2CHCA

Structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
169
structure length
169
Chain Sequence
GAMGPVDEQWIEILRIQALCARYCLTINTQDGEGWAGCFTEDGAFEFDGWVIRGRPALREYADAHARVVRGRHLTTDLLYEVDGDVATGRSASVVTLATAAGYKILGSGEYQDRLIKQDGQWRIAYRRLRNDRLVSDPSVAVNVADADVAAVVGHLLAAARRLGTQMSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RV3472
publication title Structure of Rv3472(D26N), a Function Unknown Protein from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hypothetical protein
total genus 55
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2chcA00
2YFJB 1WQLB 3BLZA 2RFRA 2Z76A 3MYTA 3B4PA 1Q40A 5JPUA 1DMNA 2K54A 1O7NB 3A76A 1AR0A 2HMMB 3OWUA 1IDPA 3G8ZA 5DRVA 5CF1A 5AEUB 5STDA 1QMAA 1OUNA 1OGZA 1O7PB 5CXOA 2OWPA 3EX9A 4R9KA 3I0YA 2HMNB 3KE7A 2Z7AA 3SOAA 5IERA 4K1UA 2GEYA 2XSOB 1TP6A 1JB2A 4IIAA 1O7WB 1O7MB 2BMQB 3EN8A 2UX0A 5HGRA 1NWWA 2HMKB 2YFLB 4HZBB 3SEDA 1JKGA 1OF5B 5FW5A 1E3RA 3SOYA 1W02A 3DUKA 3T8NA 2GBXB 3OV4A 4L8OA 1OPYA 7STDA 1DMMA 5AIIA 3EBYA 3K7CA 4R1KA 5D82A 3OWSA 2A15A 5IENA 3NV0B 3OXAA 2QGUA 4WYKA 1Z1SA 2CHCA 3NBRA 3MKIA 5BXQA 4HM6B 4X2HA 1JN5B 3H3HA 2XR8B 1JB4A 4HZ9B 1HKXA 4OVMA 3MSOA 3B4OA 5AIFA 3D9RA 8CHOA 3JUPA 3EC9A 1EG9B 1S5AA 4LEHA 2F99A 3BB9A 1K41A 3MG3A 3F8XA 3JUMA 4XDVA 2XSHB 1QJGA 3JUNA 5IF6A 3OWYA 4CDLA 2B1XB 4Q53A 5IG4A 4LMIA 4XBXA 3KZTA 5EVHA 5IG5A 5CLKA 3FSDA 3WMDA 4HM7B 4J8TA 3CPOA 2B24B 4HM8B 2BNGA 2CKFB 2RGQA 1ASKA 3FLJA 3FH1A 3RGAA 3DM8A 3FF2A 1Q42A 3G16A 4HKVB 4RZMA 1C7HA 4HM1B 1OF5A 4LGQA 1E3VA 3G0KA 4HJLB 4HVNA 2YFIB 3STDA 3FZWA 3MG1A 2STDA 3HZPA 4X2OA 2PZVA 5BVBA 3E99A 3UJMA 4N3VA 3CU3A 2W2CA 2Z77A 1NU3A 2HMLB 1W6YA 3NXJA 3NV0A 5IG3A 3NM2A 5AEWB 3LYGA 3KSPA 5JPPA 1GYBA 4I4KA 5D81A 4R9LA 4HM2B 1JN5A 2QIYA 4HM0B 3K0ZA 1ULIB 3FGYA 1OHSA 3LZAA 3MG2A 1DMQA 1STDA 3OX9A 4WP5A 4K1VA 4XDWA 3ROBA 1GY7A 3EBTA 3NHXA 5KP3A 5D83A 1ZX2A 3RGRA 1JB5A 3CNXA 1VZZA 4MJDA 3DMCA 3FF0A 1NDOB 5CF2A 5IEOA 3F7XA 3EF8A 5TGNA 5AIGA 3GZYB 3F8HA 2HMOB 4FCJA 1TUHA 1ZO2A 4XBYA 1ISKA 1A2KA 5KP4A 2F98A 4HM3B 3Q90A 3GZBA 3DZLA 2BMOB 3JUQA 1Q40B 3F9SA 3F7SA 3M8CA 1U5OA 3ER7A 3GRDA 1W00A 2R4IA 3CNMA 3NUVA 2GBWB 3HX8A 3UNLA 4HM5B 3EN1B 2JQ5A 3VSYA 1OHPA 2GEXA 1GY5A 2HMJB 3GZRA 2XRXB 5AI1A 3KKGA 4PEJA 3MHEA 3B8LA 1W01A 3EJVA 1O7GB 4OUQA 2RCDA 2GXFA 3F40A 3H51A 3F14A 4ORLA 4HM4B 3T8UA 4J9AA 3JUOA 3DXOA 4GB5A 1OH0A 1OGXA 3FKAA 5KP1A 4FCMA 5G2GA 2BMRB 2F86B 1E97A 1JKGB 3EHCA 4XM4A 1UUWB 2I9WA 2INXA 1SJWA 4L7KA 1UUVB 3ECFA 5AIHA 4KVHA 3S5CA 1EA2A 4U13A 4WWUC 4STDA 1OCVA 3HK4A 3B7CA 1CQSA 1BUQA 3GWRA 3GZXB 4XBTA 5CK6A 3EQQB 6STDA 1OHOA 1GY6A 4WYKB 4XB5A 3VGNA 1O7HB 4L8PA 1ULJB 1GS3A 2IMJA 5IEPA 4H3UA 3IPTA 5IG0A 5DREA
chains in the Genus database with same CATH superfamily
3NBBA 2UGIA 1WQLB 2YFJB 3BLZA 3LT8A 4J5KA 2RFRA 2Z76A 3MYTA 1I0XA 3B4PA 5A0OB 1Q40A 5JPUA 1DMNA 2CC3A 2K54A 1O7NB 3A76A 5EEOA 2IUJA 1AR0A 2HMMB 3SX1A 3CPW2 1GOYA 1BOXA 1TU5A 1YJ93 3OWUA 1IDPA 1BRGA 3G8ZA 3WR2A 4DKIA 5DRVA 5CF1A 5AEUB 3CCL3 1VQQA 5STDA 2XF3A 2W9PA 3TDGA 1JZOA 3LH4A 1QMAA 3WA3A 1OGZA 1O7PB 1OUNA 5CXOA 3WDGB 3PGBA 5JBSA 4N6OB 2L1SA 2CFGA 5FGOA 2OWPA 3WOEB 4N6V0 4EV5A 3EX9A 1VQO3 4R9KA 2XH9A 2W56A 3I0YA 2OTL3 2HMNB 1MOLA 3KE7A 3AHWA 1SARA 4RNYA 2Z7AA 5LC7A 3SOAA 5IERA 4O2HA 4K1UA 3CCQ3 2GEYA 1M1XB 2XSOB 1UDII 4HBRA 3FG1A 2W0QA 2W9QA 1TP6A 1JB2A 4IIAA 1O7WB 1IVXA 1UI7A 1O7MB 2D42A 1FGMA 4EV2A 2BMQB 1CYVA 1IK3A 2XGLA 1AY7A 1YNVX 2BIRA 3EN8A 4KFFA 1W7CA 2KAAA 2KF5A 1RRLA 2UX0A 4FMAA 5HGRA 5M18A 1NWWA 2HMKB 1BNFA 1G96A 2YFLB 2MF7A 1ZS7A 4HOHA 2ML6A 4FCZA 4HZBB 3X42A 2K3DA 3K9MC 3SEDA 3KFQC 4LZIA 1U8CB 1JKGA 1OF5B 2D1WA 1CYUA 2CX0A 5FW5A 1A2PA 2ML5A 1E3RA 3SOYA 2CWTA 3N8BA 1W02A 3DUKA 1GMQA 2CW9A 5LC6A 3LTAA 2QEX3 3T8NA 2GBXB 2BO9B 3OV4A 2E2TA 1A67A 2ZDJA 3DH2A 1UI8A 4FR9A 1NO3A 1N5PA 4L8OA 1OPYA 4GHOA 1HYFA 3G6E3 3LOYA 4HAAA 7STDA 1RGHA 1DMMA 5AIIA 1RRHA 1IU7A 1MWSA 1YI23 1W2ZA 1N8QA 2OOVA 3AGNA 1NNVA 3EBYA 3K7CA 4CPKA 1X1UA 4R1KA 4WHAA 5BU4A 1JBRA 3CCU3 1WTHA 3S28A 1GMPA 4KZ1A 5D82A 1VQ93 3OWSA 1TRPA 2A15A 4BTWA 5IENA 4FMCA 2K0MA 3NV0B 2WOHA 1G02A 3OXAA 5BIRA 1QVF2 2O9UX 2QGUA 4WYKA 1DVDA 2IUKA 2W03A 1PU4A 3I563 2AADA 1UCIA 1Z1SA 3MPHA 3KSED 2CHCA 1KQS2 1A2VA 3CCE3 2C10A 3NBRA 1I3IA 1LOVA 1RKYA 5GSPA 1D6ZA 3NQYA 1GD3A 3O8YA 3UL6A 3MKIA 3QK9A 2UUGC 1VQN3 5BXQA 2FNQA 1RGEA 1RMSA 2KXGA 4HM6B 4X2HA 1JN5B 2IYJA 3H3HA 2LQVA 2XR8B 1JB4A 1Q7HA 1YJN3 3U97A 4HZ9B 1AV4A 4N6MA 1F8NA 4NHFA 1MGRA 1HKXA 2KCDA 1AVKA 4OVMA 3MSOA 1T5YA 3B4OA 3CMA3 3IJEB 1RGCA 5AIFA 3D9RA 2BHMA 8CHOA 3JUPA 3EC9A 1EG9B 1S5AA 3Q3FA 3QRDA 4LEHA 3SYUA 2F99A 3BB9A 4ILFA 3CME3 4K61A 1K41A 2CFWA 3Q2PA 3MG3A 3F8XA 3GAXA 3DGOA 1FUSA 2CWUA 3JUMA 2XSHB 4XDVA 1QJGA 1X1YA 4RBNA 3JUNA 1S723 1RGGA 5IF6A 3OWYA 1LQMB 1UGHI 3LT9A 1GOUA 4CDLA 2B1XB 1A90A 4Q53A 1YVSA 1MWUA 5IG4A 4LMIA 3D79A 4XBXA 1LQGC 4NPBA 1V57A 3KZTA 3NBJA 5EVHA 5CLKA 5IG5A 1I0VA 1LOWA 3A5EA 3HIGA 3FSDA 2CWVA 7RNTA 4ZM8A 1VQP3 1DYUA 1VQ83 2Y73A 1Q824 3WMDA 4HM7B 4HYZA 3ZG5A 1GSPA 4JRFA 2W04A 1D6YA 3AHSA 4FMDA 1RNTA 1LRAA 4BU4A 3HIIA 3KIIA 3URPA 4J8TA 3CPOA 1B2UA 2B24B 3BU4A 1VQ53 4HM8B 2BNGA 2CKFB 6RNTA 2RGQA 1ASKA 1VQ63 1FGTA 1UGIA 2ZL8A 3FLJA 2P0MA 1SIHA 3FH1A 3BNCA 3RGAA 1VQL3 3DM8A 3EE1A 3FF2A 4N6UA 1Q42A 2ZHXB 2H0IA 3G16A 1N8R4 4R80A 1D6UA 4HKVB 3LTCA 1DVCA 1UCJA 4RZMA 1C7HA 5AYRB 1FA3A 4HM1B 1IV9A 1OF5A 2LYXA 2XEPA 3BNDA 1BSBA 4LGQA 6GSPA 5AYSC 1AQZA 1OACA 1E3VA 2O3OA 1VQ43 3D3LA 3G0KA 4HJLB 2WGQA 4HVNA 1VQM3 2YFIB 5M1AA 3STDA 2CFKA 7GSPA 3FZWA 2CH9A 4EBGA 3MG1A 2STDA 8RNTA 2RNTA 2V1LA 3HZPA 1JRQA 4X2OA 4JF8A 1V58A 1EUIC 2PZVA 4BIRA 5BVBA 4OK0A 1L5GB 1I3FA 2BU4A 2FXTA 1BNJA 3E99A 1KC84 1DE3A 1IVVA 4GL6A 3UJMA 4N3VA 3CU3A 3FG4A 3WOFB 2W2CA 2Z77A 3N9HA 1NU3A 1I70A 4G1MB 4MMXB 3X41A 1Q864 1GOVA 2HMLB 1IVUA 1W6CA 1WNHA 4O3VA 1BRSA 4MMYB 1BUJA 5M19A 1W6YA 1RN4A 3NXJA 2KF6A 3OW22 1W4NA 3NV0A 1RHLA 2H0HA 3PYJA 3CCS3 2SARA 1SQWA 5IW9A 3LTBA 4BTYA 3PXMA 4RNZA 1B2SA 2P05A 3NM2A 5AEWB 5IG3A 2GU3A 3T0UA 1RN7A 4RNTA 3N54B 3SXXA 1N9JA 1RSNA 3NM7A 1BSCA 1TRQA 3D5IA 3LYGA 1I2EA 5EQLA 3KSPA 5JPPA 1IQ8A 1RDSA 1GYBA 1BRKA 4I4KA 5D81A 3MWZA 4R9LA 4HM2B 1B2ZA 1JN5A 1TTOA 1V74A 2QIYA 3IMAB 4HM0B 1RGKA 3CCR3 1FW7A 4IT7A 3S67A 3K0ZA 3ZFZA 1B21A 1JNQA 1B2XA 3CC23 1YIT3 1C54A 3K5TA 3D4AA 1PFPA 4GSPA 1ULIB 1Y4KA 2C11A 1OHSA 3FGYA 1M9GA 3LZAA 3MG2A 1CEWI 2WO0A 3RNTA 1M1K4 4KFDA 3VF1A 4BL3A 3X3XA 1DMQA 3V99A 1IQYA 1NB3I 1X1WA 1STDA 3OX9A 3NX0A 4NREA 4WP5A 1N5HA 1RGLA 1MWRA 5G1LA 4K1VA 1BNIA 4XDWA 3PZWA 3ROBA 1UCKA 1JBTA 2PNCA 1GY7A 3EBTA 3NHXA 2FGTA 1CH0A 1QAFA 1N9EA 3K63A 3KN4A 5KP3A 1BSDA 2AAEA 1BSEA 4EYCA 2CX1A 3DGLA 1YIJ3 5D83A 1YJW3 1ROAA 1ZX2A 1BVIA 3RGRA 4LYLB 1JB5A 2OTJ3 1B20A 1IQXA 3CNXA 1VZZA 3WODG 1HU9A 1T2IA 4MJDA 1WMOA 3FG3A 2WGOA 3DMCA 1BIRA 2MC8A 2E2UA 3UL5A 4FMBA 1STFI 1BSAA 3FF0A 1MNLA 1NDOB 4MMZB 3AMOB 5CF2A 3X3ZA 1YVBI 5IEOA 1I2GA 2XGNA 1NB5I 3CXC2 1Q9EA 3EF8A 3F7XA 2KF3A 5TGNA 2C4BA 1X1XA 3S29A 3HI7A 5AIGA 1TIJA 9RNTA 3V92A 1JBSA 3GZYB 3X3YA 3F8HA 2HMOB 4FCJA 2WOFA 1FGRA 1BRJA 1TUHA 1LNHA 1J2BA 1RN1A 2CG0A 5HOHA 1SIIA 1IT8A 1ZO2A 2F4YA 3AGOA 4I5QA 1I2FA 4EC6A 4XBYA 2IA7A 1EQKA 4K90B 1RTUA 2OQEA 1ISKA 2XFTA 2YX9A 3RDEA 2IY2A 3NQZA 1A2KA 2W6JH 5KP4A 1PYLA 1QALA 1ZGXA 2F98A 2OOVC 4HM3B 4IPBA 5ELUA 1K8A4 3U1WA 3PS8A 4O8SA 3JVCA 3BIRA 1BANA 3Q90A 3CD63 1HZ1A 3GZBA 1B27A 3CCM3 3LXUX 1LNIA 2Z6BA 3DZLA 3DGYA 4AKZA 2BMOB 1JZDA 2RSXA 3JUQA 1RGAA 1Q814 3FCSB 4LSOA 1Q40B 3SVAA 3F9SA 3UB1A 3F7SA 1LVNA 3Q1CA 1GMRA 3WHOA 1BNGA 3M8CA 1RCKA 1U5OA 3ER7A 1AVLA 3GRDA 1JV2B 1W00A 2M7OA 2R4IA 3CNMA 3GSPA 3NUVA 4R4KA 2SBLA 3PCSA 4CJNA 2HOHA 2GBWB 1WMNA 1G0TA 3HX8A 1EKMA 4AEQA 1MWTA 3BNBA 3L0RA 5G1KA 1TFKA 3ZG0A 2CK3H 3UNLA 1NJI4 2KF4A 3BNEA 2CFDA 1RCLA 1K734 2L4VA 1FUWA 1K28A 1R4CA 2Y74A 2BT3A 1YGWA 4J5GA 4HM5B 3EN1B 2JQ5A 3VSYA 1OHPA 2W56B 2GEXA 3LMLA 1BU4A 1GY5A 2RBIA 1UCLA 2HMJB 3GZRA 1BAOA 1BGSA 2J8XB 2XRXB 4BTXA 1TFOA 1FUTA 1QAKA 5AI1A 3KKGA 4O02B 4PEJA 2CG1A 3X40A 3MHEA 3B8LA 1W01A 3EJVA 1O7GB 4OUQA 2P09A 2RCDA 4QWTA 4EXRA 3CC43 1KWIA 2GXFA 3G4S3 3V98A 3F40A 3G713 3H51A 2OCTA 1ROVA 5I97A 3F14A 4ORLA 4EW5A 5RNTA 4HM4B 3T8UA 4J9AA 3WA2X 2F5WA 2F56A 3JUOA 3DXOA 4GB5A 1IT7A 1OH0A 3DGNA 3J7Yd 1OGXA 3FKAA 1WMPA 5KP1A 3I553 1I8VA 1M904 2E2VA 4H61A 4FCMA 5G2GA 4BL2A 2BMRB 3CCV3 2F86B 2OQEC 1E97A 1YGEA 3LTDA 1R4YA 2XFSA 1JKGB 1K9M4 3EHCA 3DGMA 4XM4A 4N6LA 1IV7A 4WFOA 1Q7Y4 1UUWB 2P38A 2ZA4A 2KRTA 3EB8A 2I9WA 2INXA 1UUGB 1RJOA 1DETA 1SJWA 2CIUA 1UUVB 4L7KA 3ECFA 5AIHA 4KVHA 3S27A 4CCVA 3S5CA 1EA2A 3CC73 1SPUA 4U13A 1W6GA 3AMOA 4WWUC 2QA43 4STDA 1OCVA 3HK4A 3B7CA 4AKYA 5ELJA 1UW1A 2GU1A 2P0XA 1VQK3 1LXEA 1RLSA 4KT3B 1KD14 1US1A 1GD4A 1CQSA 1RGFA 2JDIH 1FGOA 1LOYA 4KFEA 1BUQA 3GWRA 4N6NB 1BRIA 1T3BA 1PY3A 3GZXB 4XBTA 5CK6A 1IYYA 3EQQB 3ALAA 2CFLA 2H0GA 2GSPA 3KCHA 6STDA 1KSIA 1B2MA 2R41A 3HOHA 1W2B2 4TX4A 4MEIA 1OHOA 1GY6A 4WYKB 1FZUA 1LOXA 3D5GA 4XB5A 1IVWA 1TJDA 2F5MA 1FYSA 1O7HB 3VGNA 1BNRA 1BRHA 1FGQA 4L8PA 1RNBA 3PCRA 3CCJ3 1ULJB 1EEJA 1GS3A 3DY5A 1JJ22 2Q07A 1BRNL 1BNEA 2IMJA 5IEPA 1B3SA 1QVG2 1W5ZA 1T2HA 4H3UA 3IPTA 1BNSA 1YHQ3 5IG0A 4N6TA 5DREA 1VQ73 3SLUA 1MGWA
chains in the Genus database with same CATH topology
3NBBA 2YFJB 1WQLB 3LT8A 3BLZA 2RFRA 2Z76A 3MYTA 5A0OB 3B4PA 1Q40A 5JPUA 1DMNA 2CC3A 2K54A 1O7NB 3A76A 5EEOA 2IUJA 1AR0A 2HMMB 3SX1A 3CPW2 1TU5A 1YJ93 3OWUA 1IDPA 3G8ZA 5DRVA 5CF1A 5AEUB 3CCL3 5STDA 2XF3A 2W9PA 3TDGA 3LH4A 1QMAA 3WA3A 1OGZA 1O7PB 1OUNA 5CXOA 3WDGB 3PGBA 5JBSA 4N6OB 2CFGA 5FGOA 2OWPA 3WOEB 4N6V0 4EV5A 3EX9A 1VQO3 4R9KA 2XH9A 2W56A 3I0YA 2HMNB 1MOLA 3KE7A 4RNYA 2Z7AA 5LC7A 3SOAA 5IERA 4O2HA 4K1UA 3CCQ3 2GEYA 1M1XB 2XSOB 4HBRA 3FG1A 2W0QA 2W9QA 1TP6A 1JB2A 4IIAA 1O7WB 1IVXA 1UI7A 1O7MB 2D42A 1FGMA 4EV2A 2BMQB 1CYVA 1IK3A 2XGLA 4KFFA 3EN8A 1W7CA 1RRLA 2UX0A 4FMAA 5HGRA 1NWWA 2HMKB 1G96A 2YFLB 2MF7A 2ML6A 4FCZA 4HZBB 3X42A 3K9MC 3SEDA 3KFQC 4LZIA 1U8CB 1JKGA 1OF5B 2D1WA 1CYUA 5FW5A 2ML5A 1E3RA 3SOYA 2CWTA 3N8BA 1W02A 3DUKA 2CW9A 5LC6A 3LTAA 2QEX3 3T8NA 2GBXB 2BO9B 3OV4A 2E2TA 1A67A 2ZDJA 1UI8A 4FR9A 1NO3A 1N5PA 4L8OA 1OPYA 3G6E3 3LOYA 7STDA 1DMMA 5AIIA 1RRHA 1IU7A 1YI23 1W2ZA 1N8QA 2OOVA 3EBYA 3K7CA 4R1KA 4WHAA 3CCU3 1WTHA 3S28A 4KZ1A 5D82A 1VQ93 3OWSA 4BTWA 2A15A 5IENA 4FMCA 2K0MA 3NV0B 2WOHA 3OXAA 1QVF2 2O9UX 2QGUA 4WYKA 1DVDA 2IUKA 2W03A 1PU4A 3I563 1Z1SA 3MPHA 3KSED 2CHCA 1KQS2 1A2VA 3CCE3 2C10A 3NBRA 1RKYA 1D6ZA 3NQYA 1GD3A 3O8YA 3UL6A 3MKIA 3QK9A 1VQN3 5BXQA 2FNQA 2KXGA 4HM6B 4X2HA 1JN5B 3H3HA 2LQVA 2XR8B 1JB4A 1YJN3 3U97A 4HZ9B 1AV4A 4N6MA 1F8NA 4NHFA 1HKXA 2KCDA 1AVKA 4OVMA 3MSOA 1T5YA 3B4OA 3CMA3 3IJEB 5AIFA 3D9RA 2BHMA 8CHOA 3JUPA 3EC9A 1EG9B 1S5AA 3QRDA 4LEHA 2F99A 3BB9A 3CME3 4K61A 1K41A 2CFWA 3Q2PA 3MG3A 3F8XA 3GAXA 3DGOA 3JUMA 2CWUA 4XDVA 2XSHB 1QJGA 4RBNA 3JUNA 1S723 5IF6A 3OWYA 3LT9A 4CDLA 2B1XB 1A90A 4Q53A 5IG4A 4LMIA 4XBXA 3KZTA 3NBJA 5EVHA 5CLKA 5IG5A 3HIGA 3FSDA 2CWVA 1VQP3 4ZM8A 1VQ83 1DYUA 2Y73A 1Q824 3WMDA 4HM7B 4HYZA 4JRFA 2W04A 1D6YA 4FMDA 3HIIA 3KIIA 4J8TA 3CPOA 2B24B 1VQ53 4HM8B 2BNGA 2CKFB 2RGQA 1ASKA 1VQ63 1FGTA 2ZL8A 3FLJA 2P0MA 1SIHA 3FH1A 3BNCA 3RGAA 1VQL3 3DM8A 3EE1A 3FF2A 4N6UA 1Q42A 3G16A 1N8R4 4R80A 1D6UA 4HKVB 3LTCA 1DVCA 4RZMA 5AYRB 1C7HA 1FA3A 4HM1B 1IV9A 1OF5A 2LYXA 2XEPA 3BNDA 2OTL3 4LGQA 5AYSC 1OACA 1E3VA 2O3OA 1VQ43 3D3LA 3G0KA 4HJLB 2WGQA 4HVNA 1VQM3 2YFIB 3STDA 2CFKA 3FZWA 2CH9A 4EBGA 3MG1A 2STDA 2V1LA 3HZPA 1JRQA 4X2OA 4JF8A 2PZVA 5BVBA 4OK0A 1L5GB 2FXTA 3E99A 1KC84 1IVVA 4GL6A 3UJMA 4N3VA 3CU3A 3FG4A 3WOFB 2W2CA 2Z77A 3N9HA 1NU3A 4G1MB 4MMXB 3X41A 1Q864 2HMLB 1IVUA 1W6CA 1WNHA 4O3VA 4MMYB 1W6YA 3NXJA 3OW22 1W4NA 3NV0A 3PYJA 3CCS3 1SQWA 5IW9A 3LTBA 4BTYA 3PXMA 4RNZA 2P05A 3NM2A 5AEWB 5IG3A 2GU3A 3T0UA 1RN7A 3N54B 3SXXA 1N9JA 3NM7A 3LYGA 5EQLA 3KSPA 5JPPA 1IQ8A 1GYBA 4I4KA 5D81A 3MWZA 4R9LA 4HM2B 1JN5A 2QIYA 1V74A 4HM0B 3IMAB 3CCR3 4IT7A 3S67A 3K0ZA 1JNQA 3CC23 1YIT3 3K5TA 1PFPA 1ULIB 1Y4KA 2C11A 1OHSA 3FGYA 1M9GA 3LZAA 3MG2A 1CEWI 2WO0A 1M1K4 4KFDA 3VF1A 3X3XA 1DMQA 3V99A 1IQYA 1NB3I 1STDA 3OX9A 3NX0A 4NREA 4WP5A 1N5HA 1Q814 4K1VA 4XDWA 3PZWA 3ROBA 2PNCA 1GY7A 3EBTA 3NHXA 2FGTA 3KN4A 1QAFA 1N9EA 3K63A 5KP3A 1YIJ3 4EYCA 3DGLA 5D83A 1YJW3 1ROAA 1ZX2A 3RGRA 1JB5A 2OTJ3 1IQXA 3CNXA 1VZZA 3WODG 1HU9A 4MJDA 1WMOA 3FG3A 2WGOA 3DMCA 2MC8A 2E2UA 3UL5A 4FMBA 1STFI 3FF0A 1MNLA 1NDOB 4MMZB 3AMOB 5CF2A 3X3ZA 1YVBI 5IEOA 2XGNA 1NB5I 3CXC2 3F7XA 3EF8A 5TGNA 3S29A 3HI7A 5AIGA 1TIJA 3V92A 3GZYB 3X3YA 3F8HA 2HMOB 4FCJA 2WOFA 1FGRA 1TUHA 1LNHA 1J2BA 2CG0A 1SIIA 1IT8A 1ZO2A 4EC6A 4XBYA 2IA7A 1EQKA 4K90B 2OQEA 1ISKA 2XFTA 2YX9A 3RDEA 3NQZA 1A2KA 2W6JH 5KP4A 1QALA 2OOVC 2F98A 4HM3B 4IPBA 5ELUA 1K8A4 3U1WA 3PS8A 4O8SA 3JVCA 3Q90A 3CD63 3GZBA 3CCM3 3LXUX 2Z6BA 3DZLA 4AKZA 2BMOB 2RSXA 3JUQA 3FCSB 4LSOA 1Q40B 3SVAA 3F9SA 3UB1A 3F7SA 1LVNA 3Q1CA 3M8CA 1U5OA 3ER7A 1AVLA 3GRDA 1JV2B 1W00A 2M7OA 2R4IA 3CNMA 3NUVA 4R4KA 2SBLA 3PCSA 2GBWB 1WMNA 4AEQA 3HX8A 1EKMA 3BNBA 3L0RA 1TFKA 2CK3H 3UNLA 1NJI4 3BNEA 2CFDA 1K734 1FUWA 2L4VA 1K28A 1R4CA 2Y74A 2BT3A 4HM5B 3EN1B 2JQ5A 3VSYA 1OHPA 2W56B 2GEXA 3LMLA 1GY5A 2HMJB 3GZRA 2XRXB 4BTXA 1TFOA 1QAKA 5AI1A 3KKGA 4O02B 4PEJA 2CG1A 3X40A 3MHEA 3B8LA 1W01A 3EJVA 1O7GB 4OUQA 2P09A 2RCDA 4QWTA 4EXRA 3CC43 1KWIA 2GXFA 3G4S3 3V98A 3F40A 3G713 3H51A 2OCTA 1ROVA 5I97A 3F14A 4ORLA 4HM4B 3T8UA 4J9AA 3WA2X 3JUOA 3DXOA 4GB5A 1IT7A 1OH0A 3DGNA 3J7Yd 1OGXA 3FKAA 1WMPA 5KP1A 3I553 1M904 2E2VA 4H61A 4FCMA 5G2GA 2BMRB 3CCV3 2F86B 2OQEC 1E97A 1YGEA 3LTDA 2XFSA 1JKGB 1K9M4 3EHCA 3DGMA 4XM4A 4N6LA 1IV7A 4WFOA 1Q7Y4 1UUWB 2P38A 2KRTA 3EB8A 2I9WA 2INXA 1RJOA 1SJWA 2CIUA 4L7KA 1UUVB 3S27A 3ECFA 5AIHA 4KVHA 4CCVA 3S5CA 1EA2A 3CC73 1SPUA 4U13A 1W6GA 3AMOA 4WWUC 2QA43 4STDA 1OCVA 3HK4A 3B7CA 4AKYA 5ELJA 2P0XA 1UW1A 2GU1A 1VQK3 1LXEA 1KD14 1US1A 1GD4A 1CQSA 2JDIH 1FGOA 4KFEA 1BUQA 3GWRA 4N6NB 3GZXB 4XBTA 5CK6A 3EQQB 3ALAA 2CFLA 6STDA 1KSIA 1W2B2 4TX4A 4MEIA 1OHOA 1GY6A 4WYKB 1LOXA 4XB5A 1IVWA 3VGNA 1O7HB 1FGQA 4L8PA 3PCRA 3CCJ3 1ULJB 3DY5A 1GS3A 1JJ22 2Q07A 2IMJA 1QVG2 5IEPA 1W5ZA 4H3UA 3IPTA 1YHQ3 5IG0A 4N6TA 5DREA 1VQ73 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFJ B;  1WQL B;  3BLZ A;  2RFR A;  2Z76 A;  3MYT A;  3B4P A;  1Q40 A;  5JPU A;  1DMN A;  2K54 A;  1O7N B;  3A76 A;  1AR0 A;  2HMM B;  3OWU A;  1IDP A;  3G8Z A;  5DRV A;  5CF1 A;  5AEU B;  5STD A;  1QMA A;  1OUN A;  1OGZ A;  1O7P B;  5CXO A;  2OWP A;  3EX9 A;  4R9K A;  3I0Y A;  2HMN B;  3KE7 A;  2Z7A A;  3SOA A;  5IER A;  4K1U A;  2GEY A;  2XSO B;  1TP6 A;  1JB2 A;  4IIA A;  1O7W B;  1O7M B;  2BMQ B;  3EN8 A;  2UX0 A;  5HGR A;  1NWW A;  2HMK B;  2YFL B;  4HZB B;  3SED A;  1JKG A;  1OF5 B;  5FW5 A;  1E3R A;  3SOY A;  1W02 A;  3DUK A;  3T8N A;  2GBX B;  3OV4 A;  4L8O A;  1OPY A;  7STD A;  1DMM A;  5AII A;  3EBY A;  3K7C A;  4R1K A;  5D82 A;  3OWS A;  2A15 A;  5IEN A;  3NV0 B;  3OXA A;  2QGU A;  4WYK A;  1Z1S A;  2CHC A;  3NBR A;  3MKI A;  5BXQ A;  4HM6 B;  4X2H A;  1JN5 B;  3H3H A;  2XR8 B;  1JB4 A;  4HZ9 B;  1HKX A;  4OVM A;  3MSO A;  3B4O A;  5AIF A;  3D9R A;  8CHO A;  3JUP A;  3EC9 A;  1EG9 B;  1S5A A;  4LEH A;  2F99 A;  3BB9 A;  1K41 A;  3MG3 A;  3F8X A;  3JUM A;  4XDV A;  2XSH B;  1QJG A;  3JUN A;  5IF6 A;  3OWY A;  4CDL A;  2B1X B;  4Q53 A;  5IG4 A;  4LMI A;  4XBX A;  3KZT A;  5EVH A;  5IG5 A;  5CLK A;  3FSD A;  3WMD A;  4HM7 B;  4J8T A;  3CPO A;  2B24 B;  4HM8 B;  2BNG A;  2CKF B;  2RGQ A;  1ASK A;  3FLJ A;  3FH1 A;  3RGA A;  3DM8 A;  3FF2 A;  1Q42 A;  3G16 A;  4HKV B;  4RZM A;  1C7H A;  4HM1 B;  1OF5 A;  4LGQ A;  1E3V A;  3G0K A;  4HJL B;  4HVN A;  2YFI B;  3STD A;  3FZW A;  3MG1 A;  2STD A;  3HZP A;  4X2O A;  2PZV A;  5BVB A;  3E99 A;  3UJM A;  4N3V A;  3CU3 A;  2W2C A;  2Z77 A;  1NU3 A;  2HML B;  1W6Y A;  3NXJ A;  3NV0 A;  5IG3 A;  3NM2 A;  5AEW B;  3LYG A;  3KSP A;  5JPP A;  1GYB A;  4I4K A;  5D81 A;  4R9L A;  4HM2 B;  1JN5 A;  2QIY A;  4HM0 B;  3K0Z A;  1ULI B;  3FGY A;  1OHS A;  3LZA A;  3MG2 A;  1DMQ A;  1STD A;  3OX9 A;  4WP5 A;  4K1V A;  4XDW A;  3ROB A;  1GY7 A;  3EBT A;  3NHX A;  5KP3 A;  5D83 A;  1ZX2 A;  3RGR A;  1JB5 A;  3CNX A;  1VZZ A;  4MJD A;  3DMC A;  3FF0 A;  1NDO B;  5CF2 A;  5IEO A;  3F7X A;  3EF8 A;  5TGN A;  5AIG A;  3GZY B;  3F8H A;  2HMO B;  4FCJ A;  1TUH A;  1ZO2 A;  4XBY A;  1ISK A;  1A2K A;  5KP4 A;  2F98 A;  4HM3 B;  3Q90 A;  3GZB A;  3DZL A;  2BMO B;  3JUQ A;  1Q40 B;  3F9S A;  3F7S A;  3M8C A;  1U5O A;  3ER7 A;  3GRD A;  1W00 A;  2R4I A;  3CNM A;  3NUV A;  2GBW B;  3HX8 A;  3UNL A;  4HM5 B;  3EN1 B;  2JQ5 A;  3VSY A;  1OHP A;  2GEX A;  1GY5 A;  2HMJ B;  3GZR A;  2XRX B;  5AI1 A;  3KKG A;  4PEJ A;  3MHE A;  3B8L A;  1W01 A;  3EJV A;  1O7G B;  4OUQ A;  2RCD A;  2GXF A;  3F40 A;  3H51 A;  3F14 A;  4ORL A;  4HM4 B;  3T8U A;  4J9A A;  3JUO A;  3DXO A;  4GB5 A;  1OH0 A;  1OGX A;  3FKA A;  5KP1 A;  4FCM A;  5G2G A;  2BMR B;  2F86 B;  1E97 A;  1JKG B;  3EHC A;  4XM4 A;  1UUW B;  2I9W A;  2INX A;  1SJW A;  4L7K A;  1UUV B;  3ECF A;  5AIH A;  4KVH A;  3S5C A;  1EA2 A;  4U13 A;  4WWU C;  4STD A;  1OCV A;  3HK4 A;  3B7C A;  1CQS A;  1BUQ A;  3GWR A;  3GZX B;  4XBT A;  5CK6 A;  3EQQ B;  6STD A;  1OHO A;  1GY6 A;  4WYK B;  4XB5 A;  3VGN A;  1O7H B;  4L8P A;  1ULJ B;  1GS3 A;  2IMJ A;  5IEP A;  4H3U A;  3IPT A;  5IG0 A;  5DRE A; 
#chains in the Genus database with same CATH topology
 3NBB A;  2UGI A;  1WQL B;  2YFJ B;  3BLZ A;  3LT8 A;  4J5K A;  2RFR A;  2Z76 A;  3MYT A;  1I0X A;  3B4P A;  5A0O B;  1Q40 A;  5JPU A;  1DMN A;  2CC3 A;  2K54 A;  1O7N B;  3A76 A;  5EEO A;  2IUJ A;  1AR0 A;  2HMM B;  3SX1 A;  3CPW 2;  1GOY A;  1BOX A;  1TU5 A;  1YJ9 3;  3OWU A;  1IDP A;  1BRG A;  3G8Z A;  3WR2 A;  4DKI A;  5DRV A;  5CF1 A;  5AEU B;  3CCL 3;  1VQQ A;  5STD A;  2XF3 A;  2W9P A;  3TDG A;  1JZO A;  3LH4 A;  1QMA A;  3WA3 A;  1OGZ A;  1O7P B;  1OUN A;  5CXO A;  3WDG B;  3PGB A;  5JBS A;  4N6O B;  2L1S A;  2CFG A;  5FGO A;  2OWP A;  3WOE B;  4N6V 0;  4EV5 A;  3EX9 A;  1VQO 3;  4R9K A;  2XH9 A;  2W56 A;  3I0Y A;  2OTL 3;  2HMN B;  1MOL A;  3KE7 A;  3AHW A;  1SAR A;  4RNY A;  2Z7A A;  5LC7 A;  3SOA A;  5IER A;  4O2H A;  4K1U A;  3CCQ 3;  2GEY A;  1M1X B;  2XSO B;  1UDI I;  4HBR A;  3FG1 A;  2W0Q A;  2W9Q A;  1TP6 A;  1JB2 A;  4IIA A;  1O7W B;  1IVX A;  1UI7 A;  1O7M B;  2D42 A;  1FGM A;  4EV2 A;  2BMQ B;  1CYV A;  1IK3 A;  2XGL A;  1AY7 A;  1YNV X;  2BIR A;  3EN8 A;  4KFF A;  1W7C A;  2KAA A;  2KF5 A;  1RRL A;  2UX0 A;  4FMA A;  5HGR A;  5M18 A;  1NWW A;  2HMK B;  1BNF A;  1G96 A;  2YFL B;  2MF7 A;  1ZS7 A;  4HOH A;  2ML6 A;  4FCZ A;  4HZB B;  3X42 A;  2K3D A;  3K9M C;  3SED A;  3KFQ C;  4LZI A;  1U8C B;  1JKG A;  1OF5 B;  2D1W A;  1CYU A;  2CX0 A;  5FW5 A;  1A2P A;  2ML5 A;  1E3R A;  3SOY A;  2CWT A;  3N8B A;  1W02 A;  3DUK A;  1GMQ A;  2CW9 A;  5LC6 A;  3LTA A;  2QEX 3;  3T8N A;  2GBX B;  2BO9 B;  3OV4 A;  2E2T A;  1A67 A;  2ZDJ A;  3DH2 A;  1UI8 A;  4FR9 A;  1NO3 A;  1N5P A;  4L8O A;  1OPY A;  4GHO A;  1HYF A;  3G6E 3;  3LOY A;  4HAA A;  7STD A;  1RGH A;  1DMM A;  5AII A;  1RRH A;  1IU7 A;  1MWS A;  1YI2 3;  1W2Z A;  1N8Q A;  2OOV A;  3AGN A;  1NNV A;  3EBY A;  3K7C A;  4CPK A;  1X1U A;  4R1K A;  4WHA A;  5BU4 A;  1JBR A;  3CCU 3;  1WTH A;  3S28 A;  1GMP A;  4KZ1 A;  5D82 A;  1VQ9 3;  3OWS A;  1TRP A;  2A15 A;  4BTW A;  5IEN A;  4FMC A;  2K0M A;  3NV0 B;  2WOH A;  1G02 A;  3OXA A;  5BIR A;  1QVF 2;  2O9U X;  2QGU A;  4WYK A;  1DVD A;  2IUK A;  2W03 A;  1PU4 A;  3I56 3;  2AAD A;  1UCI A;  1Z1S A;  3MPH A;  3KSE D;  2CHC A;  1KQS 2;  1A2V A;  3CCE 3;  2C10 A;  3NBR A;  1I3I A;  1LOV A;  1RKY A;  5GSP A;  1D6Z A;  3NQY A;  1GD3 A;  3O8Y A;  3UL6 A;  3MKI A;  3QK9 A;  2UUG C;  1VQN 3;  5BXQ A;  2FNQ A;  1RGE A;  1RMS A;  2KXG A;  4HM6 B;  4X2H A;  1JN5 B;  2IYJ A;  3H3H A;  2LQV A;  2XR8 B;  1JB4 A;  1Q7H A;  1YJN 3;  3U97 A;  4HZ9 B;  1AV4 A;  4N6M A;  1F8N A;  4NHF A;  1MGR A;  1HKX A;  2KCD A;  1AVK A;  4OVM A;  3MSO A;  1T5Y A;  3B4O A;  3CMA 3;  3IJE B;  1RGC A;  5AIF A;  3D9R A;  2BHM A;  8CHO A;  3JUP A;  3EC9 A;  1EG9 B;  1S5A A;  3Q3F A;  3QRD A;  4LEH A;  3SYU A;  2F99 A;  3BB9 A;  4ILF A;  3CME 3;  4K61 A;  1K41 A;  2CFW A;  3Q2P A;  3MG3 A;  3F8X A;  3GAX A;  3DGO A;  1FUS A;  2CWU A;  3JUM A;  2XSH B;  4XDV A;  1QJG A;  1X1Y A;  4RBN A;  3JUN A;  1S72 3;  1RGG A;  5IF6 A;  3OWY A;  1LQM B;  1UGH I;  3LT9 A;  1GOU A;  4CDL A;  2B1X B;  1A90 A;  4Q53 A;  1YVS A;  1MWU A;  5IG4 A;  4LMI A;  3D79 A;  4XBX A;  1LQG C;  4NPB A;  1V57 A;  3KZT A;  3NBJ A;  5EVH A;  5CLK A;  5IG5 A;  1I0V A;  1LOW A;  3A5E A;  3HIG A;  3FSD A;  2CWV A;  7RNT A;  4ZM8 A;  1VQP 3;  1DYU A;  1VQ8 3;  2Y73 A;  1Q82 4;  3WMD A;  4HM7 B;  4HYZ A;  3ZG5 A;  1GSP A;  4JRF A;  2W04 A;  1D6Y A;  3AHS A;  4FMD A;  1RNT A;  1LRA A;  4BU4 A;  3HII A;  3KII A;  3URP A;  4J8T A;  3CPO A;  1B2U A;  2B24 B;  3BU4 A;  1VQ5 3;  4HM8 B;  2BNG A;  2CKF B;  6RNT A;  2RGQ A;  1ASK A;  1VQ6 3;  1FGT A;  1UGI A;  2ZL8 A;  3FLJ A;  2P0M A;  1SIH A;  3FH1 A;  3BNC A;  3RGA A;  1VQL 3;  3DM8 A;  3EE1 A;  3FF2 A;  4N6U A;  1Q42 A;  2ZHX B;  2H0I A;  3G16 A;  1N8R 4;  4R80 A;  1D6U A;  4HKV B;  3LTC A;  1DVC A;  1UCJ A;  4RZM A;  1C7H A;  5AYR B;  1FA3 A;  4HM1 B;  1IV9 A;  1OF5 A;  2LYX A;  2XEP A;  3BND A;  1BSB A;  4LGQ A;  6GSP A;  5AYS C;  1AQZ A;  1OAC A;  1E3V A;  2O3O A;  1VQ4 3;  3D3L A;  3G0K A;  4HJL B;  2WGQ A;  4HVN A;  1VQM 3;  2YFI B;  5M1A A;  3STD A;  2CFK A;  7GSP A;  3FZW A;  2CH9 A;  4EBG A;  3MG1 A;  2STD A;  8RNT A;  2RNT A;  2V1L A;  3HZP A;  1JRQ A;  4X2O A;  4JF8 A;  1V58 A;  1EUI C;  2PZV A;  4BIR A;  5BVB A;  4OK0 A;  1L5G B;  1I3F A;  2BU4 A;  2FXT A;  1BNJ A;  3E99 A;  1KC8 4;  1DE3 A;  1IVV A;  4GL6 A;  3UJM A;  4N3V A;  3CU3 A;  3FG4 A;  3WOF B;  2W2C A;  2Z77 A;  3N9H A;  1NU3 A;  1I70 A;  4G1M B;  4MMX B;  3X41 A;  1Q86 4;  1GOV A;  2HML B;  1IVU A;  1W6C A;  1WNH A;  4O3V A;  1BRS A;  4MMY B;  1BUJ A;  5M19 A;  1W6Y A;  1RN4 A;  3NXJ A;  2KF6 A;  3OW2 2;  1W4N A;  3NV0 A;  1RHL A;  2H0H A;  3PYJ A;  3CCS 3;  2SAR A;  1SQW A;  5IW9 A;  3LTB A;  4BTY A;  3PXM A;  4RNZ A;  1B2S A;  2P05 A;  3NM2 A;  5AEW B;  5IG3 A;  2GU3 A;  3T0U A;  1RN7 A;  4RNT A;  3N54 B;  3SXX A;  1N9J A;  1RSN A;  3NM7 A;  1BSC A;  1TRQ A;  3D5I A;  3LYG A;  1I2E A;  5EQL A;  3KSP A;  5JPP A;  1IQ8 A;  1RDS A;  1GYB A;  1BRK A;  4I4K A;  5D81 A;  3MWZ A;  4R9L A;  4HM2 B;  1B2Z A;  1JN5 A;  1TTO A;  1V74 A;  2QIY A;  3IMA B;  4HM0 B;  1RGK A;  3CCR 3;  1FW7 A;  4IT7 A;  3S67 A;  3K0Z A;  3ZFZ A;  1B21 A;  1JNQ A;  1B2X A;  3CC2 3;  1YIT 3;  1C54 A;  3K5T A;  3D4A A;  1PFP A;  4GSP A;  1ULI B;  1Y4K A;  2C11 A;  1OHS A;  3FGY A;  1M9G A;  3LZA A;  3MG2 A;  1CEW I;  2WO0 A;  3RNT A;  1M1K 4;  4KFD A;  3VF1 A;  4BL3 A;  3X3X A;  1DMQ A;  3V99 A;  1IQY A;  1NB3 I;  1X1W A;  1STD A;  3OX9 A;  3NX0 A;  4NRE A;  4WP5 A;  1N5H A;  1RGL A;  1MWR A;  5G1L A;  4K1V A;  1BNI A;  4XDW A;  3PZW A;  3ROB A;  1UCK A;  1JBT A;  2PNC A;  1GY7 A;  3EBT A;  3NHX A;  2FGT A;  1CH0 A;  1QAF A;  1N9E A;  3K63 A;  3KN4 A;  5KP3 A;  1BSD A;  2AAE A;  1BSE A;  4EYC A;  2CX1 A;  3DGL A;  1YIJ 3;  5D83 A;  1YJW 3;  1ROA A;  1ZX2 A;  1BVI A;  3RGR A;  4LYL B;  1JB5 A;  2OTJ 3;  1B20 A;  1IQX A;  3CNX A;  1VZZ A;  3WOD G;  1HU9 A;  1T2I A;  4MJD A;  1WMO A;  3FG3 A;  2WGO A;  3DMC A;  1BIR A;  2MC8 A;  2E2U A;  3UL5 A;  4FMB A;  1STF I;  1BSA A;  3FF0 A;  1MNL A;  1NDO B;  4MMZ B;  3AMO B;  5CF2 A;  3X3Z A;  1YVB I;  5IEO A;  1I2G A;  2XGN A;  1NB5 I;  3CXC 2;  1Q9E A;  3EF8 A;  3F7X A;  2KF3 A;  5TGN A;  2C4B A;  1X1X A;  3S29 A;  3HI7 A;  5AIG A;  1TIJ A;  9RNT A;  3V92 A;  1JBS A;  3GZY B;  3X3Y A;  3F8H A;  2HMO B;  4FCJ A;  2WOF A;  1FGR A;  1BRJ A;  1TUH A;  1LNH A;  1J2B A;  1RN1 A;  2CG0 A;  5HOH A;  1SII A;  1IT8 A;  1ZO2 A;  2F4Y A;  3AGO A;  4I5Q A;  1I2F A;  4EC6 A;  4XBY A;  2IA7 A;  1EQK A;  4K90 B;  1RTU A;  2OQE A;  1ISK A;  2XFT A;  2YX9 A;  3RDE A;  2IY2 A;  3NQZ A;  1A2K A;  2W6J H;  5KP4 A;  1PYL A;  1QAL A;  1ZGX A;  2F98 A;  2OOV C;  4HM3 B;  4IPB A;  5ELU A;  1K8A 4;  3U1W A;  3PS8 A;  4O8S A;  3JVC A;  3BIR A;  1BAN A;  3Q90 A;  3CD6 3;  1HZ1 A;  3GZB A;  1B27 A;  3CCM 3;  3LXU X;  1LNI A;  2Z6B A;  3DZL A;  3DGY A;  4AKZ A;  2BMO B;  1JZD A;  2RSX A;  3JUQ A;  1RGA A;  1Q81 4;  3FCS B;  4LSO A;  1Q40 B;  3SVA A;  3F9S A;  3UB1 A;  3F7S A;  1LVN A;  3Q1C A;  1GMR A;  3WHO A;  1BNG A;  3M8C A;  1RCK A;  1U5O A;  3ER7 A;  1AVL A;  3GRD A;  1JV2 B;  1W00 A;  2M7O A;  2R4I A;  3CNM A;  3GSP A;  3NUV A;  4R4K A;  2SBL A;  3PCS A;  4CJN A;  2HOH A;  2GBW B;  1WMN A;  1G0T A;  3HX8 A;  1EKM A;  4AEQ A;  1MWT A;  3BNB A;  3L0R A;  5G1K A;  1TFK A;  3ZG0 A;  2CK3 H;  3UNL A;  1NJI 4;  2KF4 A;  3BNE A;  2CFD A;  1RCL A;  1K73 4;  2L4V A;  1FUW A;  1K28 A;  1R4C A;  2Y74 A;  2BT3 A;  1YGW A;  4J5G A;  4HM5 B;  3EN1 B;  2JQ5 A;  3VSY A;  1OHP A;  2W56 B;  2GEX A;  3LML A;  1BU4 A;  1GY5 A;  2RBI A;  1UCL A;  2HMJ B;  3GZR A;  1BAO A;  1BGS A;  2J8X B;  2XRX B;  4BTX A;  1TFO A;  1FUT A;  1QAK A;  5AI1 A;  3KKG A;  4O02 B;  4PEJ A;  2CG1 A;  3X40 A;  3MHE A;  3B8L A;  1W01 A;  3EJV A;  1O7G B;  4OUQ A;  2P09 A;  2RCD A;  4QWT A;  4EXR A;  3CC4 3;  1KWI A;  2GXF A;  3G4S 3;  3V98 A;  3F40 A;  3G71 3;  3H51 A;  2OCT A;  1ROV A;  5I97 A;  3F14 A;  4ORL A;  4EW5 A;  5RNT A;  4HM4 B;  3T8U A;  4J9A A;  3WA2 X;  2F5W A;  2F56 A;  3JUO A;  3DXO A;  4GB5 A;  1IT7 A;  1OH0 A;  3DGN A;  3J7Y d;  1OGX A;  3FKA A;  1WMP A;  5KP1 A;  3I55 3;  1I8V A;  1M90 4;  2E2V A;  4H61 A;  4FCM A;  5G2G A;  4BL2 A;  2BMR B;  3CCV 3;  2F86 B;  2OQE C;  1E97 A;  1YGE A;  3LTD A;  1R4Y A;  2XFS A;  1JKG B;  1K9M 4;  3EHC A;  3DGM A;  4XM4 A;  4N6L A;  1IV7 A;  4WFO A;  1Q7Y 4;  1UUW B;  2P38 A;  2ZA4 A;  2KRT A;  3EB8 A;  2I9W A;  2INX A;  1UUG B;  1RJO A;  1DET A;  1SJW A;  2CIU A;  1UUV B;  4L7K A;  3ECF A;  5AIH A;  4KVH A;  3S27 A;  4CCV A;  3S5C A;  1EA2 A;  3CC7 3;  1SPU A;  4U13 A;  1W6G A;  3AMO A;  4WWU C;  2QA4 3;  4STD A;  1OCV A;  3HK4 A;  3B7C A;  4AKY A;  5ELJ A;  1UW1 A;  2GU1 A;  2P0X A;  1VQK 3;  1LXE A;  1RLS A;  4KT3 B;  1KD1 4;  1US1 A;  1GD4 A;  1CQS A;  1RGF A;  2JDI H;  1FGO A;  1LOY A;  4KFE A;  1BUQ A;  3GWR A;  4N6N B;  1BRI A;  1T3B A;  1PY3 A;  3GZX B;  4XBT A;  5CK6 A;  1IYY A;  3EQQ B;  3ALA A;  2CFL A;  2H0G A;  2GSP A;  3KCH A;  6STD A;  1KSI A;  1B2M A;  2R41 A;  3HOH A;  1W2B 2;  4TX4 A;  4MEI A;  1OHO A;  1GY6 A;  4WYK B;  1FZU A;  1LOX A;  3D5G A;  4XB5 A;  1IVW A;  1TJD A;  2F5M A;  1FYS A;  1O7H B;  3VGN A;  1BNR A;  1BRH A;  1FGQ A;  4L8P A;  1RNB A;  3PCR A;  3CCJ 3;  1ULJ B;  1EEJ A;  1GS3 A;  3DY5 A;  1JJ2 2;  2Q07 A;  1BRN L;  1BNE A;  2IMJ A;  5IEP A;  1B3S A;  1QVG 2;  1W5Z A;  1T2H A;  4H3U A;  3IPT A;  1BNS A;  1YHQ 3;  5IG0 A;  4N6T A;  5DRE A;  1VQ7 3;  3SLU A;  1MGW A; 
#chains in the Genus database with same CATH homology
 3NBB A;  2YFJ B;  1WQL B;  3LT8 A;  3BLZ A;  2RFR A;  2Z76 A;  3MYT A;  5A0O B;  3B4P A;  1Q40 A;  5JPU A;  1DMN A;  2CC3 A;  2K54 A;  1O7N B;  3A76 A;  5EEO A;  2IUJ A;  1AR0 A;  2HMM B;  3SX1 A;  3CPW 2;  1TU5 A;  1YJ9 3;  3OWU A;  1IDP A;  3G8Z A;  5DRV A;  5CF1 A;  5AEU B;  3CCL 3;  5STD A;  2XF3 A;  2W9P A;  3TDG A;  3LH4 A;  1QMA A;  3WA3 A;  1OGZ A;  1O7P B;  1OUN A;  5CXO A;  3WDG B;  3PGB A;  5JBS A;  4N6O B;  2CFG A;  5FGO A;  2OWP A;  3WOE B;  4N6V 0;  4EV5 A;  3EX9 A;  1VQO 3;  4R9K A;  2XH9 A;  2W56 A;  3I0Y A;  2HMN B;  1MOL A;  3KE7 A;  4RNY A;  2Z7A A;  5LC7 A;  3SOA A;  5IER A;  4O2H A;  4K1U A;  3CCQ 3;  2GEY A;  1M1X B;  2XSO B;  4HBR A;  3FG1 A;  2W0Q A;  2W9Q A;  1TP6 A;  1JB2 A;  4IIA A;  1O7W B;  1IVX A;  1UI7 A;  1O7M B;  2D42 A;  1FGM A;  4EV2 A;  2BMQ B;  1CYV A;  1IK3 A;  2XGL A;  4KFF A;  3EN8 A;  1W7C A;  1RRL A;  2UX0 A;  4FMA A;  5HGR A;  1NWW A;  2HMK B;  1G96 A;  2YFL B;  2MF7 A;  2ML6 A;  4FCZ A;  4HZB B;  3X42 A;  3K9M C;  3SED A;  3KFQ C;  4LZI A;  1U8C B;  1JKG A;  1OF5 B;  2D1W A;  1CYU A;  5FW5 A;  2ML5 A;  1E3R A;  3SOY A;  2CWT A;  3N8B A;  1W02 A;  3DUK A;  2CW9 A;  5LC6 A;  3LTA A;  2QEX 3;  3T8N A;  2GBX B;  2BO9 B;  3OV4 A;  2E2T A;  1A67 A;  2ZDJ A;  1UI8 A;  4FR9 A;  1NO3 A;  1N5P A;  4L8O A;  1OPY A;  3G6E 3;  3LOY A;  7STD A;  1DMM A;  5AII A;  1RRH A;  1IU7 A;  1YI2 3;  1W2Z A;  1N8Q A;  2OOV A;  3EBY A;  3K7C A;  4R1K A;  4WHA A;  3CCU 3;  1WTH A;  3S28 A;  4KZ1 A;  5D82 A;  1VQ9 3;  3OWS A;  4BTW A;  2A15 A;  5IEN A;  4FMC A;  2K0M A;  3NV0 B;  2WOH A;  3OXA A;  1QVF 2;  2O9U X;  2QGU A;  4WYK A;  1DVD A;  2IUK A;  2W03 A;  1PU4 A;  3I56 3;  1Z1S A;  3MPH A;  3KSE D;  2CHC A;  1KQS 2;  1A2V A;  3CCE 3;  2C10 A;  3NBR A;  1RKY A;  1D6Z A;  3NQY A;  1GD3 A;  3O8Y A;  3UL6 A;  3MKI A;  3QK9 A;  1VQN 3;  5BXQ A;  2FNQ A;  2KXG A;  4HM6 B;  4X2H A;  1JN5 B;  3H3H A;  2LQV A;  2XR8 B;  1JB4 A;  1YJN 3;  3U97 A;  4HZ9 B;  1AV4 A;  4N6M A;  1F8N A;  4NHF A;  1HKX A;  2KCD A;  1AVK A;  4OVM A;  3MSO A;  1T5Y A;  3B4O A;  3CMA 3;  3IJE B;  5AIF A;  3D9R A;  2BHM A;  8CHO A;  3JUP A;  3EC9 A;  1EG9 B;  1S5A A;  3QRD A;  4LEH A;  2F99 A;  3BB9 A;  3CME 3;  4K61 A;  1K41 A;  2CFW A;  3Q2P A;  3MG3 A;  3F8X A;  3GAX A;  3DGO A;  3JUM A;  2CWU A;  4XDV A;  2XSH B;  1QJG A;  4RBN A;  3JUN A;  1S72 3;  5IF6 A;  3OWY A;  3LT9 A;  4CDL A;  2B1X B;  1A90 A;  4Q53 A;  5IG4 A;  4LMI A;  4XBX A;  3KZT A;  3NBJ A;  5EVH A;  5CLK A;  5IG5 A;  3HIG A;  3FSD A;  2CWV A;  1VQP 3;  4ZM8 A;  1VQ8 3;  1DYU A;  2Y73 A;  1Q82 4;  3WMD A;  4HM7 B;  4HYZ A;  4JRF A;  2W04 A;  1D6Y A;  4FMD A;  3HII A;  3KII A;  4J8T A;  3CPO A;  2B24 B;  1VQ5 3;  4HM8 B;  2BNG A;  2CKF B;  2RGQ A;  1ASK A;  1VQ6 3;  1FGT A;  2ZL8 A;  3FLJ A;  2P0M A;  1SIH A;  3FH1 A;  3BNC A;  3RGA A;  1VQL 3;  3DM8 A;  3EE1 A;  3FF2 A;  4N6U A;  1Q42 A;  3G16 A;  1N8R 4;  4R80 A;  1D6U A;  4HKV B;  3LTC A;  1DVC A;  4RZM A;  5AYR B;  1C7H A;  1FA3 A;  4HM1 B;  1IV9 A;  1OF5 A;  2LYX A;  2XEP A;  3BND A;  2OTL 3;  4LGQ A;  5AYS C;  1OAC A;  1E3V A;  2O3O A;  1VQ4 3;  3D3L A;  3G0K A;  4HJL B;  2WGQ A;  4HVN A;  1VQM 3;  2YFI B;  3STD A;  2CFK A;  3FZW A;  2CH9 A;  4EBG A;  3MG1 A;  2STD A;  2V1L A;  3HZP A;  1JRQ A;  4X2O A;  4JF8 A;  2PZV A;  5BVB A;  4OK0 A;  1L5G B;  2FXT A;  3E99 A;  1KC8 4;  1IVV A;  4GL6 A;  3UJM A;  4N3V A;  3CU3 A;  3FG4 A;  3WOF B;  2W2C A;  2Z77 A;  3N9H A;  1NU3 A;  4G1M B;  4MMX B;  3X41 A;  1Q86 4;  2HML B;  1IVU A;  1W6C A;  1WNH A;  4O3V A;  4MMY B;  1W6Y A;  3NXJ A;  3OW2 2;  1W4N A;  3NV0 A;  3PYJ A;  3CCS 3;  1SQW A;  5IW9 A;  3LTB A;  4BTY A;  3PXM A;  4RNZ A;  2P05 A;  3NM2 A;  5AEW B;  5IG3 A;  2GU3 A;  3T0U A;  1RN7 A;  3N54 B;  3SXX A;  1N9J A;  3NM7 A;  3LYG A;  5EQL A;  3KSP A;  5JPP A;  1IQ8 A;  1GYB A;  4I4K A;  5D81 A;  3MWZ A;  4R9L A;  4HM2 B;  1JN5 A;  2QIY A;  1V74 A;  4HM0 B;  3IMA B;  3CCR 3;  4IT7 A;  3S67 A;  3K0Z A;  1JNQ A;  3CC2 3;  1YIT 3;  3K5T A;  1PFP A;  1ULI B;  1Y4K A;  2C11 A;  1OHS A;  3FGY A;  1M9G A;  3LZA A;  3MG2 A;  1CEW I;  2WO0 A;  1M1K 4;  4KFD A;  3VF1 A;  3X3X A;  1DMQ A;  3V99 A;  1IQY A;  1NB3 I;  1STD A;  3OX9 A;  3NX0 A;  4NRE A;  4WP5 A;  1N5H A;  1Q81 4;  4K1V A;  4XDW A;  3PZW A;  3ROB A;  2PNC A;  1GY7 A;  3EBT A;  3NHX A;  2FGT A;  3KN4 A;  1QAF A;  1N9E A;  3K63 A;  5KP3 A;  1YIJ 3;  4EYC A;  3DGL A;  5D83 A;  1YJW 3;  1ROA A;  1ZX2 A;  3RGR A;  1JB5 A;  2OTJ 3;  1IQX A;  3CNX A;  1VZZ A;  3WOD G;  1HU9 A;  4MJD A;  1WMO A;  3FG3 A;  2WGO A;  3DMC A;  2MC8 A;  2E2U A;  3UL5 A;  4FMB A;  1STF I;  3FF0 A;  1MNL A;  1NDO B;  4MMZ B;  3AMO B;  5CF2 A;  3X3Z A;  1YVB I;  5IEO A;  2XGN A;  1NB5 I;  3CXC 2;  3F7X A;  3EF8 A;  5TGN A;  3S29 A;  3HI7 A;  5AIG A;  1TIJ A;  3V92 A;  3GZY B;  3X3Y A;  3F8H A;  2HMO B;  4FCJ A;  2WOF A;  1FGR A;  1TUH A;  1LNH A;  1J2B A;  2CG0 A;  1SII A;  1IT8 A;  1ZO2 A;  4EC6 A;  4XBY A;  2IA7 A;  1EQK A;  4K90 B;  2OQE A;  1ISK A;  2XFT A;  2YX9 A;  3RDE A;  3NQZ A;  1A2K A;  2W6J H;  5KP4 A;  1QAL A;  2OOV C;  2F98 A;  4HM3 B;  4IPB A;  5ELU A;  1K8A 4;  3U1W A;  3PS8 A;  4O8S A;  3JVC A;  3Q90 A;  3CD6 3;  3GZB A;  3CCM 3;  3LXU X;  2Z6B A;  3DZL A;  4AKZ A;  2BMO B;  2RSX A;  3JUQ A;  3FCS B;  4LSO A;  1Q40 B;  3SVA A;  3F9S A;  3UB1 A;  3F7S A;  1LVN A;  3Q1C A;  3M8C A;  1U5O A;  3ER7 A;  1AVL A;  3GRD A;  1JV2 B;  1W00 A;  2M7O A;  2R4I A;  3CNM A;  3NUV A;  4R4K A;  2SBL A;  3PCS A;  2GBW B;  1WMN A;  4AEQ A;  3HX8 A;  1EKM A;  3BNB A;  3L0R A;  1TFK A;  2CK3 H;  3UNL A;  1NJI 4;  3BNE A;  2CFD A;  1K73 4;  1FUW A;  2L4V A;  1K28 A;  1R4C A;  2Y74 A;  2BT3 A;  4HM5 B;  3EN1 B;  2JQ5 A;  3VSY A;  1OHP A;  2W56 B;  2GEX A;  3LML A;  1GY5 A;  2HMJ B;  3GZR A;  2XRX B;  4BTX A;  1TFO A;  1QAK A;  5AI1 A;  3KKG A;  4O02 B;  4PEJ A;  2CG1 A;  3X40 A;  3MHE A;  3B8L A;  1W01 A;  3EJV A;  1O7G B;  4OUQ A;  2P09 A;  2RCD A;  4QWT A;  4EXR A;  3CC4 3;  1KWI A;  2GXF A;  3G4S 3;  3V98 A;  3F40 A;  3G71 3;  3H51 A;  2OCT A;  1ROV A;  5I97 A;  3F14 A;  4ORL A;  4HM4 B;  3T8U A;  4J9A A;  3WA2 X;  3JUO A;  3DXO A;  4GB5 A;  1IT7 A;  1OH0 A;  3DGN A;  3J7Y d;  1OGX A;  3FKA A;  1WMP A;  5KP1 A;  3I55 3;  1M90 4;  2E2V A;  4H61 A;  4FCM A;  5G2G A;  2BMR B;  3CCV 3;  2F86 B;  2OQE C;  1E97 A;  1YGE A;  3LTD A;  2XFS A;  1JKG B;  1K9M 4;  3EHC A;  3DGM A;  4XM4 A;  4N6L A;  1IV7 A;  4WFO A;  1Q7Y 4;  1UUW B;  2P38 A;  2KRT A;  3EB8 A;  2I9W A;  2INX A;  1RJO A;  1SJW A;  2CIU A;  4L7K A;  1UUV B;  3S27 A;  3ECF A;  5AIH A;  4KVH A;  4CCV A;  3S5C A;  1EA2 A;  3CC7 3;  1SPU A;  4U13 A;  1W6G A;  3AMO A;  4WWU C;  2QA4 3;  4STD A;  1OCV A;  3HK4 A;  3B7C A;  4AKY A;  5ELJ A;  2P0X A;  1UW1 A;  2GU1 A;  1VQK 3;  1LXE A;  1KD1 4;  1US1 A;  1GD4 A;  1CQS A;  2JDI H;  1FGO A;  4KFE A;  1BUQ A;  3GWR A;  4N6N B;  3GZX B;  4XBT A;  5CK6 A;  3EQQ B;  3ALA A;  2CFL A;  6STD A;  1KSI A;  1W2B 2;  4TX4 A;  4MEI A;  1OHO A;  1GY6 A;  4WYK B;  1LOX A;  4XB5 A;  1IVW A;  3VGN A;  1O7H B;  1FGQ A;  4L8P A;  3PCR A;  3CCJ 3;  1ULJ B;  3DY5 A;  1GS3 A;  1JJ2 2;  2Q07 A;  2IMJ A;  1QVG 2;  5IEP A;  1W5Z A;  4H3U A;  3IPT A;  1YHQ 3;  5IG0 A;  4N6T A;  5DRE A;  1VQ7 3;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...