 5IG3A 1OHPA 4FMBA 2V1LA 2XGNA 3MG3A 3RGAA 1A2VA 3CU3A 3F8XA 4OK0A 1YJW3 1O7GB 3WMDA 1R4CA 2RCDA 3H51A 3JUQA 4HM8B 3DGOA 2CHCA 3EX9A 3N9HA 1K734 4XBTA 3CD63 1O7NB 2GBXB 4AKZA 4EXRA 1YGEA 3A76A 3G4S3 2RFRA 4WYKA 5IF6A 5ELJA 1LVNA 1ROVA 2OCTA 1Q7Y4 1VQ43 3AMOA 2CWVA 4H61A 6STDA 4KVHA 3F7XA 3FF2A 2XRXB 1JKGA 2KCDA 4J9AA 3X3XA 4GL6A 4RZMA 2OOVA 1EQKA 2W0QA 3CPW2 3VF1A 2HMKB 4WWUC 1WMPA 2W9PA 3G713 2Y73A 1Q814 2OQEA 2JQ5A 4N3VA 3EN8A 1SQWA 3CCR3 4H3UA 4XM4A 1HKXA 3LTBA 1YI23 1DMMA 1VZZA 3BNDA 1WNHA 1UI7A 1TP6A 3NQYA 3NM2A 1U5OA 1CYVA 3GWRA 3X3ZA 3F7SA 1LXEA 1DYUA 3S67A 4FMCA 1ROAA 4X2OA 3WDGB 2CC3A 4GB5A 5IENA 2D1WA 3LTDA 2W03A 4R9KA 1NB3I 1Q40A 1G96A 2CG0A 2P05A 5EQLA 3KFQC 2GU3A 1W7CA 2QA43 1IVVA 4HKVB 5AIGA 5D83A 2XSOB 4L7KA 3MSOA 3PXMA 3NX0A 4U13A 3I0YA 1NU3A 2W56B 2CFKA 3DXOA 2INXA 3WA2X 2FGTA 4BTYA 1GD4A 4FCZA 1IU7A 3CME3 3DGLA 1SPUA 1YJN3 3BNEA 1IV7A 3PCRA 3K5TA 2RGQA 5AEUB 3LOYA 3X40A 3KSED 1K9M4 3S5CA 3F14A 4XBXA 1M1K4 2LYXA 2P0XA 1RRLA 1JN5A 1OHOA 3CCU3 1TFKA 1ZO2A 1OH0A 4MJDA 1VQO3 3OWUA 3NHXA 3D9RA 3NBBA 2K0MA 3MWZA 2K54A 1NJI4 2HMMB 3N8BA 4HM4B 3FH1A 2KRTA 3NV0A 2CG1A 5BVBA 1OUNA 3Q2PA 1UUVB 3D3LA 1N9EA 2CH9A 3GZBA 3BLZA 3L0RA 4EV5A 4WYKB 5TGNA 1QALA 1IQXA 2BMQB 2RSXA 1SIHA 2F99A 3IMAB 2M7OA 3AMOB 2C10A 5AEWB 1W00A 5AIFA 1SIIA 1N9JA 1FA3A 2WGQA 4KZ1A 1JKGB 1VQ83 3MG2A 3V99A 1W2ZA 5D82A 3B4PA 1LNHA 1UW1A 3N54B 4MMXB 1Y4KA 3HX8A 2CFLA 3DZLA 2BNGA 1AVLA 1NB5I 1E3RA 1QJGA 3B7CA 1ISKA 1N5PA 3CPOA 3LZAA 3KZTA 4X2HA 1IT8A 2GBWB 2XSHB 3B8LA 4N6OB 2ZDJA 2Z76A 1N8QA 4R80A 1Q42A 2CFDA 4JF8A 1IQYA 5IEOA 3STDA 1US1A 1Z1SA 3TDGA 1O7HB 4CDLA 2CFGA 3X42A 2PZVA 4HVNA 1JB5A 4J8TA 1YIJ3 3K9MC 1Q40B 4HJLB 3NBJA 2P09A 2YX9A 2GEXA 5LC7A 3OX9A 3DGNA 2W6JH 4XB5A 5CK6A 1E97A 3Q1CA 1K8A4 2MF7A 2W2CA 1D6UA 1RRHA 2BMOB 1GY6A 2IMJA 3S27A 4EYCA 1L5GB 1SJWA 3IPTA 3MHEA 1IT7A 3DY5A 3F40A 1DMNA 3KKGA 1M904 5IG5A 3EBYA 1CQSA 2SBLA 1KD14 4WFOA 4ZM8A 1RKYA 4O8SA 2FNQA 2W9QA 4MMZB 1JB4A 4FMAA 2Z7AA 4AKYA 1JN5B 2WGOA 3UJMA 5HGRA 3E99A 3KE7A 4JRFA 1QVF2 2YFIB 1E3VA 4HM0B 2GEYA 2QEX3 4HZBB 1GY7A 3H3HA 4N6V0 3VGNA 3NV0B 3NQZA 2Z77A 3MG1A 5IW9A 1A67A 2B1XB 4OUQA 1UI8A 1K28A 1IDPA 3F8HA 4LGQA 3CC23 1KSIA 3FKAA 4NREA 1TU5A 3CCV3 5KP4A 3HZPA 1VQN3 3PYJA 4PEJA 1W01A 4AEQA 2GXFA 2P38A 1YJ93 3X3YA 4LEHA 5CLKA 3CC43 2A15A 2E2UA 4LZIA 1C7HA 1PU4A 4WHAA 2UX0A 2YFJB 1JV2B 4O3VA 5IG0A 1BUQA 4I4KA 5IG4A 2BHMA 3OV4A 2WOHA 3FF0A 3UL5A 4N6LA 4STDA 3SX1A 2QGUA 1HU9A 2F98A 2OQEC 2W04A 2D42A 2JDIH 2XR8B 3EQQB 2CIUA 3DMCA 3FSDA 4FR9A 4R1KA 1S5AA 4QWTA 1WMOA 1W6YA 4XBYA 2Y74A 3JUNA 5BXQA 3MPHA 1U8CB 3EHCA 3GZYB 2CFWA 1OGZA 1W2B2 1O7PB 3EF8A 3O8YA 1IVUA 3WOEB 3KSPA 1W6CA 3DUKA 5I97A 1J2BA 2CW9A 1DVDA 1N5HA 5IERA 3DGMA 1STFI 2CWTA 1OF5A 1UUWB 4NHFA 2I9WA 1TFOA 3FZWA 2HMJB 3SVAA 1NDOB 3EB8A 1VQP3 2ML5A 3EN1B 3LT8A 4ORLA 1MOLA 3FG1A 4N6MA 2IA7A 3IJEB 1VQ73 4HYZA 3NUVA 4BTWA 1JNQA 2E2TA 2O3OA 3KN4A 4R9LA 4HBRA 3F9SA 3CCS3 1FUWA 4CCVA 4KFFA 4RNYA 2QIYA 4HM5B 4LSOA 2E2VA 4BTXA 3PCSA 1WTHA 2ZL8A 4N6TA 2XFSA 2C11A 5EVHA 2WOFA 4L8PA 1QAFA 3B4OA 1OPYA 2Z6BA 3QRDA 1LOXA 2L4VA 3LYGA 2OWPA 5DREA 1FGTA 2CKFB 3SXXA 3NM7A 3V92A 3OWYA 1VQ53 3RGRA 5IEPA 2STDA 4HM6B 1DVCA 4HZ9B 5KP1A 1N8R4 1KC84 1EA2A 1WQLB 2HMOB 3G8ZA 1PFPA 4R4KA 4IIAA 4MEIA 2PNCA 3G16A 4EC6A 1TIJA 1IVXA 3LXUX 1FGOA 3I563 4FCJA 3FLJA 5G2GA 3BNCA 3M8CA 1IV9A 2B24B 3GZXB 3WA3A 1VQ93 3LTCA 1D6YA 1GY5A 1JB2A 3MYTA 2XEPA 1S723 4TX4A 3EE1A 4K1VA 2XGLA 2IUKA 4L8OA 1WMNA 5AI1A 5D81A 3FGYA 3UB1A 1YVBI 4Q53A 3CCJ3 1ASKA 1W02A 3CCE3 2BT3A 2Q07A 3QK9A 1YHQ3 3GRDA 3WOFB 4RNZA 1FGQA 1KWIA 1OF5B 3ALAA 3LTAA 3EBTA 3T0UA 1JJ22 1KQS2 3HIGA 1AR0A 4O2HA 3S29A 4N6UA 2IUJA 3OW22 3PS8A 4RBNA 5A0OB 3JVCA 5FGOA 3CNXA 1VQK3 5JPPA 3J7Yd 1NWWA 2HMLB 1VQM3 3SLUA 3LH4A 3G6E3 4EBGA 2R4IA 3K63A 1AVKA 4K90B 3CNMA 1CYUA 2OOVC 1W5ZA 1ULJB 1TUHA 3NBRA 1A90A 2F86B 3HIIA 3OWSA 2WO0A 2BMRB 4HM2B 3SOYA 3HK4A 3UNLA 5KP3A 1D6ZA 2LQVA 4G1MB 1QMAA 3HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQK A;  4IT7 A;  1FUW A;  2W9P A;  4CCV A;  3K9M C;  5LC7 A;  4N6T A;  3QRD A;  1WNH A;  1MNL A;  4EYC A;  1CYV A;  1LXE A;  3S67 A;  1ROA A;  1NB3 I;  1G96 A;  4ZM8 A;  5EQL A;  3KFQ C;  2W9Q A;  5LC6 A;  1DVC A;  3PXM A;  3NX0 A;  1PFP A;  1CEW I;  1GD4 A;  1TIJ A;  3UL6 A;  1M9G A;  1IV7 A;  4N6V 0;  1IV9 A;  1A67 A;  3GAX A;  3KSE D;  2O9U X;  3PYJ A;  4TX4 A;  2BO9 B;  1GD3 A;  4LZI A;  3MWZ A;  4N6N B;  1YVB I;  3UL5 A;  4N6L A;  3Q2P A;  1RN7 A;  2KXG A;  5ELU A;  1KWI A;  2CH9 A;  3L0R A;  3IMA B;  4N6U A;  3PS8 A;  5A0O B;  1N9J A;  1FA3 A;  1R4C A;  3LH4 A;  1DVD A;  1N5H A;  1CYU A;  1STF I;  1NB5 I;  1N5P A;  1A90 A;  3SVA A;  4N6O B;  5ELJ A;  2OCT A;  1MOL A;  4N6M A; 
#chains in the Genus database with same CATH topology
 1BRJ A;  1EKM A;  1STD A;  3JUM A;  2CWU A;  1YVS A;  3RDE A;  3V98 A;  1EUI C;  5CF2 A;  2OTL 3;  3DM8 A;  4MMY B;  1NO3 A;  1BVI A;  3AHS A;  4IT7 A;  1BRG A;  4HM7 B;  1ULI B;  4XDW A;  2UGI A;  5STD A;  3JUP A;  1OGX A;  1JRQ A;  3OXA A;  1OAC A;  4KFD A;  1LOY A;  3MKI A;  3EJV A;  1GYB A;  1RGG A;  1OCV A;  1OHS A;  1X1X A;  3LT9 A;  4O02 B;  2MC8 A;  3CCL 3;  3I55 3;  3K0Z A;  1QVG 2;  1IK3 A;  1DMQ A;  3GSP A;  7STD A;  1ZX2 A;  1MNL A;  1Q86 4;  1RJO A;  1B2M A;  2CK3 H;  4KFE A;  1LNI A;  2GU1 A;  1R4Y A;  2ML6 A;  3AHW A;  2BU4 A;  3ZG0 A;  1IVW A;  3ER7 A;  3NXJ A;  4EV2 A;  3Q90 A;  1IQ8 A;  4FCM A;  3LML A;  2YFL B;  3Q3F A;  4LMI A;  3T8U A;  3WOD G;  3A5E A;  1A2K A;  3JUO A;  3CXC 2;  5LC6 A;  1FGM A;  5CF1 A;  1EG9 B;  5JPU A;  5M1A A;  3VSY A;  3BNB A;  1BAO A;  1GOU A;  4CPK A;  1BNR A;  1K41 A;  1RGK A;  1M1X B;  1CEW I;  6GSP A;  3X41 A;  3UL6 A;  1M9G A;  3FG3 A;  3CCQ 3;  2HOH A;  1ZS7 A;  2XF3 A;  3SOA A;  3BIR A;  2H0G A;  3PGB A;  3S28 A;  3CC7 3;  4XDV A;  2FXT A;  1I2G A;  1T3B A;  3GAX A;  4K61 A;  3ROB A;  1I8V A;  1T5Y A;  1VQL 3;  2O9U X;  1W6G A;  4IPB A;  3T8N A;  3ECF A;  1YIT 3;  3PZW A;  3KII A;  5CXO A;  5AYR B;  3CCM 3;  1V74 A;  4HM3 B;  4HM1 B;  4OVM A;  2XFT A;  3U1W A;  5AIH A;  1QAK A;  1IYY A;  2W56 A;  2BO9 B;  1GD3 A;  4WP5 A;  1O7M B;  4K1U A;  5EEO A;  2HMN B;  3FG4 A;  5JBS A;  1LOV A;  3SED A;  3EC9 A;  4N6N B;  1F8N A;  1W4N A;  5AII A;  3K7C A;  3U97 A;  7GSP A;  5FW5 A;  1GS3 A;  3GZR A;  5DRV A;  1FGR A;  2H0H A;  1BU4 A;  2K3D A;  3URP A;  3CMA 3;  3G0K A;  1O7W B;  1RN7 A;  8CHO A;  5AYS C;  1VQ6 3;  4FMD A;  2KXG A;  5ELU A;  2XH9 A;  5HOH A;  2SAR A;  1Q82 4;  2P0M A;  3BB9 A;  3HOH A;  1RGA A;  5G1K A;  1AV4 A;  3FCS B;  5IG3 A;  1OHP A;  4FMB A;  1G0T A;  2V1L A;  2XGN A;  3MG3 A;  3RGA A;  1A2V A;  3CU3 A;  1GMQ A;  3F8X A;  4OK0 A;  1YJW 3;  1FYS A;  1B2X A;  1O7G B;  3KCH A;  3WMD A;  1R4C A;  2RCD A;  3H51 A;  1RGF A;  3JUQ A;  4HM8 B;  4EW5 A;  1CH0 A;  1I3I A;  3DGO A;  2CHC A;  3EX9 A;  3N9H A;  1K73 4;  4XBT A;  3CD6 3;  1O7N B;  1HZ1 A;  2GBX B;  4AKZ A;  4EXR A;  1YGE A;  2KAA A;  3A76 A;  3G4S 3;  2RFR A;  4WYK A;  5IF6 A;  3WHO A;  5ELJ A;  1LVN A;  1ROV A;  2OCT A;  3D4A A;  1Q7Y 4;  1VQ4 3;  1Q7H A;  2F5M A;  3AMO A;  2CWV A;  3SYU A;  4H61 A;  6STD A;  4KVH A;  3F7X A;  3FF2 A;  1JKG A;  2XRX B;  2KCD A;  4J9A A;  3X3X A;  4GL6 A;  4RZM A;  2OOV A;  1BSE A;  2KF3 A;  1EQK A;  2W0Q A;  3CPW 2;  1JBT A;  3VF1 A;  2HMK B;  4WWU C;  1WMP A;  2W9P A;  3G71 3;  2Y73 A;  1Q81 4;  1JBR A;  1TJD A;  2OQE A;  5M19 A;  2JQ5 A;  4N3V A;  3EN8 A;  1SQW A;  3CCR 3;  4H3U A;  1BSB A;  4XM4 A;  5G1L A;  1HKX A;  3LTB A;  1YI2 3;  1DMM A;  1VZZ A;  3BND A;  1WNH A;  2CX0 A;  1UI7 A;  1TP6 A;  3NQY A;  3NM2 A;  1U5O A;  1CYV A;  3GWR A;  3X3Z A;  3F7S A;  1LXE A;  1BNI A;  2GSP A;  1DYU A;  3S67 A;  4FMC A;  1ROA A;  4X2O A;  3WDG B;  2CC3 A;  4GB5 A;  5IEN A;  2D1W A;  3LTD A;  2W03 A;  4R9K A;  1I2E A;  1NB3 I;  1G96 A;  1Q40 A;  2CG0 A;  2P05 A;  3KFQ C;  5EQL A;  1FZU A;  2GU3 A;  1W7C A;  2QA4 3;  1IVV A;  4HKV B;  5AIG A;  5D83 A;  2XSO B;  4L7K A;  3MSO A;  3PXM A;  3NX0 A;  4U13 A;  3I0Y A;  1NU3 A;  2W56 B;  1GOY A;  1VQQ A;  2CFK A;  3DXO A;  2INX A;  1RGL A;  2FGT A;  3WA2 X;  4BTY A;  1GD4 A;  2ZA4 A;  1IU7 A;  4FCZ A;  4J5G A;  3CME 3;  3DGL A;  1RCK A;  1SPU A;  3BNE A;  1YJN 3;  1IV7 A;  1RGE A;  3PCR A;  3K5T A;  2RGQ A;  5AEU B;  3LOY A;  3X40 A;  2J8X B;  3KSE D;  1K9M 4;  3S5C A;  1V58 A;  1SAR A;  3F14 A;  4XBX A;  1M1K 4;  2LYX A;  4J5K A;  2P0X A;  1BAN A;  1RRL A;  1JN5 A;  1OHO A;  3CCU 3;  1TFK A;  1BNG A;  1OH0 A;  1ZO2 A;  4MJD A;  3OWU A;  1VQO 3;  1I0V A;  1BNJ A;  3D9R A;  3NHX A;  3NBB A;  2K0M A;  1PY3 A;  2K54 A;  3MWZ A;  1BNS A;  3D5I A;  2HMM B;  1NJI 4;  3N8B A;  4HM4 B;  3FH1 A;  2KRT A;  3NV0 A;  4GHO A;  1JZD A;  2CG1 A;  5BVB A;  1OUN A;  1RTU A;  3Q2P A;  1UUV B;  1FUT A;  2IYJ A;  3D3L A;  1B21 A;  1N9E A;  2CH9 A;  4GSP A;  9RNT A;  3GZB A;  3AGO A;  3BLZ A;  3L0R A;  4EV5 A;  1C54 A;  4WYK B;  5TGN A;  1QAL A;  1IQX A;  1Q9E A;  2BMQ B;  2RSX A;  1SIH A;  2F99 A;  1B2U A;  3IMA B;  2M7O A;  3AMO B;  2C10 A;  5AEW B;  1BGS A;  1W00 A;  5AIF A;  1SII A;  2OTJ 3;  1N9J A;  1FA3 A;  2WGQ A;  4KZ1 A;  4BU4 A;  1JKG B;  1I2F A;  1VQ8 3;  2KF5 A;  3MG2 A;  1W2Z A;  3AGN A;  5D82 A;  3B4P A;  3V99 A;  1LNH A;  1UW1 A;  1LRA A;  3N54 B;  4MMX B;  1Y4K A;  3HX8 A;  1AQZ A;  2CFL A;  3DZL A;  3DGY A;  2BNG A;  3D79 A;  1AVL A;  1NB5 I;  1E3R A;  1QJG A;  3B7C A;  1ISK A;  1N5P A;  3CPO A;  3LZA A;  3KZT A;  4X2H A;  1IT8 A;  2GBW B;  2XSH B;  3B8L A;  4N6O B;  2ZDJ A;  2Z76 A;  1N8Q A;  4R80 A;  1Q42 A;  2CFD A;  2L1S A;  4JF8 A;  1A2P A;  1IQY A;  5IEO A;  3STD A;  3ZG5 A;  2RBI A;  1US1 A;  1MGW A;  1Z1S A;  3TDG A;  1O7H B;  4CDL A;  2CFG A;  2ZHX B;  3X42 A;  2PZV A;  4HVN A;  1JB5 A;  4J8T A;  1YIJ 3;  7RNT A;  3K9M C;  1Q40 B;  4HJL B;  1MGR A;  5M18 A;  3NBJ A;  2P09 A;  2YX9 A;  2GEX A;  1BNF A;  4CJN A;  1I70 A;  5LC7 A;  3OX9 A;  3DGN A;  2W6J H;  4XB5 A;  5CK6 A;  3ZFZ A;  1E97 A;  3Q1C A;  1K8A 4;  1LOW A;  2MF7 A;  2W2C A;  1FUS A;  1D6U A;  1RRH A;  2BMO B;  1GY6 A;  2IMJ A;  3S27 A;  4EYC A;  1L5G B;  1SJW A;  3IPT A;  3MHE A;  1IT7 A;  3DY5 A;  3F40 A;  1DMN A;  3KKG A;  1M90 4;  1AY7 A;  5IG5 A;  2AAD A;  3EBY A;  8RNT A;  1CQS A;  2SBL A;  1KD1 4;  4WFO A;  1BRI A;  4ZM8 A;  1RKY A;  4O8S A;  2FNQ A;  2W9Q A;  4MMZ B;  1JB4 A;  4FMA A;  1MWT A;  1RNT A;  1BRS A;  2Z7A A;  4AKY A;  1JN5 B;  2WGO A;  3DH2 A;  5HGR A;  3UJM A;  3E99 A;  3KE7 A;  2UUG C;  4JRF A;  1QVF 2;  2YFI B;  1BIR A;  1E3V A;  1YGW A;  2GEY A;  4HM0 B;  2QEX 3;  5BU4 A;  1I0X A;  4HZB B;  1GY7 A;  3H3H A;  4N6V 0;  3VGN A;  1B27 A;  1BUJ A;  3NV0 B;  3NQZ A;  1PYL A;  2Z77 A;  3MG1 A;  5IW9 A;  1BRH A;  1A67 A;  2B1X B;  4OUQ A;  1BSD A;  1UI8 A;  1K28 A;  1IDP A;  3F8H A;  4KT3 B;  4LGQ A;  2CX1 A;  3CC2 3;  1RDS A;  1KSI A;  3FKA A;  4NRE A;  1TU5 A;  1UUG B;  3CCV 3;  5KP4 A;  1T2I A;  3HZP A;  3PYJ A;  1VQN 3;  1BSC A;  4PEJ A;  1HYF A;  1W01 A;  4AEQ A;  2GXF A;  2P38 A;  1YJ9 3;  3X3Y A;  4LEH A;  5CLK A;  3CC4 3;  2A15 A;  2E2U A;  4LZI A;  1C7H A;  1PU4 A;  4WHA A;  1V57 A;  2UX0 A;  1JV2 B;  2YFJ B;  4O3V A;  5IG0 A;  1BUQ A;  4I4K A;  5IG4 A;  2BHM A;  3OV4 A;  2WOH A;  3FF0 A;  3UL5 A;  1DE3 A;  4N6L A;  4STD A;  3SX1 A;  5GSP A;  2KF4 A;  1HU9 A;  1G02 A;  2F98 A;  2OQE C;  2QGU A;  2W04 A;  1MWR A;  2D42 A;  2JDI H;  1BSA A;  2XR8 B;  3EQQ B;  2CIU A;  3BU4 A;  3DMC A;  3FSD A;  4FR9 A;  1S5A A;  4LYL B;  1LQG C;  1W6Y A;  1WMO A;  4R1K A;  2Y74 A;  3JUN A;  4QWT A;  3MPH A;  4XBY A;  1U8C B;  5BXQ A;  1RNB A;  3EHC A;  3GZY B;  5BIR A;  2CFW A;  1OGZ A;  1W2B 2;  1O7P B;  3EF8 A;  3O8Y A;  1JZO A;  1IVU A;  3WOE B;  3KSP A;  1W6C A;  3DUK A;  5I97 A;  1J2B A;  2CW9 A;  1DVD A;  1N5H A;  5IER A;  3DGM A;  1STF I;  2CWT A;  1OF5 A;  1UUW B;  4NHF A;  2I9W A;  1LQM B;  1TFO A;  4BL2 A;  1RGC A;  3D5G A;  3FZW A;  2HMJ B;  3SVA A;  2IY2 A;  1X1W A;  1NDO B;  3EB8 A;  1VQP 3;  2ML5 A;  3EN1 B;  3LT8 A;  4ORL A;  1I3F A;  1MOL A;  1MWS A;  3FG1 A;  4N6M A;  1BNE A;  1BRK A;  2IA7 A;  5RNT A;  1UCL A;  2F56 A;  3IJE B;  1VQ7 3;  4HYZ A;  3NUV A;  4BTW A;  1JNQ A;  1T2H A;  2E2T A;  2BIR A;  2O3O A;  3KN4 A;  4HBR A;  4I5Q A;  3F9S A;  4R9L A;  3CCS 3;  1FUW A;  4CCV A;  4KFF A;  1YNV X;  4RNT A;  4RNY A;  2QIY A;  1B2Z A;  1B3S A;  4HM5 B;  4LSO A;  2E2V A;  4BTX A;  1X1U A;  3PCS A;  1WTH A;  2ZL8 A;  4N6T A;  2XFS A;  2C11 A;  5EVH A;  4NPB A;  1BRN L;  2WOF A;  4L8P A;  1QAF A;  1ZGX A;  1TTO A;  3B4O A;  1OPY A;  2Z6B A;  3QRD A;  1GSP A;  1LOX A;  2L4V A;  3LYG A;  2OWP A;  1TRP A;  5DRE A;  1FGT A;  4BL3 A;  2F5W A;  1B2S A;  2F4Y A;  2CKF B;  3SXX A;  3NM7 A;  2AAE A;  3V92 A;  1GMP A;  3OWY A;  1VQ5 3;  3RGR A;  5IEP A;  2STD A;  4HM6 B;  1DVC A;  4HZ9 B;  1RN4 A;  5KP1 A;  1KC8 4;  1N8R 4;  1EA2 A;  1WQL B;  2HMO B;  3G8Z A;  1PFP A;  4R4K A;  4IIA A;  4MEI A;  2PNC A;  3RNT A;  2KF6 A;  1BOX A;  3G16 A;  4EC6 A;  1TIJ A;  4ILF A;  1IVX A;  3LXU X;  1FGO A;  3I56 3;  4FCJ A;  3FLJ A;  5G2G A;  3BNC A;  3M8C A;  1UGH I;  1IV9 A;  1RGH A;  2B24 B;  2C4B A;  3GZX B;  3WA3 A;  1VQ9 3;  3LTC A;  1D6Y A;  1GY5 A;  1X1Y A;  1RN1 A;  1GOV A;  1JB2 A;  3MYT A;  2XEP A;  1S72 3;  4TX4 A;  1GMR A;  1MWU A;  3EE1 A;  4K1V A;  2XGL A;  2IUK A;  4DKI A;  4L8O A;  2R41 A;  1WMN A;  5AI1 A;  5D81 A;  3FGY A;  1DET A;  1YVB I;  3UB1 A;  4Q53 A;  2RNT A;  1RHL A;  3CCJ 3;  1ASK A;  1W02 A;  1B20 A;  1UDI I;  3CCE 3;  2BT3 A;  1UCK A;  2Q07 A;  3QK9 A;  1YHQ 3;  3GRD A;  3WOF B;  4RNZ A;  1FGQ A;  1KWI A;  1OF5 B;  3ALA A;  1EEJ A;  3LTA A;  1RSN A;  3EBT A;  3T0U A;  1JJ2 2;  1RMS A;  1KQS 2;  6RNT A;  1RLS A;  3HIG A;  1AR0 A;  4O2H A;  3S29 A;  4N6U A;  2IUJ A;  4BIR A;  3PS8 A;  4RBN A;  3OW2 2;  5A0O B;  3JVC A;  5FGO A;  3CNX A;  2H0I A;  1VQK 3;  1UCJ A;  5JPP A;  3J7Y d;  1NWW A;  2HML B;  1VQM 3;  1JBS A;  3SLU A;  3LH4 A;  3G6E 3;  4EBG A;  1NNV A;  2R4I A;  1UCI A;  3K63 A;  1AVK A;  4HAA A;  4K90 B;  3CNM A;  1CYU A;  2OOV C;  1W5Z A;  1ULJ B;  1TUH A;  3NBR A;  1A90 A;  2F86 B;  3HII A;  3OWS A;  3WR2 A;  1UGI A;  2WO0 A;  1TRQ A;  2BMR B;  4HOH A;  4HM2 B;  1RCL A;  3SOY A;  3HK4 A;  3UNL A;  5KP3 A;  1D6Z A;  2LQV A;  1FW7 A;  4G1M B;  1QMA A;  3HI7 A; 
#chains in the Genus database with same CATH homology
 1EKM A;  1STD A;  3JUM A;  2CWU A;  3RDE A;  3V98 A;  5CF2 A;  2OTL 3;  3DM8 A;  4MMY B;  1NO3 A;  4IT7 A;  4HM7 B;  1ULI B;  4XDW A;  5STD A;  3JUP A;  1OGX A;  1JRQ A;  3OXA A;  1OAC A;  4KFD A;  3MKI A;  3EJV A;  1GYB A;  4O02 B;  1OCV A;  1OHS A;  3LT9 A;  2MC8 A;  3CCL 3;  3I55 3;  3K0Z A;  1QVG 2;  1IK3 A;  1DMQ A;  7STD A;  1ZX2 A;  1MNL A;  1Q86 4;  1RJO A;  2CK3 H;  4KFE A;  2GU1 A;  2ML6 A;  1IVW A;  3ER7 A;  3NXJ A;  4EV2 A;  3Q90 A;  1IQ8 A;  4FCM A;  3LML A;  2YFL B;  3T8U A;  4LMI A;  3CXC 2;  3WOD G;  1A2K A;  3JUO A;  5LC6 A;  1FGM A;  5CF1 A;  1EG9 B;  5JPU A;  3VSY A;  3BNB A;  1K41 A;  1M1X B;  1CEW I;  3X41 A;  3UL6 A;  1M9G A;  3FG3 A;  3CCQ 3;  2XF3 A;  3SOA A;  3S28 A;  3PGB A;  3CC7 3;  4XDV A;  2FXT A;  3GAX A;  3ROB A;  4K61 A;  1VQL 3;  2OTJ 3;  1T5Y A;  2O9U X;  1W6G A;  4IPB A;  3T8N A;  3ECF A;  1YIT 3;  3PZW A;  3KII A;  5CXO A;  5AYR B;  3CCM 3;  1V74 A;  4HM3 B;  4HM1 B;  4OVM A;  2XFT A;  3U1W A;  5AIH A;  1QAK A;  2W56 A;  2BO9 B;  1GD3 A;  4WP5 A;  1O7M B;  4K1U A;  5EEO A;  2HMN B;  3FG4 A;  5JBS A;  3SED A;  3EC9 A;  4N6N B;  1F8N A;  1W4N A;  5AII A;  3K7C A;  3U97 A;  5FW5 A;  1GS3 A;  3GZR A;  5DRV A;  1FGR A;  3CMA 3;  3G0K A;  1O7W B;  1RN7 A;  8CHO A;  5AYS C;  1VQ6 3;  4FMD A;  2KXG A;  5ELU A;  2XH9 A;  1Q82 4;  2P0M A;  3BB9 A;  1AV4 A;  3FCS B;  5IG3 A;  1OHP A;  4FMB A;  2V1L A;  2XGN A;  3MG3 A;  3RGA A;  1A2V A;  3CU3 A;  3F8X A;  4OK0 A;  1YJW 3;  1O7G B;  3WMD A;  1R4C A;  2RCD A;  3H51 A;  3JUQ A;  4HM8 B;  3DGO A;  2CHC A;  3EX9 A;  3N9H A;  1K73 4;  4XBT A;  3CD6 3;  1O7N B;  2GBX B;  4AKZ A;  4EXR A;  1YGE A;  3A76 A;  3G4S 3;  2RFR A;  4WYK A;  5IF6 A;  5ELJ A;  1LVN A;  1ROV A;  2OCT A;  1Q7Y 4;  1VQ4 3;  3AMO A;  2CWV A;  4H61 A;  6STD A;  4KVH A;  3F7X A;  3FF2 A;  2XRX B;  1JKG A;  2KCD A;  4J9A A;  3X3X A;  4GL6 A;  4RZM A;  2OOV A;  1EQK A;  2W0Q A;  3CPW 2;  3VF1 A;  2HMK B;  4WWU C;  1WMP A;  2W9P A;  3G71 3;  2Y73 A;  1Q81 4;  2OQE A;  2JQ5 A;  4N3V A;  3EN8 A;  1SQW A;  3CCR 3;  4H3U A;  4XM4 A;  1HKX A;  3LTB A;  1YI2 3;  1DMM A;  1VZZ A;  3BND A;  1WNH A;  1UI7 A;  1TP6 A;  3NQY A;  3NM2 A;  1U5O A;  1CYV A;  3GWR A;  3X3Z A;  3F7S A;  1LXE A;  1DYU A;  3S67 A;  4FMC A;  1ROA A;  4X2O A;  3WDG B;  2CC3 A;  4GB5 A;  5IEN A;  2D1W A;  3LTD A;  2W03 A;  4R9K A;  1NB3 I;  1Q40 A;  1G96 A;  2CG0 A;  2P05 A;  5EQL A;  3KFQ C;  2GU3 A;  1W7C A;  2QA4 3;  1IVV A;  4HKV B;  5AIG A;  5D83 A;  2XSO B;  4L7K A;  3MSO A;  3PXM A;  3NX0 A;  4U13 A;  3I0Y A;  1NU3 A;  2W56 B;  2CFK A;  3DXO A;  2INX A;  3WA2 X;  2FGT A;  4BTY A;  1GD4 A;  4FCZ A;  1IU7 A;  3CME 3;  3DGL A;  1SPU A;  1YJN 3;  3BNE A;  1IV7 A;  3PCR A;  3K5T A;  2RGQ A;  5AEU B;  3LOY A;  3X40 A;  3KSE D;  1K9M 4;  3S5C A;  3F14 A;  4XBX A;  1M1K 4;  2LYX A;  2P0X A;  1RRL A;  1JN5 A;  1OHO A;  3CCU 3;  1TFK A;  1ZO2 A;  1OH0 A;  4MJD A;  1VQO 3;  3OWU A;  3NHX A;  3D9R A;  3NBB A;  2K0M A;  3MWZ A;  2K54 A;  1NJI 4;  2HMM B;  3N8B A;  4HM4 B;  3FH1 A;  2KRT A;  3NV0 A;  2CG1 A;  5BVB A;  1OUN A;  3Q2P A;  1UUV B;  3D3L A;  1N9E A;  2CH9 A;  3GZB A;  3BLZ A;  3L0R A;  4EV5 A;  4WYK B;  5TGN A;  1QAL A;  1IQX A;  2BMQ B;  2RSX A;  1SIH A;  2F99 A;  3IMA B;  2M7O A;  3AMO B;  2C10 A;  5AEW B;  1W00 A;  5AIF A;  1SII A;  1N9J A;  1FA3 A;  2WGQ A;  4KZ1 A;  1JKG B;  1VQ8 3;  3MG2 A;  3V99 A;  1W2Z A;  5D82 A;  3B4P A;  1LNH A;  1UW1 A;  3N54 B;  4MMX B;  1Y4K A;  3HX8 A;  2CFL A;  3DZL A;  2BNG A;  1AVL A;  1NB5 I;  1E3R A;  1QJG A;  3B7C A;  1ISK A;  1N5P A;  3CPO A;  3LZA A;  3KZT A;  4X2H A;  1IT8 A;  2GBW B;  2XSH B;  3B8L A;  4N6O B;  2ZDJ A;  2Z76 A;  1N8Q A;  4R80 A;  1Q42 A;  2CFD A;  4JF8 A;  1IQY A;  5IEO A;  3STD A;  1US1 A;  1Z1S A;  3TDG A;  1O7H B;  4CDL A;  2CFG A;  3X42 A;  2PZV A;  4HVN A;  1JB5 A;  4J8T A;  1YIJ 3;  3K9M C;  1Q40 B;  4HJL B;  3NBJ A;  2P09 A;  2YX9 A;  2GEX A;  5LC7 A;  3OX9 A;  3DGN A;  2W6J H;  4XB5 A;  5CK6 A;  1E97 A;  3Q1C A;  1K8A 4;  2MF7 A;  2W2C A;  1D6U A;  1RRH A;  2BMO B;  1GY6 A;  2IMJ A;  3S27 A;  4EYC A;  1L5G B;  1SJW A;  3IPT A;  3MHE A;  1IT7 A;  3DY5 A;  3F40 A;  1DMN A;  3KKG A;  1M90 4;  5IG5 A;  3EBY A;  1CQS A;  2SBL A;  1KD1 4;  4WFO A;  4ZM8 A;  1RKY A;  4O8S A;  2FNQ A;  2W9Q A;  4MMZ B;  1JB4 A;  4FMA A;  2Z7A A;  4AKY A;  1JN5 B;  2WGO A;  3UJM A;  5HGR A;  3E99 A;  3KE7 A;  4JRF A;  1QVF 2;  2YFI B;  1E3V A;  4HM0 B;  2GEY A;  2QEX 3;  4HZB B;  1GY7 A;  3H3H A;  4N6V 0;  3VGN A;  3NV0 B;  3NQZ A;  2Z77 A;  3MG1 A;  5IW9 A;  1A67 A;  2B1X B;  4OUQ A;  1UI8 A;  1K28 A;  1IDP A;  3F8H A;  4LGQ A;  3CC2 3;  1KSI A;  3FKA A;  4NRE A;  1TU5 A;  3CCV 3;  5KP4 A;  3HZP A;  1VQN 3;  3PYJ A;  4PEJ A;  1W01 A;  4AEQ A;  2GXF A;  2P38 A;  1YJ9 3;  3X3Y A;  4LEH A;  5CLK A;  3CC4 3;  2A15 A;  2E2U A;  4LZI A;  1C7H A;  1PU4 A;  4WHA A;  2UX0 A;  2YFJ B;  1JV2 B;  4O3V A;  5IG0 A;  1BUQ A;  4I4K A;  5IG4 A;  2BHM A;  3OV4 A;  2WOH A;  3FF0 A;  3UL5 A;  4N6L A;  4STD A;  3SX1 A;  2QGU A;  1HU9 A;  2F98 A;  2OQE C;  2W04 A;  2D42 A;  2JDI H;  2XR8 B;  3EQQ B;  2CIU A;  3DMC A;  3FSD A;  4FR9 A;  4R1K A;  1S5A A;  4QWT A;  1WMO A;  1W6Y A;  4XBY A;  2Y74 A;  3JUN A;  5BXQ A;  3MPH A;  1U8C B;  3EHC A;  3GZY B;  2CFW A;  1OGZ A;  1W2B 2;  1O7P B;  3EF8 A;  3O8Y A;  1IVU A;  3WOE B;  3KSP A;  1W6C A;  3DUK A;  5I97 A;  1J2B A;  2CW9 A;  1DVD A;  1N5H A;  5IER A;  3DGM A;  1STF I;  2CWT A;  1OF5 A;  1UUW B;  4NHF A;  2I9W A;  1TFO A;  3FZW A;  2HMJ B;  3SVA A;  1NDO B;  3EB8 A;  1VQP 3;  2ML5 A;  3EN1 B;  3LT8 A;  4ORL A;  1MOL A;  3FG1 A;  4N6M A;  2IA7 A;  3IJE B;  1VQ7 3;  4HYZ A;  3NUV A;  4BTW A;  1JNQ A;  2E2T A;  2O3O A;  3KN4 A;  4R9L A;  4HBR A;  3F9S A;  3CCS 3;  1FUW A;  4CCV A;  4KFF A;  4RNY A;  2QIY A;  4HM5 B;  4LSO A;  2E2V A;  4BTX A;  3PCS A;  1WTH A;  2ZL8 A;  4N6T A;  2XFS A;  2C11 A;  5EVH A;  2WOF A;  4L8P A;  1QAF A;  3B4O A;  1OPY A;  2Z6B A;  3QRD A;  1LOX A;  2L4V A;  3LYG A;  2OWP A;  5DRE A;  1FGT A;  2CKF B;  3SXX A;  3NM7 A;  3V92 A;  3OWY A;  1VQ5 3;  3RGR A;  5IEP A;  2STD A;  4HM6 B;  1DVC A;  4HZ9 B;  5KP1 A;  1N8R 4;  1KC8 4;  1EA2 A;  1WQL B;  2HMO B;  3G8Z A;  1PFP A;  4R4K A;  4IIA A;  4MEI A;  2PNC A;  3G16 A;  4EC6 A;  1TIJ A;  1IVX A;  3LXU X;  1FGO A;  3I56 3;  4FCJ A;  3FLJ A;  5G2G A;  3BNC A;  3M8C A;  1IV9 A;  2B24 B;  3GZX B;  3WA3 A;  1VQ9 3;  3LTC A;  1D6Y A;  1GY5 A;  1JB2 A;  3MYT A;  2XEP A;  1S72 3;  4TX4 A;  3EE1 A;  4K1V A;  2XGL A;  2IUK A;  4L8O A;  1WMN A;  5AI1 A;  5D81 A;  3FGY A;  3UB1 A;  1YVB I;  4Q53 A;  3CCJ 3;  1ASK A;  1W02 A;  3CCE 3;  2BT3 A;  2Q07 A;  3QK9 A;  1YHQ 3;  3GRD A;  3WOF B;  4RNZ A;  1FGQ A;  1KWI A;  1OF5 B;  3ALA A;  3LTA A;  3EBT A;  3T0U A;  1JJ2 2;  1KQS 2;  3HIG A;  1AR0 A;  4O2H A;  3S29 A;  4N6U A;  2IUJ A;  3OW2 2;  3PS8 A;  4RBN A;  5A0O B;  3JVC A;  5FGO A;  3CNX A;  1VQK 3;  5JPP A;  3J7Y d;  1NWW A;  2HML B;  1VQM 3;  3SLU A;  3LH4 A;  3G6E 3;  4EBG A;  2R4I A;  3K63 A;  1AVK A;  4K90 B;  3CNM A;  1CYU A;  2OOV C;  1W5Z A;  1ULJ B;  1TUH A;  3NBR A;  1A90 A;  2F86 B;  3HII A;  3OWS A;  2WO0 A;  2BMR B;  4HM2 B;  3SOY A;  3HK4 A;  3UNL A;  5KP3 A;  1D6Z A;  2LQV A;  4G1M B;  1QMA A;  3HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...