2CHCA

Structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
169
structure length
169
Chain Sequence
GAMGPVDEQWIEILRIQALCARYCLTINTQDGEGWAGCFTEDGAFEFDGWVIRGRPALREYADAHARVVRGRHLTTDLLYEVDGDVATGRSASVVTLATAAGYKILGSGEYQDRLIKQDGQWRIAYRRLRNDRLVSDPSVAVNVADADVAAVVGHLLAAARRLGTQMSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RV3472
publication title Structure of Rv3472(D26N), a Function Unknown Protein from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hypothetical protein
total genus 55
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2chcA00
5AIGA 5IG5A 1O7MB 3HX8A 1OHOA 4XDWA 4LEHA 3JUMA 5AEUB 3UJMA 3F8XA 3F14A 1E3RA 4KVHA 4HM7B 3DUKA 3H3HA 5D82A 4HM2B 1U5OA 7STDA 1GS3A 3EBYA 3MG3A 4XBYA 4HVNA 4ORLA 3FF0A 5IG4A 4OUQA 3T8NA 4HM3B 3OX9A 2XR8B 1NWWA 3OWSA 2QIYA 2RFRA 1JB4A 3JUPA 3FLJA 4N3VA 5AIFA 1OH0A 1SJWA 1S5AA 4WYKB 3WMDA 5BXQA 3FZWA 3FGYA 1JB5A 2Z77A 5CF2A 2RCDA 2I9WA 4FCMA 3CNMA 5BVBA 1OGZA 1JKGA 5AIIA 3GZBA 3OXAA 1DMNA 4I4KA 1O7HB 4XBXA 1ULIB 4HM4B 3LZAA 5CF1A 1C7HA 1E97A 1TUHA 4HKVB 4HM8B 4IIAA 3STDA 2BNGA 4K1VA 3KE7A 3MG2A 1VZZA 5IG3A 5CK6A 4H3UA 2HMKB 3T8UA 1JN5A 2HMOB 3DM8A 3DXOA 3F9SA 3HZPA 3MHEA 4XM4A 4HM5B 1OHPA 2GBXB 3FSDA 5IEOA 1GY6A 3JUNA 3DZLA 5IERA 1DMQA 2UX0A 2GEYA 2GXFA 3KKGA 3KSPA 1IDPA 1TP6A 4J8TA 1NDOB 3MKIA 4PEJA 2GEXA 1OGXA 3M8CA 3G8ZA 2GBWB 4X2OA 3OWUA 1W01A 4WP5A 3NV0A 1BUQA 4XBTA 1NU3A 1Q42A 5IF6A 1HKXA 4LGQA 1Q40A 1E3VA 1OF5B 5KP3A 1QMAA 2QGUA 1EG9B 3OWYA 2INXA 3F40A 3K0ZA 4WWUC 1GYBA 2HMMB 3DMCA 4J9AA 2B1XB 2BMOB 2HMJB 5DRVA 5STDA 3SOYA 2YFIB 3RGAA 4Q53A 3SOAA 3BB9A 3F8HA 4OVMA 1ISKA 5DREA 3SEDA 3D9RA 4FCJA 3OV4A 4CDLA 4LMIA 1O7GB 1QJGA 4HZ9B 5IG0A 4HJLB 3CNXA 1GY5A 1STDA 4L8PA 3EC9A 3ROBA 2F99A 1AR0A 1WQLB 5FW5A 1A2KA 2PZVA 3EHCA 2Z76A 4WYKA 4RZMA 3UNLA 1W6YA 3NM2A 3K7CA 1UUVB 3JUQA 5KP1A 3NHXA 3A76A 1DMMA 4L7KA 1OPYA 1ULJB 5HGRA 3NBRA 3FF2A 5IEPA 2XSOB 2A15A 3JUOA 3RGRA 3ER7A 3MG1A 4XDVA 2HMLB 4X2HA 3EBTA 5D83A 4MJDA 3Q90A 3B4PA 3E99A 5G2GA 1K41A 2XSHB 6STDA 3EN1B 3B4OA 2IMJA 1GY7A 2K54A 3CPOA 2BMQB 4HZBB 1JKGB 3VGNA 3GZXB 3GZYB 2Z7AA 3EX9A 4GB5A 3KZTA 4STDA 4HM0B 5AIHA 2W2CA 3F7SA 4K1UA 3EN8A 3FKAA 3G16A 1Z1SA 2CKFB 2XRXB 1CQSA 3IPTA 3FH1A 2F86B 4XB5A 1W00A 1ZX2A 3GWRA 5JPUA 3HK4A 5KP4A 5CLKA 1JN5B 3S5CA 3I0YA 3NXJA 3B8LA 1ASKA 5EVHA 1EA2A 3EQQB 2STDA 5TGNA 3G0KA 1OUNA 1O7WB 1OF5A 1O7PB 2RGQA 2OWPA 8CHOA 3VSYA 1OHSA 1OCVA 4HM1B 2R4IA 2YFLB 3CU3A 2YFJB 5IENA 3B7CA 3EF8A 4U13A 3GRDA 3NUVA 2B24B 2HMNB 1W02A 2JQ5A 3NV0B 3LYGA 2BMRB 3BLZA 4R9LA 3EJVA 3GZRA 5D81A 4L8OA 5CXOA 3MSOA 5AI1A 5AEWB 1Q40B 3ECFA 3H51A 4R1KA 2F98A 5JPPA 1UUWB 3MYTA 4R9KA 1O7NB 3F7XA 2CHCA 1JB2A 1ZO2A 4HM6B
chains in the Genus database with same CATH superfamily
1JRQA 1MNLA 5AIGA 3CCR3 5IG5A 1O7MB 3HX8A 3CPW2 2ZA4A 2FXTA 1V74A 1OHOA 4XDWA 4LEHA 2IUKA 5ELJA 3WHOA 3JUMA 5AEUB 4O3VA 3UJMA 1R4YA 5BIRA 4HYZA 1MOLA 2YX9A 3F8XA 5EQLA 3DGYA 2W04A 2O9UX 3AGNA 3F14A 4FMAA 1RHLA 2XF3A 2F5MA 1E3RA 3HOHA 4KVHA 1WTHA 1G02A 3DUKA 4HM7B 1UGIA 2Y73A 4FMBA 2Y74A 3N8BA 2OCTA 3H3HA 4ZM8A 3UB1A 1W2B2 2KCDA 3Q2PA 3HIIA 5D82A 1DVDA 4HM2B 1U5OA 7STDA 1RN1A 3PCRA 3X3XA 1VQQA 1HU9A 3DGNA 1GOUA 3HI7A 1VQM3 1VQ83 1GS3A 3WOEB 1N8R4 3EBYA 3MG3A 4XBYA 4HVNA 1SIIA 1ZS7A 2IA7A 4ORLA 3FF0A 3V98A 1GMPA 2CIUA 2E2TA 2WO0A 5IG4A 1JBSA 4OUQA 3T8NA 1TRPA 2W56B 2CC3A 2H0IA 4HM3B 3DH2A 2CWVA 3DY5A 3OX9A 2QA43 1W7CA 1RLSA 2XR8B 1L5GB 2ML6A 1US1A 1NWWA 3OWSA 1EKMA 3CME3 1BUJA 4BTXA 2UGIA 4NHFA 2ZDJA 2QIYA 2RFRA 2K0MA 1JB4A 3JUPA 3FLJA 1EEJA 4WFOA 4BL3A 1IK3A 3DGMA 4N3VA 5AIFA 1N5PA 1GD4A 1I8VA 1OH0A 4FCZA 4FR9A 4GL6A 1GMQA 4N6LA 2JDIH 1STFI 4BIRA 1FUWA 1UDII 4MMXB 1K28A 1SJWA 1S5AA 4WYKB 3WMDA 5BXQA 3FZWA 4TX4A 1DE3A 1RGKA 2CW9A 3FGYA 3GSPA 1YI23 1BNFA 2L4VA 4N6UA 1VQO3 1QAKA 2CFDA 1RNTA 1N9JA 1JB5A 2Z77A 5CF2A 3GAXA 2RCDA 3DGOA 2I9WA 5LC6A 3X3ZA 4FCMA 3CNMA 5BVBA 1OGZA 1M904 2KF5A 2UUGC 1FGQA 2CG0A 1JKGA 3IMAB 1R4CA 1Q7HA 5AIIA 3GZBA 3OXAA 1RGEA 1DMNA 4I4KA 1O7HB 4XBXA 1BNGA 1I0XA 1ULIB 1RTUA 3QK9A 3D79A 4HM4B 1ROAA 5G1LA 3LZAA 5CF1A 1RRHA 1C7HA 3LOYA 1E97A 1TUHA 3MWZA 3X42A 2XGNA 3AMOB 2SARA 4HKVB 4HM8B 3URPA 3CC23 1BNJA 1YVBI 3SOYA 4IIAA 3STDA 4LZIA 2BNGA 2CFGA 1RCKA 1TJDA 2D42A 2Z6BA 3HIGA 3CCS3 1VQ43 1SIHA 3LH4A 2PNCA 3IJEB 3KE7A 3MG2A 4K1VA 1VZZA 3N54B 1J2BA 5IG3A 5CK6A 1UUGB 4H3UA 4R80A 3CCM3 2HMKB 3T8UA 5G1KA 1IV9A 2ZL8A 3X40A 1JN5A 1SPUA 2HMOB 3DM8A 4ILFA 3RNTA 3NBJA 3DXOA 3F9SA 3VF1A 1VQL3 2C11A 3HZPA 3MHEA 1WMNA 8RNTA 1FZUA 4XM4A 1AVLA 3WR2A 4HM5B 3JVCA 4EV5A 1JBTA 2CFLA 1OHPA 1NNVA 3CCV3 1RGHA 2GBXB 2BHMA 1IV7A 1B21A 3FSDA 1UGHI 4EYCA 5IEOA 2KF3A 3PYJA 1GY6A 3JUNA 3KIIA 1X1UA 3LMLA 1IQYA 3DZLA 1YGWA 1LNHA 5IERA 1DMQA 1KSIA 2UX0A 2WGOA 3NBBA 1GD3A 2GEYA 5IW9A 2CFKA 2GXFA 2P0XA 3WA3A 3KKGA 3KSED 2CFWA 1BRIA 4IPBA 2RNTA 1DETA 1WMPA 3KSPA 1IDPA 1TP6A 1LOXA 3EB8A 4J8TA 1VQ93 1NDOB 1IU7A 3MKIA 4PEJA 4K90B 2WOFA 2GEXA 1OGXA 3M8CA 3PS8A 3G8ZA 1YJ93 1BRJA 4IT7A 1I3IA 2GBWB 3BNCA 4X2OA 3OWUA 3G4S3 1W01A 1RDSA 4WP5A 1YJW3 3NV0A 1BUQA 1BRKA 3ALAA 1JZOA 1I2GA 1T3BA 2RSXA 1ROVA 2KXGA 1PYLA 1AV4A 4XBTA 1U8CB 3LT8A 1Y4KA 9RNTA 1QAFA 1LQMB 1NU3A 4JRFA 5EEOA 1I2EA 3U1WA 3D5GA 4EBGA 1Q42A 3O8YA 2BU4A 5IF6A 1NB5I 1AY7A 3BNBA 2IY2A 1HKXA 1RJOA 4LGQA 1I3FA 3N9HA 4I5QA 3NQYA 2W9PA 3LT9A 1Q40A 1E3VA 3BNEA 4HBRA 3T0UA 1KC84 4QWTA 1OF5B 3CCQ3 1UW1A 5KP3A 1QMAA 2QGUA 2Q07A 3CMA3 3LXUX 2D1WA 1EG9B 3A5EA 4GSPA 1LVNA 1FGTA 2H0GA 3OWYA 1TFOA 1B2ZA 2INXA 1BNEA 1T2HA 4HOHA 1Q9EA 3LTCA 5GSPA 1T5YA 3F40A 1QALA 3K0ZA 2E2VA 4WWUC 2R41A 1GYBA 2HMMB 3AHWA 4N6MA 4MEIA 2QEX3 3DMCA 3CXC2 1LQGC 4NREA 4J9AA 2FGTA 1BSAA 3PCSA 1MWTA 2B1XB 1UCKA 1DVCA 2LQVA 2BMOB 1X1XA 4BTWA 1N8QA 4O2HA 3K9MC 1B2MA 1K9M4 2XGLA 1OACA 2HMJB 5DRVA 4KZ1A 1RN7A 5STDA 1BAOA 1RCLA 1SARA 1T2IA 2CWUA 2YFIB 3RGAA 1BSEA 4Q53A 3SOAA 2KRTA 3SLUA 2RBIA 3KFQC 1W2ZA 1YNVX 1YGEA 3BB9A 2BT3A 3F8HA 4CPKA 4OVMA 2OTL3 1M1XB 1ISKA 1SQWA 5DREA 1TFKA 3L0RA 3V99A 3SEDA 3KCHA 3D9RA 4FCJA 2P0MA 2W0QA 3OV4A 4N6OB 4CDLA 4AKYA 4KFFA 1FA3A 4LMIA 1BRGA 1IT7A 1O7GB 2KAAA 1QJGA 5BU4A 2XFSA 3SVAA 5M19A 3NX0A 2XEPA 4HZ9B 5IG0A 1S723 1A67A 1W4NA 4HJLB 3D5IA 2W56A 1UCIA 3ZFZA 1FGRA 1BSCA 1LRAA 1WMOA 3SXXA 2KF6A 3CNXA 4RNYA 1GY5A 1B20A 1STDA 3S27A 4L8PA 1YIT3 2CH9A 1GSPA 1I2FA 3WODG 3EC9A 2IUJA 3ROBA 2F99A 2K3DA 3X3YA 2XH9A 1GMRA 1AR0A 3KN4A 2P38A 1K8A4 1WQLB 5FW5A 1A2KA 3BNDA 1NJI4 4DKIA 3CC73 3QRDA 3BU4A 3CCE3 1JV2B 1UI7A 2PZVA 1F8NA 1IVXA 4KFEA 1RGAA 1B2XA 3DGLA 2Z76A 3EHCA 4WYKA 1RGCA 1Q824 1BU4A 1UCLA 4RZMA 3G6E3 3UNLA 1ZGXA 2CX1A 2F56A 1W6YA 3NM2A 4K61A 1KWIA 1BRNL 3RDEA 3K7CA 2GSPA 5AYSC 1RNBA 1VQ53 3D3LA 1UCJA 2ML5A 3S28A 1UUVB 2CWTA 1N5HA 1BRHA 1MGWA 3JUQA 4BU4A 4KT3B 2WGQA 1B3SA 2C10A 4LYLB 5KP1A 3NHXA 3A76A 1KQS2 1NO3A 1QVF2 1HZ1A 1B2SA 1DMMA 2H0HA 4L7KA 1CEWI 5RNTA 1IT8A 1OPYA 1ULJB 4BTYA 4KFDA 1RGLA 5HGRA 1B2UA 2AADA 1RN4A 4J5GA 3S29A 3NBRA 3FF2A 2F5WA 3MPHA 1LXEA 1Q814 4EXRA 2OQEA 4WHAA 5IEPA 5A0OB 2XSOB 2A15A 3JUOA 5ELUA 3RGRA 3ER7A 2OOVA 1YHQ3 1FYSA 3MG1A 3FG1A 4JF8A 4XDVA 1BVIA 3K5TA 2HMLB 1B27A 4X2HA 3FG4A 1IVUA 4BL2A 1BSDA 3EBTA 5D83A 1I70A 4MJDA 3I553 1A2VA 3Q90A 1HYFA 3B4PA 3OW22 2LYXA 3E99A 5G2GA 1K41A 4FMDA 1D6UA 1MGRA 2XSHB 3D4AA 4RNZA 3SYUA 6STDA 1G0TA 3G713 1W6GA 3EN1B 1YJN3 1VQK3 3B4OA 2F4YA 1V57A 7RNTA 1X1YA 2IMJA 3NM7A 1FUSA 1Q7Y4 4OK0A 4RNTA 2MC8A 1FGMA 2P05A 1GY7A 1BIRA 2K54A 1MWUA 3PZWA 1JJ22 4R4KA 3CPOA 2BIRA 4AKZA 1EQKA 1IQ8A 2BMQB 4HZBB 1IYYA 1TTOA 1A90A 1PU4A 1JKGB 3VGNA 1BSBA 3GZXB 1FGOA 2HOHA 2Z7AA 3EX9A 3GZYB 4GHOA 1RSNA 4GB5A 1IVVA 1RKYA 3KZTA 4STDA 3WOFB 1LOWA 1RGGA 4G1MB 4HM0B 4H61A 4N6NB 5AIHA 2W2CA 3F7SA 4K1UA 3ZG0A 3CC43 3EN8A 3FKAA 4CCVA 1CYUA 1VQ73 1LNIA 1N9EA 1Z1SA 1I0VA 1GOYA 2CKFB 2XRXB 3G16A 1KD14 1RMSA 3WA2X 1CQSA 3TDGA 3IPTA 3FH1A 2F86B 1D6YA 4XB5A 3AGOA 4FMCA 1GOVA 1MWRA 4EC6A 1W00A 1ZX2A 3FG3A 3GWRA 5JPUA 3WDGB 3Q1CA 1PY3A 2ZHXB 3SX1A 2FNQA 1BOXA 1BRSA 3HK4A 5LC7A 5KP4A 3CCU3 5CLKA 4O8SA 1JN5B 1RGFA 3S5CA 1M1K4 3CCL3 3I0YA 1Q864 1QVG2 1VQP3 2E2UA 3NXJA 1YVSA 3B8LA 1D6ZA 3S67A 4O02B 1A2PA 1ASKA 3LTDA 1EA2A 2CK3H 5EVHA 3UL5A 6RNTA 3EQQB 3J7Yd 1YIJ3 2STDA 1W5ZA 1PFPA 5M1AA 2O3OA 5TGNA 3G0KA 6GSPA 1OUNA 2AAEA 5JBSA 1CYVA 1O7WB 1OF5A 1O7PB 2RGQA 2OWPA 8CHOA 3VSYA 3U97A 1K734 1OHSA 5FGOA 1G96A 1OCVA 4N6V0 2IYJA 3LTBA 5HOHA 1JNQA 3NQZA 3PXMA 4EV2A 2P09A 1IVWA 5AYRB 4HM1B 7GSPA 2R4IA 2YFLB 1W6CA 2YFJB 3CU3A 4NPBA 1FUTA 1RRLA 2CX0A 5I97A 5IENA 3EE1A 3V92A 3B7CA 2XFTA 3EF8A 1IQXA 1TIJA 4HAAA 1DYUA 4U13A 3X41A 1LOYA 3I563 2W03A 2KF4A 3GRDA 3NUVA 2B24B 2HMNB 1W02A 2JQ5A 1MWSA 1TU5A 4J5KA 4MMYB 1AVKA 3NV0B 4RBNA 3K63A 3LYGA 2CG1A 2BMRB 1JBRA 1AQZA 3LTAA 3CD63 2BO9B 3Q3FA 3BLZA 4R9LA 4AEQA 3EJVA 2L1SA 3GZRA 1CH0A 4MMZB 5D81A 2OTJ3 3CCJ3 4L8OA 5CXOA 2MF7A 3MSOA 3UL6A 2OQEC 1FW7A 5AI1A 1WNHA 1JZDA 5AEWB 1NB3I 1Q40B 5M18A 3AHSA 3BIRA 3ECFA 4N6TA 2J8XB 2OOVC 4CJNA 2M7OA 3H51A 4R1KA 2F98A 2W9QA 2WOHA 1X1WA 2C4BA 2GU3A 1BNRA 1VQ63 2V1LA 1C54A 1BGSA 2SBLA 3AMOA 1BNIA 1V58A 1UUWB 5JPPA 1LOVA 3MYTA 4R9KA 4EW5A 4LSOA 1VQN3 2W6JH 1O7NB 3ZG5A 3PGBA 2GU1A 3F7XA 1EUIC 2CHCA 1UI8A 1BNSA 1TRQA 1JB2A 1ZO2A 3FCSB 1BANA 4HM6B 1M9GA
chains in the Genus database with same CATH topology
1JRQA 1MNLA 5AIGA 3CCR3 5IG5A 1O7MB 3HX8A 3CPW2 2FXTA 1V74A 1OHOA 4XDWA 4LEHA 2IUKA 5ELJA 3JUMA 5AEUB 4O3VA 3UJMA 4HYZA 1MOLA 2YX9A 3F8XA 5EQLA 2W04A 2O9UX 3F14A 4FMAA 2XF3A 1E3RA 4KVHA 1WTHA 4HM7B 3DUKA 4FMBA 2Y74A 3N8BA 2OCTA 3H3HA 4ZM8A 3UB1A 1W2B2 2KCDA 3Q2PA 3HIIA 5D82A 1DVDA 4HM2B 1U5OA 7STDA 3PCRA 3X3XA 1HU9A 3DGNA 3HI7A 1VQM3 1VQ83 1GS3A 3WOEB 1N8R4 3EBYA 3MG3A 4XBYA 4HVNA 1SIIA 2IA7A 4ORLA 3FF0A 3V98A 2WO0A 2CIUA 2E2TA 5IG4A 4OUQA 3T8NA 2W56B 2CC3A 4HM3B 2CWVA 3DY5A 3OX9A 2QA43 1W7CA 1L5GB 2XR8B 2ML6A 1US1A 1NWWA 3OWSA 1EKMA 3CME3 4BTXA 4NHFA 2ZDJA 2QIYA 2RFRA 2K0MA 1JB4A 3JUPA 3FLJA 4WFOA 1IK3A 3DGMA 4N3VA 5AIFA 1N5PA 1GD4A 1OH0A 4FCZA 4FR9A 4GL6A 4N6LA 2JDIH 1STFI 1FUWA 4MMXB 1K28A 1SJWA 1S5AA 4WYKB 3WMDA 5BXQA 3FZWA 4TX4A 2CW9A 3FGYA 1YI23 2L4VA 4N6UA 1VQO3 1QAKA 2CFDA 1N9JA 1JB5A 2Z77A 5CF2A 3GAXA 2RCDA 3DGOA 2I9WA 5LC6A 3X3ZA 4FCMA 3CNMA 5BVBA 1OGZA 1M904 1FGQA 2CG0A 1JKGA 3IMAB 1R4CA 5AIIA 3GZBA 3OXAA 1DMNA 4I4KA 1O7HB 4XBXA 1ULIB 3QK9A 4HM4B 1ROAA 3LZAA 5CF1A 1RRHA 1C7HA 3LOYA 1E97A 1TUHA 3MWZA 3X42A 2XGNA 3AMOB 4HKVB 4HM8B 3CC23 1YVBI 4IIAA 3STDA 4LZIA 2BNGA 2CFGA 2D42A 2Z6BA 3HIGA 3CCS3 1VQ43 1SIHA 3LH4A 2PNCA 3IJEB 3KE7A 3MG2A 4K1VA 1VZZA 3N54B 1J2BA 5IG3A 5CK6A 4H3UA 4R80A 3CCM3 2HMKB 3T8UA 1IV9A 2ZL8A 3X40A 1JN5A 1SPUA 2HMOB 3DM8A 3NBJA 3DXOA 3F9SA 3VF1A 1VQL3 2C11A 3HZPA 3MHEA 1WMNA 4XM4A 1AVLA 4HM5B 3JVCA 4EV5A 2CFLA 1OHPA 3CCV3 2GBXB 2BHMA 1IV7A 3FSDA 4EYCA 5IEOA 3PYJA 1GY6A 3JUNA 3KIIA 3LMLA 1IQYA 3DZLA 1LNHA 5IERA 1DMQA 1KSIA 2UX0A 2WGOA 3NBBA 1GD3A 2GEYA 5IW9A 2CFKA 2GXFA 2P0XA 3WA3A 3KKGA 3KSED 2CFWA 4IPBA 1WMPA 3KSPA 1IDPA 1TP6A 1LOXA 3EB8A 4J8TA 1VQ93 1NDOB 1IU7A 3MKIA 4PEJA 4K90B 2WOFA 2GEXA 1OGXA 3M8CA 3PS8A 3G8ZA 1YJ93 4IT7A 2GBWB 3BNCA 4X2OA 3OWUA 3G4S3 1W01A 4WP5A 1YJW3 3NV0A 1BUQA 3ALAA 2RSXA 1ROVA 2KXGA 1AV4A 4XBTA 1U8CB 3LT8A 1Y4KA 1QAFA 1NU3A 4JRFA 5EEOA 3U1WA 4EBGA 1Q42A 3O8YA 5IF6A 1NB5I 3BNBA 1HKXA 1RJOA 4LGQA 3N9HA 3NQYA 2W9PA 3LT9A 1Q40A 1E3VA 3BNEA 4HBRA 3T0UA 1KC84 4QWTA 1OF5B 3CCQ3 1UW1A 5KP3A 1QMAA 2QGUA 2Q07A 3CMA3 3LXUX 2D1WA 1EG9B 1LVNA 1FGTA 3OWYA 1TFOA 2INXA 3LTCA 1T5YA 3F40A 1QALA 3K0ZA 2E2VA 4WWUC 1GYBA 2HMMB 4N6MA 4MEIA 2QEX3 3DMCA 3CXC2 4NREA 4J9AA 2FGTA 3PCSA 2B1XB 1DVCA 2LQVA 2BMOB 4BTWA 1N8QA 4O2HA 3K9MC 1K9M4 2XGLA 1OACA 2HMJB 5DRVA 4KZ1A 1RN7A 5STDA 2YFIB 3SOYA 2CWUA 3RGAA 4Q53A 3SOAA 2KRTA 3SLUA 3KFQC 1W2ZA 1YGEA 3BB9A 2OTL3 2BT3A 3F8HA 4OVMA 1M1XB 1ISKA 1SQWA 5DREA 1TFKA 3L0RA 3V99A 3SEDA 3D9RA 4FCJA 2P0MA 2W0QA 3OV4A 4N6OB 4CDLA 4AKYA 4KFFA 1FA3A 4LMIA 1IT7A 1O7GB 1QJGA 2XFSA 3SVAA 3NX0A 2XEPA 4HZ9B 5IG0A 1S723 1A67A 1W4NA 4HJLB 2W56A 1FGRA 1WMOA 3SXXA 3CNXA 4RNYA 1GY5A 1STDA 3S27A 4L8PA 1YIT3 2CH9A 3WODG 3EC9A 2IUJA 3ROBA 2F99A 3X3YA 2XH9A 1AR0A 3KN4A 2P38A 1K8A4 1WQLB 5FW5A 1A2KA 3BNDA 1NJI4 3CC73 3QRDA 3CCE3 1JV2B 1UI7A 2PZVA 1F8NA 1IVXA 4KFEA 1Q824 3DGLA 3EHCA 2Z76A 4WYKA 4RZMA 3G6E3 3UNLA 1W6YA 3NM2A 4K61A 1KWIA 3RDEA 3K7CA 1VQ53 5AYSC 3D3LA 2ML5A 3S28A 1UUVB 2CWTA 1N5HA 3JUQA 2WGQA 2C10A 5KP1A 3NHXA 3A76A 1KQS2 1NO3A 1QVF2 1DMMA 4L7KA 1CEWI 1IT8A 1OPYA 1ULJB 4BTYA 4KFDA 5HGRA 3S29A 3NBRA 3FF2A 3MPHA 1LXEA 1Q814 4EXRA 2OQEA 4WHAA 5IEPA 5A0OB 2XSOB 2A15A 3JUOA 5ELUA 3RGRA 3ER7A 2OOVA 1YHQ3 3MG1A 3FG1A 4JF8A 4XDVA 3K5TA 2HMLB 4X2HA 3FG4A 1IVUA 3EBTA 5D83A 4MJDA 3I553 1A2VA 3Q90A 3B4PA 3OW22 2LYXA 3E99A 5G2GA 1K41A 4FMDA 1D6UA 2XSHB 6STDA 4RNZA 3G713 1W6GA 3EN1B 1YJN3 1VQK3 3B4OA 2IMJA 3NM7A 1Q7Y4 4OK0A 2MC8A 1FGMA 2P05A 1GY7A 2K54A 3PZWA 1JJ22 4R4KA 3CPOA 4AKZA 1EQKA 1IQ8A 2BMQB 4HZBB 1A90A 1PU4A 1JKGB 3VGNA 3GZXB 1FGOA 2Z7AA 3EX9A 3GZYB 4GB5A 1IVVA 1RKYA 3KZTA 4STDA 3WOFB 4HM0B 4G1MB 4H61A 4N6NB 5AIHA 2W2CA 3F7SA 4K1UA 3CC43 3EN8A 3FKAA 4CCVA 1CYUA 1VQ73 3G16A 1N9EA 1Z1SA 2CKFB 2XRXB 1KD14 3WA2X 1CQSA 3TDGA 3IPTA 3FH1A 2F86B 1D6YA 4XB5A 4FMCA 4EC6A 1W00A 1ZX2A 3FG3A 3GWRA 5JPUA 3WDGB 3Q1CA 3SX1A 2FNQA 3HK4A 5LC7A 5KP4A 3CCU3 5CLKA 4O8SA 1JN5B 3S5CA 1M1K4 3CCL3 3I0YA 1Q864 1QVG2 1VQP3 2E2UA 3NXJA 3B8LA 1D6ZA 3S67A 4O02B 1ASKA 3LTDA 1EA2A 2CK3H 5EVHA 3UL5A 1YIJ3 3EQQB 3J7Yd 2STDA 1W5ZA 1PFPA 2O3OA 5TGNA 3G0KA 5JBSA 1OUNA 1CYVA 1O7WB 1OF5A 1O7PB 2RGQA 2OWPA 8CHOA 3VSYA 3U97A 1K734 1OHSA 5FGOA 1G96A 1OCVA 4N6V0 3LTBA 1JNQA 3NQZA 3PXMA 4EV2A 2P09A 1IVWA 5AYRB 4HM1B 2R4IA 2YFLB 1W6CA 2YFJB 3CU3A 1RRLA 5I97A 5IENA 3EE1A 3V92A 3B7CA 2XFTA 3EF8A 1IQXA 1TIJA 4U13A 1DYUA 3X41A 3I563 2W03A 3GRDA 3NUVA 2B24B 2HMNB 1W02A 2JQ5A 1TU5A 4MMYB 1AVKA 3NV0B 4RBNA 3K63A 3LYGA 2CG1A 2BMRB 3LTAA 3CD63 2BO9B 3BLZA 4R9LA 4AEQA 3EJVA 3GZRA 4MMZB 5D81A 2OTJ3 3CCJ3 4L8OA 5CXOA 2MF7A 3MSOA 3UL6A 2OQEC 5AI1A 1WNHA 5AEWB 1NB3I 1Q40B 3ECFA 4N6TA 2OOVC 2M7OA 3H51A 4R1KA 2F98A 2W9QA 2WOHA 2GU3A 1VQ63 2V1LA 2SBLA 5JPPA 3AMOA 1UUWB 3MYTA 4R9KA 4LSOA 1VQN3 2W6JH 1O7NB 3PGBA 2GU1A 3F7XA 2CHCA 1UI8A 1JB2A 1ZO2A 3FCSB 2Y73A 4HM6B 1M9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIG A;  5IG5 A;  1O7M B;  3HX8 A;  1OHO A;  4XDW A;  4LEH A;  3JUM A;  5AEU B;  3UJM A;  3F8X A;  3F14 A;  1E3R A;  4KVH A;  4HM7 B;  3DUK A;  3H3H A;  5D82 A;  4HM2 B;  1U5O A;  7STD A;  1GS3 A;  3EBY A;  3MG3 A;  4XBY A;  4HVN A;  4ORL A;  3FF0 A;  5IG4 A;  4OUQ A;  3T8N A;  4HM3 B;  3OX9 A;  2XR8 B;  1NWW A;  3OWS A;  2QIY A;  2RFR A;  1JB4 A;  3JUP A;  3FLJ A;  4N3V A;  5AIF A;  1OH0 A;  1SJW A;  1S5A A;  4WYK B;  3WMD A;  5BXQ A;  3FZW A;  3FGY A;  1JB5 A;  2Z77 A;  5CF2 A;  2RCD A;  2I9W A;  4FCM A;  3CNM A;  5BVB A;  1OGZ A;  1JKG A;  5AII A;  3GZB A;  3OXA A;  1DMN A;  4I4K A;  1O7H B;  4XBX A;  1ULI B;  4HM4 B;  3LZA A;  5CF1 A;  1C7H A;  1E97 A;  1TUH A;  4HKV B;  4HM8 B;  4IIA A;  3STD A;  2BNG A;  4K1V A;  3KE7 A;  3MG2 A;  1VZZ A;  5IG3 A;  5CK6 A;  4H3U A;  2HMK B;  3T8U A;  1JN5 A;  2HMO B;  3DM8 A;  3DXO A;  3F9S A;  3HZP A;  3MHE A;  4XM4 A;  4HM5 B;  1OHP A;  2GBX B;  3FSD A;  5IEO A;  1GY6 A;  3JUN A;  3DZL A;  5IER A;  1DMQ A;  2UX0 A;  2GEY A;  2GXF A;  3KKG A;  3KSP A;  1IDP A;  1TP6 A;  4J8T A;  1NDO B;  3MKI A;  4PEJ A;  2GEX A;  1OGX A;  3M8C A;  3G8Z A;  2GBW B;  4X2O A;  3OWU A;  1W01 A;  4WP5 A;  3NV0 A;  1BUQ A;  4XBT A;  1NU3 A;  1Q42 A;  5IF6 A;  1HKX A;  4LGQ A;  1Q40 A;  1E3V A;  1OF5 B;  5KP3 A;  1QMA A;  2QGU A;  1EG9 B;  3OWY A;  2INX A;  3F40 A;  3K0Z A;  4WWU C;  1GYB A;  2HMM B;  3DMC A;  4J9A A;  2B1X B;  2BMO B;  2HMJ B;  5DRV A;  5STD A;  3SOY A;  2YFI B;  3RGA A;  4Q53 A;  3SOA A;  3BB9 A;  3F8H A;  4OVM A;  1ISK A;  5DRE A;  3SED A;  3D9R A;  4FCJ A;  3OV4 A;  4CDL A;  4LMI A;  1O7G B;  1QJG A;  4HZ9 B;  5IG0 A;  4HJL B;  3CNX A;  1GY5 A;  1STD A;  4L8P A;  3EC9 A;  3ROB A;  2F99 A;  1AR0 A;  1WQL B;  5FW5 A;  1A2K A;  2PZV A;  3EHC A;  2Z76 A;  4WYK A;  4RZM A;  3UNL A;  1W6Y A;  3NM2 A;  3K7C A;  1UUV B;  3JUQ A;  5KP1 A;  3NHX A;  3A76 A;  1DMM A;  4L7K A;  1OPY A;  1ULJ B;  5HGR A;  3NBR A;  3FF2 A;  5IEP A;  2XSO B;  2A15 A;  3JUO A;  3RGR A;  3ER7 A;  3MG1 A;  4XDV A;  2HML B;  4X2H A;  3EBT A;  5D83 A;  4MJD A;  3Q90 A;  3B4P A;  3E99 A;  5G2G A;  1K41 A;  2XSH B;  6STD A;  3EN1 B;  3B4O A;  2IMJ A;  1GY7 A;  2K54 A;  3CPO A;  2BMQ B;  4HZB B;  1JKG B;  3VGN A;  3GZX B;  3GZY B;  2Z7A A;  3EX9 A;  4GB5 A;  3KZT A;  4STD A;  4HM0 B;  5AIH A;  2W2C A;  3F7S A;  4K1U A;  3EN8 A;  3FKA A;  3G16 A;  1Z1S A;  2CKF B;  2XRX B;  1CQS A;  3IPT A;  3FH1 A;  2F86 B;  4XB5 A;  1W00 A;  1ZX2 A;  3GWR A;  5JPU A;  3HK4 A;  5KP4 A;  5CLK A;  1JN5 B;  3S5C A;  3I0Y A;  3NXJ A;  3B8L A;  1ASK A;  5EVH A;  1EA2 A;  3EQQ B;  2STD A;  5TGN A;  3G0K A;  1OUN A;  1O7W B;  1OF5 A;  1O7P B;  2RGQ A;  2OWP A;  8CHO A;  3VSY A;  1OHS A;  1OCV A;  4HM1 B;  2R4I A;  2YFL B;  3CU3 A;  2YFJ B;  5IEN A;  3B7C A;  3EF8 A;  4U13 A;  3GRD A;  3NUV A;  2B24 B;  2HMN B;  1W02 A;  2JQ5 A;  3NV0 B;  3LYG A;  2BMR B;  3BLZ A;  4R9L A;  3EJV A;  3GZR A;  5D81 A;  4L8O A;  5CXO A;  3MSO A;  5AI1 A;  5AEW B;  1Q40 B;  3ECF A;  3H51 A;  4R1K A;  2F98 A;  5JPP A;  1UUW B;  3MYT A;  4R9K A;  1O7N B;  3F7X A;  2CHC A;  1JB2 A;  1ZO2 A;  4HM6 B; 
#chains in the Genus database with same CATH topology
 1JRQ A;  1MNL A;  5AIG A;  3CCR 3;  5IG5 A;  1O7M B;  3HX8 A;  3CPW 2;  2ZA4 A;  2FXT A;  1V74 A;  1OHO A;  4XDW A;  4LEH A;  2IUK A;  5ELJ A;  3WHO A;  3JUM A;  5AEU B;  4O3V A;  3UJM A;  1R4Y A;  5BIR A;  4HYZ A;  1MOL A;  2YX9 A;  3F8X A;  5EQL A;  3DGY A;  2W04 A;  2O9U X;  3AGN A;  3F14 A;  4FMA A;  1RHL A;  2XF3 A;  2F5M A;  1E3R A;  3HOH A;  4KVH A;  1WTH A;  1G02 A;  3DUK A;  4HM7 B;  1UGI A;  2Y73 A;  4FMB A;  2Y74 A;  3N8B A;  2OCT A;  3H3H A;  4ZM8 A;  3UB1 A;  1W2B 2;  2KCD A;  3Q2P A;  3HII A;  5D82 A;  1DVD A;  4HM2 B;  1U5O A;  7STD A;  1RN1 A;  3PCR A;  3X3X A;  1VQQ A;  1HU9 A;  3DGN A;  1GOU A;  3HI7 A;  1VQM 3;  1VQ8 3;  1GS3 A;  3WOE B;  1N8R 4;  3EBY A;  3MG3 A;  4XBY A;  4HVN A;  1SII A;  1ZS7 A;  2IA7 A;  4ORL A;  3FF0 A;  3V98 A;  1GMP A;  2CIU A;  2E2T A;  2WO0 A;  5IG4 A;  1JBS A;  4OUQ A;  3T8N A;  1TRP A;  2W56 B;  2CC3 A;  2H0I A;  4HM3 B;  3DH2 A;  2CWV A;  3DY5 A;  3OX9 A;  2QA4 3;  1W7C A;  1RLS A;  2XR8 B;  1L5G B;  2ML6 A;  1US1 A;  1NWW A;  3OWS A;  1EKM A;  3CME 3;  1BUJ A;  4BTX A;  2UGI A;  4NHF A;  2ZDJ A;  2QIY A;  2RFR A;  2K0M A;  1JB4 A;  3JUP A;  3FLJ A;  1EEJ A;  4WFO A;  4BL3 A;  1IK3 A;  3DGM A;  4N3V A;  5AIF A;  1N5P A;  1GD4 A;  1I8V A;  1OH0 A;  4FCZ A;  4FR9 A;  4GL6 A;  1GMQ A;  4N6L A;  2JDI H;  1STF I;  4BIR A;  1FUW A;  1UDI I;  4MMX B;  1K28 A;  1SJW A;  1S5A A;  4WYK B;  3WMD A;  5BXQ A;  3FZW A;  4TX4 A;  1DE3 A;  1RGK A;  2CW9 A;  3FGY A;  3GSP A;  1YI2 3;  1BNF A;  2L4V A;  4N6U A;  1VQO 3;  1QAK A;  2CFD A;  1RNT A;  1N9J A;  1JB5 A;  2Z77 A;  5CF2 A;  3GAX A;  2RCD A;  3DGO A;  2I9W A;  5LC6 A;  3X3Z A;  4FCM A;  3CNM A;  5BVB A;  1OGZ A;  1M90 4;  2KF5 A;  2UUG C;  1FGQ A;  2CG0 A;  1JKG A;  3IMA B;  1R4C A;  1Q7H A;  5AII A;  3GZB A;  3OXA A;  1RGE A;  1DMN A;  4I4K A;  1O7H B;  4XBX A;  1BNG A;  1I0X A;  1ULI B;  1RTU A;  3QK9 A;  3D79 A;  4HM4 B;  1ROA A;  5G1L A;  3LZA A;  5CF1 A;  1RRH A;  1C7H A;  3LOY A;  1E97 A;  1TUH A;  3MWZ A;  3X42 A;  2XGN A;  3AMO B;  2SAR A;  4HKV B;  4HM8 B;  3URP A;  3CC2 3;  1BNJ A;  1YVB I;  3SOY A;  4IIA A;  3STD A;  4LZI A;  2BNG A;  2CFG A;  1RCK A;  1TJD A;  2D42 A;  2Z6B A;  3HIG A;  3CCS 3;  1VQ4 3;  1SIH A;  3LH4 A;  2PNC A;  3IJE B;  3KE7 A;  3MG2 A;  4K1V A;  1VZZ A;  3N54 B;  1J2B A;  5IG3 A;  5CK6 A;  1UUG B;  4H3U A;  4R80 A;  3CCM 3;  2HMK B;  3T8U A;  5G1K A;  1IV9 A;  2ZL8 A;  3X40 A;  1JN5 A;  1SPU A;  2HMO B;  3DM8 A;  4ILF A;  3RNT A;  3NBJ A;  3DXO A;  3F9S A;  3VF1 A;  1VQL 3;  2C11 A;  3HZP A;  3MHE A;  1WMN A;  8RNT A;  1FZU A;  4XM4 A;  1AVL A;  3WR2 A;  4HM5 B;  3JVC A;  4EV5 A;  1JBT A;  2CFL A;  1OHP A;  1NNV A;  3CCV 3;  1RGH A;  2GBX B;  2BHM A;  1IV7 A;  1B21 A;  3FSD A;  1UGH I;  4EYC A;  5IEO A;  2KF3 A;  3PYJ A;  1GY6 A;  3JUN A;  3KII A;  1X1U A;  3LML A;  1IQY A;  3DZL A;  1YGW A;  1LNH A;  5IER A;  1DMQ A;  1KSI A;  2UX0 A;  2WGO A;  3NBB A;  1GD3 A;  2GEY A;  5IW9 A;  2CFK A;  2GXF A;  2P0X A;  3WA3 A;  3KKG A;  3KSE D;  2CFW A;  1BRI A;  4IPB A;  2RNT A;  1DET A;  1WMP A;  3KSP A;  1IDP A;  1TP6 A;  1LOX A;  3EB8 A;  4J8T A;  1VQ9 3;  1NDO B;  1IU7 A;  3MKI A;  4PEJ A;  4K90 B;  2WOF A;  2GEX A;  1OGX A;  3M8C A;  3PS8 A;  3G8Z A;  1YJ9 3;  1BRJ A;  4IT7 A;  1I3I A;  2GBW B;  3BNC A;  4X2O A;  3OWU A;  3G4S 3;  1W01 A;  1RDS A;  4WP5 A;  1YJW 3;  3NV0 A;  1BUQ A;  1BRK A;  3ALA A;  1JZO A;  1I2G A;  1T3B A;  2RSX A;  1ROV A;  2KXG A;  1PYL A;  1AV4 A;  4XBT A;  1U8C B;  3LT8 A;  1Y4K A;  9RNT A;  1QAF A;  1LQM B;  1NU3 A;  4JRF A;  5EEO A;  1I2E A;  3U1W A;  3D5G A;  4EBG A;  1Q42 A;  3O8Y A;  2BU4 A;  5IF6 A;  1NB5 I;  1AY7 A;  3BNB A;  2IY2 A;  1HKX A;  1RJO A;  4LGQ A;  1I3F A;  3N9H A;  4I5Q A;  3NQY A;  2W9P A;  3LT9 A;  1Q40 A;  1E3V A;  3BNE A;  4HBR A;  3T0U A;  1KC8 4;  4QWT A;  1OF5 B;  3CCQ 3;  1UW1 A;  5KP3 A;  1QMA A;  2QGU A;  2Q07 A;  3CMA 3;  3LXU X;  2D1W A;  1EG9 B;  3A5E A;  4GSP A;  1LVN A;  1FGT A;  2H0G A;  3OWY A;  1TFO A;  1B2Z A;  2INX A;  1BNE A;  1T2H A;  4HOH A;  1Q9E A;  3LTC A;  5GSP A;  1T5Y A;  3F40 A;  1QAL A;  3K0Z A;  2E2V A;  4WWU C;  2R41 A;  1GYB A;  2HMM B;  3AHW A;  4N6M A;  4MEI A;  2QEX 3;  3DMC A;  3CXC 2;  1LQG C;  4NRE A;  4J9A A;  2FGT A;  1BSA A;  3PCS A;  1MWT A;  2B1X B;  1UCK A;  1DVC A;  2LQV A;  2BMO B;  1X1X A;  4BTW A;  1N8Q A;  4O2H A;  3K9M C;  1B2M A;  1K9M 4;  2XGL A;  1OAC A;  2HMJ B;  5DRV A;  4KZ1 A;  1RN7 A;  5STD A;  1BAO A;  1RCL A;  1SAR A;  1T2I A;  2CWU A;  2YFI B;  3RGA A;  1BSE A;  4Q53 A;  3SOA A;  2KRT A;  3SLU A;  2RBI A;  3KFQ C;  1W2Z A;  1YNV X;  1YGE A;  3BB9 A;  2BT3 A;  3F8H A;  4CPK A;  4OVM A;  2OTL 3;  1M1X B;  1ISK A;  1SQW A;  5DRE A;  1TFK A;  3L0R A;  3V99 A;  3SED A;  3KCH A;  3D9R A;  4FCJ A;  2P0M A;  2W0Q A;  3OV4 A;  4N6O B;  4CDL A;  4AKY A;  4KFF A;  1FA3 A;  4LMI A;  1BRG A;  1IT7 A;  1O7G B;  2KAA A;  1QJG A;  5BU4 A;  2XFS A;  3SVA A;  5M19 A;  3NX0 A;  2XEP A;  4HZ9 B;  5IG0 A;  1S72 3;  1A67 A;  1W4N A;  4HJL B;  3D5I A;  2W56 A;  1UCI A;  3ZFZ A;  1FGR A;  1BSC A;  1LRA A;  1WMO A;  3SXX A;  2KF6 A;  3CNX A;  4RNY A;  1GY5 A;  1B20 A;  1STD A;  3S27 A;  4L8P A;  1YIT 3;  2CH9 A;  1GSP A;  1I2F A;  3WOD G;  3EC9 A;  2IUJ A;  3ROB A;  2F99 A;  2K3D A;  3X3Y A;  2XH9 A;  1GMR A;  1AR0 A;  3KN4 A;  2P38 A;  1K8A 4;  1WQL B;  5FW5 A;  1A2K A;  3BND A;  1NJI 4;  4DKI A;  3CC7 3;  3QRD A;  3BU4 A;  3CCE 3;  1JV2 B;  1UI7 A;  2PZV A;  1F8N A;  1IVX A;  4KFE A;  1RGA A;  1B2X A;  3DGL A;  2Z76 A;  3EHC A;  4WYK A;  1RGC A;  1Q82 4;  1BU4 A;  1UCL A;  4RZM A;  3G6E 3;  3UNL A;  1ZGX A;  2CX1 A;  2F56 A;  1W6Y A;  3NM2 A;  4K61 A;  1KWI A;  1BRN L;  3RDE A;  3K7C A;  2GSP A;  5AYS C;  1RNB A;  1VQ5 3;  3D3L A;  1UCJ A;  2ML5 A;  3S28 A;  1UUV B;  2CWT A;  1N5H A;  1BRH A;  1MGW A;  3JUQ A;  4BU4 A;  4KT3 B;  2WGQ A;  1B3S A;  2C10 A;  4LYL B;  5KP1 A;  3NHX A;  3A76 A;  1KQS 2;  1NO3 A;  1QVF 2;  1HZ1 A;  1B2S A;  1DMM A;  2H0H A;  4L7K A;  1CEW I;  5RNT A;  1IT8 A;  1OPY A;  1ULJ B;  4BTY A;  4KFD A;  1RGL A;  5HGR A;  1B2U A;  2AAD A;  1RN4 A;  4J5G A;  3S29 A;  3NBR A;  3FF2 A;  2F5W A;  3MPH A;  1LXE A;  1Q81 4;  4EXR A;  2OQE A;  4WHA A;  5IEP A;  5A0O B;  2XSO B;  2A15 A;  3JUO A;  5ELU A;  3RGR A;  3ER7 A;  2OOV A;  1YHQ 3;  1FYS A;  3MG1 A;  3FG1 A;  4JF8 A;  4XDV A;  1BVI A;  3K5T A;  2HML B;  1B27 A;  4X2H A;  3FG4 A;  1IVU A;  4BL2 A;  1BSD A;  3EBT A;  5D83 A;  1I70 A;  4MJD A;  3I55 3;  1A2V A;  3Q90 A;  1HYF A;  3B4P A;  3OW2 2;  2LYX A;  3E99 A;  5G2G A;  1K41 A;  4FMD A;  1D6U A;  1MGR A;  2XSH B;  3D4A A;  4RNZ A;  3SYU A;  6STD A;  1G0T A;  3G71 3;  1W6G A;  3EN1 B;  1YJN 3;  1VQK 3;  3B4O A;  2F4Y A;  1V57 A;  7RNT A;  1X1Y A;  2IMJ A;  3NM7 A;  1FUS A;  1Q7Y 4;  4OK0 A;  4RNT A;  2MC8 A;  1FGM A;  2P05 A;  1GY7 A;  1BIR A;  2K54 A;  1MWU A;  3PZW A;  1JJ2 2;  4R4K A;  3CPO A;  2BIR A;  4AKZ A;  1EQK A;  1IQ8 A;  2BMQ B;  4HZB B;  1IYY A;  1TTO A;  1A90 A;  1PU4 A;  1JKG B;  3VGN A;  1BSB A;  3GZX B;  1FGO A;  2HOH A;  2Z7A A;  3EX9 A;  3GZY B;  4GHO A;  1RSN A;  4GB5 A;  1IVV A;  1RKY A;  3KZT A;  4STD A;  3WOF B;  1LOW A;  1RGG A;  4G1M B;  4HM0 B;  4H61 A;  4N6N B;  5AIH A;  2W2C A;  3F7S A;  4K1U A;  3ZG0 A;  3CC4 3;  3EN8 A;  3FKA A;  4CCV A;  1CYU A;  1VQ7 3;  1LNI A;  1N9E A;  1Z1S A;  1I0V A;  1GOY A;  2CKF B;  2XRX B;  3G16 A;  1KD1 4;  1RMS A;  3WA2 X;  1CQS A;  3TDG A;  3IPT A;  3FH1 A;  2F86 B;  1D6Y A;  4XB5 A;  3AGO A;  4FMC A;  1GOV A;  1MWR A;  4EC6 A;  1W00 A;  1ZX2 A;  3FG3 A;  3GWR A;  5JPU A;  3WDG B;  3Q1C A;  1PY3 A;  2ZHX B;  3SX1 A;  2FNQ A;  1BOX A;  1BRS A;  3HK4 A;  5LC7 A;  5KP4 A;  3CCU 3;  5CLK A;  4O8S A;  1JN5 B;  1RGF A;  3S5C A;  1M1K 4;  3CCL 3;  3I0Y A;  1Q86 4;  1QVG 2;  1VQP 3;  2E2U A;  3NXJ A;  1YVS A;  3B8L A;  1D6Z A;  3S67 A;  4O02 B;  1A2P A;  1ASK A;  3LTD A;  1EA2 A;  2CK3 H;  5EVH A;  3UL5 A;  6RNT A;  3EQQ B;  3J7Y d;  1YIJ 3;  2STD A;  1W5Z A;  1PFP A;  5M1A A;  2O3O A;  5TGN A;  3G0K A;  6GSP A;  1OUN A;  2AAE A;  5JBS A;  1CYV A;  1O7W B;  1OF5 A;  1O7P B;  2RGQ A;  2OWP A;  8CHO A;  3VSY A;  3U97 A;  1K73 4;  1OHS A;  5FGO A;  1G96 A;  1OCV A;  4N6V 0;  2IYJ A;  3LTB A;  5HOH A;  1JNQ A;  3NQZ A;  3PXM A;  4EV2 A;  2P09 A;  1IVW A;  5AYR B;  4HM1 B;  7GSP A;  2R4I A;  2YFL B;  1W6C A;  2YFJ B;  3CU3 A;  4NPB A;  1FUT A;  1RRL A;  2CX0 A;  5I97 A;  5IEN A;  3EE1 A;  3V92 A;  3B7C A;  2XFT A;  3EF8 A;  1IQX A;  1TIJ A;  4HAA A;  1DYU A;  4U13 A;  3X41 A;  1LOY A;  3I56 3;  2W03 A;  2KF4 A;  3GRD A;  3NUV A;  2B24 B;  2HMN B;  1W02 A;  2JQ5 A;  1MWS A;  1TU5 A;  4J5K A;  4MMY B;  1AVK A;  3NV0 B;  4RBN A;  3K63 A;  3LYG A;  2CG1 A;  2BMR B;  1JBR A;  1AQZ A;  3LTA A;  3CD6 3;  2BO9 B;  3Q3F A;  3BLZ A;  4R9L A;  4AEQ A;  3EJV A;  2L1S A;  3GZR A;  1CH0 A;  4MMZ B;  5D81 A;  2OTJ 3;  3CCJ 3;  4L8O A;  5CXO A;  2MF7 A;  3MSO A;  3UL6 A;  2OQE C;  1FW7 A;  5AI1 A;  1WNH A;  1JZD A;  5AEW B;  1NB3 I;  1Q40 B;  5M18 A;  3AHS A;  3BIR A;  3ECF A;  4N6T A;  2J8X B;  2OOV C;  4CJN A;  2M7O A;  3H51 A;  4R1K A;  2F98 A;  2W9Q A;  2WOH A;  1X1W A;  2C4B A;  2GU3 A;  1BNR A;  1VQ6 3;  2V1L A;  1C54 A;  1BGS A;  2SBL A;  3AMO A;  1BNI A;  1V58 A;  1UUW B;  5JPP A;  1LOV A;  3MYT A;  4R9K A;  4EW5 A;  4LSO A;  1VQN 3;  2W6J H;  1O7N B;  3ZG5 A;  3PGB A;  2GU1 A;  3F7X A;  1EUI C;  2CHC A;  1UI8 A;  1BNS A;  1TRQ A;  1JB2 A;  1ZO2 A;  3FCS B;  1BAN A;  4HM6 B;  1M9G A; 
#chains in the Genus database with same CATH homology
 1JRQ A;  1MNL A;  5AIG A;  3CCR 3;  5IG5 A;  1O7M B;  3HX8 A;  3CPW 2;  2FXT A;  1V74 A;  1OHO A;  4XDW A;  4LEH A;  2IUK A;  5ELJ A;  3JUM A;  5AEU B;  4O3V A;  3UJM A;  4HYZ A;  1MOL A;  2YX9 A;  3F8X A;  5EQL A;  2W04 A;  2O9U X;  3F14 A;  4FMA A;  2XF3 A;  1E3R A;  4KVH A;  1WTH A;  4HM7 B;  3DUK A;  4FMB A;  2Y74 A;  3N8B A;  2OCT A;  3H3H A;  4ZM8 A;  3UB1 A;  1W2B 2;  2KCD A;  3Q2P A;  3HII A;  5D82 A;  1DVD A;  4HM2 B;  1U5O A;  7STD A;  3PCR A;  3X3X A;  1HU9 A;  3DGN A;  3HI7 A;  1VQM 3;  1VQ8 3;  1GS3 A;  3WOE B;  1N8R 4;  3EBY A;  3MG3 A;  4XBY A;  4HVN A;  1SII A;  2IA7 A;  4ORL A;  3FF0 A;  3V98 A;  2WO0 A;  2CIU A;  2E2T A;  5IG4 A;  4OUQ A;  3T8N A;  2W56 B;  2CC3 A;  4HM3 B;  2CWV A;  3DY5 A;  3OX9 A;  2QA4 3;  1W7C A;  1L5G B;  2XR8 B;  2ML6 A;  1US1 A;  1NWW A;  3OWS A;  1EKM A;  3CME 3;  4BTX A;  4NHF A;  2ZDJ A;  2QIY A;  2RFR A;  2K0M A;  1JB4 A;  3JUP A;  3FLJ A;  4WFO A;  1IK3 A;  3DGM A;  4N3V A;  5AIF A;  1N5P A;  1GD4 A;  1OH0 A;  4FCZ A;  4FR9 A;  4GL6 A;  4N6L A;  2JDI H;  1STF I;  1FUW A;  4MMX B;  1K28 A;  1SJW A;  1S5A A;  4WYK B;  3WMD A;  5BXQ A;  3FZW A;  4TX4 A;  2CW9 A;  3FGY A;  1YI2 3;  2L4V A;  4N6U A;  1VQO 3;  1QAK A;  2CFD A;  1N9J A;  1JB5 A;  2Z77 A;  5CF2 A;  3GAX A;  2RCD A;  3DGO A;  2I9W A;  5LC6 A;  3X3Z A;  4FCM A;  3CNM A;  5BVB A;  1OGZ A;  1M90 4;  1FGQ A;  2CG0 A;  1JKG A;  3IMA B;  1R4C A;  5AII A;  3GZB A;  3OXA A;  1DMN A;  4I4K A;  1O7H B;  4XBX A;  1ULI B;  3QK9 A;  4HM4 B;  1ROA A;  3LZA A;  5CF1 A;  1RRH A;  1C7H A;  3LOY A;  1E97 A;  1TUH A;  3MWZ A;  3X42 A;  2XGN A;  3AMO B;  4HKV B;  4HM8 B;  3CC2 3;  1YVB I;  4IIA A;  3STD A;  4LZI A;  2BNG A;  2CFG A;  2D42 A;  2Z6B A;  3HIG A;  3CCS 3;  1VQ4 3;  1SIH A;  3LH4 A;  2PNC A;  3IJE B;  3KE7 A;  3MG2 A;  4K1V A;  1VZZ A;  3N54 B;  1J2B A;  5IG3 A;  5CK6 A;  4H3U A;  4R80 A;  3CCM 3;  2HMK B;  3T8U A;  1IV9 A;  2ZL8 A;  3X40 A;  1JN5 A;  1SPU A;  2HMO B;  3DM8 A;  3NBJ A;  3DXO A;  3F9S A;  3VF1 A;  1VQL 3;  2C11 A;  3HZP A;  3MHE A;  1WMN A;  4XM4 A;  1AVL A;  4HM5 B;  3JVC A;  4EV5 A;  2CFL A;  1OHP A;  3CCV 3;  2GBX B;  2BHM A;  1IV7 A;  3FSD A;  4EYC A;  5IEO A;  3PYJ A;  1GY6 A;  3JUN A;  3KII A;  3LML A;  1IQY A;  3DZL A;  1LNH A;  5IER A;  1DMQ A;  1KSI A;  2UX0 A;  2WGO A;  3NBB A;  1GD3 A;  2GEY A;  5IW9 A;  2CFK A;  2GXF A;  2P0X A;  3WA3 A;  3KKG A;  3KSE D;  2CFW A;  4IPB A;  1WMP A;  3KSP A;  1IDP A;  1TP6 A;  1LOX A;  3EB8 A;  4J8T A;  1VQ9 3;  1NDO B;  1IU7 A;  3MKI A;  4PEJ A;  4K90 B;  2WOF A;  2GEX A;  1OGX A;  3M8C A;  3PS8 A;  3G8Z A;  1YJ9 3;  4IT7 A;  2GBW B;  3BNC A;  4X2O A;  3OWU A;  3G4S 3;  1W01 A;  4WP5 A;  1YJW 3;  3NV0 A;  1BUQ A;  3ALA A;  2RSX A;  1ROV A;  2KXG A;  1AV4 A;  4XBT A;  1U8C B;  3LT8 A;  1Y4K A;  1QAF A;  1NU3 A;  4JRF A;  5EEO A;  3U1W A;  4EBG A;  1Q42 A;  3O8Y A;  5IF6 A;  1NB5 I;  3BNB A;  1HKX A;  1RJO A;  4LGQ A;  3N9H A;  3NQY A;  2W9P A;  3LT9 A;  1Q40 A;  1E3V A;  3BNE A;  4HBR A;  3T0U A;  1KC8 4;  4QWT A;  1OF5 B;  3CCQ 3;  1UW1 A;  5KP3 A;  1QMA A;  2QGU A;  2Q07 A;  3CMA 3;  3LXU X;  2D1W A;  1EG9 B;  1LVN A;  1FGT A;  3OWY A;  1TFO A;  2INX A;  3LTC A;  1T5Y A;  3F40 A;  1QAL A;  3K0Z A;  2E2V A;  4WWU C;  1GYB A;  2HMM B;  4N6M A;  4MEI A;  2QEX 3;  3DMC A;  3CXC 2;  4NRE A;  4J9A A;  2FGT A;  3PCS A;  2B1X B;  1DVC A;  2LQV A;  2BMO B;  4BTW A;  1N8Q A;  4O2H A;  3K9M C;  1K9M 4;  2XGL A;  1OAC A;  2HMJ B;  5DRV A;  4KZ1 A;  1RN7 A;  5STD A;  2YFI B;  3SOY A;  2CWU A;  3RGA A;  4Q53 A;  3SOA A;  2KRT A;  3SLU A;  3KFQ C;  1W2Z A;  1YGE A;  3BB9 A;  2OTL 3;  2BT3 A;  3F8H A;  4OVM A;  1M1X B;  1ISK A;  1SQW A;  5DRE A;  1TFK A;  3L0R A;  3V99 A;  3SED A;  3D9R A;  4FCJ A;  2P0M A;  2W0Q A;  3OV4 A;  4N6O B;  4CDL A;  4AKY A;  4KFF A;  1FA3 A;  4LMI A;  1IT7 A;  1O7G B;  1QJG A;  2XFS A;  3SVA A;  3NX0 A;  2XEP A;  4HZ9 B;  5IG0 A;  1S72 3;  1A67 A;  1W4N A;  4HJL B;  2W56 A;  1FGR A;  1WMO A;  3SXX A;  3CNX A;  4RNY A;  1GY5 A;  1STD A;  3S27 A;  4L8P A;  1YIT 3;  2CH9 A;  3WOD G;  3EC9 A;  2IUJ A;  3ROB A;  2F99 A;  3X3Y A;  2XH9 A;  1AR0 A;  3KN4 A;  2P38 A;  1K8A 4;  1WQL B;  5FW5 A;  1A2K A;  3BND A;  1NJI 4;  3CC7 3;  3QRD A;  3CCE 3;  1JV2 B;  1UI7 A;  2PZV A;  1F8N A;  1IVX A;  4KFE A;  1Q82 4;  3DGL A;  3EHC A;  2Z76 A;  4WYK A;  4RZM A;  3G6E 3;  3UNL A;  1W6Y A;  3NM2 A;  4K61 A;  1KWI A;  3RDE A;  3K7C A;  1VQ5 3;  5AYS C;  3D3L A;  2ML5 A;  3S28 A;  1UUV B;  2CWT A;  1N5H A;  3JUQ A;  2WGQ A;  2C10 A;  5KP1 A;  3NHX A;  3A76 A;  1KQS 2;  1NO3 A;  1QVF 2;  1DMM A;  4L7K A;  1CEW I;  1IT8 A;  1OPY A;  1ULJ B;  4BTY A;  4KFD A;  5HGR A;  3S29 A;  3NBR A;  3FF2 A;  3MPH A;  1LXE A;  1Q81 4;  4EXR A;  2OQE A;  4WHA A;  5IEP A;  5A0O B;  2XSO B;  2A15 A;  3JUO A;  5ELU A;  3RGR A;  3ER7 A;  2OOV A;  1YHQ 3;  3MG1 A;  3FG1 A;  4JF8 A;  4XDV A;  3K5T A;  2HML B;  4X2H A;  3FG4 A;  1IVU A;  3EBT A;  5D83 A;  4MJD A;  3I55 3;  1A2V A;  3Q90 A;  3B4P A;  3OW2 2;  2LYX A;  3E99 A;  5G2G A;  1K41 A;  4FMD A;  1D6U A;  2XSH B;  6STD A;  4RNZ A;  3G71 3;  1W6G A;  3EN1 B;  1YJN 3;  1VQK 3;  3B4O A;  2IMJ A;  3NM7 A;  1Q7Y 4;  4OK0 A;  2MC8 A;  1FGM A;  2P05 A;  1GY7 A;  2K54 A;  3PZW A;  1JJ2 2;  4R4K A;  3CPO A;  4AKZ A;  1EQK A;  1IQ8 A;  2BMQ B;  4HZB B;  1A90 A;  1PU4 A;  1JKG B;  3VGN A;  3GZX B;  1FGO A;  2Z7A A;  3EX9 A;  3GZY B;  4GB5 A;  1IVV A;  1RKY A;  3KZT A;  4STD A;  3WOF B;  4HM0 B;  4G1M B;  4H61 A;  4N6N B;  5AIH A;  2W2C A;  3F7S A;  4K1U A;  3CC4 3;  3EN8 A;  3FKA A;  4CCV A;  1CYU A;  1VQ7 3;  3G16 A;  1N9E A;  1Z1S A;  2CKF B;  2XRX B;  1KD1 4;  3WA2 X;  1CQS A;  3TDG A;  3IPT A;  3FH1 A;  2F86 B;  1D6Y A;  4XB5 A;  4FMC A;  4EC6 A;  1W00 A;  1ZX2 A;  3FG3 A;  3GWR A;  5JPU A;  3WDG B;  3Q1C A;  3SX1 A;  2FNQ A;  3HK4 A;  5LC7 A;  5KP4 A;  3CCU 3;  5CLK A;  4O8S A;  1JN5 B;  3S5C A;  1M1K 4;  3CCL 3;  3I0Y A;  1Q86 4;  1QVG 2;  1VQP 3;  2E2U A;  3NXJ A;  3B8L A;  1D6Z A;  3S67 A;  4O02 B;  1ASK A;  3LTD A;  1EA2 A;  2CK3 H;  5EVH A;  3UL5 A;  1YIJ 3;  3EQQ B;  3J7Y d;  2STD A;  1W5Z A;  1PFP A;  2O3O A;  5TGN A;  3G0K A;  5JBS A;  1OUN A;  1CYV A;  1O7W B;  1OF5 A;  1O7P B;  2RGQ A;  2OWP A;  8CHO A;  3VSY A;  3U97 A;  1K73 4;  1OHS A;  5FGO A;  1G96 A;  1OCV A;  4N6V 0;  3LTB A;  1JNQ A;  3NQZ A;  3PXM A;  4EV2 A;  2P09 A;  1IVW A;  5AYR B;  4HM1 B;  2R4I A;  2YFL B;  1W6C A;  2YFJ B;  3CU3 A;  1RRL A;  5I97 A;  5IEN A;  3EE1 A;  3V92 A;  3B7C A;  2XFT A;  3EF8 A;  1IQX A;  1TIJ A;  4U13 A;  1DYU A;  3X41 A;  3I56 3;  2W03 A;  3GRD A;  3NUV A;  2B24 B;  2HMN B;  1W02 A;  2JQ5 A;  1TU5 A;  4MMY B;  1AVK A;  3NV0 B;  4RBN A;  3K63 A;  3LYG A;  2CG1 A;  2BMR B;  3LTA A;  3CD6 3;  2BO9 B;  3BLZ A;  4R9L A;  4AEQ A;  3EJV A;  3GZR A;  4MMZ B;  5D81 A;  2OTJ 3;  3CCJ 3;  4L8O A;  5CXO A;  2MF7 A;  3MSO A;  3UL6 A;  2OQE C;  5AI1 A;  1WNH A;  5AEW B;  1NB3 I;  1Q40 B;  3ECF A;  4N6T A;  2OOV C;  2M7O A;  3H51 A;  4R1K A;  2F98 A;  2W9Q A;  2WOH A;  2GU3 A;  1VQ6 3;  2V1L A;  2SBL A;  5JPP A;  3AMO A;  1UUW B;  3MYT A;  4R9K A;  4LSO A;  1VQN 3;  2W6J H;  1O7N B;  3PGB A;  2GU1 A;  3F7X A;  2CHC A;  1UI8 A;  1JB2 A;  1ZO2 A;  3FCS B;  2Y73 A;  4HM6 B;  1M9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...