2CHDA

Crystal structure of the c2a domain of rabphilin-3a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
TLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords RABPHILIN-3A
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2chdA00
4EZLA 3T8MA 5CCHE 2CHWA 4TV3A 4WAFA 3R7QA 4F92B 3RDJA 1RSYA 2K45A 3OAWA 3QK0A 4PS3A 4WWNA 4GB9A 3QR0A 3NZSA 4ANXA 1DJIA 3R7RA 4EZJA 1CJYA 3MJWA 3PFQA 4AJWA 2WXKA 3L54A 2N1TE 1DJYA 4G11A 4L1LA 2RD0A 3L13A 4V11A 4QJ5B 2WXRA 2WXQA 4XX5A 4F93B 2ENQA 3QARA 3JZYA 4OVUA 3KWTA 2JQZA 2YOAA 1TJXA 3PRZA 3ZVVA 4BGDA 3RPBA 2WXPA 3ENEA 1HE8A 2YRBA 4DK5A 3N5AA 4JPSA 3ML8A 3B7YA 3FDWA 3PYCA 2Z0UA 3APCA 3PREA 4Y1SA 2DMGA 2K8MA 1E8WA 4TUUA 1E8XA 3ZW3A 1WFJA 2WXLA 4LDCA 2Q0ZX 1K5WA 2X38A 2LHAA 4AOFA 4ICXA 1RLWA 2WXMA 4URKA 4BFRA 1TJMA 4L23A 5H4YA 2CM6A 2NQ3A 1QATA 3ZIMA 5H4ZA 4WWOA 4FA6A 1YRKA 5CCJA 2Q3XA 3IBEA 2WXJA 3L4CA 4MJJA 2NCEA 2ZKMX 4QJ3B 1UOWA 5EDSA 4IHBA 2UZPA 4IQHA 2KI6A 3APDA 3HN8A 1E8ZA 4LCVA 3HIZA 4J6IA 3QR1A 4NP9A 4FHJA 1W15A 2ENPA 4WWPA 2A4ZA 4PS8A 3ML9A 1E90A 2V4LA 2Y3AA 3F05A 1DJWA 1DQVA 4HVBA 2BWQA 1UOVA 2DMHA 2B3RA 2A5UA 2QZQA 1E7UA 3TJPA 3APFA 2ISDA 3PS6A 3SD5A 4ICWA 5JHBA 2NSQA 4A55A 4WEEA 5G2NA 3HHMA 4FJYA 4DNLA 2WXOA 1DJZA 4TS6A 4FULA 2EP6A 1BYNA 4ANUA 4XZ4A 2D8KA 2K4AA 2WXGA 3GPEA 4F91B 4LT7A 4KITB 3DBSA 3L17A 2ENJA 5G55A 5KJ7E 4Y1TA 1DJXA 4KZ0A 3IM1A 1DJHA 2CHXA 3NSJA 3L08A 2CHZA 1RH8A 3M7FB 4NPJA 4NPKA 5T8IA 3FBKA 2QZ5A 3NZUA 4F1SA 2WXHA 3F04A 2FJUB 4QAMB 3W57A 3DPDA 1W16A 2CJTA 5JHAA 1GMIA 3CSTA 2CHDA 3P2BA 4HLEA 1DJGA 3F00A 2FK9A 3F01A 4QJ4B 2WXFA 1E8YA 4FLHA 2CJSA 4FJZA 1WFMA 4NS0A 1DSYA 5CCGE 3TWYA 2WXIA 1BDYA 3QJZA 3CSFA 4FHKA 4OVVA 3L9BA 2CM5A 4PS7A 4ANVA 3S2AA 1UGKA 3W56A 4EZKA 2R83A 3L16A 4FADA 4XE0A 1E7VA 1BCIA 4L2YA 4L1BA 1V27A 2WXNA 3OHMB 3TL5A 4KZCA 2K3HA 1A25A 4ANWA 3QAQA 1QASA 3KWUA 3LJ3A 4GNKB
chains in the Genus database with same CATH superfamily
2WVTA 4WV1A 3GRBA 2NXZD 3G6DL 3MV7A 5BZDA 3QFJB 5IHBA 1KTLA 1XT5A 3P69A 4ZAKB 4DP7X 1CI5A 4FNRA 2WOYA 5AW8B 5IEKB 3IJYB 3MHZA 1KXQE 3BSZL 5DD6A 1RZKL 4PJ7E 2BSCA 2K6YA 4FQPA 4NKMA 4FTDA 2WXPA 4PJFB 4NQCE 4OJAA 3V5KA 5SX5K 4DFIA 4BUQA 5DJZB 1S3KL 5JIIA 1QG3A 4HP5A 3WKYA 4KI5F 2XY1A 3APCA 4FG6D 2EDWA 4OCWH 4I3SH 3ZPDA 4GFXA 5KJRH 3OC8A 3T2PA 3CFTA 5KEZA 4Y2LA 3LRLA 3QO0B 3KCPA 4U4IA 1WUZA 2Z64C 3QIBA 3JQOB 4IRJA 1CGVA 2CO3A 2XZCH 2GITA 4TF4A 1MFAH 2FQFA 4QXWA 1UACL 5CU9A 5AG8A 4KJWD 3C60D 4FJ6A 3SKOB 4ONFH 3J2PA 4A38A 3UADA 1ZWIA 1AGDB 4QRTB 2EIZB 3OB0K 2KZKA 6CGTA 3IDNA 5EDSA 2F08A 5LG1A 2C9VA 4L3ED 1EXHA 5DS2A 2JTYA 3GS7A 4NDMB 3LQZA 5E2WL 3L8QA 4H25B 2YEZB 4YDLC 2ZCHL 4B97A 2I9TB 3DMMD 4YDMA 1B2YA 4LCIL 4YDLB 4NGHL 4HUCA 4WCYL 1B9KA 4AG4H 2J88L 1CXIA 4X98A 3RY6A 2BNQB 4MRCA 5ESVB 4KK8D 3STZA 2P44B 2VQ1B 4M9OA 1KCRL 5IMLA 3VXTA 5IJDC 2EC9U 3WJLA 3CLEL 1EAPB 2O6PA 1AS6A 1E5UI 3UCRA 1VADB 1BQLH 4KV5F 4YHKH 2DMCA 3IWUA 3M7FB 3BQUD 3DXAD 4XNDA 4Z6AT 4HBQA 4Z76A 1M7XA 3FONB 1CXKA 2HT3D 3DUSA 3AWFA 4PGEA 3FTVA 3U7WH 1MHCA 5D2NB 3B9VA 5H94A 1NEZB 2OMZA 3K46A 4JFTA 3HVDA 2J1XA 3A67L 5E23A 1DUYB 3QI9B 1XGZA 2I24N 2GK0B 2K4WA 5SV3A 1T1ZA 2DJMA 5CP7A 4J3OD 3OHMB 4JRXD 5T1KB 3C8KA 2NLJB 3CPUA 1TYRA 5D7IF 2ZG2A 3ARFD 1OQXA 4JO1L 5EBMB 4ETQA 5ECGA 1IAIL 4M6OL 4GSUA 1N68A 3VTTA 1EPFA 2ICWB 4UAOB 5BRZA 3INUH 1G6RB 2F54D 4BK4A 3QJQB 2XOTA 4RQQA 1X7TA 1JE6A 4FXLA 3X11A 5FHBL 3UL4A 1MCLA 4LEBA 5IFAH 5I26A 4PUBL 3AZUA 2X4PB 3MLXL 3VD5A 3DJ9A 5MEQA 1EO5A 5ISZA 4CVXB 4Y4FA 4XB8A 2UY6A 4UZGA 3O0RL 1TTCA 1ZPUA 1EJOL 3BWZA 5EEYA 1IEAA 2HJLB 4YSPA 1OHQA 1RZ7L 2BJML 4U6VH 1KPUA 5KTEH 4GEJA 1G7MB 3OGCB 5L7XL 3IDNB 3QXAA 3TZVB 3WY3A 1ZXQA 1J1OL 2O6FA 4DKFL 4N2HA 2AITA 2GW5A 4H25A 2XTJE 4M7LT 3RG1C 2CIKB 5GSVA 1R3LA 4OKVA 2VC2H 1RD6A 1CIDA 1NEZG 3ZE0B 2YD2A 3HMXA 4N0YL 3QYNA 5JHDD 4M1DH 2FSEB 5CEZL 2WLLA 5EEXA 4U6XB 4U1IA 3RX7A 3QUXD 4HHWA 1MCIA 2V2TA 4K7FA 1X5XA 1FNSL 5E6ZA 1Q8MA 3PP4H 5SWSE 1WCBB 4QRFA 1Y18B 3RTQC 1SFDA 2GBUA 4LNRB 3ARSA 5MP6H 3O2WH 5J6GA 4DVRH 3G5ZA 4LSSH 3PXLA 4UV4L 4GQ9H 3M45A 1KJ2A 4GY4A 3VFNB 3FB7A 5ENWA 4R7LA 5H94B 3N40P 2JMRA 3I74A 2AQSA 1JD7A 4KHXH 4N2OA 3ZLQC 5AYUL 2YD4A 4NQEB 3ZKQD 3WNLA 2MQ3A 3LS4H 1IFHH 4XVSL 2NSXA 5EWIH 2LOEA 3PWLB 1DJGA 3MBWB 1HS6A 3DJTA 2EEFA 1DVFD 2ZSVA 1CICC 3ZJAA 4PV9A 3JVFC 4OBSA 1F6AA 3MV8B 4YR6B 4PPTA 1HNFA 5JMRA 5AVYB 1VLXA 4WEUD 2HFGH 4M61A 4UI2A 3ESPA 4FN0A 5DA4A 2WQ8A 3V7MA 1QASA 3FOMB 4WK0B 3RA7H 2IXQA 4RDBA 2B8OT 1G87A 4ZMAT 4UTBA 1QLFA 2XWCA 4TVPE 3HMWL 5KVGE 3TPUA 4UOJA 4JLRA 2VC2B 5C0CE 3QYCA 4G80A 2BXZA 4PB9H 5CGMA 3T77B 1ACZA 2XQBH 1FL5B 3BP6A 1R5WA 3KGRA 3SQBA 2HFGL 3LRSA 4AGLA 4XMLL 2N7AA 2PP7A 1BX2A 2JTDA 3P3TA 3P3YA 5I8EA 5I1EL 1LDPL 3L5JA 4UOW0 4RFEA 4N2MA 3I6SA 3SKOA 2OTWB 4LSUH 4BGLA 1NMBH 1BVZA 1U8KB 5CEZD 1QI3A 3BAJA 1K5WA 5CMAB 3EJCA 4QKTA 2A6JB 3H53A 3QWRD 3P9WB 2Q7YB 1CUOA 4X4YA 5KS9E 3NEOA 2Q6WB 3VCLB 3DETC 4X9BA 4OAWB 3WIHL 1UFUA 3MRHB 3L3JB 5FAAA 3DJSA 4EQ3A 4MBRA 1HILB 1OGAD 4R90H 1L6XA 1JNNL 2J25A 1EHKB 4G6JH 3RAJL 3FB8A 3GMQB 3IGAA 1F13A 4NHUB 1JZJA 3KPLA 4PI2A 3N44B 3V6FB 1XH1A 1S2EA 2WYHA 4PP2A 2BIHA 5HHQA 3WEBA 4WWPA 4NJ9H 3RFRA 3BKCH 4RBPK 5FUCE 4O5LL 4RRPA 5FR3A 2BVOB 3MNMA 4KQ4L 2DJSA 5BS0D 3UPRA 1P7BA 4U1MA 3VGDA 1RK1B 5IZ7A 2BK8A 2BMKB 4ZK8A 1BF8A 3V6OA 1I1AC 4HT1H 2HN7A 4J3OG 2CGRH 1P84J 2PR4H 4HZLA 2NXYD 5T1LB 4AQ1C 2JJTC 5FECA 2OKMA 4U3HA 1EUUA 4X7DC 3ULVC 1IVTA 2F8VA 3F7YA 2X4QB 3V7AE 4ANUA 5J56B 2WZ0A 1KYOK 1F11B 3DBSA 3RVTD 3HAEB 2AEQH 1A9BA 3PFUA 2QQKL 2WO2B 1JGVL 2WGXA 3D05A 4LCYB 4FFVD 4N0UA 4P46A 4R2GD 5TF0A 4KFMA 1OCWL 3RWJB 3VXTB 4I1RA 4K5NA 3WD5L 4DKFH 1UJ3B 1JGDB 1ANUA 4ZMWA 4Z78A 3L3KB 3RWFA 3EOAA 1X5MA 5IMKA 5BVJB 4GRLD 5AKTA 1NJ9B 2V37A 4L3AA 4WGWB 2NUPA 4PS4H 1QSVA 3QFJE 3NRFA 5IM7B 1SOQA 4K71C 1WFMA 2C9QA 1QBLL 1UGNA 3THMH 3WO4C 4PRIA 1OAJA 3S35X 5IHLB 2OMYB 2PCFB 3P0YH 1E4WH 2AJYL 2LTQB 1GGCL 4MJHA 4XPAL 25C8L 1OZUA 3NGBC 5BVPL 2V7NB 4NZUL 1O7DE 3MXVL 4U1HB 3US0A 2CZNA 1U30A 2Y3NA 3OV6A 5CSZA 2NPLX 3EOTH 5DJDA 4BFNA 4R8WH 3DX1A 3QS2A 3CXFA 2F0CA 4JEGB 4TQEL 1R3HA 3NJKA 1KY6A 4FX5A 1NGQH 4YBLB 5E9DB 5IR1A 3RFZA 3ZQ9A 2YBGA 1NPJA 4JG1H 2V2XA 1LE9B 2WWKT 4Z7QF 3UTQA 3IMSA 1A4CA 1IGYB 3TVMB 3FAWA 3QUYB 4PRPB 5CZXD 4F8OA 2H2SD 2AKRA 5EH1A 3QUMB 3HZKB 2XTSA 4PYGA 2WXLA 3UABA 1N7ML 5EU3B 1ET8A 5F3FA 4RX4D 4IMKC 5HJBA 4L18A 5CWSA 4PTTA 1INQA 1OARL 1YG9A 5AOIA 4EXPX 3NPZB 5CEYB 1PZAA 3DI3B 4UNTA 1T5KA 1G6RL 4N5UA 3BPLC 3IMRA 5E99H 3SKJL 1NGYA 3QEQA 4NOFA 3KYKL 1A1NA 5FM4A 2PPDA 3ULUD 1CGUA 2ZX6A 1GGBL 4B9IA 3OZKA 2HB0A 3APDA 3CNKA 1ETZA 1XZ0B 5DZJA 1TTUA 5AW2B 5F97E 3U0WL 1UWEH 2F5AL 4IK7A 4MA1B 2YAPA 4PIBA 4J4PA 4AYSA 4XAKD 2QZQA 5HVFB 2IIJA 1PDKA 2Q87A 3PU7A 2D3LA 4BJLA 1QNIA 5DCCA 5AVTB 1FG2B 2FZ3A 2E0PA 3BD4A 2VITB 5I1EH 2AEPH 1SF3A 2HP4A 5D1XE 2Z4QB 1SJEB 3GSVA 1FF5A 4AGPA 2ZIDA 1VZHA 2WYTA 5DWPA 5DD5L 4TLUA 1A5FH 1MW3A 4OCSL 2VNCA 4DQOL 4TNGA 2YPVL 4PJIA 1AGEA 1X5LA 3GWJA 3QG7L 2BFVH 5KBPA 1W72B 1JZ4A 3NA4A 3V0WL 4OCXH 3ULUH 2VLLA 1IGCH 1KCRH 1ZHLB 1G5AA 4I0PD 1J8RA 1JPGA 3PUUA 4FS0A 2CR0A 3QNYB 4WJG3 1AGDA 3BH8B 5I74C 2AV7A 3UC2A 4JDEA 1IAOB 4YSDA 5D5MA 5F8RC 3EJQA 3NPSB 4HWNA 4Z7OB 1LD9B 4YNYA 4UQ3A 3BYYA 3FK3A 1ORSB 3I50L 5K9KA 5LXGH 1H5BC 4JHVA 4PJ5B 3L3HB 3ZDXB 4ZOEA 4Z3GA 5GS0H 4NT6A 1QRNB 3I02B 5DUPH 4DJMA 4QXUL 4J3XA 4H5SA 4JM2C 3BCDA 1A8JH 4L1TA 4KXDA 4WUKH 4AZUA 2BNQA 4RGNB 2C1OB 4AEHL 2RQ8A 1LK3L 3QHTC 1R0AH 3R7QA 5DD0H 1U8NA 3N3EA 2OSLB 1T3FA 4XOBA 4V2BA 3AU1A 3T6QC 1WITA 2VYRE 5F9DC 3SBRA 2B5IC 1WWWX 2UXGA 4L5FH 1T0OA 1G7JA 1NIEA 3D0VB 1BQ5A 4N2IA 1CTMA 4R5XA 4I3SL 3KGSA 3O2WL 3RB7A 2CD0A 1TQCB 3FPYA 4R97C 1LWHA 4DK5A 2IDFA 1KIQB 3AWEA 4Y4HA 1EXGA 4XVJL 3WTVA 1U3HC 4OI7A 3FTGB 3JVGC 2WLKA 3QH3A 5HDLA 1C8PA 3VXME 1OP9A 1RKRA 3ULSA 1LDSA 1ZEAL 1F4YL 4RGMB 3Q1EA 5C0DA 1W0WA 2FGZA 4KY1H 2A38A 4HOWA 2VLKB 2I9LA 4G7YH 5D7KD 2AXGA 5LN4A 4EIBA 5C86A 5I28A 1F4WL 4A67A 3D85B 1F6FB 4TUJA 4KTEL 4YDVB 1AE6H 4OCNC 3NQIA 4N6RB 1ZLVK 1AZCA 4LCVA 2VISA 4GAJL 2Q76B 2EINB 1OALA 5L7XH 2VM3A 2A1WL 2AABL 2WVVA 3GZQA 4IOSA 1CI3M 2JI1A 5FA3B 4OGYH 4M4RA 1OANA 2NX5D 2XN9E 4ATWA 4I3GA 1BZ7B 3VI4B 2DQDH 3FQYA 3HAEA 2IANA 1XEUA 3GMMA 1E7UA 2DI9A 5E56A 1I3VA 2UWEE 3TJPA 3WMQA 2OZ4H 2Y5TB 5C0AE 1V3MA 5C0FA 4N0UE 4WU7A 3D25B 1J0KA 2AJSL 2C26A 5E03A 1D7CA 1CE1H 3RVVC 2BMKA 4LBEA 4XNQB 5CSBA 5I1DA 4MJ5A 4KKLC 5C0BA 3S3PA 2VABB 4WSJA 4QNPE 4V1DB 2Q3AA 4LAQH 5JOEA 1A4JA 3SQRA 4QMEA 4NPYB 4TQ8A 5C6TH 3S5LG 1NCDH 5E6IB 4BRVA 3V4PA 3F04A 1D5IL 1SLVA 3DPDA 1C7TA 1OAZH 1OD9A 4EIUA 3S6CA 2B5IB 3D18B 3FTWA 5GSVB 1G7HA 3EJTA 4XGZB 2FK9A 4FQ1H 4QJ4B 3F5WB 4M7JH 1FZJA 3GJEA 2NXZB 5FYJL 2NY4D 4Y2DD 1B0RA 2Q3ZA 4NZFA 5CSZB 1E2ZA 4G3YL 1SUHA 1HI6A 1EDYA 1WZAA 2ZXQA 2PW1B 4MA8L 1XR8B 3VWKC 2WOBA 1YPZE 1YVLA 4DO5A 5DJ0B 4PJHE 4M6NH 1FFOA 1YPZA 1MI5B 1ZLUK 3DSFL 1AKJD 1OSZB 1VFMA 3Q8CA 4O2EB 1M3IA 3BH9A 3FSVA 4AIZB 3DUHA 5IQ7L 1SHWA 5CJQL 5ABAA 5BS0A 2Z0BA 4JMXA 4EEEA 3CC1A 3MX0A 4CC0A 4F8QA 2XV0A 1TKWA 2H6PA 3TO4A 4WSKA 1WFTA 4OUUA 1TEYA 4BH8A 3DSNB 1LP9B 4I9WD 3PAYA 5K39A 2BOBB 4J3SA 4O9HH 2X9YA 2YD6A 4G6ML 4GKNB 5FOJA 2GEQA 5DEGA 3LDBC 3LZPA 2Y1ZA 1AGCA 4TXVB 5I8CB 4ABWA 1KC5H 3KWWB 1I7RB 3JUYA 3QFDA 4Y7OC 4GSQA 2CU9A 5I8KL 3RKPA 4WHCA 3KEHA 5IJCC 3B2DC 5IB5A 2GJ6E 4X9FA 2CUAA 3IN2A 4R8WL 4L05A 4ZS6D 5JW5A 2AKRB 3HTLX 1UT1A 1SXZA 4LESA 3WHXA 1IKNA 1U8OA 1D2PA 3UYRH 3RFZC 5AB2A 3LHAA 3RLSA 5D1XD 5EOCJ 2IWFA 4E9RA 3WFEH 2WLMA 5AOMA 1X9UA 5EEZA 1LM8V 2WBJD 3CFBB 5I1LB 4L29A 3IT8D 1ND0A 2ZPKH 3QR2A 3QNXA 4AM0Q 3DO7B 1CDGA 1CFBA 5DI8A 3CQFA 3L7EB 1N59A 4QHLB 4HIIB 4GP5B 1N6QH 1HCZA 4PS4L 2A74A 3P0VH 2HFFB 2YLHA 2ZUQB 3GXPA 4Y19A 3WEAA 3P02A 3CHSA 4A6YB 3ECVA 4MB5A 1E65A 4F9LC 3FSAA 2XN0A 2Y72A 2EP6A 3IDMA 5HYSG 1RJYA 5DXWA 4O2CB 4AZ8A 5DMKB 3LKQA 2XXGA 2FRGP 2R1WB 4DGYH 1DVFA 1JMZA 2EO9A 1DO5A 1AOZA 4LQ1A 4G59C 5E6UB 1QX1A 4LHUA 3F6LA 3HE7A 2EE2A 2ZWKA 4WK2B 2Z93A 3VRJB 3I3EA 2F8OA 4MCZB 4ZMOA 2ZXGA 3ZHKA 1O6VA 1AGBB 2FIKB 3IJHB 1NH6A 1G9EA 2NNCA 4XCEB 1S46A 4TSAH 2K9UA 4JX0A 2G0KA 2QGEA 3NCCB 5E0QA 4NQXA 2ERJC 3ZTCC 2A99A 4PRNB 3WNKA 4PGJA 2DQDL 5HYQA 5HYSB 1OXYA 4EDXB 3UJIL 4FHKA 3VI3A 4ANVA 2L3BA 2AABH 2MRYA 4AKPA 5L2KB 5LQBH 1I8IA 2QSCH 1GHFH 4F9PC 5HY9B 1H19A 5CM1A 1A6PA 2XCMC 5IOPA 3F85A 1QACA 2X12A 4F7EB 3V0FA 4HZLB 2L7UA 5C0GB 1CDIA 1FFNB 1W72L 2BFVL 5F0PB 4AMXA 1JXJA 2FGWL 1MCBA 5DA0B 4DQOH 2BINA 3LIUA 2A0LC 2APVA 3MJWA 4PRBA 4UU9B 4KRNA 2G5BB 2QQNH 1DSFH 5HDWA 1JOIA 2VLME 2ZSWA 4N2EA 5D71H 2J8UB 3TA3C 1AXTH 1DQQA 2IFFL 4HKJA 3BAYA 1SLUA 3MYJA 2VIRA 1TEGA 4XMLH 2XIDA 3BGFC 1M6OA 1PY9A 1CWVA 3AS3A 2XBDA 3H9SA 4P5TA 1YQVL 3E8VA 5SV4A 2NX5E 2XN9D 1EDQA 4AYBA 3KYNB 3NCXA 2ARJQ 4JJ5B 4I4WB 1X5FA 3LV3B 1AJ7L 4NAQA 4NQUA 4JG5A 4UNVA 1OB1B 4Z7OF 4GMTH 3BYTA 2HUHA 4HHAB 2BX5A 2JELL 3TNMB 5D1ZI 3VGFA 3ZO0A 1S5HB 2ZXCA 1BZOA 2Z8RA 3HFFA 1M57B 2EDRA 3K6NA 3MACL 5IMOB 5T1DL 4D0BA 1J8HE 3A6OA 3QR1A 4FQCL 3IPFA 4GRLB 2VLRB 4ZFGH 4FYQA 5FHAL 5JXEA 3NRPA 3VDBA 4RGNE 1TZIB 5LBGA 4AK2A 5LXGL 1HSBA 3KLLA 1FFRA 5KOMC 3V0GA 1T1WA 3U82B 3WNJA 1BMWA 3VXOA 1F18A 1JRHL 3MJ7B 3U83A 2D7OA 2FVNA 5E8NA 4M6AA 4APQC 5F3BB 2JJSC 2WBWB 3RURA 4KITB 1NC4A 4HCIA 4NFBA 3QO0A 2EDNA 4IU2B 2WCPA 2VTFA 2J6EA 4GQ9L 2ZSVB 2WBJA 3UYPA 3V4VA 4M93C 5F6HI 4PW9A 1R3IL 3MV8D 3R4RA 5DUML 4LVOB 2JKTM 4PWFA 3MROA 4MNHA 2PTTA 4JDVB 2DRUA 2YAMA 1AQKH 1H9DA 2ZUTA 3PNWA 5J11B 1BPLB 5IJVA 4N8CH 3QJZA 4R7NA 2AEIT 1A7OH 3GSQA 2H8PB 3TLRA 3UBXA 3LQAH 3IN0A 4P9MH 4YDKH 4GUOA 4LKXA 1GA2A 4K9EC 2YHGA 2BDNH 2Q7AA 3C5ZB 1MW1A 5E2VL 3D5OF 5C0IA 1J1OH 1P9MA 4GNKB 3AY4A 5AAMA 5D55A 4XB3A 4YXHL 3PHOA 4C83A 4E5XB 5CILL 4JQIA 4HUWA 1ES0B 1RURL 4ZSOA 3EYVA 3JWNC 2UZIH 3UAAA 3ZO9A 1M7IA 1A4KB 4YHZL 3UPAA 2DWEA 1SVCP 4JQIL 3L3IA 2VDOH 1N5AB 1P2CA 1FG9C 2H0JA 2OA9A 1CD1B 3MJGX 4KNSA 5KVGH 5C07A 3C60A 1KJVA 1LO3L 2CUMA 4P2OD 4XODA 4Q58C 1UWXK 2JQMA 4AITA 5JW4R 4JK0D 5DRXB 4YHZH 2UY7B 2KLTA 2Y7SA 1BM3H 1KPRB 2A6KA 4PBXA 1KB5B 3H2QA 4DF9A 3OLDA 3P4OB 5LLIC 3PAUA 3T6WA 1ZPLA 2ADJA 2XWBA 1FI8C 2P3YA 5HHNB 1IAIH 1M1SA 1YPZF 4I1NB 3A23A 4LCCC 5BJTB 3ZN6A 1C1EL 3GBML 4QHNA 5CS7A 5B1JA 2BP5M 2A74B 4YLCA 3OWRA 4OZGF 4F7MB 2CO2A 1BJMA 1IKFH 3B2XA 4NQCD 1IO4C 4I2XE 5T1LA 1MLCA 12E8H 3A67H 5F1IB 2YQGA 3ULVF 4I18B 3CFCL 1NMAH 2WLYA 3DETD 3STLB 3UTPD 4GUQA 2WO3B 4PMFA 1SJVA 1E5AA 1BD2A 3QDMD 1NMBL 2EC9T 3CXDH 3LKQB 5F0JB 2AZUA 4BWUA 3FHAA 4K55A 1KCLA 5IVXF 1F45A 2PP8A 4KKBD 4TVPL 2KQNA 5KSAC 5F7WC 2F1AA 3UC0H 4F37F 3SKUD 1D5ZA 1GC1L 1MCOH 5IKCB 4P23A 4HIIA 3OB8A 2VDKH 4U1SA 2DLFH 4UUJB 3TM6A 5EIVA 4PRHD 1NBZA 1UCBH 4F7PA 2XACC 4J23A 1HYSC 3MUHL 1S5IH 4WJ5B 3BDXA 4A6YL 5KYWB 1UC6A 4DPCX 3CHPA 4E9SA 2EDDA 2ERJB 2QZ5A 3SPGA 4PJDE 2X4RB 3V4PL 2ATPA 2HMID 5F9JB 1TYEB 3PGCB 3NP4A 3D9AH 2BXYA 1CBVH 1HZHL 4M00A 4JRLA 3X13A 1RZIB 1W9XA 1KCSL 5IHUL 3PABB 4OLXH 4KQ4H 3GSRB 4WWKC 5KWYC 3MV11 2W9DH 1P6FA 4J3VA 5KG9A 1I8LA 4KK8C 3UBXG 2HKAA 1VESA 1X9RA 4FZ8L 4WAFA 1JNNH 2VMFA 3RAJH 5IWLA 1CT8B 3I6KA 3VM7A 2QGDA 3ARYA 4F9PA 3OXRA 2FL5A 3HMXL 4JZJB 3HG1A 1FZKA 4Z8FL 4JHAL 3VQMA 4PD4K 1A66A 3R0NA 4F33A 4AVIA 4PAZA 5DO8A 1UB5A 1KYDA 4WIQA 3B7YA 4N8PA 3MKGA 2NNXA 4AQZA 2X4NB 2AQTA 3Q5TA 3TEWA 1IU1A 2CK2A 2IADB 2R0KL 3SY0A 2D7PA 4B5EA 5EF2A 3SDDC 2AXFB 3MV9B 4I3RL 1U8IA 3MLSH 1ID2A 1KJ2L 1AHWC 2YMOA 2WKOA 3GM8A 5J12B 4MJIE 4J6RH 1G1CA 5FFOA 3IS1X 5I16A 3B3IA 3U4BL 3O9WA 4WFGE 3MXWL 1DSWA 3BQVA 3PHAA 5L2KE 3VW3L 1RJZA 4FNSA 4NKDA 4EUPG 2JKNA 3Q13A 2LW3A 2FBJL 1KBKA 3UTTE 4YBQC 3C5ZC 1UXSB 1ICTA 2N7SA 3FMGH 3KPRE 1QBAA 4PR5B 3VWJD 3V0AC 1FVDB 4HS3A 4HH8A 1LNUB 3KG5A 3WI9A 4WENB 2VLRE 3BLPX 4M1GL 1T66D 3IFOB 3I6GA 2OMXA 1J05A 1U8QB 5CIPA 1FNFA 1JZGA 3W81A 4NKIH 5INDB 1BXAA 4OF7A 2J71A 3S36H 2WWMD 4PRDA 4HFUL 2F54B 5E1IA 4DESA 3RGVB 3QXAB 1L7IH 4P5MA 3O4LD 5HI4C 1WYJA 5F1KC 2EACA 2GJ6D 1EFXB 2MTPA 3D85A 4PJ5D 1YAIA 3ZE0F 3MLTA 4Q2ZA 2BZ7A 5HXMA 3MRRA 4URTB 2ED6A 3GSXB 2C3GA 3VYOA 4BSWA 4D9LL 3KBPA 1ZA6B 4MHHI 4ODTL 3VG0H 4JVPA 4MA7H 4HC1L 5FA3A 3ZKND 2WBXA 3FFCE 3D33A 1PG7L 4OQTH 1BYOA 2C9UA 2JQAA 3L7EA 1SDYA 2DBLH 3BUTA 5FCUH 5JNYA 5IFJA 2BZDA 2J8UE 2H32A 4DGWC 5T3ZD 3K80A 4H20H 5CZVL 4ZPVB 3IMBA 1IBZA 1U3JA 4DK3A 5CJBA 1O5DT 3W0WA 3WFHA 5B38B 2NW2A 1XIWD 3TN0D 5IBUB 3F7YB 3IDJB 5A6MA 3IJSA 1HHIB 4AWJC 4EI6A 3VGBA 3OPZL 4L3CB 3R7RA 3POHA 4W9HC 2PPCA 2VMDA 2CRZA 2YC1A 3BHBB 3MNWA 4FNLH 5I8KH 1TYJA 4F7CA 3N6YA 1RZ7H 5C0NC 5BUGA 1J8KA 4S1RL 1ZJAA 5EO0B 4YEFA 3W38A 3QARA 4LPVA 2WM0A 2NY6D 4LVHC 3NJGA 1ZT7B 3QHFH 1I1AA 3ARGC 3VSUA 2HJKB 4RA0C 3I6LE 2ZXWB 3MBWA 1UA6H 3MV9A 4PJBB 2EH7H 1VGKA 2VZUA 3DX9B 1AY1L 5E1AB 5AW3B 3BVUA 5T1MB 3RU8H 3S48A 3TT1L 3WNIA 1M2VA 3BJ91 1LE5A 4YAQA 2WYZA 1KENL 3W39A 3QJFB 3TIDA 3WFZA 1DANU 4PJAA 5HY9A 1UFGA 2C5DC 1F2XK 3R1GL 5TQ0L 5CF3A 1I4FA 5GQBA 4KMLB 2ADJB 2IQ9H 1IGIL 4YHLH 4JPIA 3C60C 2A9MH 1D5ZB 5I24A 4G80B 3P4LA 4ORZC 1S7QB 4YDNA 2FWOB 4F7TB 3MJ8B 2FQGA 1YEFL 3DOIA 4QNPF 4AQAB 1Q1PA 4BK5C 2D7TH 3Q2NA 5J6HB 5DQJB 4BEIA 1UZ8B 1MUJB 5EPMB 1CL7H 3FCBA 1PLBA 4FJYA 3PWJA 1DJZA 1FPTL 3OMZA 4LRIA 3HRZC 5JTWA 2ALAA 1UH3A 4IBYA 4PYHA 3R06B 5HP5A 5C0JA 3UAJD 3PGCA 2F5BL 1ZSDB 5JDSA 1LEKB 3G6DH 4Y16B 3IXAA 2W88A 5DMJB 5DC0A 1QMUA 2G60L 3N1QC 4GW4A 2WQRA 5AYTA 4OJDH 1HX0A 2A3TA 5DHDA 5DHEA 5JXAL 1EFXD 5MEPA 2YK1H 3TEUA 2Y07H 4LEOB 2H3NB 4PJHF 3SIKA 1MCHA 2Q20A 3D0AA 2PYEB 4XC1H 3D07A 2HVKB 4JRYA 3UG5A 1H8NA 1NIAA 3AT8A 3NJHA 4X5LA 1ULVA 1UB6B 1TENA 3FNKA 3CSFA 5EO9B 5EBWB 4P57A 4FABL 3CZFB 3L6FA 1TXKA 3WFCH 1AGFB 4ZMVA 3EFOA 1C16B 2ICWJ 4HZAA 1PG7X 1A1OA 4NHCH 2VR7A 4QRAA 2ZP8A 5AD0A 1MLBA 2FECI 4F58H 4J12A 4UANA 1OOWA 5CCHE 1WZMA 4DZBB 2PCFA 2HCZX 4Y5VC 2P24A 4GLRH 4EZJA 2CJUH 3VE0A 2CSPA 4RWYH 3LNGA 4BDVB 1QI5A 2Z8SA 5DJXB 3CX5K 1ILUA 2A9NH 4IBZA 5KOVC 1CGYA 4UINH 4PFEA 1RHFA 4QGTA 4YZWA 2WBKA 4G8FB 2QLVB 1E8WA 3M07A 5LCVH 4GAAA 5DSCB 3NCJL 4N25A 5K9OA 4FNPA 1CFNB 1S9YA 4JFPA 1IBBA 1XGPA 4Q4EA 1NCUA 4ACPA 1PQZA 2CA3A 4YFLI 2YWYA 3MUUA 1RLBA 2KPNA 2RALA 2GTQA 2OR9L 4HJGA 2ATAA 1IGMH 4J1UA 5C9KA 4LCCA 2H6OA 2WXJA 1BQRA 3KEDA 5G5DA 5LWYH 3ZHLA 4NO2A 2J5LC 4OD3L 3KPRA 1L9OA 1DFBH 5BO0D 3HI1A 3TWCH 4CADA 4EUPA 3FTXA 4HMDA 4JFEE 5K9JL 2JCCE 3NT0A 4HUWB 3VD7A 1V7MH 1FCGA 1JGLL 5I6MA 3W5NA 3BCFA 4WEBH 1NLBH 4ZS7H 1E28A 1WEJH 1QLEL 4LK4A 5B4MD 3QIUB 1DBML 3K4AA 3WTXA 3N42F 3VWKB 3TO2A 1CD1A 1JCVA 2C3XA 3SDCB 4A7GA 4FG2A 1DUZB 3HE6D 5A2KH 3NGBB 1AFVH 3M86A 2D8KA 4W68A 2WXGA 5D1ZC 4XWOD 5AWNH 4U1KB 4HJJH 4Z7VB 1A7BA 4ELMA 3RZCC 4MLIA 4XNUH 4Y1TA 5IROD 4ZPTB 3VMOA 2QHLA 3B1UA 4HJUA 2R7EB 3NFSL 1VPOH 3KR3H 2VXSH 3FN0H 5IIEA 2Z4QA 3BWUF 1T0NA 2EDTA 3D06A 3GXNA 4HU2A 3ZKXC 5LO7A 4DUVA 2PXYA 2VLJB 2PO6B 3E6FA 3O3DA 3VXRE 4YDVA 3BPNC 4KRLB 3W9EA 5C7ZA 5DC2A 1WFUA 1N5YL 2NX5A 1CGXA 3W0WB 3WFHB 3GBMH 3EYUH 1PZ2A 3MRCA 2O5ZH 2EIDA 3DRQB 3QJOA 3L45A 4ZMNA 1KDIA 5I1GH 3CC5B 3EYOA 4LCUA 5GGQL 1FNLA 2JK5B 4LZKA 3SYOA 1MDAA 2AV7B 2VLJD 4H4NA 5C0AD 1FO0A 1NGWB 3AQYA 1RZQA 4GT7A 4AQ1B 1MSPA 3FFCB 1YEKL 3EOYG 2DYSB 3GRGA 5CO1A 5KSBF 3ILQC 3BE1H 2NY4B 3TFKC 1ZGLM 4WI3A 1RSYA 3FZUC 3QDJD 1F3DJ 2DIJA 4WWNA 5GHWL 5E94B 1GZHC 4JM2A 4I88A 3UDWC 4Z7UA 3UTTD 1KG0A 5DMYA 4HK3J 1ZHNB 2Q2LA 1SHMA 2ZZUT 4G42B 2E27H 2ARJB 1U8NB 3O6MH 4HGWB 3M8OH 3L2NA 3TV3L 2C9AA 4WI6A 4ZOCA 1T7VA 4PJEB 4HUMB 2GAZB 4IW4C 4YFLF 1I4FB 3SGJA 3FL7A 4YHYC 3OKNA 3MLWH 2IWGA 1TMCB 5I23A 1DEEB 1KYUA 1IM9B 4K2UH 4A7UA 3BZEA 1QRNA 1OAQH 4OZ4B 4JFFB 1JYNA 1QRNE 3QFGA 4ZXBA 5DFVD 2QR0B 2VW6A 3GIZH 1PGRB 3JVGA 3APNA 4GAGH 2BVYA 2ZYHA 3HPJA 4YL4A 2EXWC 5TDPA 2UUDK 3HB3B 1HE7A 3KHQA 1E4WL 2AJYH 3VXNB 5EU6E 2IV9A 2I5YH 4R96B 3SCMA 3W2DH 3UOAB 1AO7B 4RGNC 1KBGL 1URLA 4QRTA 5K59F 4B27A 2L7JA 2BPBA 3S97C 2EAEA 4QWWC 2AK1H 4QRSB 4BZYA 3NSXA 5KYXA 1SXNA 3BQUB 3DXAB 4FTVE 1DLFL 2L0DA 3IAQA 2CKBL 4U1KA 1FN4B 4P5SA 3MR9B 4BZ2A 1GYCA 3LXUX 2LLLA 1H15A 4J4PC 3HHSB 2OXHB 3TJEL 3SHSA 3WUZA 3QEGH 2DQHL 3ESOA 2FSEA 2X4NA 3U36B 2DW5A 3VX1A 1U3ZA 3FC8A 3HC3H 3GMMB 4KKAC 2E27L 3VXSB 2ITDB 2Y5TA 2NTFB 3EJYC 4S0SD 4NM8L 3CZLA 2Z91A 3II2A 4U3XA 1D9KD 2OW6A 1JWSB 2EYRA 4HH9A 5FHAH 2X1OA 1N4XH 5TE6H 2XPYA 3GSWA 4YPGB 2UYLB 5KVFH 2IJ0C 3ARQA 3TGXA 1P4BH 4KJPC 3DHMA 4NN6C 2GJZB 3HAEH 3RRQA 4DKAA 1BAWA 5B7FA 1MH5B 1U95A 3J8F7 5BRQA 3QG6A 3LKSB 1NC2A 5IT2H 5TH2A 3BKCL 1D9KB 1FAIH 3DVFA 1QOKA 5HDQH 4HD9A 3B2UD 3DYPA 2Z3FA 5J3HC 5I1GL 1H3PL 4KI1A 2CMRH 4U3CA 2NY3C 1MPAH 4KZDL 1NWPA 5F6HJ 5CIPB 6TAAA 3G5VB 3WIHH 2FB4L 1KG0B 1WC7B 2Q7NA 1S3RA 4PJGF 5HGHA 2H47C 2GSGA 4QRQB 5F7BA 3KR3L 2N1TE 4HSQA 3OR6A 1E4XL 1MJ8L 5IK3A 4UIKL 2HG0A 2EYSB 5CAYB 1QFWH 3VI3F 1Q9OA 3HE6A 3H7BB 1ED3A 1QZ1A 4HMCA 4L37A 4XGZA 5DTFA 3SJVB 4Q9RH 3BAIA 4J5VA 4JY4A 3QRLA 3D69B 2XPGB 4P2RA 2SODB 1F00I 3V7AG 4ADIA 4OFKA 3QDGE 4HEPG 4AJYV 4AYFA 4EBQH 4IBUA 1MHPH 2A9CA 1XF3A 3CZUB 2EKSB 1ADQH 3HMWH 1F3JB 3RY6C 3WTSA 4KWUA 4NQSB 4HIJA 5GIRA 1S7RB 5HHOE 2N59A 4AV5A 4F7EA 4XPTL 1DVSA 2GJ6B 1O5PA 4YHPA 2OP4L 3HN8A 3TO4B 3HIZA 4ODVL 2J6EH 3BESR 5E5MA 1AZNA 3N41F 4PJ9D 4BH8B 5SWQB 4MS8D 3UJJH 3BSHA 1FA4A 4AW7A 1S9XB 1RZ8B 4LPXA 3SE3A 4B0MM 2YA1A 2JXMA 4Z7VA 4E9WA 5IB3A 4FFWD 3GMNB 1OM9A 4NO5B 3TEXA 4C56B 3AQDA 4M62H 4ZNEE 2IOMA 3U36A 3VFWA 3VXRD 4KKRA 3NJIA 3EO9H 3WO4B 2EVIA 1TQSA 3QIUA 3AREB 2WN2A 1KIPB 1PTZA 2R2EA 1ODAA 4DETA 3BN9D 3IKCB 3IMWA 3UTSE 1ZLDA 3QQDB 4F9LA 2GJZA 4IJ3C 4MXWH 1WAAA 2BS71 5D1ZB 1Q0XL 4CU7A 2B1AH 5F7DA 2BIMA 3FYIB 1JZ8A 2GC7C 2WP3T 1WFIA 2E8ZA 3ARVA 1GS8A 4M1CD 3T3MB 3ME0B 4NQEA 1BGXL 4G5ZH 5FKAB 4YGVA 1WZ1H 1M05B 2DQHH 1FVDA 1X5ZA 4O02B 4U1LB 2PXYC 4QXGH 2CKBA 1DBAH 4FYSA 4FADA 4PVBA 4F5CA 2DMBA 4D8PB 3GTNA 2RGSA 2AJUL 3WJMA 2P5WA 3AUVA 3KBHE 3B7SA 2W38A 1NMCB 4HGWA 3P9LA 4HUUB 3J07A 3W0WD 3MOBH 1S9WB 4JFED 5EG6C 1FHGA 4IOIA 1ED3B 1ZXKA 4OV5A 1A3ZA 2EDEA 4FEIA 2JB5H 1NGXB 2A9DA 3N04A 3HR5B 3QCVH 3U7AA 1DEEA 5AAWA 5IBTH 3WIIL 1NFIA 1V3JA 3V9FA 3VD1A 2XWRA 3D51A 4OCMC 4JBSA 4UB0H 5ICXA 3TBVB 4LEXL 3KPTA 5JOFA 1XGYH 4YO0A 3LRKA 4JHUA 1S7VB 4P9HL 5I5JA 4GLRI 3S37X 2H2PD 2OX5B 3GJFK 4XWGH 3FQ1A 3TF7C 4FTVD 4IGBC 5HJGA 2GAZA 5D7EA 1HCFX 3KCWA 3S3SA 4LOUC 4NKQB 4WHYH 5IHZB 2E3VA 2G75B 3KPOA 2J1WA 4MDRA 5ID0B 5FYJH 4GP8B 5MERB 5T33H 3RGVC 1D9KC 2FT8A 5DS8A 4MWFB 3FQUB 3KJ6H 1JWMA 3MR9A 4XBPB 1F3RB 3VTAA 4Y5XB 2VZ3A 3BAXA 3MMEA 4AJVA 1AXSB 1SYSB 1NWOA 3EBHA 5HDRA 4U1GB 3V0VB 3ZQWA 4OI9A 5H35B 4NLHA 4NAJA 3V0JA 2DWEB 4IKIA 5DFWH 2WC7A 1FNGA 4R2GB 4R96A 4AL8L 3ISRA 4WWKB 1VACA 4XN9A 4KTGA 2W8CA 2YN5A 2DLIA 4KOBA 2V9TA 3WDIA 3UBXI 2MOQA 1I8KA 1PLGL 2DDQL 1OGTA 1XH3A 3JYCA 3GO1H 4QCIB 5F1OB 4DKDC 3OXSB 2HN7B 4CNIB 5FGBA 1MCFA 5FECB 5G55A 1TJHH 3PPSA 5F3HA 1FFPA 1DBMH 5FV2A 3L81A 3X14A 3HI5H 1UWXH 4UQDA 4K0OA 2EIJB 1CVRA 3RP1A 1J87A 4DZ8B 2DTML 4XPBL 5DFVC 3MRMA 4KZEH 3STBA 4K23H 1AIFA 4G2AA 4WHDA 2K0RA 2WQVA 2ITFA 1TFHA 2ZF8A 4QHKJ 3G04A 5JHMA 2D3NA 2VDPB 4J27A 4P48A 4AKOA 4KUCD 3CXHJ 1NAKH 5ETUA 5EZOL 3BAKA 4GSDL 5E08L 1OW0C 1ZE3C 1XSOA 3P9MB 5GGVH 1G9NH 1MUJA 1E28B 1UOLA 3BH8A 1S9KC 4U7KA 4HIXL 2EEDA 3QG6B 4KK9C 1PKQB 2R29H 3LMJH 3MOQA 2KMWA 4DIXA 1E9PB 3WY2A 1XDTT 1KZQA 4QT5B 5EA0L 1SFHA 2CDGB 3AW5A 1G6VK 1KNOB 4X5XB 3DROB 5L4IA 4ELKB 5F2FA 2V7NA 5DO2D 2COVD 3NCWA 2NYZA 2PETA 4L48A 5CCKL 3O4LA 1CJYA 1H3VA 1ZTXH 3V52L 2YARA 1YY8A 5E2TL 3FZUD 1RV6X 1OM3H 3SE4A 3D39B 3ILQD 1MFDL 4XOAA 4OIIL 1DDTA 2BSRA 3QP3A 3VXSE 3KD4A 4YWGL 4L4VA 3VI4F 4X8JA 2YWZA 4EKXA 2DQIH 2FYYA 3BUYB 3E6HB 4PJDA 2O6EA 3LKOA 4MD4A 1IL1B 1NINA 2J21A 1QFUH 2ZCLL 1G7JB 1URZA 3O9WC 4TTDD 5HGAA 1W91A 1HC1A 3OHXB 2BWDA 4H26A 1U8PB 2W94A 1IGYA 1RZIA 3H0TB 4NFCA 2Q5BA 3TBYB 5GS1A 4FTVB 4GXUM 4FABH 3R8QA 2JK5A 1S9XA 3CZGA 3O2VL 4IIQC 1MJJB 4OF8A 3QIBB 4OLUH 1C5CL 2VWEE 5D2LF 3ABKB 3FQRA 3LNHA 1PY4A 4IHOB 4ATTA 4P2RD 2UZPA 5CEYA 5C2BH 4YS4A 2B0SH 1XD0A 5GIRB 1F97A 2XV2A 4BDVA 2PO6D 3ZIYA 1QO3A 4YX2H 2KC0A 1M42A 4F80A 3C5SB 2IAMA 5TDNA 3HZMA 3RDTB 4XO8A 4N86A 1KFAL 1UEYA 1JPST 4WI7A 5AW1B 1O6SB 5TD4A 3UMTA 4OD1L 1HL8A 2VISB 3NQKA 1K3ZA 1QAWA 4HLZG 4FULA 2NYYD 3U9PL 5LDSA 2I60H 3B8YA 5DWUH 4OIAA 3D3VB 3NJXA 5AUMB 2OXGA 1RVFL 4M48L 1OAYL 2BOCA 5CNHA 5E00B 3TOPA 3ARDA 3T4AA 1VHPA 3VMPA 3FYEB 4QRUA 1V55B 4ZMLA 1JGUL 1IGIH 4YHLL 1HWWA 2IV8A 3TTSA 1YYLH 5GGRY 1NCWL 1FZMA 1SXBA 4UMGA 1WDAA 3MGOB 1EO8L 1TZHA 2W0KA 1G7MA 1G6RH 1ZV9A 3OGCA 2J5LB 1Q1JH 4IGBD 4EZKA 5EUOE 3EO1B 3NCYS 1R3JB 1QKZL 3SCMC 4O58H 1KIRA 2PWHA 3C6EA 4WKZB 3V6ZA 3WE6B 3GJEB 4LLMB 3TT1H 2MTAA 5IVZB 3RL2A 3AS2A 2CHWA 2YXVA 3IRCA 1K6QL 3D39A 1XX9C 1UKSA 3NUKA 4XXWA 4PP2B 1Q4NX 5D72H 1KB3A 1K4DA 2WNKA 4NZTH 2A9ML 5B39G 4N2NA 2IQAA 1K85A 4FQXB 1KT2A 4OT1H 2WLJA 1NBVH 2KZ1B 1NDTA 3VI4E 4HOMA 1K3IA 2ZG1A 1OTUC 4FYTA 2EDQA 2IPKB 4L3EB 2IDTA 2HPOA 3V5DA 2KLRA 1ODUA 4GPVA 5EZOH 4F3FB 3BMVA 5F9OH 4A7QA 2OMWA 4M4PA 4X80H 2RA1A 3F3HA 2GTZB 5D1QA 3CDZB 2BNRE 1PS3A 25C8H 5FO7B 3VFSB 1I8UA 2DWDB 1SY6A 43C9B 4TPRL 3WIAA 1SYSA 1MJ7L 2JB6B 4BFJA 3T8VA 1J9CT 1V8HA 3HUJB 3VUAA 4X9GA 3O8XC 12E8L 2ZKMX 3C5SA 3WEOA 1T5XB 4YHML 1HHGB 2XU9A 2E74C 3O3UN 3HI5L 2BOLA 2FEEI 4FQHB 1E5ZA 5IHZA 1A8ZA 1IIKA 3K5SA 4TSBL 5E94A 1DUZA 5AVQB 4L0YA 1TZ8A 1WRFA 2Y3AA 4DVBA 4MJ6A 5GGSY 1PCSA 4P3DB 4X6BA 1CICB 4GAYB 3REWA 3UZVB 5DJAA 3ZXAC 2X87A 2Y1VA 4N8VA 4CW1B 1GGIL 4FXGC 4WEEA 2JCWA 4JDZA 3P77B 4HSCX 4TS6A 1T03L 4OCRH 3B2VL 3FO1A 3GXMA 3QPXH 2LGNA 3ATDA 3KBEA 5AEAA 1D5MB 3U7YH 3FOLB 4QO1B 3TH4T 2OBGA 3CMOL 1I8AA 4PJCB 5SWSD 4FFWC 4EI5A 3QXVA 2XG5B 2VB5A 2G9KA 3IS0X 3L3OA 5BZXA 1WA0X 2JIXA 3ARFB 1AS8A 1EAOA 2QMJA 3DURA 3VU1A 4NJ9L 2Q8AL 1BIIA 1HHKA 1NGWA 4AE1A 2J56A 1T2QL 1EMTL 3V4PB 4JPIB 3GI8H 2CBMA 4ESKA 3K71B 4TUKL 3MRMB 2EDKA 1A3LH 2FJFA 1TVHA 2R29A 4JQVA 4A2LA 3O8XB 3PWLA 2CIIB 4JRWA 2WLNA 2WXNA 3NJFA 1KXVA 4OV6F 3CVHH 1IEHA 1KLUB 5KSVB 4ZODA 3KPMA 3WEXB 5ETUB 2FBOJ 3CX2A 3HBQA 4J39A 2YPLD 1IB5A 5B39B 1R6VA 1Z9SA 2X9ZA 3OKKB 3RZWA 1BD2D 4XOEA 5EU6A 5C0ND 3ZT5A 4B9CA 5DJ6A 4QGYA 4KO9A 1P1VA 2FBJH 5IROA 4KROC 4NRYA 5DLMH 2Y2TA 2ZCKH 4YLBA 3US9A 3LXAA 5DUMH 2B0SL 2WLHA 2ZX8A 4Q74A 3QB7C 2Y9RT 1P69B 4XPHL 2BP0A 2JE8A 1SJHB 2ZWSA 5D4JA 5DRWA 1S7WA 3VH8G 2NMSA 3GI9H 4JY5H 4OJCA 1U58A 1ZIAA 1XF2A 5M95B 2XA8H 3P4NA 4W6XB 4X8XA 1BFTA 4BSWB 1EGJL 2MNWA 1OV8A 2NRDA 2VR3A 3FB5B 3BIBX 3W82A 3LRSB 5DRNB 3S4SG 3FQRB 5J1SC 3NJJA 1KGWA 2BSRB 5DEGB 5J3HD 5JNYB 2HKHH 3AXIA 4GH7B 4JRXA 3VFUB 4N0UB 4G71B 5HYJD 1R24B 3LKRA 4ZFZB 1CGTA 1BQSA 1I31A 5I6OA 4XP4L 4OM0H 3GBNL 2HWZL 4K8RL 5FYLE 2JKXA 1KEGL 5D7SH 1EBPA 2YUVA 2QT6A 1BP3B 4P5RA 2MQCA 3FRPG 4PSPA 5HHPB 1H3GA 4JO5A 4FFTA 2EO7A 3N85H 3GB7A 5KSBB 1D2OA 4NP9A 2V3DA 3CFMA 3JWNG 1IC5H 1T7XA 4N8VB 4PRIB 5I1JH 1U33A 3CFNA 2WWMC 4Y9CA 4ZT1A 5SWZE 1ZS2A 3V4PH 3ET9F 3VE0B 3IJ8A 2MCAA 4NO0A 1ORSA 5KZCD 1CFQA 1MFMA 2ZUQC 3H9ZA 3H9SD 3HR5A 4OSUH 3LIZL 4IJTA 3EO9L 2XWTA 3FQTB 4P5TD 4R0LA 5IW6A 3REVA 3DX6B 1RULL 3AG1B 3JT0A 1WBYA 2ZONA 1QSEE 1UVQA 1YQVH 3Q1SL 4Y88A 1S7QA 3SDXF 3CVHB 1J88A 4CN6A 4BUHA 3Q06A 4ALAL 4EIZC 3MV01 5ICXB 3TBVA 3C5ZD 5HHXH 3S2CA 1TQWA 1XR9B 4N5ED 3UP1A 4FZEL 4K4KA 3BIAX 5D71L 1OT2A 3RFZB 4KNQA 2H9GA 1RXLA 3S7GA 2ED7A 4S0HA 4KNTA 4XBGB 3CFCH 3OWEA 4FQXC 4MQTB 5DVPA 2CJTA 2XZQL 1XWVA 3RWEB 5E4EC 4B9FA 1IKFL 4GIOA 3CK0H 1JBJA 4RCAA 1YY9C 3RX8A 2KKQA 4GW4B 2ENSA 4NYLB 2MNUA 4AYID 3V0IA 2QDVA 1PF3A 1G43A 4FXKA 1B4TA 3KXFD 5GRYA 3JWDH 3V0VA 4D2NA 2R83A 2VZOA 4ZW3A 4YC2C 1RJCA 2WW8A 1BOGA 2XJKA 4H13C 4JM4H 3GHEL 3PWJB 1UD5A 2X0WA 2NSMA 1XB3A 4DPAX 5ABZA 3TO2B 3RBSA 3CFDB 4FQIH 1Z5LB 3ZE1B 1XFPA 3ZYOA 4AGNA 4MBOA 1YSOA 4GQRA 3HLKA 4JHBA 3O81A 1LQSR 3LQZB 4BQ8A 3SJVD 3OZ9H 5I75C 1DQTA 2DQFB 4POYA 3ATBA 4Z95L 5DMIH 1P5UA 5L4JA 2G9HB 3B2PA 3DNKA 2B77A 1J8SA 1QSED 4LLWA 2YD1A 4RGMC 4CVZB 3VFUA 2J2ZA 5GS3A 3ZU8A 3TFKD 2IGTA 1TZAA 2ZOOA 1G0YR 2BW4A 3LH2H 2BSTA 4UWQB 1L4IA 3BPCB 3IU4H 2PTUA 2GJ6A 4HHGA 1HZKA 4TQPA 5IT2L 1GL4B 3L4ZA 1BJ8A 2XHNA 3T6XA 4N90D 1L0PA 4CDGC 3T6VA 2NY0D 2NQ3A 3N0AA 1QPPA 5EU3A 4UBDC 1MLBB 2N01B 3VGGA 2XVKA 3CSPA 3MRPB 2O5XL 5AZ2L 4M61B 3BLKA 4NC2B 4PJ9A 4PG2C 2YXMA 3P9LB 4HUUA 3MA7A 3VFSA 4O4YL 4P2QE 4CW1A 4NM8H 1KXVC 2C9PA 3ABLB 1BZEA 2P8PA 3DX6A 2VXUL 1OL0A 4G9FB 2X0VA 4K94L 4Z7WE 4DH2A 4PIRF 4P5KB 1E2VA 1SVZA 3GNMH 4KQ0A 1MF2H 1SM3H 2BVPA 4UT6H 5C2UB 2QPEB 1LGVA 3IGUA 3OB0H 1JHLH 5E7FA 3SO3B 3WLWC 4K2UL 1A7NH 3HCVA 4RRPG 3TO4C 2YBRA 3MUGA 4LSQH 3EF7A 4IRSB 4XWOC 3L3OB 1XR9A 4PJIE 4KV5E 3QUGA 5FCSH 4ZUVA 1Y1DA 1FSKC 1UTDA 2FEJA 2XVGA 2X7LB 1TCRA 5JA9A 1R34A 4GO6B 2OTWA 3LIZA 3OKMB 4RETB 1X7QB 2OV0A 4RDQF 3T0WA 3L7FA 5HGAB 4TULL 2DQGL 3F7QA 4C47A 2OMNA 3IRZA 2FO4B 1HXMB 3K71A 3QWNA 3H0TA 1UT2A 3RNKB 5I76B 5G5DB 3T77A 1SHSA 3GK8L 5GRXG 3DV6A 3KPQA 1HZLA 3BWSA 3RB5A 4IU2A 4KTDL 3X3GH 4MWFA 2HKFH 1ECYA 4MD5B 4PVMA 4XC3H 1LVEA 4IEFB 4CVXA 4G1MA 4BQBA 4KVNH 4Z77B 2BIOA 4FXGA 3F00A 4NN5C 4NRZB 3PDOA 2X4SB 3ZX1A 4MCNA 1IEAB 2HJLA 4J3OH 4PQXA 2WZPD 1DSYA 3ULSB 4BK8A 2VDQB 4FD0A 5C09B 1FC2D 4GW5B 4ZZFA 3CLWA 5IB4A 4JNXA 5JDJA 4YH6A 1CZ8H 2FNBA 2XZCL 4I2XA 3LZFL 1E6OH 2NX5B 1A9VA 1C08A 5L0QB 4EN3D 2RCSL 1TTAA 4GSRA 1T22A 2Y6SC 4KI5E 1XSKA 3D3VA 4UQ9A 3FCSB 2C7UA 5AFAA 4L1LA 5GZOA 1OP5H 1JCKA 5GPRA 4PN6A 5E5RB 2QGBA 2FATL 1ORQA 2AERT 4N2GA 5HVGB 4XNYL 4AMKH 3B9KA 3AROA 2HFFA 3UXFA 5HVHB 5HYEA 5D7LA 4QYAA 3H55A 5D6DC 4E9QA 3G5ZB 1I1FB 3L9YA 3JTTA 3SE9L 3VXUB 4HETA 3RGBA 4L0PB 3WKNA 1R4XA 5JOPE 1UD4A 4I0KA 4IBSA 3CC5A 4OTXL 4QLRA 4LMQE 4PY7A 1WAPA 5I74B 3QRGL 2TSAA 2QSCL 2GK2A 1Y07A 1MHHB 2IC2A 3E8UL 3NIGF 4HCGA 4RMVA 1MWAA 3BEVB 3K8KA 1IKNC 2VDML 2P8PB 1DBBL 5KBDA 3BP5B 4LL1A 2LABA 3MRNB 4J3BA 4P5KA 1BPVA 1F1AA 1MJ8H 2CLRA 2EE0A 2JFCA 4U1NB 3EG9A 4Y1AD 1MELA 1J8HB 4TOYL 2XWEA 1J7VR 3HNVH 4JUSA 2AFNA 2M26A 4XNXL 5JR1H 3MV8A 5AWNL 5E9DE 2DWYA 4N6RA 1AQHA 2UVFA 3QPQD 3MV8E 3KYOA 2Q76A 4JHWH 2Z7UA 2VDQH 1F4YH 3NMEA 4I18A 2Y24A 3S96B 2P7TB 2FYYB 3E6HA 4OCYL 3A21A 5FW7A 5BV7H 1DQJA 5D4QA 3OKNB 1YJDH 4F2EA 3GSNA 1YC7A 4XZ4A 4AYEC 2WLIB 1S7XA 2VXTL 5TE4L 2X05A 4JFHE 1IBGL 2CDEB 1E42A 1H3UA 3NA9H 4APQB 4NPJA 1JDCA 1G5GA 1R5WB 3FS9A 1RZGA 5T8IA 5FO7A 3V5HB 4WI4A 2QVFB 5F71A 4KDWA 5B7MA 2OMXB 5LDUA 3NZHH 1DEDA 1T04A 5TDPB 2OR9H 1SY6H 3P2BA 4RIRA 4HK0A 1KB9J 4DTGL 1QNZH 2ATPB 4FLOA 3U25A 3IDYB 4EN3A 2NLJA 3TVMC 1LK2A 5FPIA 5KYXB 1XBDA 4I48A 5EUOF 4BRJA 1U92A 2IMMA 5JW5B 4YBHA 2A6IA 1CLVA 4ZFOB 4RAUB 4A2MA 1G4RA 1DQKA 3IGAB 1F3DH 3CLFL 3KW8A 4FXKB 3QIWB 1S6NA 4JS7A 3B5TA 4PRHA 3CFBA 5I1LA 1GIGL 4F92B 1XB8A 3JWOH 3WELA 2H3XC 1JFQL 1L0QA 4XPGL 3BI9X 2A0LD 2WXKA 2ZOLB 3NFPA 3BSZA 4EXKA 5B38A 3BW9B 1WS8A 3SEPA 5IVXA 4GRWE 2H6PB 3SGDI 1JZ2A 5DD5H 2VLLB 1KEML 2ZOUA 4YXLL 3C6LD 4FC3E 1PNDA 1QBBA 4MB1A 4NZ8A 4W1TA 1FZKB 4UV7H 3ZKXB 2GSGB 4Y4FC 1TQUA 3LZRA 1FBIL 2WQXA 1WFJA 2IG2H 3UG3A 3VSVA 5BV7B 3H42L 4AOFA 4GKNA 4UTAA 2D7QA 5E24E 1MIEH 1QZNA 1A1MB 1T2QH 4NENA 2AJXL 1QATA 1I7RA 1T20A 2Q8AH 5ESAA 2VQ4A 3IJ7A 4N20A 3UYPB 4HXAH 2FQEA 2OMBA 3QDGB 2Z34A 2XNAA 2CGYA 5EORL 1I9EA 3QXUA 1D6EA 4P9HC 3PF2A 3GFUA 2NUPB 3RWDB 4UOQA 4ISVB 3RNQA 5EOQL 2M1KA 5F89A 6PCYA 1DCLA 2G60H 1BFOB 4J6IA 1U36A 4NQXB 4FHJA 4N2LA 5LBSA 2V9UA 3KS0H 2XIBA 2VN7A 5GHWH 5FWRA 3OKMA 2X4OA 3F05A 1E4XI 1IE5A 5HI4D 1SJHA 1KOAA 4L8DB 5E5UB 1YUHB 1LO2L 4FE9A 3IETA 4LSPH 2EDBA 4P8QA 4YDIH 5MHSD 5DR5L 3ZUCA 3GXDA 3ZTNH 4JFZL 3FB7B 2VWEC 4QTIH 5CWSB 5DRNA 2X42A 4A2GA 1NSNL 4FQLH 4G8GD 5CJ5A 5D2LA 1DJHA 1GJUA 5DUBB 2K6ZA 2WBJC 1HNYA 4JCMA 2YAFA 4JPWL 5I6KA 4RZKA 2F68X 4QAMB 5FF6B 3VFRA 4Q6IB 4XH2A 2VZTA 5JHDB 4HPOL 3H6AA 4NB7A 4UT9L 1M6OB 1QWHA 2GQHA 3BX7C 3QUZC 4ZW8A 2DQCL 5J6SA 2DQUL 1WFOA 1XF4B 4HULB 3QQDA 4G5AA 5LGJA 3LB6D 1KXHA 1WE5A 2IBZY 4N1EA 3BT2H 1I8MA 4AI7A 5DJCA 1OWWA 4DFHA 3KYAA 4AEIL 2R4RL 3DIFB 1ZVYA 1UURA 2EH7L 4Y5VB 5DZVA 1LTXA 4WRLA 2VDPL 1VACB 1S7TB 3ZDWA 1MFNA 3CTTA 4KXBA 2HA1A 5IFJB 1UB6A 2R15A 2UXTA 3CVHA 3NSYA 3C9NA 3P2TA 4B96A 2NQDA 3QZNA 4U05A 5L8KB 3OBAA 3O6KH 2YMXH 4IRZA 4RSVA 3T0VA 3I9GL 1BOYA 2NY7H 3VA6A 1OY3B 4W4OC 2Y36H 3ARFA 2W9LA 1WA1X 2VDLB 2Y5QA 1P84K 4U6TA 2A6DB 5B3SB 3VDAA 3JV6B 5IW1A 3FT9A 4G70B 4Z7VF 5DVNA 1K72A 4Y1AE 4G7YL 2BP3A 4H20L 2RFXB 3D18A 2EDYA 3GKZA 3ZR6A 3A22A 2UZYA 1JV2B 4OJEH 4CSPA 3QULA 1A2YB 2XETA 1MN4A 1HJCA 3F2LA 1M1XA 1INDH 2KPWA 4HQQH 1QPXA 3WSQL 1TITA 2Z31C 4ODTH 1F6AB 3NIGE 4IRSC 4OR1A 4NC0B 5BZWB 1SVBA 4V1DA 3FTSA 3ZDYE 2QKIC 3H9SB 4P5TB 1QSFB 4MJIB 3S37L 4Z5RB 4PRAB 2ARWA 4P3DA 1QHPA 3UO8B 5JO5B 5C09E 4BFFA 5BRZB 4PW3A 3UPRB 4QEGA 4FA7B 4HGMA 5EU7E 3GBLA 3FT4A 3LHPH 3MRBA 2B08A 5JQ6L 2CKNA 3HB3C 2EIBA 2YJQA 2AQNA 1HTYA 2E7LA 2F7RA 1T21B 3V0WH 2BWQA 4PWEA 5DD0L 5EUKA 1N64H 2VXVH 4PJ5E 1AXIB 4AEHH 1ZTMA 2E9IA 1JK8A 4AGQA 2ISDA 2VOTA 3O4LE 2G4GA 5DZ9A 2VQTA 1HYSD 5BO1H 5AOJA 1KELL 3Q7JA 4E41D 3TASA 4CC4A 3LQMA 3H3PH 1HINH 1UYWH 1WH0A 3M6DA 5CJ8A 4MYPA 1NL0L 4CILA 4TNWK 1ZLWK 2QVIA 4WO4B 1JF1A 2PYED 4KUZH 4QI3A 4P4RB 5T5FL 1AAJA 3ULUF 4Q6IA 3EBAA 3QFJD 3VCLA 4F1ZA 5BVJA 5IMKB 3QA3B 4KRPB 3QAZB 4H88H 5DVOA 4IIQA 4JZJA 4PB9L 1UT9A 3MXWH 1GTNA 1ZVSB 3RWHB 3GMQA 4GP4B 3TURA 4JQXC 4Y4HB 1UQSB 5BNXD 3VRIB 2VMJA 4AVJA 5F44A 5LVEA 1GGBH 3G7TA 1TLMA 1HH6A 5I8CA 2CJSA 2G5UA 4E9LA 5B3JF 2FATH 2ZICA 4XMKL 4C57C 1NIFA 2F74A 4PRHE 2X4TB 4UM8B 5D6CA 2RTTA 2QQLH 4BZ1H 2IADA 3SY0B 3C12A 4CMHB 3T0EA 1JF6A 2VLKA 2DYPB 2HRLA 4RAVA 1TZGH 1WTGT 2VLKE 1FL6B 1QFPA 2OMTB 3G04B 4Y19B 3PQYB 4WHTB 1S7WB 3BFWA 1UZ6E 3FXIC 2AAVA 3MFGB 1Q72L 5LKNA 1TCRB 2FO1A 5IWLC 4EMZA 2LLGA 5GXBB 1FLRH 3FQ2A 1F11A 2KDYA 1KIUB 4AJWA 3QUHA 4DPRA 3COOA 3BZ5A 2IPUK 3EGSA 4G6FB 3C5JB 3EF4A 1CIUA 4B5ZA 5K59E 4UT9A 5KW9L 3GSNL 4E68A 5D6DA 1JWUA 3P30H 4G7VL 4A6YA 4ZFQA 3PL6D 3ZY7A 1M71B 4CAGA 4MQXC 4JDTH 5B3NA 3GTTA 5ECJE 3V0DA 3SDAC 4FKKA 4DW2H 4OU3A 3J27A 4ODSH 1BVLB 3UZEC 3VFVA 5KZCB 4K23L 4F15B 1BA9A 1KMGA 1EEQA 4QRPA 4I0PC 3LN5B 1UWGH 4N0FB 4WKZA 3V6ZB 3VYPA 2B15A 3VXQA 1XVSA 4BQ9A 5I2IA 2XRAL 2CK0H 4I9XA 2XKSA 1LP9A 3QO1B 1FGNH 5FYLL 3MRQA 2VXQA 2VRAA 2DS4A 3SGKC 1B90A 3QUYD 4PRPD 2DQEH 3LD8B 4KTYA 4XCYA 1NBCA 4O2EA 4ZTEA 5G2NA 3UJTH 2R0ZL 4KX7A 5D7JA 4WF7A 1HFUA 4Y16C 4XO9A 3FUJA 1OGPA 2OL3L 4OJFH 1SN0A 3HOGA 4IIQB 4WY7H 2PR9A 3S0PA 3GPEA 1PBYA 5MHSE 3VJ6B 4DW2L 1WISA 4GXVL 2HVBA 1F5WA 1MXDA 4LGSB 2W65A 2XX0A 3PWVB 3VQ1C 3HG2A 4XBEH 2P4AB 5AOLA 5TGBA 5IFHL 3IU4L 4IKLA 2D7MA 1ROWA 4Y5VA 1T1ZB 1K8IB 2QKIA 2HLEB 3DO7A 3EH1A 4RAVB 5FWQA 5CLTA 1GKEA 5TDNB 3RDTA 3BGFB 4R90L 3ZDZE 4YAQB 1Z3GH 1JXKA 3CFKA 4JANA 3SBPA 4L2YA 3K8LA 2ICWA 4YVUA 5DJCB 4RX4A 3WJJC 3EYSL 3CBJB 4HBCL 1K8DA 2X3CA 4OJFL 4WY7L 2MIZA 3VXUD 2VXQL 3RTLA 2MFNA 1NAMB 3CZKA 2W1NA 5DDHB 4CUCA 4W9EC 1B0WA 4O02H 1RFDL 5DI8B 3U4EB 4YZFF 1KY7A 3QUYC 3BP7A 1MCRA 1R33A 3G5WA 4PR5A 4D9QD 4LLMA 2J4WL 4PU2A 5IMMB 3GJFB 1HH9B 3WGVB 3ZVVA 3S5ZA 3GHBH 1AVAA 2D0HA 4PWJA 5HGHB 4OFPA 5IQ9A 4MJIA 1DBAL 1Z66A 4XP1H 3LPWA 1JTOA 1D5RA 1KBVA 3S4SA 2D73A 2Q0ZX 3OR6B 4NQVA 4XAKE 1BGXH 4G5ZL 5FO9A 4OLVL 5ICYB 2J88H 1ZLSL 1F90L 2VDOB 4D3CL 5IB4B 2FJFB 2VT0A 2GKIA 4AY0A 4QAWA 4AV4A 1IGFL 3RGHA 4OKVB 5M94B 1MCWM 2B3IA 2P8MB 4EI5D 5MENE 2PW2B 4FZEH 1NL0H 4MQXD 5F1NA 2UV3A 5IJBC 2IOIA 2QVKA 2DV6A 4KVPA 1ZKAA 5LAXA 3UO1L 3SGDH 5I1KL 1AGBA 1WA2X 4ALAH 1F1DA 4JHAH 4ZDHA 3V2AR 3WTUA 5D1QC 4D7PA 5KSAB 4FFVC 4Y9BA 4R2GC 4K71B 4IRSA 3DX8B 4M8UA 4ZO8A 1MCQA 2FEDD 1XSIA 4YIQB 2BNRD 2F53B 4GBXB 4XAWL 4HIJB 1EJFA 4KHXL 1CLZL 2BS9A 2IH8A 4EI0A 2A5UA 2Z92A 5DRWB 1TIUA 4PVLA 1OE1A 4ABVA 3OF6D 2NXYC 4MKMA 1ZVNA 5CEXA 1A1OB 3QUMA 5EUKB 1E3ZA 2I27N 4KXZI 4Z7AA 3LXCA 1FRGH 3B5HA 2D0FA 2RMNA 5FOBB 4F91B 3REWB 1AD9B 1AG0A 2BHUA 3BDYL 1P5VA 4Z9KB 2K8QA 4JE0A 5GJTH 3RPIB 2E7LC 3HUJA 1IFGA 3IBOA 4X6EB 2K70A 1A7RH 1ZT7A 3FHEA 1QLRB 4N2AA 5JHLL 3WFDL 1BBDH 5C70A 3KLQA 2WHVA 1VGKB 3QQNA 4ODHL 4PWHA 3FN3A 3CFJB 1FV1A 1KZYA 1SN5A 2I85A 4DEUA 5D7IE 1YO4A 5DGRA 1E9OA 5ELIA 5D1ZA 2WB1A 2ZYSA 4LSSL 3SKMB 2IALA 4WNQA 3KGUA 2FEEL 4HAFA 5EZIL 1CFQB 2AI0H 2X70B 5IW6B 5CUSH 1QRKA 3UZEA 4ODUB 5DMGC 2C34A 3A3YB 3O0RH 4YWGH 4YE0A 3SDDB 2VL5B 3MLRH 3OAWA 4K5OA 4JO4L 4LHJB 1CCZA 3EYSH 3IGKA 3QR0A 2CIIA 4ZPVA 4EUPB 2QV2A 4AEIH 4S10A 3BAEH 1PJWA 5BOJA 1W72A 1MFBL 5J89A 1S7UA 1DCEA 4YK4B 1FJ1B 4S11A 3DVGA 3ZRCC 4H44C 1MHEB 3T0BA 1TJXA 4MAUH 5C7XH 4Y16D 1PZSA 1JGEB 2PWDA 3QRFM 1IBFA 2E59A 3SDYL 1UZ6F 4Q9BA 1MRDH 1GHFL 3H9HA 4Q97A 5IQMA 4MNQE 3B34A 2NZ9C 1FZJB 4JO1H 3T0AA 5AKSA 1BZ8A 4XP9L 1LEKA 3X13B 5DS1A 1Z5YD 2C9XA 5EN2A 1WAAF 4GXVH 2FLMA 2PWEA 4Y2DC 4FLSA 5LBVA 1I7UA 5I73C 1OE2A 3CDFA 2W0PA 3SE8L 3RJOA 5HGBA 1ES0A 3CHQA 1J5DA 4QHLA 1J8HD 1F58H 3QJVB 2ZAHA 2C3HA 3WOVA 1RZFL 1A6UH 1N70A 3DLQR 3LYRA 1TU2A 5FO8A 3UBXB 2CGZA 5I6XC 5ID1A 5BS0E 4NJAH 2IWEA 3GMOB 1RJYB 5ACZB 3N50A 1T4KB 1U42A 2DI7A 3H9YA 4KKLD 5EOQH 1MWOA 2OJZH 5FOBA 4BIKA 4GG8B 3CLEH 2YPKA 2XC8A 3QNFA 4HCRH 3PHOB 3QDHA 4L9LC 3Q3GB 3K8MA 4ZO9A 1M7DB 3SY6A 2F15A 3HC0A 4WFEE 4WNSA 3T8XB 1JZ7A 1HKFA 5C0CD 4G6AD 3KDMA 5I1CL 1S8DA 1VEOA 2IGFL 3L1GA 3NSJA 1QR4A 4O9HL 2B59B 1NFAA 5FUOL 5FUCC 1X5IA 3HNSH 3BKMH 4EUPH 4XO5A 2EXYC 3R19A 4P23D 2W59A 4G72B 4F2MB 5FEBA 1T7WA 4BXVA 1G9ML 1DVZA 3GKWH 5AW7B 5HYQB 5HYSA 3S9DB 5CJXA 3IXAB 3MVSA 3GD1C 3FHQA 4G8FA 3JYBA 3ZTJG 4MZIA 1SUJA 5INCA 5J1AB 2P26A 1WIPA 4DGVL 4M4RB 2Y1YA 1NFDF 2FSDA 4LIQE 5KYYB 2APFA 4PLKD 1TQCC 4R0LB 2WSPA 5IW3A 4K9EL 3MRDA 4MZ3A 5HYJB 2RBLA 3TV3H 4Z7WA 2ZX7A 2A2QT 5ITBL 1Z2KA 2I07B 1GZHA 4ABUA 5F7UA 1Z1WA 4PCSA 4ZUSB 4MB3A 1IAMA 3O41B 4YDIL 1S3KH 2A9BA 3NZSA 1REIA 1JS4A 4JFSA 5E2WH 1BD2E 4DSYA 2X6UA 2YN3A 3VRLF 1HEHC 3QJHB 3QA3A 2GFBA 1KGUA 1NAMA 1UXWA 4NAMA 3JZYA 3VD2A 3NYKA 4WW1A 4X9HA 4QT5A 4DTGH 3ASOB 1C8QA 1SGKA 1LO4H 1ZT1B 4HS3B 4CA4A 4M6NL 2CO7A 3T0XA 1X44A 3FSZA 4P2RE 3SJVE 4HXBL 3PGDA 3UROR 4PJGA 4XNMB 1T6VN 4MAYC 3LD8C 3IGFA 5D2LE 5D7HA 4HHAA 1LO0H 2HG5B 3D0LA 2Q8BL 3EYUL 4IU3B 4JG0H 4PRDB 4Y5YC 4LLWB 1IV8A 4FFYH 5F7KC 5ICZB 3S8GB 4Z7WF 1MCPH 2CBOA 2UUDH 2DIBA 4PGDA 3MCLL 4P4KB 5C08B 3NFSH 1CFVL 2XBZA 4WTXA 4EN2A 4NRXA 4QOKD 3EH3B 3QSKB 4Y5XC 3DVNB 3BQUC 1RHHB 4Z0XA 3W9DB 6FABL 3IJSB 5E2UL 4G7QB 3NIDF 4EI6B 3OKDB 4LLAA 4WO4D 2HVJB 3TYGH 4ADGA 3FQ4A 1SDDB 5HHMB 2FZ3B 1SXAA 1CE6A 1MW0A 1RERA 2N7BA 3DX8A 4QHKI 5C0AB 5E8DH 1NDGA 4BZ2L 1J0ZA 1P4LA 3OR7B 1R5IA 3L9EA 1IZKA 1HAUA 1JV2A 2VR9A 3BVXA 4P2QD 4XNZC 5D7LB 1UJ3A 3LRMA 3WV0A 3MJ9H 4YSAA 1BLNB 4W70A 3AADB 5I1IL 1K2DA 3DMMC 5JPMB 1OOAA 2VDNL 3T04D 1JYVA 1EZLA 5E8DL 3G5YA 4QHPA 1LMIA 3WXWL 2X09A 5D7IA 4U7MA 3TTYA 4HXBH 4A2HA 4WI8A 5D7KE 4P2AA 1G7IA 1FIGH 1INEL 1I9IL 1S5HA 4MA3A 1AACA 4GO8A 1WBZA 1DE4A 1D6VL 2EIKB 4KJWC 3SPVA 1M7UA 4PJXF 5E2UH 1N3NA 3ES6A 1S7TA 3QEHB 1N0LA 1J8HA 2XZAL 4PW4A 3I02A 1S9VB 1MDTA 4U0RC 2HTLD 3D69A 5A2IH 1DBKH 2VL5A 2XVLA 4C58B 2X89A 3GUTB 1SJMA 2W0FB 3NCJH 4HUKB 1U6AL 1NEUA 5CBAA 4TNVK 4IRJB 4UCFA 3LB6C 5L88L 4MFHA 3S8WA 3OSVA 1D7DA 4QYOB 1UADC 2F53E 2AQ2A 3NH7L 5HDBB 2IMNA 2QR0A 3CVDA 3TPKA 5E9DA 5IR1B 2P5EA 5TE4H 3AS0A 1XHHA 4JVWA 4O2CA 4AZ8B 1P0SE 4U49A 1JTTA 3DI2B 3ZYIA 1QR1B 3WLBA 5GRVK 2NW3B 2ZPKL 2B4CL 4F57H 1PLAA 3QPQC 3SO5A 3ULUL 5TDOB 3KNBB 2PPAA 2CO7B 4JB9H 1PSKL 4Y4KB 1RZGB 2NXZC 2ZWYA 4QF1B 4F58L 5JR1L 2LTQC 3MI6A 4TOYH 3T2NL 3ULVE 2ID5A 4O51B 2EUVA 1CLOH 3GKWL 3KWVA 3TT3H 3IVKB 1IC4H 4JDVA 1ZHNA 4HPOH 4UT9H 3RIAF 2J1ZA 4G42A 3ZL2A 2TSBA 5EC2A 4PRID 1JGEA 3N9GL 3GHPA 1AR1B 4I48B 2NDFA 4L4TD 4F7MA 5TPWH 5EDXA 3PGFL 3KLAB 3T4YB 2VN5A 2ZXBA 3OKDA 4YPGA 1RPUA 1V05A 4Y4KC 3LEVH 4QTIL 1BZQK 4G8AC 4OCXL 2OMUA 5B1AB 2P9RA 2D4DA 1I9JL 1SEBB 4GRLC 4TQIA 2P49B 5A43C 5I18L 3BKYH 1QUNA 1NKGA 4WK4B 5ESVA 1N2RB 4YSSA 1RJLA 3N1PC 1CG9B 3NEXA 3QDGD 4WO4A 3AG3B 4O02L 2B2XL 1J9RA 1T2JA 2DLHA 4H0GA 1DVUA 1DZ0A 5F7FA 2IOOA 4IGBA 3T1WA 3BGMA 1RUML 5HJ3B 2YSSA 4NIKB 3C8KB 4DNLA 4H8PA 4HBCH 1W8OA 2BRRL 2MPVA 3WS6C 1Y1UA 4XN7A 4NQDA 4JJ5A 3D4ZA 3K0YA 5DSCA 4F8PA 5EORH 2TRYA 2FJSA 1U8CB 3RJDA 5KJ7E 2NY5L 2J8OA 4M7JL 5CP3H 3WEMA 4PD4J 2WK2A 4A7GF 2VJ8A 1FYTB 3TA3B 1U3HB 2X89D 4FNUA 3B1TA 1Z9PA 4I89A 4LF3A 4P9HH 4TQEH 4NJAL 5DQ9A 2APWA 2CLRB 2WYIA 5B3JE 2WCGA 4R83A 4K3JL 2BNRA 4JFYA 5A40E 3BP4A 2YR3A 3OSKA 3NBNA 2P43B 2HH0H 5EBMA 4HMEA 1MLCB 4QYOA 1ET5A 4XO4A 2KS0A 4M8QA 2O30A 3T65B 1CE1L 1R19A 4PTUB 4UDTA 1Q38A 2Z92B 1GC1C 1JPEA 5I1CH 4JN2A 2Y7QA 4WFFE 3QJHA 2J5WA 2ZWZA 1YA5A 1G84A 2QQQA 5CEXB 1I8LC 3O3BA 4M7LH 4XP9H 4FA8A 4NLAA 1VFAB 2R0ZH 1UHVA 2NR6C 3RVUD 3S34L 4CU6A 2K45A 1Q9KB 2AJUH 3DARA 3PIQA 5ERWA 4NN6B 2WBJB 4H2AA 4HWUA 1GGYA 1P5VB 2N4IA 3JWOC 1UA7A 4O51A 4HJSA 2DEXX 4ONGH 4KTEH 5D1XA 3MXVH 1BSIA 2FBRA 4XMTA 1E50A 4QOKE 4LASH 4X6CB 5ES4B 3OLEA 4OQTL 2BP0B 4ZYKA 1KCUL 2WAQA 3NZHL 1L9PA 3DRTA 4Y2NA 4DN4H 5KBMA 2ZTBA 4JDTL 4RVBA 3FB5A 1T7YA 1CICD 4J3TA 4X0NA 1CDCA 1N26A 2R7EA 2IDSA 2YUZA 4IMKA 3QEQE 4B95C 3LTVA 5BQ7B 1FDLL 3EYVB 2UX6A 3K3QA 1W15A 1A4KA 2E4FA 3LKRB 3GS0A 2OSYA 3ZOAA 4E9TA 4I77H 3ML9A 2VDQL 5E7BA 3CZFA 3MRCB 1HWHB 1C5BL 2FJHA 4DT2A 2NY2C 1YJDC 4R7XA 4WKXA 4CBPA 1NGPH 3TS8A 5E5MB 3T9WA 2C7FA 4M43H 1AKJA 4G8IA 4JY6B 4WUKL 5BV7C 4F8TA 4MCYA 3VNYA 5GJTL 3VXPB 4OZHB 2R0LL 3G5YB 4IDJL 4JM2F 1RUQL 3FO2B 4WZ9A 5A3ID 4BWWA 4E0RB 1KEGH 4G7RB 4PJBF 1FYTA 1UD8A 3BPLB 1L9QA 2AAAA 4FQIL 4MQSB 2W5PA 3U9WA 4R4BB 2ENJA 4Y1AA 3ZE1F 5C3LD 4OF3A 5E6YA 3LDBB 4KPHH 1U8IB 5GRWA 3ZHFA 2WMPA 3NZUA 4XCEA 3KLKA 1MRFL 4QY8B 1LXMA 4JFVA 4L8BA 2EDJA 3A4AA 5F89B 3WY1A 3MBXL 2PNDA 5L2KA 3G9AB 2F53A 2HYMA 4ZZKA 5KBNC 1A4AA 4LOFA 3RA7L 1PYWA 4IOSD 1BD2B 1RU9L 1O75A 1TPXB 4ZUTB 2Q7YA 2R51A 3UO1H 2WUCH 5I8OL 4YSQA 1VCAA 2DQMA 4ZMQA 4OLYL 5FM5O 5MI0C 4CN1A 4AH2B 2R4SH 4BFEA 2V0AA 5BO1L 3TNNA 4APXB 5J4MA 2LAGB 5I6XB 1PX8A 3N2JA 5GGSB 3O45B 2PUQT 1ML0A 3LAFA 1EJ6A 4L4VD 4HIQA 1YCSA 1FFTB 2IANE 3D34A 3PDDA 4JFWA 5CHNA 4D8PA 1N9PA 1JF1B 4YHOL 3OC5A 3WHE1 1KGXA 1N64L 3BPNB 5AYUH 1WG3A 1LLAA 3LIZH 4JKNA 5C8JB 3ELQA 3EFDH 1XB6A 5AYQA 4QD2E 1OW0A 2BHYA 4O00A 1E27A 4JKPH 1AHMA 2J1YA 1MNUL 5FIEA 3TO4D 3LPPA 3DRQA 1OARH 4ZX5A 3WLWD 1IBDA 3UIZA 5TE6L 2W07B 4LSRL 4NP4L 4L3FA 1OF0A 1AYRA 3AJ7A 4J3OC 4W6WB 1A9EB 4IK6A 4XP4H 1JZHA 3CMOH 5H4YA 3HI6L 4JREB 3QNXB 3HPLB 3QZOA 1Y6MR 5DZAA 1CVSC 1C5DA 1JVLA 2ESVB 4AK1A 3VH8B 1NGPL 1JD9A 2WVSA 4PGCA 3TZVD 5DEJA 4IQHA 1SEQL 2Y2YA 4HCFA 1RIUL 3T08A 2KH2B 4UILL 2DJ4A 5DK0B 1WC7A 1YMME 2VE6A 3W0WE 3U2IA 3M1BA 5LB1A 4B53A 5FLUA 4WV1C 2GFBB 3EZJB 1F56A 4XBPA 3V0EA 3LPGA 1KBGH 4Y5XA 3E2HB 2VAAA 3DGGB 5DVMA 4U6VL 1O7SA 1J0HA 3P11H 4TNVF 2ADIB 3GSUA 4TVPH 3D39D 1TVBA 4OQTA 4K94C 3DYOA 3MNZA 5F6IB 2KHAA 2XWTB 2E86A 2GUYA 4QR7A 1NBQA 4FHBD 4B9JA 3HS0A 4HKBB 4L8BB 1YN7B 3L3GB 2FH8A 2X2HA 2PP9A 4X83A 4LMQI 4A39A 1LO5A 1R46A 1BEXA 1U8JB 1VFBA 4HS6B 4OM1H 4FQJH 1DHKA 2AMGA 2IDUA 4ZO7A 5IUCA 2F61A 1VZGA 3G6JE 3FT3A 3L7FB 1UM5L 2V6HA 1ZMYA 4G43B 4RMRA 4MNQA 1MCCA 1NDMB 1KTRL 1TQVA 5B7EA 4TNEA 3AT9A 3LNEA 1FC1A 3M1OA