2CHBD

Cholera toxin b-pentamer complexed with gm1 pentasaccharide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN
publication title Structural studies of receptor binding by cholera toxin mutants.
pubmed rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2chbD00
3EFXD 1EEID 1I4GA 1CHPD 4L63B 1TS2A 3BVGA 1PTOH 3MC0B 1UUPA 5ELDA 1KLGD 4RHSA 1BCPC 2AQ2B 1EWCA 1D5XC 1D5MC 1JWSD 4RGTA 1LTBD 4K6LA 2Z8LA 1M4VA 2CHBD 5D3IB 5ELFA 3BVZA 3DWAA 1FGBD 1MD2D 4TSSA 2AQ3B 1SJED 1SBBB 1LT3D 3GP7A 4L6TB 3V05A 1TY0A 5FKAC 1JWUD 3DWQA 4OHJA 1B1ZA 1CQVA 1LT4D 3OWEB 4RHRA 1SE4A 1XXGA 1ET9A 1HQRD 3CHBD 1HA5A 2R61A 1RDPD 1SE3A 3BVMA 1LT5D 1RD9D 1B44D 1PZKD 2AQ1B 2SEBD 1AW7A 1AN8A 5D3DA 1FNVA 1HTLD 1JWMD 3DWPA 1EFID 1UNSA 4RGNA 5ELCA 1TS3A 1I4PA 1HXYD 4UDUC 1PZJD 1L0XB 3R2TA 1PRTC 1LTID 1XTCD 3R2IA 1D5ZC 4RGOS 3BZDB 2O2LD 1S5ED 1PTOB 2QEJC 1ENFA 1ET6A 1LLRD 1LO5D 5FK9C 5ELEA 1PTOF 4Z9CB 1PTOD 1SEBD 4C56C 1CHQD 3KLSX 4RFBA 1FNUA 1F77A 1SXTA 2IJ0A 1S5BD 3SEBA 3TSSA 1CK1A 1BCPB 1RF2D 1V1PB 1I4HA 1T5XD 3MFGA 3BYYB 1PYWD 2RDHA 1LT6D 1EU4A 1BCPF 1SE2A 1BCPD 1STEA 3URYA 1DYQA 2NTTA 1QILA 1PZID 1TS5A 3R8BA 1SJHD 1CT1D 2G9HD 2ICIA 4DXGA 1LTAD 1EEFD 1JQYD 2RDGA 1TS4A 1L0YB 5TSSA 1LTTD 1KLUD 1ESFA 1TY2A 4BWGB 4RGMA 1D6EC 1I4XA 1LTRD 5I4DA 3BYTB 4RCOA 2IPKD 2XRQD 3W2DA 2TSSA 1S5CD 1EU3A 2WV6D 1RCVD 1FNWA 1I4RA 1LTSD 2QILA 1I4QA 1S5FD 1V1PA 1LTGD 3O13A 4O1NA 2XN9C 1JR0D 2XRSD 4ZYSA 1JCKB 1KTKA 2XNAC 1PRTB 2NTSA 1V1OA 3EA6A 1PTOC 5ELBA 1DJRD 1GOZA 4RH6A 1FD7D 1G8ZD 1PRTF 1PRTD 2J4XA 1BXTA 1S5DD 4DXFA
chains in the Genus database with same CATH superfamily
3E3XA 1I4GA 3KLWA 1TS2A 1QVCA 5M5WB 3KOJA 1QCBD 3I2ZA 5I6YA 2VQFQ 1QVFA 5JEAH 2DNEA 3TZDA 5DNFA 1R9TB 1CKMA 3A5UA 1YBYA 4G7ZC 1B70B 2KQ3A 3VR5A 4A3KH 1P16A 4XTCS 3NQIA 2E5LL 2A6ED 1X3FA 2F0HA 2HCCA 4JBJA 2BA0A 2R61A 1PYSB 3GDEA 3GTQH 1E2VA 5K5PA 3F2DA 1LM0A 2F0FA 2B2WA 2ZXRA 4DNIA 5KGUA 5FO7B 1IYJB 1HTLD 1S3OA 4DUYQ 3WOEA 3ULPA 4B3RQ 3IFDA 2F0UA 1M8AA 1Y8OB 2CWPA 5ELOA 1L0XB 4C2MH 2YYZA 1JOQA 3T1YQ 2I5HA 3DM3A 3BZDB 4BBRG 2R92H 1S5ED 5C44H 3HOUB 3CPFA 1WTVA 4BY7G 2DUDA 3PUVA 2JA8B 1PH8A 3G48A 2CKZB 1UAPA 4X6AH 4N9PA 2IJ0A 1S5BD 1EL0A 4RAUC 2XWJB 1PMRA 2QF7A 2H4OA 3G6JB 3URYA 4KHZA 5M5WH 3RUZA 1QNKA 2H5XA 5AJ3L 3PIO3 1Y1VB 1I6HB 2D9UA 4OL7A 3J81j 1R9TH 1CSQA 5BR8Q 4FF3A 3C1EA 4QUCA 4P72A 1R4PB 5KEEA 1SRUA 1JT8A 4N9TA 2PPBC 2A69C 3RR5A 1C7YA 1XMOL 1EOTA 4KD3A 2HIXA 2MO0A 4FF1A 2K01A 1LACA 2DGYA 1V1PA 1IBMQ 5T1IA 1KD1C 5JEAG 1XNRL 1F9RA 2A6HC 2K1BA 4QCLA 1SNOA 2OCEA 4B3TQ 2E2JB 1PTOC 3GV3A 3OMCA 1FYCA 2EYLA 4DV5Q 3F8TA 2D2CC 4KN4C 1ENAA 1ICFB 1SMXA 4MTNA 1K8OA 4HIMA 4AYBE 3HOUH 4EQPA 4MTKA 1VQAA 5I6WA 2JA8H 3OTOQ 1Q7YC 1V8QA 4XQJA 4GNXA 2IX3A 4O42A 3PO3B 2K5VA 2B2VA 4DAPA 3CCLA 5FLMH 2ZTEA 3T51B 4TSSA 1IKMA 1NSNS 3FP9A 1XJVA 4IALA 3KJOA 4BA1I 5FKAC 2AWNA 1JB3A 1A63A 1X6OA 5KIXA 2VQEL 1EYAA 1Y1VH 2AUKA 2NWGA 3I8ZA 5C44G 4ZCKA 1I6HH 4OEMB 5E4WC 5IT9E 1F9PA 1BF4A 3T1HL 1EY8A 3DWPA 2WB1E 2A69D 1JE5A 4A3FB 4RKLA 1SYFA 3FPPA 1KABA 1UNSA 3A74A 3W3AA 2RSOA 4GKKL 2B2YA 1B50A 1V9PA 1KQSA 2CWAA 3NSWA 4QIWB 2PI2A 2E2DC 1HNXQ 3PUWA 2A6HD 2V4DA 3I73A 3A55A 2PZWA 1HZ9A 2E2JH 3BZCA 4B08A 4KKUA 1PTOD 1VQKA 4LUOA 4JI5L 4UY8C 2L1BA 4UP9A 1EY0A 3K5MA 1FJGQ 3D31A 1IBLL 3BYYB 3ERSX 2B3GA 4HCSA 1A2TA 3PO3H 1FL0A 1VQJA 1H9KA 5E1FA 4DV1Q 1JB7A 4ULLA 2QKIC 1KDCA 4M8AA 3IFTA 1H95A 2UXBQ 3Q8DA 5J22A 1WCMB 1K9MC 1BBWA 1N33Q 1FNWA 1I4RA 3HOUG 4X3KA 1Q82C 2MNAA 1QVGA 1J5EL 3DUZA 2JA8G 2WP8J 1X32A 2ZM6Q 1HZAA 5IP9H 3MXPA 5FLMG 4KHPL 1VQNA 1QE6A 4A3FH 5CBEE 4YWMA 1EYGA 1IXRA 1VCIA 4OWXB 5IGFA 1PRTF 4DV6Q 1G2SA 1KNEA 1SYBA 3T4AC 2LSSA 1Y1VG 2AQ2B 3SK8A 1LTBD 4B9XA 2ZTCA 2E2HB 3K81C 4ZK9B 1MSGA 5IGBA 1S40A 2K28A 2JEBI 1B3QA 1AEXA 1VQOA 4QF4A 4IOAA 1TR5A 2C35B 3OYYA 2JP1A 2KJXA 2OT2A 1B1ZA 3CCMA 4RA8A 4DPGA 2JQOA 3N6RA 3D8GA 1CM9A 4A3GB 1ASYA 1TWAB 5IE8A 3K57A 2UXCL 3KJPA 4PMCA 2SEBD 1AW7A 2GVAA 3SK4A 1OXTA 3CKIB 3OOCA 2MQHA 2B2UC 1B3AA 1WCMH 1Z6HA 3CC4A 2ATWA 1W3SA 1R4QB 4LUZA 1X3PA 4U68A 2Z6KA 4H13C 2XTIA 2A5HA 3TP7A 3GTOB 2QGQA 1SROA 2JK8A 4J15A 2ZTDA 1FNUA 4GLAC 1ILQA 1V1PB 4CHTB 1E3PA 1JMCA 1EYDA 2OEOA 2MFIA 2K03A 4CDDC 3J7YW 4IJLA 3EBEA 1CT1D 2E2HH 2Q2UA 3BDLA 2BCOA 3QIAA 2EY5A 2L0CA 1VQ9A 2AUJD 4YIJA 4A3FG 3VYRA 5DAUA 4DNTB 1WJJA 4HAEA 1DGSA 1B9NA 1YEZA 1ICWA 2ZT9C 4MHEA 4GNXB 1D8LA 1O7ZA 3L7ZC 4FF2A 4A3GH 2ES2A 3KF6A 5KNDA 4O1NA 1NMGA 1JR0D 4DV7Q 1RL2A 4AQYL 2EQSA 2NVQB 3T16A 2F3WA 2XGTA 1E24A 1C8CA 2Z0SA 3R3OA 2X6LA 4CKBA 1UE5A 1MIUA 2J4XA 4NXNL 1SAPA 1VQ6A 1EY7A 3S2HH 4WJ3M 3FKIB 2P5ZX 4LK1C 3GTOH 1D5MC 1OXVA 2JN4A 2UXDL 2OXPA 3BVZA 4FF4A 3DMUA 3A7LA 3GP7A 4K2LA 1TXYA 5FO9B 2UUCQ 5C4ZA 2QW7A 3QB3A 5GAHC 3V05A 1DOLA 1WCMG 5ISRA 4MIUA 1VQLA 4L8JA 3J81L 3Q6SA 4LFAQ 3VYTA 1XPUA 4X64Q 4G7OC 2B63G 4F88A 2R7FA 1E7ZA 1EIYB 2VUMB 1SYEA 4DR6L 1G291 1PFMA 2NVYB 3MWYW 3M4QA 1FNVA 2UUBQ 4BY1B 5IGDA 4DV4Q 1QJOA 4C3JB 4WJWA 1NY4A 3OW2A 2FMCA 2EJGC 1BR9A 3JAMc 3TN2A 4OIJA 2RDFA 5CV7A 2NVQH 4IPCA 4JI7L 4LWCA 5IGEA 1PTOF 4Z9CB 3MZ5A 2F0VA 1CKOA 5LMUL 4JV5L 3C2PA 4POGA 1E1OA 4QJFA 4ODGA 3AMUA 1HUNA 2F1MA 1PYWD 2KCNA 4B3MQ 4A3GG 4OONA 3NPPA 4IO9A 3L0OA 3CMEA 3FKIH 3HKSA 3I55A 5DEHA 3ULJA 4EVOA 1EEFD 4J8QA 4IFDI 1WTXA 5JJLA 4CGYB 1HZBA 4HJ8A 3GD7A 1I4XA 3LWEA 2XRQD 5JJKA 5I2YA 2F03A 2A68C 2VUMH 5IP7H 2NVYH 2A73B 3BU2A 2FINB 2Z4HA 3E6ZX 2JXMB 4G57A 4BY1H 3QO2A 2NTSA 3ZJYC 2SNSA 4C3JH 4BA2I 3J80c 1N32L 1G8ZD 3I4OA 3TS2A 3TEHB 4LF6Q 1RHPA 1CI3M 1EIGA 1UUPA 1K0RA 4DU9A 4JBMA 3HOZB 5M5YB 4KKTA 2VNUD 5D3IB 4YY3L 5CC4A 4JI4Q 4LF4Q 4DR4Q 2F3VA 3PIOA 4DR5L 1XMQQ 3RNUA 1CQVA 1M90C 2YTYA 5LMNL 5GAEC 3NTIA 2NUCA 4JI8L 1PZKD 2UU9Q 3NUCA 4LF9L 4OWTB 3S16B 3E9HA 4CKEA 4JI0L 3HZXA 1DM0B 3NBIA 4DV0L 4X66Q 4K5VA 2RHSB 3S1QB 1X54A 4X65L 4CDCC 1L1OC 2A68D 2K5QA 4APVA 3PF5A 1KIXA 1H9RA 5EPLA 1JICA 2L4NA 4KN7C 4GS3A 2JA6B 1J8IA 4HSPA 2PZUA 1G6ZA 3PSIA 3ULLA 3M7NA 1E2ZA 5C0XJ 3VR4A 3KBXA 2SNMA 1BUVT 4G4KA 1K8GA 2L55A 3TRZA 3HGBA 2VUMG 5IP7G 3HOZH 5M5YH 5ELNA 4DR7L 1Q8IA 2F0MA 2D5DA 4LJZC 4OX9Q 2RDGA 4IUVA 1GHKA 1RIPA 3AQQA 4PV1C 4BY1G 4C3JG 2VB3X 1CFMA 1NMFA 5JJZA 1EOVA 4A3IB 1NUCA 3BYTB 2F4VQ 1STGA 2BDOA 3W2DA 1YNXA 3J81E 1XPRA 1PA6A 4IPHA 3X3MA 4X3TA 3U58A 5EJWA 4JBKA 4DR2L 1TWHB 2B2UA 4HN7A 1DOKA 5LMNW 3S24A 3S16H 4LFBL 1T5EA 1U4MA 1CKNA 4R8NA 2WINB 1X3GA 3S1QH 3PO2H 1I5FA 3OSOA 1A3UA 2KCCA 2PQEA 4JYAQ 4QMGA 2JA6H 1B7YB 1VQPA 4QQBX 1YVCA 1BVSA 3ERQA 2CH4A 3QWNA 3H3VI 3D4DA 4MNOA 2WAQE 4NB3A 5M3FB 2Z9HA 5CGKA 3NWSA 4IUQA 4L6TB 1VQIA 2O5IC 1CTMA 2JSOA 2VY3A 2A8VA 3LX0A 3F2UA 3Q23A 4L5TA 3FDTA 3NENA 5F2DA 1WFQA 2HD3A 4LMQD 2AQ1B 5FLXL 3GV6A 5IYDG 1KL9A 4A3IH 1STHA 4IUTA 1OTCA 1HXYD 2EXZA 1UWVA 1QB5D 2PMZB 4I65A 1Z47A 3MAQA 2XVSA 1TWHH 1TVXA 2B29A 3HOZG 1TKWB 4JPBW 4JI3L 3A8IE 3MEFA 4XXEA 2QA4A 4JI6L 1EWHA 4TQUS 1BBXC 1NBWA 4A3BB 1SEBD 3MXGA 4LF8Q 2HIVA 3KUPA 2RA4A 4N8FA 3CCVA 3Q22A 1I4HA 1IYVA 1EUJA 1HR0Q 1HNWL 3S14B 3OPOA 1LT6D 2Q2IA 5J39A 5EGTA 4C3HB 4R4TA 4LF5Q 2Y0SB 4UP8A 1SJHD 2PZTA 4CBVA 1D2BA 2M00A 3QG1A 2YTVA 3KK7A 1Q3LA 4DV3L 1BKBA 5M3FH 3ZYYX 3TS0A 4KJNA 2N55A 1KHIA 4A76A 1A15A 5GADC 3EJIA 4U673 4YCUA 1OXXK 5JVG3 2JA6G 3GTJB 1B8AA 3FVQA 4OXPA 1LTGD 4GOPB 2HHHQ 2OQKA 4NMZA 2XRSD 3K6OA 1KTKA 4IUPA 1O78A 4IFDG 1YNNC 1SR3A 2J7ZA 4P71A 3EA6A 5HGQA 4KLKA 3G6EA 2IY5B 1FD7D 1LTLA 1OXUA 4EGVA 3AB9A 1GUGA 1Y1WB 1BCPC 2KBNA 4J1MA 4KK7A 2F0NA 3KDFA 2VQFL 2EY1A 4DK1A 2Z8LA 3M9BA 2RBMA 3K5LA 4DR1Q 4A3BH 3PMFA 3E5SA 3CRKC 1FGBD 2AQ3B 4HEDA 5EPJA 1LT3D 3G71A 4A3IG 2I0QA 3S14H 3S15B 1STAA 2X69A 4NKLA 4FVMA 2KEEA 3V2TA 3A56A 1J9OA 1UEAB 4OHJA 5J1ZA 4A3KG 4FXDA 4C3HH 4O2DA 1HQRD 1Q46A 3L3OC 4RMFA 1KDBA 2F0DA 2BH8A 2ENBA 3BJUA 1IYUA 3EVQA 5GROA 1GUSA 4X62Q 4YCVA 4B3RL 4ZQ3A 2RSNA 4UDUC 3HOYB 2AWOA 2RCFA 5JVH3 2EZVA 1MHWC 4RWSC 3GTJH 3I90A 1HFNA 3T1YL 4KY6A 3U9SA 1QUQB 3H0GB 1YNND 3W5OA 3ICEA 1K83B 3KYHC 1LO5D 2J0TD 3NK9A 3SHLA 3T13A 4I7ZC 2R92G 3LNNA 5M3FG 3H3VH 1K0SA 3SEBA 3TSSA 4J6HA 4JI1Q 4P73A 2DY8A 1ILPA 2VB2X 3CMAA 4DAVA 3K80C 3K0YA 3M3YB 1I94Q 2IT1A 1BCPD 1AE3A 3CCEA 1Y1WH 1CKNB 1VMCA 4KHPQ 4P74A 3J7A5 2ICIA 2MUYA 4ABNA 3VYSA 5BR8L 1IHZA 1JQYD 2F0LA 4LW1A 4S3SA 2QEXA 2VXWA 1N9WA 3BDOA 4A75A 4HJ7A 1HJPA 2K7VA 3S15H 3L9AX 5I4DA 1U4PA 2EE1A 3UE1A 3S1MH 2I5MX 4KY7A 1UE1A 5FJ8H 4YHHQ 1DZ1A 3P1HA 2L15A 4OO1H 2ZJRA 4FXKC 1IBML 3K0XA 1DONA 1JCKB 3CCJA 5FLXE 3NE5B 1X9NA 3OIPA 1Z7TA 1ENCA 1X3QA 2F0KA 2RKSA 1G51A 1KRSA 4GLVB 1HR0W 3HOYH 4E6IA 1B53A 4DV5L 4CJ0B 4C3HG 3C1FA 4QL5A 4ZKBB 1H9SA 1KNAA 3H0GH 3OTOL 1K83H 5EKLA 1O7LA 3PV0A 1GUTA 4FXGC 1CZGA 4POFA 5E3FA 4A3DB 1XX8A 2NN6I 3DLLA 3HOWB 3I4NB 3NXWA 4WFN3 3EIVA 3M3YH 1A3VA 4K0KQ 2EYMA 3H91A 1XNQQ 2MHVA 2IL8A 3DHQA 2VS1A 1SE3A 4HCEA 4UPAA 1TWCB 3M4YA 5DLQE 5H1SE 3BDCA 3H94A 4XQNA 4KD4A 1VQEA 1EFID 2F0QA 3G4SA 1SYGA 4PMWA 1N34Q 1XTCD 1HNXL 1Y1WG 1U4RA 3RD4A 1K28A 2WIIB 2JYOA 2E76C 4MN3A 5ELEA 1AZQA 4XYOA 2B8FA 3RZOB 3NBHA 1FGUA 4RFBA 3K7UC 1F77A 1CK1A 2NBFA 1JE4A 1T5XD 5C4HA 3HG9A 5FJ8G 1MI2A 1EU4A 4XIGS 3VDYA 1SE2A 1VQFA 2B2TC 1X65A 4R8IA 3MTSA 3TP8A 3DXJC 1SE8A 1Q12A 3DEPA 4RKBA 1AZPA 4H02A 4HJAA 4DXGA 3S2HB 4A3DH 2XWBB 3PUYA 3PO3G 4Q0FA 1ESFA 5E7NA 4DA2A 1IL8A 3HOWH 4KV6A 3HOYG 2IPKD 3I4NH 1K3BC 4I7AA 2UXBL 3KDFB 1VQDA 1S5CD 5JJIA 1KDAA 1N33L 1X55A 4A3EB 2WKDA 2ASBA 1CZWA 3H0GG 4HR7B 2ZM6L 2DJFC 1TWCH 3HOVB 1VQHA 4KJOA 2G5DA 2F0IA 2BDNA 5IP9G 1ZEQX 2N49A 3KF8A 3OWFA 3L2PA 4RH6A 4DV6L 3D3RA 1GD7A 4FP5D 4YCWA 5EQ0A 5M9OA 4CJ2C 3E0EA 5CV8A 4PMBA 3M4OB 1F2YA 1CHPD 4L63B 1BOSA 3AU7A 1KLGD 1N36Q 1JWSD 1AFPA 1HHVA 2AKWB 3M85A 3RZOH 3Q0AA 2R7ZB 1RTOA 4G7HC 1MD2D 5CV6A 1GKHA 3FPUB 4WRDA 5CYUA 3PIP3 4AYBB 2Q8TA 3ONAB 3VA7A 4RCNA 1UE6A 1B2TA 5KYLA 3J81i 2LFNA 1MGSA 3CC7A 2C5CA 1LT5D 2LY7A 4QGUA 3D4WA 3TDQA 3F2BA 2CCZA 2O5JC 1Y14B 5D3DA 3WDNA 2D0PA 2MPMA 4ME5A 5CR3A 1BNZA 4RGNA 4LUVA 1KC8C 4DV2Q 3H09A 3MVVA 4YWKA 3R2TA 1XYIA 1T9HA 4XYQA 4JI2Q 2KCTA 4A3EH 5K36H 2F52A 5I2XA 2WB1B 3UI2A 2K75A 3HOVH 5E4XA 4LF7Q 1YJNA 2IWHA 2BOSA 3VA5A 3OMGA 5C0XH 5C4XB 2RF4A 5GQOA 5IWAQ 4L5RC 2NN6H 3I4NG 3GTPB 3S9WA 2JA7B 3M4OH 4Y52H 3HP3A 1A2UA 2K5NA 1BCPF 4DNRB 4AIMA 1MSHA 3E0JA 4F7XA 4DK0A 4KY5A 4GLXA 2EYHA 1Q86C 5EAYA 4BBSB 2R7ZH 1EIFA 2ALYB 1KRTA 1TS4A 4C3IB 1QZHA 1TY2A 1SSOA 1YZ6A 3I91A 4RGMA 4LFCQ 1H9SB 5CV5A 2EOTA 5I9OA 3S1RB 4DK6C 1GUWA 3CXCA 1LTSD 2WKCA 3CU7A 3BS1A 1S5FD 5NUCA 4YWLA 3M4PA 1HNZQ 4DV7L 3H6MA 5G3LD 1WTPA 2BE5C 1PRTB 2F0OA 3HEJA 1SNCA 5C4JB 1QWYA 1EQTA 4GKJQ 4BWGB 1EEID 4P2CB 2R3ZA 1IBKL 3BVGA 5IGCA 1PH4A 1NNXA 2DN8A 5D65A 1Q1EA 3UDFA 3HKZB 2EY2A 1VF7A 1EZ6A 5C4XH 1NR2A 2DNCA 2FFKB 2TMPA 3A54A 2OTJA 1SJED 4JBWA 1EY6A 5IT9c 3ER0A 3GTPH 3W1GA 2JA7H 2Z1CA 1LT4D 4A3EG 4RHRA 3CRLC 4NW2A 4LFAL 5K36G 4X64L 1K8MA 3CHBD 2DY7A 1BQQT 3NBHB 1GUNA 3HOVG 1RD9D 2UUAQ 4BBSH 1HRJA 2PW5A 2PQAA 4C3IH 4QUFA 1J6QA 2F3IA 3HS0C 4IJHA 3K7AB 5C0XG 2UUBL 1XWEA 4K14A 4DV4L 2NN6G 4UAIA 5ELCA 3AEVA 3CF5A 1SMYC 3S1RH 2F0GA 1UEBA 1PZJD 2KHSA 2EIFA 2XSCA 1K8AC 2BE5D 3VR2A 2R7ZG 5FK9C 2CH4W 1AP0A 3A8KE 1YHBA 4HMIA 3KLRA 4LAAA 3KBGA 3I4MB 4AYBG 5C4JH 1PH6A 3UE0A 4B3ML 1I3QB 3PO2B 1NJIC 1WVLA 2N8NA 1SNQA 4LFBQ 3TP6A 3SK6A 2MJ8A 1OXSC 3K5NA 1GHJA 3KF8B 1G2TA 2D0OA 4K5WA 2OQ0A 1LTAD 3A7AB 3FKIG 1ML0D 5M3MB 2WACA 4OGQC 1KLUD 5C3EB 4ILWA 2PYKA 1HCZA 1C9OA 3D0FA 4HMJA 1H9JA 3KLSA 1GVPA 3U50C 1TWGB 2QILA 3KF6B 2WB1G 4DR3Q 3RN5A 1TIID 3VR6A 2EYOA 5EBDA 4A3CH 2K05A 3K7AH 2HQLA 4HJ5A 4DFAA 1ESRA 1SMYD 3MFYA 4KHVA 4F8MA 4DUZQ 2HDMA 5HGTA 2JA7G 2MP1A 1IZ6A 3JAML 2KHIA 1C0AA 3FRPB 4LF6L 2A74C 4MZ9A 4XT3B 4BBSG 1D7QA 1RJTA 1RTNA 2YV5A 4JI4L 1GXDC 3DWAA 2KVMA 2CQAA 3I4MH 4LF4L 1C48A 2B2TA 4DR4L 3Q24A 1WTRA 4H7BA 2E5LQ 1NCVA 3PUZA 1XMQL 1TY0A 1D1KA 1JWUD 3RLOA 3SGIA 4R9WA 4JI6Q 1I3QH 1SE4A 3TQYA 4R4IA 2KOLA 3BVMA 1TQOA 1X3EA 5M3MH 1NE3A 2UU9L 4QIWE 1EQRA 3T56B 1YIJA 5A2QL 5C3EH 2QCPX 3AFQA 5KNBA 2K14A 3MA2B 1BDOA 5KYIA 1K73C 2LS01 1DCZA 1G6PA 1TWGH 3IAYA 5IT9L 5IY0A 5A35A 4FNFA 2O2LD 1PTOB 3HKZG 1LABA 1U5KA 4L5QA 4ZLTF 3UDIA 3D6CA 2FHTA 3J80L 2EJFC 1L2FA 4PZ7A 4B3SL 1U9RA 1PH7A 1EY4A 5HY6A 3PQIA 4KMUC 5AJ3Q 1PZID 2CFMA 3X3NA 2R93B 4OX9L 1S72A 4H0LC 4OO1I 4A3MB 4CKCA 1DOMA 3AYHB 1E22A 1LTTD 4TKOB 2F4VL 4L5SA 1GO3E 1CA6A 2TSSA 3EQLC 4ZUIA 1XMOQ 2KA7A 3A0JA 2EXDA 2K32A 4HJ9A 4JOIC 2PNHA 5G3LF 1I50B 3GO5A 1XNRQ 2XNAC 1CQFA 4JW0A 2E8GA 2ZXOA 3A5ZB 3I4MG 4O0AA 1JC7A 1V1OA 3STBC 3R93A 1HUMA 4NXML 1EIHA 1EZ8A 2OTLA 5COYA 4JYAL 4ZUJA 4IUNA 2NB0A 2PQAB 3PO2G 1PTOH 1STNA 3MHBA 1TWFB 1EWCA 5BN4A 1D5XC 5JOBA 1IKLA 1F9SA 4K6LA 4RGTA 5M3MG 1GUOA 5KRUA 1VQGA 3P7JA 4PZ6A 2YU9B 1VQMA 5C3EG 3HOXB 1SNMA 2E2IB 2C9OA 4OELB 3SVMA 2NZHA 2CVRA 2XIWA 1LUZA 1SNPA 5GAGC 2ZXPA 1F2LA 3DWQA 3I72A 4A4IA 1VQCA 2JE6I 3OWEB 1JJ2A 3IL8A 2VQEQ 2R93H 1RDPD 4FYDA 3HFZB 5JPMC 1S4ZA 4A3MH 1B44D 3T1HQ 1E0BA 1NAPA 3NTHA 2M9VA 4GKKQ 2B39A 1I4PA 2NVTB 3IRBA 1PFNA 3I70A 4BS9A 1N8RC 5IYCH 4UHVA 4RGOS 4K8JA 1I50H 4DAYA 3S1MB 2F0SA 1WTHA 2HT1A 2LXJA 2GA4B 3SXHA 3STBD 2JA5B 3KLSX 5EPKA 1U0LA 4JI5Q 4LF8L 2L5TA 1H9MA 1RF2D 1HR0L 3JAME 3NTKA 2E75C 4TVAB 4K5XA 4DUYL 3SR1A 1IBLQ 2K6AA 2ZJPA 3LWUA 1TWFH 2NTTA 4LF5L 1SYCA 2BH2A 1TS5A 3PIPA 3OIQA 2YU9H 2E74C 2Z6BA 3OHXC 3HOXH 3UDXA 2E2IH 1SFOB 1SNDA 5EKKA 1W6KA 1D6EC 2YTXA 3CW2C 1VQ5A 3FEWX 4UP7A 1O7YA 1WTQA 3MXNA 1Q90A 1C4QA 1KAWA 1UE7A 3CCSA 2NZ1D 2RCNA 3NELA 4IFDJ 2HHHL 5LHY1 2VW9A 4C1NK 1J5EQ 5A2QE 4FDBA 1VQBA 2N3SA 4EQNA 2A1AA 2NVTH 3GTMB 1PVOA 5BN5A 3C3LA 2SOBA 2F0EA 2PI2E 4PG3A 3RMHA 2R93G 2F0JA 5EBCA 1MKHA 4CJ1B 4A3MG 5JEAJ 1P8LA 2CHBD 2RQXA 3D4RA 4DR1L 4GZYC 3J80E 2JA5H 3CP0A 1XPOA 1SBBB 1HFGA 5BN3A 2G9DA 4A3BG 1L1OA 4IZ8A 3NQTA 4B3TL 3CQZB 3MXUA 5IYCG 4QY7A 5LL6X 3VYUA 2CQOA 2L12A 1ASZA 5FOBB 2WAQB 3U4VA 2K5HA 2UXCQ 1QNUA 2Y0SG 1Q81C 4N8X1 1MJCA 1EY9A 1SLJA 3CPWA 1SFOH 1AN8A 4X62L 1Y8PB 4PNYA 1JWMD 3CCQA 1DXMA 2FXQA 4GOPC 1ZXTA 1ZYRC 5C0XI 3RN2A 1BO0A 2QDLA 2Q2HA 1HH2P 2BA1A 3LGJA 5CORA 3CD6A 3A8JE 1SYDA 2HUGA 2ID0A 2EYFA 4ME3A 4KI0A 3H3VC 4R4OA 2K52A 4BXXH 2OWOA 1ET6A 5IGGA 1M1KC 3HOXG 2JA9A 1PXUA 3P20A 3TMEA 2O4XA 1A62A 3GTMH 2L11A 1TU2B 3BG3A 4JI1L 4K2KA 5IOCA 1PH3A 2B63B 5HURA 1I94L 1STEA 4XQQA 4F87A 1Y8NB 1JJCB 1QG7A 3J81c 4CDFC 2PO4A 2JEAI 3VR3A 2MO1A 3TZUA 4HSVA 3HKZE 1YJ9A 1PYBA 1HZCA 2NVXB 3J7ZC 4A93B 5IODA 1QZGA 5T1GA 2AMCB 5DM63 4RCOA 1JJGA 3CQZH 2EYPA 3I3CA 4YHHL 2K50A 1EU3A 5EKIA 2EPBA 4PQXA 4CDEC 1CSPA 1FJGL 3I4LA 4IURA 4ZKCB 4AQYQ 3U4ZA 3H15A 1MJEA 1O80A 4OO1G 3V96A 2JA5G 4JK1C 2K33A 1F2MA 1ZYRD 5C6AA 3MEHA 2R6GA 1TT2A 4DV1L 1YHAA 4NXNQ 1A3TA 4DXFA 1W2BA 3TREA 5J3BA 4WJ4A 4P75A 3PUXA 3T53B 3CAMA 1PFBA 3PCOB 2KECA 4H44C 3ITPA 1MBYA 3QJYA 3S17B 5ELFA 2UXDQ 3RZDB 1VS0A 5JPNC 3S2DB 2PNRC 1OO9B 4DAYB 1WOCA 4ALPA 2B63H 2KUMA 2DJGC 4K0KL 3ND9A 1PFSA 1XNQL 1ET9A 4GN5A 2HQEA 4XDXA 4JVZA 4NP5A 4BXXG 4XT1B 4R4CA 4DR6Q 2NVXH 1PHJA 4A93H 2KEDA 4EQOA 1FVIA 4JOIA 1N34L 2KHJA 1A8VA 4R4QA 2MGSA 3NEMA 5JAVA 3K58A 1A6XA 3R2IA 5D14A 2QEJC 4R1JA 3RLFA 3PF4A 2WFWA 4JI7Q 3MXNB 4EQ5A 5LMUQ 4JV5Q 2IW3A 1TWAH 2LXKA 3NP8A 3D6WA 3HRZC 1VQ4A 2WAQG 1DYQA 4ID6A 5FO8B 3R8BA 5IIFA 2OF1A 3S17H 1Y69U 2KCMA 3RZDH 3NHHA 3QOJA 3G7LA 3S2DH 3FMCA 1RKNA 1WYDA 3W1BA 1CA5A 3UDGA 1LTRD 1IBKQ 4A3DG 3SE0A 2K4KA 2F0PA 2B2WC 5CMDA 2WV6D 5C3WA 1LV9A 3HOWG 1U4LA 1EQVA 2EVBA 1Z9FA 4M1UB 1SDFA 2XN9C 2I07B 1VMPA 1JOOA 1L1OB 3TBIB 5CBAE 3PGZA 3JC66 4OWWB 1DD2A 2SDFA 1L0WA 4A3JB 1DJRD 4ZAIA 2PCFB 3E9IA 1STYA 1N32Q 4X3UA 4V190 1S5DD 2JJQA 2L9HA 3EFXD 3KFUA 3S1NB 2V1CC 2F4IA 4DKAC 4IPDA 2FMMA 1N36L 3CCRA 1B9MA 4HTHA 4WORA 1W6JA 4Y7NB 1A0IA 1M4VA 4A93G 4V0BA 4YY3Q 2A19A 1EWIA 1KAAA 3GTGB 5M5XB 4DR5Q 3N52A 1JOKA 1O7IA 3AFPA 2EJMA 4GN4B 2CW0C 1WD1A 1XXGA 1HA5A 2NYZD 1YITA 5LMNQ 2Q2TA 2AHOB 2LMCB 3QR8A 3TP5A 1HQMC 2PMZE 4JI8Q 4DAMA 5IYBH 4LF9Q 4PZ8A 4JI0Q 4DV0Q 3OW7A 3FHWA 4DV2L 4X65Q 4HIKA 2UUCL 4JI2L 1STBA 1V43A 1AE2A 3GQBA 3U9OA 4DN4M 2H1EA 5KNCA 1BBUA 4C1NI 4LF7L 5DM73 1FR3A 2Y0SE 4C56C 1CHQD 2IX0A 5IWAL 4A3JH 1WTOA 2B8GA 5CV4A 1GJXA 1ONLA 2EDGA 4GNXC 1I6VC 2B2VC 3S1NH 2N78A 2PW7A 1VDZA 4A3LH 5I9PA 4Y7NH 4DR7Q 5TSSA 1YNJC 3CC2A 2Z4IA 3GTGH 5M5XH 5FLXc 2I5LX 2N88A 4LFCL 1YI2A 2CW0D 1YHQA 4QB4A 1IW7C 1RCVD 3EN2A 1HPCA 3DM1A 2GVBA 3BZKA 5C3XA 1HNZL 2B2YC 4GOPA 4HIDA 4DR2Q 3B6YA 1NTGA 3C46A 1B4OA 4DK3C 3J7AF 1RODA 1Q1BA 1IL2A 4JCVE 4GKJL 1WTWA 3EROA 1CUKA 3JAMi 1NR4A 3MC0B 3F2CA 5ELDA 2Q8IB 2IHEA 1WI5A 4FO2A 4NDXA 3ND8A 4RHSA 4BBRB 1F9QA 1HA6A 3SDZA 2K04A 2R7DA 3NWTA 4DF7A 2RVLA 1PV4A 4BY7B 1Q8KA 4TRDA 5IYBG 3GTKB 3CCUA 1JORA 4IQZA 4IOCA 5C4XG 2I46A 3I7FA 2ZJQA 1E2WA 2LKVA 1ZKOA 2ICEC 3P75A 1WD0A 5IYDH 4B9WA 2UUAL 1EYCA 1EY5A 5C5MA 1YNJD 1II3A 2EY6A 2QDBA 4B3SQ 2K5DA 2K5WA 4A3JG 1EFWA 5C5LA 4Q5VA 1QOHA 1VQ7A 1TS3A 4C3IG 4KKSA 1IW7D 2M2LA 4DGZA 2HDLA 2Q8RE 3QOLA 3GTLB 1F2ZA 1PRTC 1LTID 4K8IA 1D5ZC 1EQQA 2GN5A 1XTDA 4A3LG 5L37A 4RG1A 1ENFA 1KXLA 1PH5A 1PH1A 5AFWA 1QUQA 4JI3Q 1VF5C 1LLRD 4IUUA 4GN3B 2IHFA 2HCIA 5LL6S 1SXTA 3J80i 4JG2A 1BCPB 4A3KB 3K59A 5CV9A 1YJWA 1SN8A 1HNWQ 1K3RA 2A6EC 2VZAA 3MFGA 2RDHA 4X66L 2RHQB 1V1QA 3RLNA 3WOFA 1GM5A 1G91A 4BBRH 1PH2A 1QILA 4OIKA 3K5OA 4AH6A 1AH9A 2G9HD 3GTQB 4BY7H 2EYJA 4NXMQ 1PLFA 3GTKH 1VQ8A 1X56A 4NPSA 3WWVA 1L0YB 4DV3Q 3K8AA 4IN3A 4HIOA 2F0WA 2NZOA 3J7AV 2VL6A 2X6GA 4EX5A 2F0TA 2D62A 2FJ2A 4C2MB 3SK5A 1I4QA 1PDQA 4DR3L 2KENA 3O13A 4IFDH 2R92B 1LYLA 3IKJA 4ZRZA 3DEOA 4ZYSA 5C44B 1PH9A 4K6DA 4LNQA 4JC0A 1E1TA 3I56A 1D1IA 2Z6KC 4KTAA 2IX1A 5ELBA 4DUZL 4A3CG 1GOZA 4IPGA 1HTPA 1PRTD 3M7GA 3F1ZA 1BXTA 4X3SA 3GTLH
chains in the Genus database with same CATH topology
1I4GA 1TS2A 5M5WB 1QCBD 5I6YA 5JEAH 2DNEA 3TZDA 5DNFA 1R9TB 4G7ZC 2KQ3A 3VR5A 4XTCS 3NQIA 2A6ED 2F0HA 2HCCA 2BA0A 2R61A 1E2VA 5K5PA 2F0FA 2B2WA 2ZXRA 5KGUA 5FO7B 1HTLD 3WOEA 3IFDA 2F0UA 1M8AA 1Y8OB 1L0XB 2YYZA 1JOQA 3BZDB 1S5ED 3HOUB 1WTVA 3PUVA 2JA8B 1UAPA 4N9PA 2IJ0A 1S5BD 1EL0A 4RAUC 2XWJB 1PMRA 2QF7A 2H4OA 3G6JB 3URYA 4KHZA 3RUZA 1QNKA 3PIO3 1Y1VB 1I6HB 2D9UA 4OL7A 4FF3A 3C1EA 4QUCA 1R4PB 5KEEA 4N9TA 2PPBC 2A69C 1EOTA 4KD3A 4FF1A 2K01A 1LACA 1V1PA 5T1IA 5JEAG 1F9RA 2A6HC 2K1BA 4QCLA 1SNOA 2E2JB 1PTOC 3GV3A 3OMCA 1FYCA 2EYLA 2D2CC 4KN4C 1ENAA 1K8OA 4EQPA 5I6WA 1V8QA 4XQJA 3PO3B 2IX3A 4O42A 2B2VA 4DAPA 3T51B 4TSSA 1IKMA 1NSNS 4IALA 4BA1I 5FKAC 2AWNA 1JB3A 5KIXA 1EYAA 2AUKA 2NWGA 3I8ZA 5E4WC 5IT9E 1F9PA 1BF4A 1EY8A 3DWPA 2A69D 4A3FB 4RKLA 1SYFA 3FPPA 1KABA 1UNSA 3W3AA 2RSOA 2B2YA 1B50A 3NSWA 4QIWB 2E2DC 3PUWA 2A6HD 2V4DA 3I73A 3A55A 2PZWA 4B08A 4KKUA 1PTOD 2L1BA 1EY0A 3K5MA 3D31A 3BYYB 4HCSA 1A2TA 1H9KA 5E1FA 4ULLA 2QKIC 1KDCA 4M8AA 3IFTA 5J22A 1WCMB 1FNWA 1I4RA 4X3KA 3DUZA 2WP8J 1X32A 3MXPA 1QE6A 5CBEE 1VCIA 5IGFA 1PRTF 1G2SA 1KNEA 1SYBA 3T4AC 2AQ2B 3SK8A 1LTBD 4B9XA 2E2HB 5IGBA 4ZK9B 1MSGA 2K28A 2JEBI 1AEXA 4QF4A 1TR5A 2JP1A 2KJXA 2OT2A 1B1ZA 4RA8A 3N6RA 3D8GA 1CM9A 4A3GB 1TWAB 3K57A 4PMCA 2SEBD 1AW7A 3SK4A 1OXTA 3CKIB 3OOCA 2B2UC 1B3AA 1Z6HA 1R4QB 1X3PA 4U68A 4H13C 2A5HA 3TP7A 3GTOB 1FNUA 1ILQA 1V1PB 4CHTB 1EYDA 2OEOA 2K03A 3J7YW 1CT1D 3BDLA 2BCOA 3QIAA 2EY5A 2L0CA 2AUJD 4YIJA 3VYRA 5DAUA 4DNTB 4HAEA 1B9NA 1ICWA 2ZT9C 4MHEA 1O7ZA 3L7ZC 4FF2A 5KNDA 4O1NA 1JR0D 2NVQB 3T16A 2F3WA 1C8CA 3R3OA 2X6LA 4CKBA 2J4XA 1SAPA 1EY7A 3FKIB 4LK1C 1D5MC 1OXVA 2OXPA 3BVZA 4FF4A 3DMUA 3A7LA 3GP7A 4K2LA 5FO9B 5C4ZA 3QB3A 3V05A 1DOLA 5ISRA 4MIUA 4L8JA 3J81L 3Q6SA 3VYTA 4G7OC 4F88A 2VUMB 1SYEA 1G291 1PFMA 2NVYB 3MWYW 1FNVA 4BY1B 5IGDA 1QJOA 4C3JB 4WJWA 2FMCA 2EJGC 1BR9A 3TN2A 4OIJA 2RDFA 5CV7A 5IGEA 1PTOF 4Z9CB 3MZ5A 2F0VA 3C2PA 4ODGA 3AMUA 1HUNA 2F1MA 1PYWD 2KCNA 3NPPA 5DEHA 4EVOA 1EEFD 4J8QA 4IFDI 1WTXA 4CGYB 3GD7A 1I4XA 3LWEA 2XRQD 5I2YA 2F03A 2A68C 2A73B 2FINB 2Z4HA 3E6ZX 2JXMB 4G57A 3QO2A 2NTSA 2SNSA 4BA2I 1G8ZD 1RHPA 1CI3M 1EIGA 1UUPA 4DU9A 3HOZB 5M5YB 4KKTA 2VNUD 5D3IB 5CC4A 2F3VA 1CQVA 3NTIA 2NUCA 1PZKD 3NUCA 3S16B 4CKEA 3HZXA 1DM0B 3NBIA 4K5VA 3S1QB 2A68D 2K5QA 1H9RA 5EPLA 1JICA 2L4NA 4KN7C 2JA6B 1J8IA 4HSPA 2PZUA 1G6ZA 3M7NA 1E2ZA 5C0XJ 3VR4A 3KBXA 2SNMA 1BUVT 4G4KA 2L55A 3HGBA 1Q8IA 2F0MA 2D5DA 4LJZC 2RDGA 4IUVA 1GHKA 4PV1C 4C3JG 2VB3X 1CFMA 5JJZA 4A3IB 1NUCA 3BYTB 1STGA 2BDOA 3W2DA 3J81E 3X3MA 4X3TA 5EJWA 1TWHB 2B2UA 4HN7A 1DOKA 1T5EA 1U4MA 4R8NA 2WINB 3OSOA 1A3UA 2KCCA 2PQEA 4QMGA 3ERQA 3QWNA 3D4DA 5M3FB 5CGKA 3NWSA 4IUQA 4L6TB 2O5IC 1CTMA 2JSOA 3LX0A 3F2UA 3Q23A 3FDTA 5F2DA 4LMQD 2AQ1B 5FLXL 3GV6A 1STHA 4IUTA 1HXYD 2EXZA 1QB5D 2PMZB 4I65A 1Z47A 3MAQA 2XVSA 1TVXA 1TKWB 3A8IE 4XXEA 1EWHA 4TQUS 1BBXC 4A3BB 1SEBD 3MXGA 3KUPA 2RA4A 1IYVA 3Q22A 1I4HA 3S14B 3OPOA 1LT6D 5J39A 5EGTA 4C3HB 2Y0SB 1SJHD 2PZTA 4CBVA 1D2BA 2M00A 3QG1A 3KK7A 1Q3LA 3ZYYX 4KJNA 2N55A 1A15A 3EJIA 4U673 1OXXK 5JVG3 3GTJB 3FVQA 1LTGD 4NMZA 2XRSD 3K6OA 1KTKA 4IUPA 1O78A 4IFDG 1YNNC 2J7ZA 3EA6A 1FD7D 1OXUA 4EGVA 3AB9A 1GUGA 1Y1WB 1BCPC 4J1MA 4KK7A 2F0NA 2EY1A 4DK1A 2Z8LA 2RBMA 3K5LA 3PMFA 3E5SA 3CRKC 1FGBD 2AQ3B 4HEDA 5EPJA 1LT3D 3S15B 1STAA 2X69A 4NKLA 4FVMA 2KEEA 3V2TA 3A56A 1J9OA 1UEAB 4OHJA 5J1ZA 4FXDA 1HQRD 3L3OC 1KDBA 2F0DA 2ENBA 1IYUA 3EVQA 1GUSA 4ZQ3A 2RSNA 4UDUC 3HOYB 2AWOA 5JVH3 2EZVA 1HFNA 4RWSC 3I90A 4KY6A 3U9SA 3H0GB 1YNND 1K83B 3T13A 1LO5D 2J0TD 3NK9A 3SHLA 4I7ZC 3LNNA 3SEBA 3TSSA 4J6HA 2DY8A 1ILPA 2VB2X 4DAVA 3K0YA 3M3YB 2IT1A 1BCPD 1VMCA 2ICIA 2MUYA 4ABNA 3VYSA 1IHZA 1JQYD 2F0LA 4S3SA 2VXWA 3BDOA 2K7VA 3L9AX 5I4DA 1U4PA 2EE1A 4KY7A 1DZ1A 3P1HA 4OO1H 4FXKC 1DONA 1JCKB 5FLXE 3NE5B 3OIPA 1Z7TA 1ENCA 1X3QA 2F0KA 2RKSA 4E6IA 1B53A 4CJ0B 4C3HG 3C1FA 4ZKBB 1H9SA 1KNAA 5EKLA 1O7LA 3PV0A 1GUTA 4FXGC 1CZGA 5E3FA 4A3DB 1XX8A 2NN6I 3HOWB 3I4NB 3NXWA 4WFN3 1A3VA 2EYMA 3H91A 2MHVA 2IL8A 3DHQA 1SE3A 4HCEA 1TWCB 3M4YA 3BDCA 3H94A 4XQNA 4KD4A 1EFID 2F0QA 1SYGA 4PMWA 1XTCD 1U4RA 3RD4A 2WIIB 2JYOA 2E76C 4MN3A 5ELEA 1AZQA 4XYOA 2B8FA 3RZOB 3NBHA 4RFBA 1F77A 1CK1A 2NBFA 1JE4A 1T5XD 5C4HA 3HG9A 1MI2A 1EU4A 4XIGS 1SE2A 2B2TC 4R8IA 3MTSA 3TP8A 3DXJC 1Q12A 3DEPA 4RKBA 1AZPA 3S2HB 4DXGA 2XWBB 3PUYA 4Q0FA 1ESFA 4DA2A 1IL8A 4KV6A 2IPKD 1S5CD 1KDAA 4A3EB 2WKDA 1CZWA 4HR7B 3HOVB 4KJOA 2F0IA 2BDNA 1ZEQX 3OWFA 3KF8A 4RH6A 3D3RA 4FP5D 5EQ0A 5M9OA 4CJ2C 5CV8A 4PMBA 3M4OB 1F2YA 1CHPD 4L63B 1BOSA 3AU7A 1KLGD 1JWSD 1AFPA 1HHVA 3M85A 3Q0AA 2R7ZB 1RTOA 4G7HC 1MD2D 5CV6A 4WRDA 3FPUB 5CYUA 3PIP3 4AYBB 2Q8TA 3ONAB 3VA7A 4RCNA 1B2TA 5KYLA 2LFNA 1MGSA 2C5CA 1LT5D 2LY7A 3D4WA 3TDQA 2O5JC 5D3DA 3WDNA 2MPMA 4ME5A 5CR3A 1BNZA 4RGNA 3H09A 3MVVA 3R2TA 1XYIA 4XYQA 5K36H 5I2XA 2WB1B 3UI2A 5E4XA 2IWHA 2BOSA 3VA5A 3OMGA 5C0XH 5C4XB 2NN6H 3GTPB 3S9WA 2JA7B 3HP3A 1A2UA 1BCPF 4DNRB 1MSHA 3E0JA 4F7XA 4DK0A 4KY5A 2EYHA 4BBSB 1TS4A 4C3IB 1TY2A 1SSOA 3I91A 4RGMA 1H9SB 5CV5A 2EOTA 5I9OA 3S1RB 1GUWA 1LTSD 2WKCA 3CU7A 3BS1A 1S5FD 5NUCA 3H6MA 5G3LD 1WTPA 2BE5C 1PRTB 2F0OA 3HEJA 1SNCA 5C4JB 1QWYA 1EQTA 4BWGB 1EEID 4P2CB 2R3ZA 3BVGA 5IGCA 2DN8A 5D65A 1Q1EA 3HKZB 2EY2A 1VF7A 1EZ6A 1NR2A 2DNCA 2FFKB 2TMPA 3A54A 1SJED 4JBWA 1EY6A 2Z1CA 1LT4D 4RHRA 3CRLC 4NW2A 5K36G 1K8MA 3CHBD 2DY7A 1BQQT 1GUNA 1RD9D 1HRJA 2PW5A 4QUFA 3HS0C 3K7AB 5C0XG 1XWEA 4K14A 2NN6G 4UAIA 5ELCA 1SMYC 2F0GA 1PZJD 2KHSA 2XSCA 2BE5D 3VR2A 5FK9C 1AP0A 3A8KE 4HMIA 3KLRA 4LAAA 3KBGA 3I4MB 1I3QB 3PO2B 1WVLA 1SNQA 3TP6A 3SK6A 2MJ8A 1OXSC 3K5NA 1GHJA 1G2TA 4K5WA 1LTAD 3A7AB 5M3MB 1ML0D 2WACA 4OGQC 1KLUD 5C3EB 4ILWA 2PYKA 1HCZA 4HMJA 1H9JA 3KLSA 1TWGB 2QILA 1TIID 3VR6A 2EYOA 5EBDA 2K05A 4DFAA 1ESRA 1SMYD 3MFYA 4KHVA 4F8MA 2HDMA 5HGTA 2MP1A 3JAML 3FRPB 2A74C 4XT3B 1RJTA 1RTNA 1GXDC 3DWAA 2KVMA 2CQAA 1C48A 2B2TA 3Q24A 1WTRA 4H7BA 1NCVA 3PUZA 1TY0A 1D1KA 1JWUD 4R9WA 1SE4A 2KOLA 3BVMA 1TQOA 3T56B 5A2QL 2QCPX 5KNBA 3MA2B 1BDOA 5KYIA 2LS01 1DCZA 3IAYA 5IT9L 5A35A 4FNFA 2O2LD 1PTOB 1LABA 4ZLTF 3D6CA 2FHTA 3J80L 2EJFC 1U9RA 1EY4A 4KMUC 1PZID 3X3NA 2R93B 4OO1I 4H0LC 4A3MB 4CKCA 1DOMA 1LTTD 4TKOB 1CA6A 2TSSA 3EQLC 4ZUIA 2KA7A 2K32A 5G3LF 1I50B 3GO5A 2XNAC 1CQFA 2ZXOA 1JC7A 1V1OA 3R93A 1HUMA 1EIHA 1EZ8A 5COYA 4ZUJA 4IUNA 2NB0A 1PTOH 1STNA 3MHBA 1TWFB 1EWCA 5BN4A 1D5XC 5JOBA 1IKLA 1F9SA 4K6LA 4RGTA 1GUOA 5KRUA 3P7JA 2YU9B 3HOXB 1SNMA 2E2IB 2C9OA 3SVMA 2CVRA 2XIWA 1SNPA 2ZXPA 1F2LA 3DWQA 3I72A 2JE6I 3OWEB 3IL8A 1RDPD 4FYDA 5JPMC 1S4ZA 1B44D 1E0BA 1NAPA 3NTHA 2M9VA 2B39A 1I4PA 2NVTB 1PFNA 3I70A 4BS9A 4RGOS 4K8JA 3S1MB 4DAYA 2F0SA 2GA4B 3SXHA 2JA5B 3KLSX 5EPKA 2L5TA 1H9MA 1RF2D 3JAME 3NTKA 2E75C 4K5XA 3SR1A 2K6AA 3LWUA 2NTTA 1SYCA 1TS5A 3OIQA 2E74C 3OHXC 1SFOB 1SNDA 5EKKA 1W6KA 1D6EC 3FEWX 1O7YA 1WTQA 3MXNA 1Q90A 1C4QA 2NZ1D 4IFDJ 5LHY1 4C1NK 5A2QE 4EQNA 3GTMB 5BN5A 3C3LA 2SOBA 2F0EA 3RMHA 2F0JA 5EBCA 4CJ1B 5JEAJ 2RQXA 2CHBD 3D4RA 4GZYC 3J80E 1SBBB 1HFGA 5BN3A 2G9DA 4IZ8A 3NQTA 3CQZB 3MXUA 5LL6X 3VYUA 2L12A 5FOBB 2WAQB 1QNUA 1EY9A 1AN8A 1Y8PB 4PNYA 1JWMD 1DXMA 1ZXTA 1ZYRC 5C0XI 1BO0A 2BA1A 5CORA 3A8JE 1SYDA 2HUGA 2ID0A 2EYFA 3H3VC 4KI0A 1ET6A 5IGGA 1PXUA 3P20A 3TMEA 2O4XA 2L11A 1TU2B 3BG3A 4K2KA 5IOCA 2B63B 5HURA 1STEA 4XQQA 4F87A 1Y8NB 1QG7A 2PO4A 2JEAI 3VR3A 3TZUA 4HSVA 2NVXB 4A93B 5IODA 5T1GA 5DM63 4RCOA 2EYPA 3I3CA 1EU3A 5EKIA 2EPBA 4PQXA 3I4LA 4IURA 4ZKCB 1O80A 4OO1G 3V96A 4JK1C 2K33A 1F2MA 1ZYRD 5C6AA 3MEHA 2R6GA 1TT2A 1A3TA 4DXFA 3PUXA 3T53B 1PFBA 2KECA 4H44C 3ITPA 1MBYA 3QJYA 3S17B 5ELFA 3RZDB 5JPNC 3S2DB 2PNRC 1OO9B 2KUMA 3ND9A 1ET9A 2HQEA 4XDXA 4NP5A 4XT1B 2KEDA 4EQOA 2MGSA 5JAVA 3K58A 1A6XA 3R2IA 5D14A 2QEJC 3RLFA 2IW3A 3NP8A 3D6WA 3HRZC 1DYQA 4ID6A 5FO8B 3R8BA 5IIFA 2OF1A 1Y69U 3NHHA 3QOJA 3G7LA 3FMCA 1RKNA 1CA5A 1LTRD 3SE0A 2F0PA 2B2WC 5CMDA 2WV6D 5C3WA 1LV9A 1U4LA 1EQVA 2EVBA 4M1UB 1SDFA 2XN9C 2I07B 1VMPA 1JOOA 3TBIB 5CBAE 1DD2A 2SDFA 4A3JB 1DJRD 4ZAIA 2PCFB 1STYA 4X3UA 4V190 1S5DD 2L9HA 3EFXD 3S1NB 2F4IA 2FMMA 1B9MA 4HTHA 4WORA 1W6JA 4Y7NB 1M4VA 4V0BA 1KAAA 3GTGB 5M5XB 3N52A 1JOKA 2EJMA 2CW0C 1WD1A 1XXGA 1HA5A 2NYZD 2LMCB 3TP5A 1HQMC 3OW7A 1STBA 1V43A 3GQBA 3U9OA 4DN4M 5KNCA 2H1EA 4C1NI 5DM73 1FR3A 4C56C 1CHQD 2IX0A 1WTOA 2B8GA 5CV4A 1GJXA 1ONLA 2EDGA 1I6VC 2B2VC 2PW7A 1VDZA 5I9PA 5TSSA 1YNJC 2Z4IA 2N88A 2CW0D 4QB4A 1IW7C 1RCVD 1HPCA 3DM1A 5C3XA 2B2YC 3C46A 1B4OA 3J7AF 1RODA 1Q1BA 1WTWA 3EROA 1NR4A 3MC0B 2Q8IB 5ELDA 4FO2A 4NDXA 4RHSA 4BBRB 3ND8A 1HA6A 1F9QA 3SDZA 2K04A 3NWTA 4DF7A 2RVLA 4BY7B 4TRDA 3GTKB 1JORA 4IQZA 2I46A 1E2WA 2LKVA 1ZKOA 2ICEC 3P75A 1WD0A 4B9WA 1EYCA 1EY5A 5C5MA 1YNJD 1II3A 2EY6A 2QDBA 2K5DA 2K5WA 5C5LA 4Q5VA 1QOHA 1TS3A 4C3IG 4KKSA 1IW7D 2M2LA 4DGZA 2HDLA 2Q8RE 3QOLA 3GTLB 1F2ZA 1PRTC 1LTID 4K8IA 1D5ZC 1ENFA 5AFWA 1VF5C 1LLRD 4IUUA 2HCIA 5LL6S 1SXTA 1BCPB 4A3KB 3K59A 5CV9A 2A6EC 3MFGA 2RDHA 3WOFA 1G91A 1QILA 4OIKA 3K5OA 2G9HD 3GTQB 2EYJA 1PLFA 1L0YB 4IN3A 2F0WA 3J7AV 2X6GA 2F0TA 2D62A 2FJ2A 4C2MB 3SK5A 1I4QA 1PDQA 3O13A 4IFDH 2R92B 3IKJA 4ZRZA 3DEOA 4ZYSA 5C44B 4K6DA 1D1IA 4KTAA 2IX1A 5ELBA 1GOZA 1HTPA 1PRTD 3M7GA 4X3SA 1BXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFX D;  1EEI D;  1I4G A;  1CHP D;  4L63 B;  1TS2 A;  3BVG A;  1PTO H;  3MC0 B;  1UUP A;  5ELD A;  1KLG D;  4RHS A;  1BCP C;  2AQ2 B;  1EWC A;  1D5X C;  1D5M C;  1JWS D;  4RGT A;  1LTB D;  4K6L A;  2Z8L A;  1M4V A;  2CHB D;  5D3I B;  5ELF A;  3BVZ A;  3DWA A;  1FGB D;  1MD2 D;  4TSS A;  2AQ3 B;  1SJE D;  1SBB B;  1LT3 D;  3GP7 A;  4L6T B;  3V05 A;  1TY0 A;  5FKA C;  1JWU D;  3DWQ A;  4OHJ A;  1B1Z A;  1CQV A;  1LT4 D;  3OWE B;  4RHR A;  1SE4 A;  1XXG A;  1ET9 A;  1HQR D;  3CHB D;  1HA5 A;  2R61 A;  1RDP D;  1SE3 A;  3BVM A;  1LT5 D;  1RD9 D;  1B44 D;  1PZK D;  2AQ1 B;  2SEB D;  1AW7 A;  1AN8 A;  5D3D A;  1FNV A;  1HTL D;  1JWM D;  3DWP A;  1EFI D;  1UNS A;  4RGN A;  5ELC A;  1TS3 A;  1I4P A;  1HXY D;  4UDU C;  1PZJ D;  1L0X B;  3R2T A;  1PRT C;  1LTI D;  1XTC D;  3R2I A;  1D5Z C;  4RGO S;  3BZD B;  2O2L D;  1S5E D;  1PTO B;  2QEJ C;  1ENF A;  1ET6 A;  1LLR D;  1LO5 D;  5FK9 C;  5ELE A;  1PTO F;  4Z9C B;  1PTO D;  1SEB D;  4C56 C;  1CHQ D;  3KLS X;  4RFB A;  1FNU A;  1F77 A;  1SXT A;  2IJ0 A;  1S5B D;  3SEB A;  3TSS A;  1CK1 A;  1BCP B;  1RF2 D;  1V1P B;  1I4H A;  1T5X D;  3MFG A;  3BYY B;  1PYW D;  2RDH A;  1LT6 D;  1EU4 A;  1BCP F;  1SE2 A;  1BCP D;  1STE A;  3URY A;  1DYQ A;  2NTT A;  1QIL A;  1PZI D;  1TS5 A;  3R8B A;  1SJH D;  1CT1 D;  2G9H D;  2ICI A;  4DXG A;  1LTA D;  1EEF D;  1JQY D;  2RDG A;  1TS4 A;  1L0Y B;  5TSS A;  1LTT D;  1KLU D;  1ESF A;  1TY2 A;  4BWG B;  4RGM A;  1D6E C;  1I4X A;  1LTR D;  5I4D A;  3BYT B;  4RCO A;  2IPK D;  2XRQ D;  3W2D A;  2TSS A;  1S5C D;  1EU3 A;  2WV6 D;  1RCV D;  1FNW A;  1I4R A;  1LTS D;  2QIL A;  1I4Q A;  1S5F D;  1V1P A;  1LTG D;  3O13 A;  4O1N A;  2XN9 C;  1JR0 D;  2XRS D;  4ZYS A;  1JCK B;  1KTK A;  2XNA C;  1PRT B;  2NTS A;  1V1O A;  3EA6 A;  1PTO C;  5ELB A;  1DJR D;  1GOZ A;  4RH6 A;  1FD7 D;  1G8Z D;  1PRT F;  1PRT D;  2J4X A;  1BXT A;  1S5D D;  4DXF A; 
#chains in the Genus database with same CATH topology
 3E3X A;  1I4G A;  3KLW A;  1TS2 A;  1QVC A;  5M5W B;  3KOJ A;  1QCB D;  3I2Z A;  5I6Y A;  2VQF Q;  1QVF A;  5JEA H;  2DNE A;  3TZD A;  5DNF A;  1R9T B;  1CKM A;  3A5U A;  1YBY A;  4G7Z C;  1B70 B;  2KQ3 A;  3VR5 A;  4A3K H;  1P16 A;  4XTC S;  3NQI A;  2E5L L;  2A6E D;  1X3F A;  2F0H A;  2HCC A;  4JBJ A;  2BA0 A;  2R61 A;  1PYS B;  3GDE A;  3GTQ H;  1E2V A;  5K5P A;  3F2D A;  1LM0 A;  2F0F A;  2B2W A;  2ZXR A;  4DNI A;  5KGU A;  5FO7 B;  1IYJ B;  1HTL D;  1S3O A;  4DUY Q;  3WOE A;  3ULP A;  4B3R Q;  3IFD A;  2F0U A;  1M8A A;  1Y8O B;  2CWP A;  5ELO A;  1L0X B;  4C2M H;  2YYZ A;  1JOQ A;  3T1Y Q;  2I5H A;  3DM3 A;  3BZD B;  4BBR G;  2R92 H;  1S5E D;  5C44 H;  3HOU B;  3CPF A;  1WTV A;  4BY7 G;  2DUD A;  3PUV A;  2JA8 B;  1PH8 A;  3G48 A;  2CKZ B;  1UAP A;  4X6A H;  4N9P A;  2IJ0 A;  1S5B D;  1EL0 A;  4RAU C;  2XWJ B;  1PMR A;  2QF7 A;  2H4O A;  3G6J B;  3URY A;  4KHZ A;  5M5W H;  3RUZ A;  1QNK A;  2H5X A;  5AJ3 L;  3PIO 3;  1Y1V B;  1I6H B;  2D9U A;  4OL7 A;  3J81 j;  1R9T H;  1CSQ A;  5BR8 Q;  4FF3 A;  3C1E A;  4QUC A;  4P72 A;  1R4P B;  5KEE A;  1SRU A;  1JT8 A;  4N9T A;  2PPB C;  2A69 C;  3RR5 A;  1C7Y A;  1XMO L;  1EOT A;  4KD3 A;  2HIX A;  2MO0 A;  4FF1 A;  2K01 A;  1LAC A;  2DGY A;  1V1P A;  1IBM Q;  5T1I A;  1KD1 C;  5JEA G;  1XNR L;  1F9R A;  2A6H C;  2K1B A;  4QCL A;  1SNO A;  2OCE A;  4B3T Q;  2E2J B;  1PTO C;  3GV3 A;  3OMC A;  1FYC A;  2EYL A;  4DV5 Q;  3F8T A;  2D2C C;  4KN4 C;  1ENA A;  1ICF B;  1SMX A;  4MTN A;  1K8O A;  4HIM A;  4AYB E;  3HOU H;  4EQP A;  4MTK A;  1VQA A;  5I6W A;  2JA8 H;  3OTO Q;  1Q7Y C;  1V8Q A;  4XQJ A;  4GNX A;  2IX3 A;  4O42 A;  3PO3 B;  2K5V A;  2B2V A;  4DAP A;  3CCL A;  5FLM H;  2ZTE A;  3T51 B;  4TSS A;  1IKM A;  1NSN S;  3FP9 A;  1XJV A;  4IAL A;  3KJO A;  4BA1 I;  5FKA C;  2AWN A;  1JB3 A;  1A63 A;  1X6O A;  5KIX A;  2VQE L;  1EYA A;  1Y1V H;  2AUK A;  2NWG A;  3I8Z A;  5C44 G;  4ZCK A;  1I6H H;  4OEM B;  5E4W C;  5IT9 E;  1F9P A;  1BF4 A;  3T1H L;  1EY8 A;  3DWP A;  2WB1 E;  2A69 D;  1JE5 A;  4A3F B;  4RKL A;  1SYF A;  3FPP A;  1KAB A;  1UNS A;  3A74 A;  3W3A A;  2RSO A;  4GKK L;  2B2Y A;  1B50 A;  1V9P A;  1KQS A;  2CWA A;  3NSW A;  4QIW B;  2PI2 A;  2E2D C;  1HNX Q;  3PUW A;  2A6H D;  2V4D A;  3I73 A;  3A55 A;  2PZW A;  1HZ9 A;  2E2J H;  3BZC A;  4B08 A;  4KKU A;  1PTO D;  1VQK A;  4LUO A;  4JI5 L;  4UY8 C;  2L1B A;  4UP9 A;  1EY0 A;  3K5M A;  1FJG Q;  3D31 A;  1IBL L;  3BYY B;  3ERS X;  2B3G A;  4HCS A;  1A2T A;  3PO3 H;  1FL0 A;  1VQJ A;  1H9K A;  5E1F A;  4DV1 Q;  1JB7 A;  4ULL A;  2QKI C;  1KDC A;  4M8A A;  3IFT A;  1H95 A;  2UXB Q;  3Q8D A;  5J22 A;  1WCM B;  1K9M C;  1BBW A;  1N33 Q;  1FNW A;  1I4R A;  3HOU G;  4X3K A;  1Q82 C;  2MNA A;  1QVG A;  1J5E L;  3DUZ A;  2JA8 G;  2WP8 J;  1X32 A;  2ZM6 Q;  1HZA A;  5IP9 H;  3MXP A;  5FLM G;  4KHP L;  1VQN A;  1QE6 A;  4A3F H;  5CBE E;  4YWM A;  1EYG A;  1IXR A;  1VCI A;  4OWX B;  5IGF A;  1PRT F;  4DV6 Q;  1G2S A;  1KNE A;  1SYB A;  3T4A C;  2LSS A;  1Y1V G;  2AQ2 B;  3SK8 A;  1LTB D;  4B9X A;  2ZTC A;  2E2H B;  3K81 C;  4ZK9 B;  1MSG A;  5IGB A;  1S40 A;  2K28 A;  2JEB I;  1B3Q A;  1AEX A;  1VQO A;  4QF4 A;  4IOA A;  1TR5 A;  2C35 B;  3OYY A;  2JP1 A;  2KJX A;  2OT2 A;  1B1Z A;  3CCM A;  4RA8 A;  4DPG A;  2JQO A;  3N6R A;  3D8G A;  1CM9 A;  4A3G B;  1ASY A;  1TWA B;  5IE8 A;  3K57 A;  2UXC L;  3KJP A;  4PMC A;  2SEB D;  1AW7 A;  2GVA A;  3SK4 A;  1OXT A;  3CKI B;  3OOC A;  2MQH A;  2B2U C;  1B3A A;  1WCM H;  1Z6H A;  3CC4 A;  2ATW A;  1W3S A;  1R4Q B;  4LUZ A;  1X3P A;  4U68 A;  2Z6K A;  4H13 C;  2XTI A;  2A5H A;  3TP7 A;  3GTO B;  2QGQ A;  1SRO A;  2JK8 A;  4J15 A;  2ZTD A;  1FNU A;  4GLA C;  1ILQ A;  1V1P B;  4CHT B;  1E3P A;  1JMC A;  1EYD A;  2OEO A;  2MFI A;  2K03 A;  4CDD C;  3J7Y W;  4IJL A;  3EBE A;  1CT1 D;  2E2H H;  2Q2U A;  3BDL A;  2BCO A;  3QIA A;  2EY5 A;  2L0C A;  1VQ9 A;  2AUJ D;  4YIJ A;  4A3F G;  3VYR A;  5DAU A;  4DNT B;  1WJJ A;  4HAE A;  1DGS A;  1B9N A;  1YEZ A;  1ICW A;  2ZT9 C;  4MHE A;  4GNX B;  1D8L A;  1O7Z A;  3L7Z C;  4FF2 A;  4A3G H;  2ES2 A;  3KF6 A;  5KND A;  4O1N A;  1NMG A;  1JR0 D;  4DV7 Q;  1RL2 A;  4AQY L;  2EQS A;  2NVQ B;  3T16 A;  2F3W A;  2XGT A;  1E24 A;  1C8C A;  2Z0S A;  3R3O A;  2X6L A;  4CKB A;  1UE5 A;  1MIU A;  2J4X A;  4NXN L;  1SAP A;  1VQ6 A;  1EY7 A;  3S2H H;  4WJ3 M;  3FKI B;  2P5Z X;  4LK1 C;  3GTO H;  1D5M C;  1OXV A;  2JN4 A;  2UXD L;  2OXP A;  3BVZ A;  4FF4 A;  3DMU A;  3A7L A;  3GP7 A;  4K2L A;  1TXY A;  5FO9 B;  2UUC Q;  5C4Z A;  2QW7 A;  3QB3 A;  5GAH C;  3V05 A;  1DOL A;  1WCM G;  5ISR A;  4MIU A;  1VQL A;  4L8J A;  3J81 L;  3Q6S A;  4LFA Q;  3VYT A;  1XPU A;  4X64 Q;  4G7O C;  2B63 G;  4F88 A;  2R7F A;  1E7Z A;  1EIY B;  2VUM B;  1SYE A;  4DR6 L;  1G29 1;  1PFM A;  2NVY B;  3MWY W;  3M4Q A;  1FNV A;  2UUB Q;  4BY1 B;  5IGD A;  4DV4 Q;  1QJO A;  4C3J B;  4WJW A;  1NY4 A;  3OW2 A;  2FMC A;  2EJG C;  1BR9 A;  3JAM c;  3TN2 A;  4OIJ A;  2RDF A;  5CV7 A;  2NVQ H;  4IPC A;  4JI7 L;  4LWC A;  5IGE A;  1PTO F;  4Z9C B;  3MZ5 A;  2F0V A;  1CKO A;  5LMU L;  4JV5 L;  3C2P A;  4POG A;  1E1O A;  4QJF A;  4ODG A;  3AMU A;  1HUN A;  2F1M A;  1PYW D;  2KCN A;  4B3M Q;  4A3G G;  4OON A;  3NPP A;  4IO9 A;  3L0O A;  3CME A;  3FKI H;  3HKS A;  3I55 A;  5DEH A;  3ULJ A;  4EVO A;  1EEF D;  4J8Q A;  4IFD I;  1WTX A;  5JJL A;  4CGY B;  1HZB A;  4HJ8 A;  3GD7 A;  1I4X A;  3LWE A;  2XRQ D;  5JJK A;  5I2Y A;  2F03 A;  2A68 C;  2VUM H;  5IP7 H;  2NVY H;  2A73 B;  3BU2 A;  2FIN B;  2Z4H A;  3E6Z X;  2JXM B;  4G57 A;  4BY1 H;  3QO2 A;  2NTS A;  3ZJY C;  2SNS A;  4C3J H;  4BA2 I;  3J80 c;  1N32 L;  1G8Z D;  3I4O A;  3TS2 A;  3TEH B;  4LF6 Q;  1RHP A;  1CI3 M;  1EIG A;  1UUP A;  1K0R A;  4DU9 A;  4JBM A;  3HOZ B;  5M5Y B;  4KKT A;  2VNU D;  5D3I B;  4YY3 L;  5CC4 A;  4JI4 Q;  4LF4 Q;  4DR4 Q;  2F3V A;  3PIO A;  4DR5 L;  1XMQ Q;  3RNU A;  1CQV A;  1M90 C;  2YTY A;  5LMN L;  5GAE C;  3NTI A;  2NUC A;  4JI8 L;  1PZK D;  2UU9 Q;  3NUC A;  4LF9 L;  4OWT B;  3S16 B;  3E9H A;  4CKE A;  4JI0 L;  3HZX A;  1DM0 B;  3NBI A;  4DV0 L;  4X66 Q;  4K5V A;  2RHS B;  3S1Q B;  1X54 A;  4X65 L;  4CDC C;  1L1O C;  2A68 D;  2K5Q A;  4APV A;  3PF5 A;  1KIX A;  1H9R A;  5EPL A;  1JIC A;  2L4N A;  4KN7 C;  4GS3 A;  2JA6 B;  1J8I A;  4HSP A;  2PZU A;  1G6Z A;  3PSI A;  3ULL A;  3M7N A;  1E2Z A;  5C0X J;  3VR4 A;  3KBX A;  2SNM A;  1BUV T;  4G4K A;  1K8G A;  2L55 A;  3TRZ A;  3HGB A;  2VUM G;  5IP7 G;  3HOZ H;  5M5Y H;  5ELN A;  4DR7 L;  1Q8I A;  2F0M A;  2D5D A;  4LJZ C;  4OX9 Q;  2RDG A;  4IUV A;  1GHK A;  1RIP A;  3AQQ A;  4PV1 C;  4BY1 G;  4C3J G;  2VB3 X;  1CFM A;  1NMF A;  5JJZ A;  1EOV A;  4A3I B;  1NUC A;  3BYT B;  2F4V Q;  1STG A;  2BDO A;  3W2D A;  1YNX A;  3J81 E;  1XPR A;  1PA6 A;  4IPH A;  3X3M A;  4X3T A;  3U58 A;  5EJW A;  4JBK A;  4DR2 L;  1TWH B;  2B2U A;  4HN7 A;  1DOK A;  5LMN W;  3S24 A;  3S16 H;  4LFB L;  1T5E A;  1U4M A;  1CKN A;  4R8N A;  2WIN B;  1X3G A;  3S1Q H;  3PO2 H;  1I5F A;  3OSO A;  1A3U A;  2KCC A;  2PQE A;  4JYA Q;  4QMG A;  2JA6 H;  1B7Y B;  1VQP A;  4QQB X;  1YVC A;  1BVS A;  3ERQ A;  2CH4 A;  3QWN A;  3H3V I;  3D4D A;  4MNO A;  2WAQ E;  4NB3 A;  5M3F B;  2Z9H A;  5CGK A;  3NWS A;  4IUQ A;  4L6T B;  1VQI A;  2O5I C;  1CTM A;  2JSO A;  2VY3 A;  2A8V A;  3LX0 A;  3F2U A;  3Q23 A;  4L5T A;  3FDT A;  3NEN A;  5F2D A;  1WFQ A;  2HD3 A;  4LMQ D;  2AQ1 B;  5FLX L;  3GV6 A;  5IYD G;  1KL9 A;  4A3I H;  1STH A;  4IUT A;  1OTC A;  1HXY D;  2EXZ A;  1UWV A;  1QB5 D;  2PMZ B;  4I65 A;  1Z47 A;  3MAQ A;  2XVS A;  1TWH H;  1TVX A;  2B29 A;  3HOZ G;  1TKW B;  4JPB W;  4JI3 L;  3A8I E;  3MEF A;  4XXE A;  2QA4 A;  4JI6 L;  1EWH A;  4TQU S;  1BBX C;  1NBW A;  4A3B B;  1SEB D;  3MXG A;  4LF8 Q;  2HIV A;  3KUP A;  2RA4 A;  4N8F A;  3CCV A;  3Q22 A;  1I4H A;  1IYV A;  1EUJ A;  1HR0 Q;  1HNW L;  3S14 B;  3OPO A;  1LT6 D;  2Q2I A;  5J39 A;  5EGT A;  4C3H B;  4R4T A;  4LF5 Q;  2Y0S B;  4UP8 A;  1SJH D;  2PZT A;  4CBV A;  1D2B A;  2M00 A;  3QG1 A;  2YTV A;  3KK7 A;  1Q3L A;  4DV3 L;  1BKB A;  5M3F H;  3ZYY X;  3TS0 A;  4KJN A;  2N55 A;  1KHI A;  4A76 A;  1A15 A;  5GAD C;  3EJI A;  4U67 3;  4YCU A;  1OXX K;  5JVG 3;  2JA6 G;  3GTJ B;  1B8A A;  3FVQ A;  4OXP A;  1LTG D;  4GOP B;  2HHH Q;  2OQK A;  4NMZ A;  2XRS D;  3K6O A;  1KTK A;  4IUP A;  1O78 A;  4IFD G;  1YNN C;  1SR3 A;  2J7Z A;  4P71 A;  3EA6 A;  5HGQ A;  4KLK A;  3G6E A;  2IY5 B;  1FD7 D;  1LTL A;  1OXU A;  4EGV A;  3AB9 A;  1GUG A;  1Y1W B;  1BCP C;  2KBN A;  4J1M A;  4KK7 A;  2F0N A;  3KDF A;  2VQF L;  2EY1 A;  4DK1 A;  2Z8L A;  3M9B A;  2RBM A;  3K5L A;  4DR1 Q;  4A3B H;  3PMF A;  3E5S A;  3CRK C;  1FGB D;  2AQ3 B;  4HED A;  5EPJ A;  1LT3 D;  3G71 A;  4A3I G;  2I0Q A;  3S14 H;  3S15 B;  1STA A;  2X69 A;  4NKL A;  4FVM A;  2KEE A;  3V2T A;  3A56 A;  1J9O A;  1UEA B;  4OHJ A;  5J1Z A;  4A3K G;  4FXD A;  4C3H H;  4O2D A;  1HQR D;  1Q46 A;  3L3O C;  4RMF A;  1KDB A;  2F0D A;  2BH8 A;  2ENB A;  3BJU A;  1IYU A;  3EVQ A;  5GRO A;  1GUS A;  4X62 Q;  4YCV A;  4B3R L;  4ZQ3 A;  2RSN A;  4UDU C;  3HOY B;  2AWO A;  2RCF A;  5JVH 3;  2EZV A;  1MHW C;  4RWS C;  3GTJ H;  3I90 A;  1HFN A;  3T1Y L;  4KY6 A;  3U9S A;  1QUQ B;  3H0G B;  1YNN D;  3W5O A;  3ICE A;  1K83 B;  3KYH C;  1LO5 D;  2J0T D;  3NK9 A;  3SHL A;  3T13 A;  4I7Z C;  2R92 G;  3LNN A;  5M3F G;  3H3V H;  1K0S A;  3SEB A;  3TSS A;  4J6H A;  4JI1 Q;  4P73 A;  2DY8 A;  1ILP A;  2VB2 X;  3CMA A;  4DAV A;  3K80 C;  3K0Y A;  3M3Y B;  1I94 Q;  2IT1 A;  1BCP D;  1AE3 A;  3CCE A;  1Y1W H;  1CKN B;  1VMC A;  4KHP Q;  4P74 A;  3J7A 5;  2ICI A;  2MUY A;  4ABN A;  3VYS A;  5BR8 L;  1IHZ A;  1JQY D;  2F0L A;  4LW1 A;  4S3S A;  2QEX A;  2VXW A;  1N9W A;  3BDO A;  4A75 A;  4HJ7 A;  1HJP A;  2K7V A;  3S15 H;  3L9A X;  5I4D A;  1U4P A;  2EE1 A;  3UE1 A;  3S1M H;  2I5M X;  4KY7 A;  1UE1 A;  5FJ8 H;  4YHH Q;  1DZ1 A;  3P1H A;  2L15 A;  4OO1 H;  2ZJR A;  4FXK C;  1IBM L;  3K0X A;  1DON A;  1JCK B;  3CCJ A;  5FLX E;  3NE5 B;  1X9N A;  3OIP A;  1Z7T A;  1ENC A;  1X3Q A;  2F0K A;  2RKS A;  1G51 A;  1KRS A;  4GLV B;  1HR0 W;  3HOY H;  4E6I A;  1B53 A;  4DV5 L;  4CJ0 B;  4C3H G;  3C1F A;  4QL5 A;  4ZKB B;  1H9S A;  1KNA A;  3H0G H;  3OTO L;  1K83 H;  5EKL A;  1O7L A;  3PV0 A;  1GUT A;  4FXG C;  1CZG A;  4POF A;  5E3F A;  4A3D B;  1XX8 A;  2NN6 I;  3DLL A;  3HOW B;  3I4N B;  3NXW A;  4WFN 3;  3EIV A;  3M3Y H;  1A3V A;  4K0K Q;  2EYM A;  3H91 A;  1XNQ Q;  2MHV A;  2IL8 A;  3DHQ A;  2VS1 A;  1SE3 A;  4HCE A;  4UPA A;  1TWC B;  3M4Y A;  5DLQ E;  5H1S E;  3BDC A;  3H94 A;  4XQN A;  4KD4 A;  1VQE A;  1EFI D;  2F0Q A;  3G4S A;  1SYG A;  4PMW A;  1N34 Q;  1XTC D;  1HNX L;  1Y1W G;  1U4R A;  3RD4 A;  1K28 A;  2WII B;  2JYO A;  2E76 C;  4MN3 A;  5ELE A;  1AZQ A;  4XYO A;  2B8F A;  3RZO B;  3NBH A;  1FGU A;  4RFB A;  3K7U C;  1F77 A;  1CK1 A;  2NBF A;  1JE4 A;  1T5X D;  5C4H A;  3HG9 A;  5FJ8 G;  1MI2 A;  1EU4 A;  4XIG S;  3VDY A;  1SE2 A;  1VQF A;  2B2T C;  1X65 A;  4R8I A;  3MTS A;  3TP8 A;  3DXJ C;  1SE8 A;  1Q12 A;  3DEP A;  4RKB A;  1AZP A;  4H02 A;  4HJA A;  4DXG A;  3S2H B;  4A3D H;  2XWB B;  3PUY A;  3PO3 G;  4Q0F A;  1ESF A;  5E7N A;  4DA2 A;  1IL8 A;  3HOW H;  4KV6 A;  3HOY G;  2IPK D;  3I4N H;  1K3B C;  4I7A A;  2UXB L;  3KDF B;  1VQD A;  1S5C D;  5JJI A;  1KDA A;  1N33 L;  1X55 A;  4A3E B;  2WKD A;  2ASB A;  1CZW A;  3H0G G;  4HR7 B;  2ZM6 L;  2DJF C;  1TWC H;  3HOV B;  1VQH A;  4KJO A;  2G5D A;  2F0I A;  2BDN A;  5IP9 G;  1ZEQ X;  2N49 A;  3KF8 A;  3OWF A;  3L2P A;  4RH6 A;  4DV6 L;  3D3R A;  1GD7 A;  4FP5 D;  4YCW A;  5EQ0 A;  5M9O A;  4CJ2 C;  3E0E A;  5CV8 A;  4PMB A;  3M4O B;  1F2Y A;  1CHP D;  4L63 B;  1BOS A;  3AU7 A;  1KLG D;  1N36 Q;  1JWS D;  1AFP A;  1HHV A;  2AKW B;  3M85 A;  3RZO H;  3Q0A A;  2R7Z B;  1RTO A;  4G7H C;  1MD2 D;  5CV6 A;  1GKH A;  3FPU B;  4WRD A;  5CYU A;  3PIP 3;  4AYB B;  2Q8T A;  3ONA B;  3VA7 A;  4RCN A;  1UE6 A;  1B2T A;  5KYL A;  3J81 i;  2LFN A;  1MGS A;  3CC7 A;  2C5C A;  1LT5 D;  2LY7 A;  4QGU A;  3D4W A;  3TDQ A;  3F2B A;  2CCZ A;  2O5J C;  1Y14 B;  5D3D A;  3WDN A;  2D0P A;  2MPM A;  4ME5 A;  5CR3 A;  1BNZ A;  4RGN A;  4LUV A;  1KC8 C;  4DV2 Q;  3H09 A;  3MVV A;  4YWK A;  3R2T A;  1XYI A;  1T9H A;  4XYQ A;  4JI2 Q;  2KCT A;  4A3E H;  5K36 H;  2F52 A;  5I2X A;  2WB1 B;  3UI2 A;  2K75 A;  3HOV H;  5E4X A;  4LF7 Q;  1YJN A;  2IWH A;  2BOS A;  3VA5 A;  3OMG A;  5C0X H;  5C4X B;  2RF4 A;  5GQO A;  5IWA Q;  4L5R C;  2NN6 H;  3I4N G;  3GTP B;  3S9W A;  2JA7 B;  3M4O H;  4Y52 H;  3HP3 A;  1A2U A;  2K5N A;  1BCP F;  4DNR B;  4AIM A;  1MSH A;  3E0J A;  4F7X A;  4DK0 A;  4KY5 A;  4GLX A;  2EYH A;  1Q86 C;  5EAY A;  4BBS B;  2R7Z H;  1EIF A;  2ALY B;  1KRT A;  1TS4 A;  4C3I B;  1QZH A;  1TY2 A;  1SSO A;  1YZ6 A;  3I91 A;  4RGM A;  4LFC Q;  1H9S B;  5CV5 A;  2EOT A;  5I9O A;  3S1R B;  4DK6 C;  1GUW A;  3CXC A;  1LTS D;  2WKC A;  3CU7 A;  3BS1 A;  1S5F D;  5NUC A;  4YWL A;  3M4P A;  1HNZ Q;  4DV7 L;  3H6M A;  5G3L D;  1WTP A;  2BE5 C;  1PRT B;  2F0O A;  3HEJ A;  1SNC A;  5C4J B;  1QWY A;  1EQT A;  4GKJ Q;  4BWG B;  1EEI D;  4P2C B;  2R3Z A;  1IBK L;  3BVG A;  5IGC A;  1PH4 A;  1NNX A;  2DN8 A;  5D65 A;  1Q1E A;  3UDF A;  3HKZ B;  2EY2 A;  1VF7 A;  1EZ6 A;  5C4X H;  1NR2 A;  2DNC A;  2FFK B;  2TMP A;  3A54 A;  2OTJ A;  1SJE D;  4JBW A;  1EY6 A;  5IT9 c;  3ER0 A;  3GTP H;  3W1G A;  2JA7 H;  2Z1C A;  1LT4 D;  4A3E G;  4RHR A;  3CRL C;  4NW2 A;  4LFA L;  5K36 G;  4X64 L;  1K8M A;  3CHB D;  2DY7 A;  1BQQ T;  3NBH B;  1GUN A;  3HOV G;  1RD9 D;  2UUA Q;  4BBS H;  1HRJ A;  2PW5 A;  2PQA A;  4C3I H;  4QUF A;  1J6Q A;  2F3I A;  3HS0 C;  4IJH A;  3K7A B;  5C0X G;  2UUB L;  1XWE A;  4K14 A;  4DV4 L;  2NN6 G;  4UAI A;  5ELC A;  3AEV A;  3CF5 A;  1SMY C;  3S1R H;  2F0G A;  1UEB A;  1PZJ D;  2KHS A;  2EIF A;  2XSC A;  1K8A C;  2BE5 D;  3VR2 A;  2R7Z G;  5FK9 C;  2CH4 W;  1AP0 A;  3A8K E;  1YHB A;  4HMI A;  3KLR A;  4LAA A;  3KBG A;  3I4M B;  4AYB G;  5C4J H;  1PH6 A;  3UE0 A;  4B3M L;  1I3Q B;  3PO2 B;  1NJI C;  1WVL A;  2N8N A;  1SNQ A;  4LFB Q;  3TP6 A;  3SK6 A;  2MJ8 A;  1OXS C;  3K5N A;  1GHJ A;  3KF8 B;  1G2T A;  2D0O A;  4K5W A;  2OQ0 A;  1LTA D;  3A7A B;  3FKI G;  1ML0 D;  5M3M B;  2WAC A;  4OGQ C;  1KLU D;  5C3E B;  4ILW A;  2PYK A;  1HCZ A;  1C9O A;  3D0F A;  4HMJ A;  1H9J A;  3KLS A;  1GVP A;  3U50 C;  1TWG B;  2QIL A;  3KF6 B;  2WB1 G;  4DR3 Q;  3RN5 A;  1TII D;  3VR6 A;  2EYO A;  5EBD A;  4A3C H;  2K05 A;  3K7A H;  2HQL A;  4HJ5 A;  4DFA A;  1ESR A;  1SMY D;  3MFY A;  4KHV A;  4F8M A;  4DUZ Q;  2HDM A;  5HGT A;  2JA7 G;  2MP1 A;  1IZ6 A;  3JAM L;  2KHI A;  1C0A A;  3FRP B;  4LF6 L;  2A74 C;  4MZ9 A;  4XT3 B;  4BBS G;  1D7Q A;  1RJT A;  1RTN A;  2YV5 A;  4JI4 L;  1GXD C;  3DWA A;  2KVM A;  2CQA A;  3I4M H;  4LF4 L;  1C48 A;  2B2T A;  4DR4 L;  3Q24 A;  1WTR A;  4H7B A;  2E5L Q;  1NCV A;  3PUZ A;  1XMQ L;  1TY0 A;  1D1K A;  1JWU D;  3RLO A;  3SGI A;  4R9W A;  4JI6 Q;  1I3Q H;  1SE4 A;  3TQY A;  4R4I A;  2KOL A;  3BVM A;  1TQO A;  1X3E A;  5M3M H;  1NE3 A;  2UU9 L;  4QIW E;  1EQR A;  3T56 B;  1YIJ A;  5A2Q L;  5C3E H;  2QCP X;  3AFQ A;  5KNB A;  2K14 A;  3MA2 B;  1BDO A;  5KYI A;  1K73 C;  2LS0 1;  1DCZ A;  1G6P A;  1TWG H;  3IAY A;  5IT9 L;  5IY0 A;  5A35 A;  4FNF A;  2O2L D;  1PTO B;  3HKZ G;  1LAB A;  1U5K A;  4L5Q A;  4ZLT F;  3UDI A;  3D6C A;  2FHT A;  3J80 L;  2EJF C;  1L2F A;  4PZ7 A;  4B3S L;  1U9R A;  1PH7 A;  1EY4 A;  5HY6 A;  3PQI A;  4KMU C;  5AJ3 Q;  1PZI D;  2CFM A;  3X3N A;  2R93 B;  4OX9 L;  1S72 A;  4H0L C;  4OO1 I;  4A3M B;  4CKC A;  1DOM A;  3AYH B;  1E22 A;  1LTT D;  4TKO B;  2F4V L;  4L5S A;  1GO3 E;  1CA6 A;  2TSS A;  3EQL C;  4ZUI A;  1XMO Q;  2KA7 A;  3A0J A;  2EXD A;  2K32 A;  4HJ9 A;  4JOI C;  2PNH A;  5G3L F;  1I50 B;  3GO5 A;  1XNR Q;  2XNA C;  1CQF A;  4JW0 A;  2E8G A;  2ZXO A;  3A5Z B;  3I4M G;  4O0A A;  1JC7 A;  1V1O A;  3STB C;  3R93 A;  1HUM A;  4NXM L;  1EIH A;  1EZ8 A;  2OTL A;  5COY A;  4JYA L;  4ZUJ A;  4IUN A;  2NB0 A;  2PQA B;  3PO2 G;  1PTO H;  1STN A;  3MHB A;  1TWF B;  1EWC A;  5BN4 A;  1D5X C;  5JOB A;  1IKL A;  1F9S A;  4K6L A;  4RGT A;  5M3M G;  1GUO A;  5KRU A;  1VQG A;  3P7J A;  4PZ6 A;  2YU9 B;  1VQM A;  5C3E G;  3HOX B;  1SNM A;  2E2I B;  2C9O A;  4OEL B;  3SVM A;  2NZH A;  2CVR A;  2XIW A;  1LUZ A;  1SNP A;  5GAG C;  2ZXP A;  1F2L A;  3DWQ A;  3I72 A;  4A4I A;  1VQC A;  2JE6 I;  3OWE B;  1JJ2 A;  3IL8 A;  2VQE Q;  2R93 H;  1RDP D;  4FYD A;  3HFZ B;  5JPM C;  1S4Z A;  4A3M H;  1B44 D;  3T1H Q;  1E0B A;  1NAP A;  3NTH A;  2M9V A;  4GKK Q;  2B39 A;  1I4P A;  2NVT B;  3IRB A;  1PFN A;  3I70 A;  4BS9 A;  1N8R C;  5IYC H;  4UHV A;  4RGO S;  4K8J A;  1I50 H;  4DAY A;  3S1M B;  2F0S A;  1WTH A;  2HT1 A;  2LXJ A;  2GA4 B;  3SXH A;  3STB D;  2JA5 B;  3KLS X;  5EPK A;  1U0L A;  4JI5 Q;  4LF8 L;  2L5T A;  1H9M A;  1RF2 D;  1HR0 L;  3JAM E;  3NTK A;  2E75 C;  4TVA B;  4K5X A;  4DUY L;  3SR1 A;  1IBL Q;  2K6A A;  2ZJP A;  3LWU A;  1TWF H;  2NTT A;  4LF5 L;  1SYC A;  2BH2 A;  1TS5 A;  3PIP A;  3OIQ A;  2YU9 H;  2E74 C;  2Z6B A;  3OHX C;  3HOX H;  3UDX A;  2E2I H;  1SFO B;  1SND A;  5EKK A;  1W6K A;  1D6E C;  2YTX A;  3CW2 C;  1VQ5 A;  3FEW X;  4UP7 A;  1O7Y A;  1WTQ A;  3MXN A;  1Q90 A;  1C4Q A;  1KAW A;  1UE7 A;  3CCS A;  2NZ1 D;  2RCN A;  3NEL A;  4IFD J;  2HHH L;  5LHY 1;  2VW9 A;  4C1N K;  1J5E Q;  5A2Q E;  4FDB A;  1VQB A;  2N3S A;  4EQN A;  2A1A A;  2NVT H;  3GTM B;  1PVO A;  5BN5 A;  3C3L A;  2SOB A;  2F0E A;  2PI2 E;  4PG3 A;  3RMH A;  2R93 G;  2F0J A;  5EBC A;  1MKH A;  4CJ1 B;  4A3M G;  5JEA J;  1P8L A;  2CHB D;  2RQX A;  3D4R A;  4DR1 L;  4GZY C;  3J80 E;  2JA5 H;  3CP0 A;  1XPO A;  1SBB B;  1HFG A;  5BN3 A;  2G9D A;  4A3B G;  1L1O A;  4IZ8 A;  3NQT A;  4B3T L;  3CQZ B;  3MXU A;  5IYC G;  4QY7 A;  5LL6 X;  3VYU A;  2CQO A;  2L12 A;  1ASZ A;  5FOB B;  2WAQ B;  3U4V A;  2K5H A;  2UXC Q;  1QNU A;  2Y0S G;  1Q81 C;  4N8X 1;  1MJC A;  1EY9 A;  1SLJ A;  3CPW A;  1SFO H;  1AN8 A;  4X62 L;  1Y8P B;  4PNY A;  1JWM D;  3CCQ A;  1DXM A;  2FXQ A;  4GOP C;  1ZXT A;  1ZYR C;  5C0X I;  3RN2 A;  1BO0 A;  2QDL A;  2Q2H A;  1HH2 P;  2BA1 A;  3LGJ A;  5COR A;  3CD6 A;  3A8J E;  1SYD A;  2HUG A;  2ID0 A;  2EYF A;  4ME3 A;  4KI0 A;  3H3V C;  4R4O A;  2K52 A;  4BXX H;  2OWO A;  1ET6 A;  5IGG A;  1M1K C;  3HOX G;  2JA9 A;  1PXU A;  3P20 A;  3TME A;  2O4X A;  1A62 A;  3GTM H;  2L11 A;  1TU2 B;  3BG3 A;  4JI1 L;  4K2K A;  5IOC A;  1PH3 A;  2B63 B;  5HUR A;  1I94 L;  1STE A;  4XQQ A;  4F87 A;  1Y8N B;  1JJC B;  1QG7 A;  3J81 c;  4CDF C;  2PO4 A;  2JEA I;  3VR3 A;  2MO1 A;  3TZU A;  4HSV A;  3HKZ E;  1YJ9 A;  1PYB A;  1HZC A;  2NVX B;  3J7Z C;  4A93 B;  5IOD A;  1QZG A;  5T1G A;  2AMC B;  5DM6 3;  4RCO A;  1JJG A;  3CQZ H;  2EYP A;  3I3C A;  4YHH L;  2K50 A;  1EU3 A;  5EKI A;  2EPB A;  4PQX A;  4CDE C;  1CSP A;  1FJG L;  3I4L A;  4IUR A;  4ZKC B;  4AQY Q;  3U4Z A;  3H15 A;  1MJE A;  1O80 A;  4OO1 G;  3V96 A;  2JA5 G;  4JK1 C;  2K33 A;  1F2M A;  1ZYR D;  5C6A A;  3MEH A;  2R6G A;  1TT2 A;  4DV1 L;  1YHA A;  4NXN Q;  1A3T A;  4DXF A;  1W2B A;  3TRE A;  5J3B A;  4WJ4 A;  4P75 A;  3PUX A;  3T53 B;  3CAM A;  1PFB A;  3PCO B;  2KEC A;  4H44 C;  3ITP A;  1MBY A;  3QJY A;  3S17 B;  5ELF A;  2UXD Q;  3RZD B;  1VS0 A;  5JPN C;  3S2D B;  2PNR C;  1OO9 B;  4DAY B;  1WOC A;  4ALP A;  2B63 H;  2KUM A;  2DJG C;  4K0K L;  3ND9 A;  1PFS A;  1XNQ L;  1ET9 A;  4GN5 A;  2HQE A;  4XDX A;  4JVZ A;  4NP5 A;  4BXX G;  4XT1 B;  4R4C A;  4DR6 Q;  2NVX H;  1PHJ A;  4A93 H;  2KED A;  4EQO A;  1FVI A;  4JOI A;  1N34 L;  2KHJ A;  1A8V A;  4R4Q A;  2MGS A;  3NEM A;  5JAV A;  3K58 A;  1A6X A;  3R2I A;  5D14 A;  2QEJ C;  4R1J A;  3RLF A;  3PF4 A;  2WFW A;  4JI7 Q;  3MXN B;  4EQ5 A;  5LMU Q;  4JV5 Q;  2IW3 A;  1TWA H;  2LXK A;  3NP8 A;  3D6W A;  3HRZ C;  1VQ4 A;  2WAQ G;  1DYQ A;  4ID6 A;  5FO8 B;  3R8B A;  5IIF A;  2OF1 A;  3S17 H;  1Y69 U;  2KCM A;  3RZD H;  3NHH A;  3QOJ A;  3G7L A;  3S2D H;  3FMC A;  1RKN A;  1WYD A;  3W1B A;  1CA5 A;  3UDG A;  1LTR D;  1IBK Q;  4A3D G;  3SE0 A;  2K4K A;  2F0P A;  2B2W C;  5CMD A;  2WV6 D;  5C3W A;  1LV9 A;  3HOW G;  1U4L A;  1EQV A;  2EVB A;  1Z9F A;  4M1U B;  1SDF A;  2XN9 C;  2I07 B;  1VMP A;  1JOO A;  1L1O B;  3TBI B;  5CBA E;  3PGZ A;  3JC6 6;  4OWW B;  1DD2 A;  2SDF A;  1L0W A;  4A3J B;  1DJR D;  4ZAI A;  2PCF B;  3E9I A;  1STY A;  1N32 Q;  4X3U A;  4V19 0;  1S5D D;  2JJQ A;  2L9H A;  3EFX D;  3KFU A;  3S1N B;  2V1C C;  2F4I A;  4DKA C;  4IPD A;  2FMM A;  1N36 L;  3CCR A;  1B9M A;  4HTH A;  4WOR A;  1W6J A;  4Y7N B;  1A0I A;  1M4V A;  4A93 G;  4V0B A;  4YY3 Q;  2A19 A;  1EWI A;  1KAA A;  3GTG B;  5M5X B;  4DR5 Q;  3N52 A;  1JOK A;  1O7I A;  3AFP A;  2EJM A;  4GN4 B;  2CW0 C;  1WD1 A;  1XXG A;  1HA5 A;  2NYZ D;  1YIT A;  5LMN Q;  2Q2T A;  2AHO B;  2LMC B;  3QR8 A;  3TP5 A;  1HQM C;  2PMZ E;  4JI8 Q;  4DAM A;  5IYB H;  4LF9 Q;  4PZ8 A;  4JI0 Q;  4DV0 Q;  3OW7 A;  3FHW A;  4DV2 L;  4X65 Q;  4HIK A;  2UUC L;  4JI2 L;  1STB A;  1V43 A;  1AE2 A;  3GQB A;  3U9O A;  4DN4 M;  2H1E A;  5KNC A;  1BBU A;  4C1N I;  4LF7 L;  5DM7 3;  1FR3 A;  2Y0S E;  4C56 C;  1CHQ D;  2IX0 A;  5IWA L;  4A3J H;  1WTO A;  2B8G A;  5CV4 A;  1GJX A;  1ONL A;  2EDG A;  4GNX C;  1I6V C;  2B2V C;  3S1N H;  2N78 A;  2PW7 A;  1VDZ A;  4A3L H;  5I9P A;  4Y7N H;  4DR7 Q;  5TSS A;  1YNJ C;  3CC2 A;  2Z4I A;  3GTG H;  5M5X H;  5FLX c;  2I5L X;  2N88 A;  4LFC L;  1YI2 A;  2CW0 D;  1YHQ A;  4QB4 A;  1IW7 C;  1RCV D;  3EN2 A;  1HPC A;  3DM1 A;  2GVB A;  3BZK A;  5C3X A;  1HNZ L;  2B2Y C;  4GOP A;  4HID A;  4DR2 Q;  3B6Y A;  1NTG A;  3C46 A;  1B4O A;  4DK3 C;  3J7A F;  1ROD A;  1Q1B A;  1IL2 A;  4JCV E;  4GKJ L;  1WTW A;  3ERO A;  1CUK A;  3JAM i;  1NR4 A;  3MC0 B;  3F2C A;  5ELD A;  2Q8I B;  2IHE A;  1WI5 A;  4FO2 A;  4NDX A;  3ND8 A;  4RHS A;  4BBR B;  1F9Q A;  1HA6 A;  3SDZ A;  2K04 A;  2R7D A;  3NWT A;  4DF7 A;  2RVL A;  1PV4 A;  4BY7 B;  1Q8K A;  4TRD A;  5IYB G;  3GTK B;  3CCU A;  1JOR A;  4IQZ A;  4IOC A;  5C4X G;  2I46 A;  3I7F A;  2ZJQ A;  1E2W A;  2LKV A;  1ZKO A;  2ICE C;  3P75 A;  1WD0 A;  5IYD H;  4B9W A;  2UUA L;  1EYC A;  1EY5 A;  5C5M A;  1YNJ D;  1II3 A;  2EY6 A;  2QDB A;  4B3S Q;  2K5D A;  2K5W A;  4A3J G;  1EFW A;  5C5L A;  4Q5V A;  1QOH A;  1VQ7 A;  1TS3 A;  4C3I G;  4KKS A;  1IW7 D;  2M2L A;  4DGZ A;  2HDL A;  2Q8R E;  3QOL A;  3GTL B;  1F2Z A;  1PRT C;  1LTI D;  4K8I A;  1D5Z C;  1EQQ A;  2GN5 A;  1XTD A;  4A3L G;  5L37 A;  4RG1 A;  1ENF A;  1KXL A;  1PH5 A;  1PH1 A;  5AFW A;  1QUQ A;  4JI3 Q;  1VF5 C;  1LLR D;  4IUU A;  4GN3 B;  2IHF A;  2HCI A;  5LL6 S;  1SXT A;  3J80 i;  4JG2 A;  1BCP B;  4A3K B;  3K59 A;  5CV9 A;  1YJW A;  1SN8 A;  1HNW Q;  1K3R A;  2A6E C;  2VZA A;  3MFG A;  2RDH A;  4X66 L;  2RHQ B;  1V1Q A;  3RLN A;  3WOF A;  1GM5 A;  1G91 A;  4BBR H;  1PH2 A;  1QIL A;  4OIK A;  3K5O A;  4AH6 A;  1AH9 A;  2G9H D;  3GTQ B;  4BY7 H;  2EYJ A;  4NXM Q;  1PLF A;  3GTK H;  1VQ8 A;  1X56 A;  4NPS A;  3WWV A;  1L0Y B;  4DV3 Q;  3K8A A;  4IN3 A;  4HIO A;  2F0W A;  2NZO A;  3J7A V;  2VL6 A;  2X6G A;  4EX5 A;  2F0T A;  2D62 A;  2FJ2 A;  4C2M B;  3SK5 A;  1I4Q A;  1PDQ A;  4DR3 L;  2KEN A;  3O13 A;  4IFD H;  2R92 B;  1LYL A;  3IKJ A;  4ZRZ A;  3DEO A;  4ZYS A;  5C44 B;  1PH9 A;  4K6D A;  4LNQ A;  4JC0 A;  1E1T A;  3I56 A;  1D1I A;  2Z6K C;  4KTA A;  2IX1 A;  5ELB A;  4DUZ L;  4A3C G;  1GOZ A;  4IPG A;  1HTP A;  1PRT D;  3M7G A;  3F1Z A;  1BXT A;  4X3S A;  3GTL H; 
#chains in the Genus database with same CATH homology
 1I4G A;  1TS2 A;  5M5W B;  1QCB D;  5I6Y A;  5JEA H;  2DNE A;  3TZD A;  5DNF A;  1R9T B;  4G7Z C;  2KQ3 A;  3VR5 A;  4XTC S;  3NQI A;  2A6E D;  2F0H A;  2HCC A;  2BA0 A;  2R61 A;  1E2V A;  5K5P A;  2F0F A;  2B2W A;  2ZXR A;  5KGU A;  5FO7 B;  1HTL D;  3WOE A;  3IFD A;  2F0U A;  1M8A A;  1Y8O B;  1L0X B;  2YYZ A;  1JOQ A;  3BZD B;  1S5E D;  3HOU B;  1WTV A;  3PUV A;  2JA8 B;  1UAP A;  4N9P A;  2IJ0 A;  1S5B D;  1EL0 A;  4RAU C;  2XWJ B;  1PMR A;  2QF7 A;  2H4O A;  3G6J B;  3URY A;  4KHZ A;  3RUZ A;  1QNK A;  3PIO 3;  1Y1V B;  1I6H B;  2D9U A;  4OL7 A;  4FF3 A;  3C1E A;  4QUC A;  1R4P B;  5KEE A;  4N9T A;  2PPB C;  2A69 C;  1EOT A;  4KD3 A;  4FF1 A;  2K01 A;  1LAC A;  1V1P A;  5T1I A;  5JEA G;  1F9R A;  2A6H C;  2K1B A;  4QCL A;  1SNO A;  2E2J B;  1PTO C;  3GV3 A;  3OMC A;  1FYC A;  2EYL A;  2D2C C;  4KN4 C;  1ENA A;  1K8O A;  4EQP A;  5I6W A;  1V8Q A;  4XQJ A;  3PO3 B;  2IX3 A;  4O42 A;  2B2V A;  4DAP A;  3T51 B;  4TSS A;  1IKM A;  1NSN S;  4IAL A;  4BA1 I;  5FKA C;  2AWN A;  1JB3 A;  5KIX A;  1EYA A;  2AUK A;  2NWG A;  3I8Z A;  5E4W C;  5IT9 E;  1F9P A;  1BF4 A;  1EY8 A;  3DWP A;  2A69 D;  4A3F B;  4RKL A;  1SYF A;  3FPP A;  1KAB A;  1UNS A;  3W3A A;  2RSO A;  2B2Y A;  1B50 A;  3NSW A;  4QIW B;  2E2D C;  3PUW A;  2A6H D;  2V4D A;  3I73 A;  3A55 A;  2PZW A;  4B08 A;  4KKU A;  1PTO D;  2L1B A;  1EY0 A;  3K5M A;  3D31 A;  3BYY B;  4HCS A;  1A2T A;  1H9K A;  5E1F A;  4ULL A;  2QKI C;  1KDC A;  4M8A A;  3IFT A;  5J22 A;  1WCM B;  1FNW A;  1I4R A;  4X3K A;  3DUZ A;  2WP8 J;  1X32 A;  3MXP A;  1QE6 A;  5CBE E;  1VCI A;  5IGF A;  1PRT F;  1G2S A;  1KNE A;  1SYB A;  3T4A C;  2AQ2 B;  3SK8 A;  1LTB D;  4B9X A;  2E2H B;  5IGB A;  4ZK9 B;  1MSG A;  2K28 A;  2JEB I;  1AEX A;  4QF4 A;  1TR5 A;  2JP1 A;  2KJX A;  2OT2 A;  1B1Z A;  4RA8 A;  3N6R A;  3D8G A;  1CM9 A;  4A3G B;  1TWA B;  3K57 A;  4PMC A;  2SEB D;  1AW7 A;  3SK4 A;  1OXT A;  3CKI B;  3OOC A;  2B2U C;  1B3A A;  1Z6H A;  1R4Q B;  1X3P A;  4U68 A;  4H13 C;  2A5H A;  3TP7 A;  3GTO B;  1FNU A;  1ILQ A;  1V1P B;  4CHT B;  1EYD A;  2OEO A;  2K03 A;  3J7Y W;  1CT1 D;  3BDL A;  2BCO A;  3QIA A;  2EY5 A;  2L0C A;  2AUJ D;  4YIJ A;  3VYR A;  5DAU A;  4DNT B;  4HAE A;  1B9N A;  1ICW A;  2ZT9 C;  4MHE A;  1O7Z A;  3L7Z C;  4FF2 A;  5KND A;  4O1N A;  1JR0 D;  2NVQ B;  3T16 A;  2F3W A;  1C8C A;  3R3O A;  2X6L A;  4CKB A;  2J4X A;  1SAP A;  1EY7 A;  3FKI B;  4LK1 C;  1D5M C;  1OXV A;  2OXP A;  3BVZ A;  4FF4 A;  3DMU A;  3A7L A;  3GP7 A;  4K2L A;  5FO9 B;  5C4Z A;  3QB3 A;  3V05 A;  1DOL A;  5ISR A;  4MIU A;  4L8J A;  3J81 L;  3Q6S A;  3VYT A;  4G7O C;  4F88 A;  2VUM B;  1SYE A;  1G29 1;  1PFM A;  2NVY B;  3MWY W;  1FNV A;  4BY1 B;  5IGD A;  1QJO A;  4C3J B;  4WJW A;  2FMC A;  2EJG C;  1BR9 A;  3TN2 A;  4OIJ A;  2RDF A;  5CV7 A;  5IGE A;  1PTO F;  4Z9C B;  3MZ5 A;  2F0V A;  3C2P A;  4ODG A;  3AMU A;  1HUN A;  2F1M A;  1PYW D;  2KCN A;  3NPP A;  5DEH A;  4EVO A;  1EEF D;  4J8Q A;  4IFD I;  1WTX A;  4CGY B;  3GD7 A;  1I4X A;  3LWE A;  2XRQ D;  5I2Y A;  2F03 A;  2A68 C;  2A73 B;  2FIN B;  2Z4H A;  3E6Z X;  2JXM B;  4G57 A;  3QO2 A;  2NTS A;  2SNS A;  4BA2 I;  1G8Z D;  1RHP A;  1CI3 M;  1EIG A;  1UUP A;  4DU9 A;  3HOZ B;  5M5Y B;  4KKT A;  2VNU D;  5D3I B;  5CC4 A;  2F3V A;  1CQV A;  3NTI A;  2NUC A;  1PZK D;  3NUC A;  3S16 B;  4CKE A;  3HZX A;  1DM0 B;  3NBI A;  4K5V A;  3S1Q B;  2A68 D;  2K5Q A;  1H9R A;  5EPL A;  1JIC A;  2L4N A;  4KN7 C;  2JA6 B;  1J8I A;  4HSP A;  2PZU A;  1G6Z A;  3M7N A;  1E2Z A;  5C0X J;  3VR4 A;  3KBX A;  2SNM A;  1BUV T;  4G4K A;  2L55 A;  3HGB A;  1Q8I A;  2F0M A;  2D5D A;  4LJZ C;  2RDG A;  4IUV A;  1GHK A;  4PV1 C;  4C3J G;  2VB3 X;  1CFM A;  5JJZ A;  4A3I B;  1NUC A;  3BYT B;  1STG A;  2BDO A;  3W2D A;  3J81 E;  3X3M A;  4X3T A;  5EJW A;  1TWH B;  2B2U A;  4HN7 A;  1DOK A;  1T5E A;  1U4M A;  4R8N A;  2WIN B;  3OSO A;  1A3U A;  2KCC A;  2PQE A;  4QMG A;  3ERQ A;  3QWN A;  3D4D A;  5M3F B;  5CGK A;  3NWS A;  4IUQ A;  4L6T B;  2O5I C;  1CTM A;  2JSO A;  3LX0 A;  3F2U A;  3Q23 A;  3FDT A;  5F2D A;  4LMQ D;  2AQ1 B;  5FLX L;  3GV6 A;  1STH A;  4IUT A;  1HXY D;  2EXZ A;  1QB5 D;  2PMZ B;  4I65 A;  1Z47 A;  3MAQ A;  2XVS A;  1TVX A;  1TKW B;  3A8I E;  4XXE A;  1EWH A;  4TQU S;  1BBX C;  4A3B B;  1SEB D;  3MXG A;  3KUP A;  2RA4 A;  1IYV A;  3Q22 A;  1I4H A;  3S14 B;  3OPO A;  1LT6 D;  5J39 A;  5EGT A;  4C3H B;  2Y0S B;  1SJH D;  2PZT A;  4CBV A;  1D2B A;  2M00 A;  3QG1 A;  3KK7 A;  1Q3L A;  3ZYY X;  4KJN A;  2N55 A;  1A15 A;  3EJI A;  4U67 3;  1OXX K;  5JVG 3;  3GTJ B;  3FVQ A;  1LTG D;  4NMZ A;  2XRS D;  3K6O A;  1KTK A;  4IUP A;  1O78 A;  4IFD G;  1YNN C;  2J7Z A;  3EA6 A;  1FD7 D;  1OXU A;  4EGV A;  3AB9 A;  1GUG A;  1Y1W B;  1BCP C;  4J1M A;  4KK7 A;  2F0N A;  2EY1 A;  4DK1 A;  2Z8L A;  2RBM A;  3K5L A;  3PMF A;  3E5S A;  3CRK C;  1FGB D;  2AQ3 B;  4HED A;  5EPJ A;  1LT3 D;  3S15 B;  1STA A;  2X69 A;  4NKL A;  4FVM A;  2KEE A;  3V2T A;  3A56 A;  1J9O A;  1UEA B;  4OHJ A;  5J1Z A;  4FXD A;  1HQR D;  3L3O C;  1KDB A;  2F0D A;  2ENB A;  1IYU A;  3EVQ A;  1GUS A;  4ZQ3 A;  2RSN A;  4UDU C;  3HOY B;  2AWO A;  5JVH 3;  2EZV A;  1HFN A;  4RWS C;  3I90 A;  4KY6 A;  3U9S A;  3H0G B;  1YNN D;  1K83 B;  3T13 A;  1LO5 D;  2J0T D;  3NK9 A;  3SHL A;  4I7Z C;  3LNN A;  3SEB A;  3TSS A;  4J6H A;  2DY8 A;  1ILP A;  2VB2 X;  4DAV A;  3K0Y A;  3M3Y B;  2IT1 A;  1BCP D;  1VMC A;  2ICI A;  2MUY A;  4ABN A;  3VYS A;  1IHZ A;  1JQY D;  2F0L A;  4S3S A;  2VXW A;  3BDO A;  2K7V A;  3L9A X;  5I4D A;  1U4P A;  2EE1 A;  4KY7 A;  1DZ1 A;  3P1H A;  4OO1 H;  4FXK C;  1DON A;  1JCK B;  5FLX E;  3NE5 B;  3OIP A;  1Z7T A;  1ENC A;  1X3Q A;  2F0K A;  2RKS A;  4E6I A;  1B53 A;  4CJ0 B;  4C3H G;  3C1F A;  4ZKB B;  1H9S A;  1KNA A;  5EKL A;  1O7L A;  3PV0 A;  1GUT A;  4FXG C;  1CZG A;  5E3F A;  4A3D B;  1XX8 A;  2NN6 I;  3HOW B;  3I4N B;  3NXW A;  4WFN 3;  1A3V A;  2EYM A;  3H91 A;  2MHV A;  2IL8 A;  3DHQ A;  1SE3 A;  4HCE A;  1TWC B;  3M4Y A;  3BDC A;  3H94 A;  4XQN A;  4KD4 A;  1EFI D;  2F0Q A;  1SYG A;  4PMW A;  1XTC D;  1U4R A;  3RD4 A;  2WII B;  2JYO A;  2E76 C;  4MN3 A;  5ELE A;  1AZQ A;  4XYO A;  2B8F A;  3RZO B;  3NBH A;  4RFB A;  1F77 A;  1CK1 A;  2NBF A;  1JE4 A;  1T5X D;  5C4H A;  3HG9 A;  1MI2 A;  1EU4 A;  4XIG S;  1SE2 A;  2B2T C;  4R8I A;  3MTS A;  3TP8 A;  3DXJ C;  1Q12 A;  3DEP A;  4RKB A;  1AZP A;  3S2H B;  4DXG A;  2XWB B;  3PUY A;  4Q0F A;  1ESF A;  4DA2 A;  1IL8 A;  4KV6 A;  2IPK D;  1S5C D;  1KDA A;  4A3E B;  2WKD A;  1CZW A;  4HR7 B;  3HOV B;  4KJO A;  2F0I A;  2BDN A;  1ZEQ X;  3OWF A;  3KF8 A;  4RH6 A;  3D3R A;  4FP5 D;  5EQ0 A;  5M9O A;  4CJ2 C;  5CV8 A;  4PMB A;  3M4O B;  1F2Y A;  1CHP D;  4L63 B;  1BOS A;  3AU7 A;  1KLG D;  1JWS D;  1AFP A;  1HHV A;  3M85 A;  3Q0A A;  2R7Z B;  1RTO A;  4G7H C;  1MD2 D;  5CV6 A;  4WRD A;  3FPU B;  5CYU A;  3PIP 3;  4AYB B;  2Q8T A;  3ONA B;  3VA7 A;  4RCN A;  1B2T A;  5KYL A;  2LFN A;  1MGS A;  2C5C A;  1LT5 D;  2LY7 A;  3D4W A;  3TDQ A;  2O5J C;  5D3D A;  3WDN A;  2MPM A;  4ME5 A;  5CR3 A;  1BNZ A;  4RGN A;  3H09 A;  3MVV A;  3R2T A;  1XYI A;  4XYQ A;  5K36 H;  5I2X A;  2WB1 B;  3UI2 A;  5E4X A;  2IWH A;  2BOS A;  3VA5 A;  3OMG A;  5C0X H;  5C4X B;  2NN6 H;  3GTP B;  3S9W A;  2JA7 B;  3HP3 A;  1A2U A;  1BCP F;  4DNR B;  1MSH A;  3E0J A;  4F7X A;  4DK0 A;  4KY5 A;  2EYH A;  4BBS B;  1TS4 A;  4C3I B;  1TY2 A;  1SSO A;  3I91 A;  4RGM A;  1H9S B;  5CV5 A;  2EOT A;  5I9O A;  3S1R B;  1GUW A;  1LTS D;  2WKC A;  3CU7 A;  3BS1 A;  1S5F D;  5NUC A;  3H6M A;  5G3L D;  1WTP A;  2BE5 C;  1PRT B;  2F0O A;  3HEJ A;  1SNC A;  5C4J B;  1QWY A;  1EQT A;  4BWG B;  1EEI D;  4P2C B;  2R3Z A;  3BVG A;  5IGC A;  2DN8 A;  5D65 A;  1Q1E A;  3HKZ B;  2EY2 A;  1VF7 A;  1EZ6 A;  1NR2 A;  2DNC A;  2FFK B;  2TMP A;  3A54 A;  1SJE D;  4JBW A;  1EY6 A;  2Z1C A;  1LT4 D;  4RHR A;  3CRL C;  4NW2 A;  5K36 G;  1K8M A;  3CHB D;  2DY7 A;  1BQQ T;  1GUN A;  1RD9 D;  1HRJ A;  2PW5 A;  4QUF A;  3HS0 C;  3K7A B;  5C0X G;  1XWE A;  4K14 A;  2NN6 G;  4UAI A;  5ELC A;  1SMY C;  2F0G A;  1PZJ D;  2KHS A;  2XSC A;  2BE5 D;  3VR2 A;  5FK9 C;  1AP0 A;  3A8K E;  4HMI A;  3KLR A;  4LAA A;  3KBG A;  3I4M B;  1I3Q B;  3PO2 B;  1WVL A;  1SNQ A;  3TP6 A;  3SK6 A;  2MJ8 A;  1OXS C;  3K5N A;  1GHJ A;  1G2T A;  4K5W A;  1LTA D;  3A7A B;  5M3M B;  1ML0 D;  2WAC A;  4OGQ C;  1KLU D;  5C3E B;  4ILW A;  2PYK A;  1HCZ A;  4HMJ A;  1H9J A;  3KLS A;  1TWG B;  2QIL A;  1TII D;  3VR6 A;  2EYO A;  5EBD A;  2K05 A;  4DFA A;  1ESR A;  1SMY D;  3MFY A;  4KHV A;  4F8M A;  2HDM A;  5HGT A;  2MP1 A;  3JAM L;  3FRP B;  2A74 C;  4XT3 B;  1RJT A;  1RTN A;  1GXD C;  3DWA A;  2KVM A;  2CQA A;  1C48 A;  2B2T A;  3Q24 A;  1WTR A;  4H7B A;  1NCV A;  3PUZ A;  1TY0 A;  1D1K A;  1JWU D;  4R9W A;  1SE4 A;  2KOL A;  3BVM A;  1TQO A;  3T56 B;  5A2Q L;  2QCP X;  5KNB A;  3MA2 B;  1BDO A;  5KYI A;  2LS0 1;  1DCZ A;  3IAY A;  5IT9 L;  5A35 A;  4FNF A;  2O2L D;  1PTO B;  1LAB A;  4ZLT F;  3D6C A;  2FHT A;  3J80 L;  2EJF C;  1U9R A;  1EY4 A;  4KMU C;  1PZI D;  3X3N A;  2R93 B;  4OO1 I;  4H0L C;  4A3M B;  4CKC A;  1DOM A;  1LTT D;  4TKO B;  1CA6 A;  2TSS A;  3EQL C;  4ZUI A;  2KA7 A;  2K32 A;  5G3L F;  1I50 B;  3GO5 A;  2XNA C;  1CQF A;  2ZXO A;  1JC7 A;  1V1O A;  3R93 A;  1HUM A;  1EIH A;  1EZ8 A;  5COY A;  4ZUJ A;  4IUN A;  2NB0 A;  1PTO H;  1STN A;  3MHB A;  1TWF B;  1EWC A;  5BN4 A;  1D5X C;  5JOB A;  1IKL A;  1F9S A;  4K6L A;  4RGT A;  1GUO A;  5KRU A;  3P7J A;  2YU9 B;  3HOX B;  1SNM A;  2E2I B;  2C9O A;  3SVM A;  2CVR A;  2XIW A;  1SNP A;  2ZXP A;  1F2L A;  3DWQ A;  3I72 A;  2JE6 I;  3OWE B;  3IL8 A;  1RDP D;  4FYD A;  5JPM C;  1S4Z A;  1B44 D;  1E0B A;  1NAP A;  3NTH A;  2M9V A;  2B39 A;  1I4P A;  2NVT B;  1PFN A;  3I70 A;  4BS9 A;  4RGO S;  4K8J A;  3S1M B;  4DAY A;  2F0S A;  2GA4 B;  3SXH A;  2JA5 B;  3KLS X;  5EPK A;  2L5T A;  1H9M A;  1RF2 D;  3JAM E;  3NTK A;  2E75 C;  4K5X A;  3SR1 A;  2K6A A;  3LWU A;  2NTT A;  1SYC A;  1TS5 A;  3OIQ A;  2E74 C;  3OHX C;  1SFO B;  1SND A;  5EKK A;  1W6K A;  1D6E C;  3FEW X;  1O7Y A;  1WTQ A;  3MXN A;  1Q90 A;  1C4Q A;  2NZ1 D;  4IFD J;  5LHY 1;  4C1N K;  5A2Q E;  4EQN A;  3GTM B;  5BN5 A;  3C3L A;  2SOB A;  2F0E A;  3RMH A;  2F0J A;  5EBC A;  4CJ1 B;  5JEA J;  2RQX A;  2CHB D;  3D4R A;  4GZY C;  3J80 E;  1SBB B;  1HFG A;  5BN3 A;  2G9D A;  4IZ8 A;  3NQT A;  3CQZ B;  3MXU A;  5LL6 X;  3VYU A;  2L12 A;  5FOB B;  2WAQ B;  1QNU A;  1EY9 A;  1AN8 A;  1Y8P B;  4PNY A;  1JWM D;  1DXM A;  1ZXT A;  1ZYR C;  5C0X I;  1BO0 A;  2BA1 A;  5COR A;  3A8J E;  1SYD A;  2HUG A;  2ID0 A;  2EYF A;  3H3V C;  4KI0 A;  1ET6 A;  5IGG A;  1PXU A;  3P20 A;  3TME A;  2O4X A;  2L11 A;  1TU2 B;  3BG3 A;  4K2K A;  5IOC A;  2B63 B;  5HUR A;  1STE A;  4XQQ A;  4F87 A;  1Y8N B;  1QG7 A;  2PO4 A;  2JEA I;  3VR3 A;  3TZU A;  4HSV A;  2NVX B;  4A93 B;  5IOD A;  5T1G A;  5DM6 3;  4RCO A;  2EYP A;  3I3C A;  1EU3 A;  5EKI A;  2EPB A;  4PQX A;  3I4L A;  4IUR A;  4ZKC B;  1O80 A;  4OO1 G;  3V96 A;  4JK1 C;  2K33 A;  1F2M A;  1ZYR D;  5C6A A;  3MEH A;  2R6G A;  1TT2 A;  1A3T A;  4DXF A;  3PUX A;  3T53 B;  1PFB A;  2KEC A;  4H44 C;  3ITP A;  1MBY A;  3QJY A;  3S17 B;  5ELF A;  3RZD B;  5JPN C;  3S2D B;  2PNR C;  1OO9 B;  2KUM A;  3ND9 A;  1ET9 A;  2HQE A;  4XDX A;  4NP5 A;  4XT1 B;  2KED A;  4EQO A;  2MGS A;  5JAV A;  3K58 A;  1A6X A;  3R2I A;  5D14 A;  2QEJ C;  3RLF A;  2IW3 A;  3NP8 A;  3D6W A;  3HRZ C;  1DYQ A;  4ID6 A;  5FO8 B;  3R8B A;  5IIF A;  2OF1 A;  1Y69 U;  3NHH A;  3QOJ A;  3G7L A;  3FMC A;  1RKN A;  1CA5 A;  1LTR D;  3SE0 A;  2F0P A;  2B2W C;  5CMD A;  2WV6 D;  5C3W A;  1LV9 A;  1U4L A;  1EQV A;  2EVB A;  4M1U B;  1SDF A;  2XN9 C;  2I07 B;  1VMP A;  1JOO A;  3TBI B;  5CBA E;  1DD2 A;  2SDF A;  4A3J B;  1DJR D;  4ZAI A;  2PCF B;  1STY A;  4X3U A;  4V19 0;  1S5D D;  2L9H A;  3EFX D;  3S1N B;  2F4I A;  2FMM A;  1B9M A;  4HTH A;  4WOR A;  1W6J A;  4Y7N B;  1M4V A;  4V0B A;  1KAA A;  3GTG B;  5M5X B;  3N52 A;  1JOK A;  2EJM A;  2CW0 C;  1WD1 A;  1XXG A;  1HA5 A;  2NYZ D;  2LMC B;  3TP5 A;  1HQM C;  3OW7 A;  1STB A;  1V43 A;  3GQB A;  3U9O A;  4DN4 M;  5KNC A;  2H1E A;  4C1N I;  5DM7 3;  1FR3 A;  4C56 C;  1CHQ D;  2IX0 A;  1WTO A;  2B8G A;  5CV4 A;  1GJX A;  1ONL A;  2EDG A;  1I6V C;  2B2V C;  2PW7 A;  1VDZ A;  5I9P A;  5TSS A;  1YNJ C;  2Z4I A;  2N88 A;  2CW0 D;  4QB4 A;  1IW7 C;  1RCV D;  1HPC A;  3DM1 A;  5C3X A;  2B2Y C;  3C46 A;  1B4O A;  3J7A F;  1ROD A;  1Q1B A;  1WTW A;  3ERO A;  1NR4 A;  3MC0 B;  2Q8I B;  5ELD A;  4FO2 A;  4NDX A;  4RHS A;  4BBR B;  3ND8 A;  1HA6 A;  1F9Q A;  3SDZ A;  2K04 A;  3NWT A;  4DF7 A;  2RVL A;  4BY7 B;  4TRD A;  3GTK B;  1JOR A;  4IQZ A;  2I46 A;  1E2W A;  2LKV A;  1ZKO A;  2ICE C;  3P75 A;  1WD0 A;  4B9W A;  1EYC A;  1EY5 A;  5C5M A;  1YNJ D;  1II3 A;  2EY6 A;  2QDB A;  2K5D A;  2K5W A;  5C5L A;  4Q5V A;  1QOH A;  1TS3 A;  4C3I G;  4KKS A;  1IW7 D;  2M2L A;  4DGZ A;  2HDL A;  2Q8R E;  3QOL A;  3GTL B;  1F2Z A;  1PRT C;  1LTI D;  4K8I A;  1D5Z C;  1ENF A;  5AFW A;  1VF5 C;  1LLR D;  4IUU A;  2HCI A;  5LL6 S;  1SXT A;  1BCP B;  4A3K B;  3K59 A;  5CV9 A;  2A6E C;  3MFG A;  2RDH A;  3WOF A;  1G91 A;  1QIL A;  4OIK A;  3K5O A;  2G9H D;  3GTQ B;  2EYJ A;  1PLF A;  1L0Y B;  4IN3 A;  2F0W A;  3J7A V;  2X6G A;  2F0T A;  2D62 A;  2FJ2 A;  4C2M B;  3SK5 A;  1I4Q A;  1PDQ A;  3O13 A;  4IFD H;  2R92 B;  3IKJ A;  4ZRZ A;  3DEO A;  4ZYS A;  5C44 B;  4K6D A;  1D1I A;  4KTA A;  2IX1 A;  5ELB A;  1GOZ A;  1HTP A;  1PRT D;  3M7G A;  4X3S A;  1BXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...