2CHDA

Crystal structure of the c2a domain of rabphilin-3a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
TLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RABPHILIN-3A
publication title Structure of the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2chdA00
2CM6A 1E7VA 2JQZA 2K45A 4MJJA 3KWTA 1E7UA 2K8MA 3L9BA 4FULA 1DSYA 3F04A 3PS6A 3QAQA 4F91B 3R7RA 1TJMA 3DBSA 2CHXA 5CCHE 3TWYA 3ML8A 5G55A 4OVUA 1E8WA 2WXJA 3RDJA 1K5WA 3HHMA 4NPKA 4A55A 4FJYA 3L4CA 4LCVA 4PS8A 2YOAA 3T8MA 5CCJA 3CSFA 5JHAA 3FDWA 1DJYA 4J6IA 1DJHA 4XE0A 4NPJA 4L1BA 4QJ4B 1QASA 2B3RA 2NSQA 5KJ7E 1E8XA 3FBKA 3QR0A 3MJWA 3B7YA 1W16A 3R7QA 1DQVA 2Z0UA 3PYCA 2D8KA 3F05A 2RD0A 4ICXA 4Y1TA 3F00A 4DNLA 3QK0A 2WXPA 4V11A 2WXFA 2WXHA 2CHZA 4L1LA 1HE8A 4L2YA 3APCA 3ENEA 2YRBA 2A5UA 5G2NA 2WXGA 2X38A 2FK9A 3F01A 1QATA 2Y3AA 3NSJA 1DJGA 4URKA 5H4ZA 2CJSA 4L23A 1RH8A 2UZPA 1BYNA 3M7FB 2ENPA 1DJZA 4NS0A 1BDYA 2WXMA 4QJ3B 2WXQA 4F92B 4WWPA 1TJXA 2CJTA 2WXNA 1E8ZA 3W56A 2QZ5A 1UOWA 1DJIA 2K3HA 2A4ZA 3RPBA 2WXRA 4FJZA 4ANVA 1A25A 3JZYA 4WEEA 4ICWA 4F1SA 3ZVVA 2ENQA 3QR1A 4ANXA 4NP9A 3ZW3A 3QARA 2ENJA 2NCEA 3QJZA 2EP6A 1E8YA 2BWQA 2ISDA 4JPSA 4OVVA 3ML9A 2ZKMX 4ANUA 3KWUA 4FHJA 4LDCA 2NQ3A 4FLHA 3S2AA 4EZJA 4KZ0A 4TS6A 4GNKB 4BGDA 1V27A 2DMGA 3GPEA 1UOVA 2FJUB 3PRZA 4GB9A 1W15A 4Y1SA 3P2BA 3L08A 1E90A 4XZ4A 1WFMA 3OHMB 2LHAA 4IHBA 3DPDA 4QJ5B 4FA6A 1YRKA 3APFA 3PREA 4EZKA 4FADA 3L13A 4EZLA 3W57A 2WXOA 3PFQA 4ANWA 3N5AA 5T8IA 4F93B 5EDSA 2CM5A 3HIZA 2DMHA 4XX5A 1BCIA 1CJYA 3L16A 4G11A 2CHWA 2WXIA 2V4LA 3IM1A 3IBEA 4QAMB 3NZUA 2R83A 3L17A 5H4YA 4KZCA 4WWNA 4DK5A 2Q0ZX 5CCGE 2N1TE 1GMIA 4BFRA 3TJPA 3HN8A 3APDA 4LT7A 2Q3XA 2CHDA 4FHKA 4KITB 3ZIMA 4IQHA 4HLEA 3LJ3A 4HVBA 4TUUA 4WAFA 2WXLA 4PS3A 1DJWA 2K4AA 2KI6A 1DJXA 3TL5A 4WWOA 1RSYA 5JHBA 1UGKA 3NZSA 1RLWA 3OAWA 4AOFA 4AJWA 3SD5A 4TV3A 3CSTA 2WXKA 2QZQA 1WFJA 4PS7A 3L54A
chains in the Genus database with same CATH superfamily
3IFLL 4POYA 1TPXB 2J2ZA 1NCTA 5H37H 5L2KE 3GB7A 3UH8A 4DT2A 1E30A 1K5NA 3DBXA 1F18A 1DZBA 2YMOA 3F04A 2GIXA 3L3DA 1HXKA 3CBJB 1MI5B 1WS7A 2FDBP 4LLUB 5J4MA 1ET5A 5D8JL 1FO0B 3E6FA 1FNGA 3U6XA 5KVFE 1KCSH 5C86A 1GAFH 3NIGF 1KPRB 2QJDA 4PYHA 2PYEA 3SPHA 3ZX1A 1ORQB 3O6MH 4L3CB 1PD6A 2VMJA 5ILTH 2HKFH 2XZQL 2BY2A 2OL3L 3CXHK 4J3VA 1BQHG 2YXFA 4GRWB 3UP1A 3D0LB 1HS6A 2VOTA 3IJ9A 3EXJA 4X4ZA 4LU5H 3VX1A 1W0WA 5E08L 3N06B 3HMXL 2IV8A 1ZIBA 2DWDB 3L5WB 4XXDA 5I6MA 4FQXA 3DK0A 1FVDA 2WIMA 4O2CA 3M1CA 4ZW6A 4PWIA 5BRQA 2YA0A 4YHPA 2Q10A 4URKA 3SO3C 2OMZB 1R46A 3LB6C 2FHFA 2NY0B 1G5AA 4FE9A 3LQZB 4P57B 5TE6L 4KTDH 4IU2A 2G5BA 2BY3A 1SEQH 3RDTA 4DO5A 4B27A 5C9JB 2QZ5A 1QLFA 4YIQA 5IB2A 5MEND 3T6WA 1TYRA 1ZTMA 4NQSA 5F7YC 2HWZH 2X89A 2HPOA 3SPIA 3FH8A 1TU2A 3KG5A 2WNKA 4CNIA 3HE6B 3LKOB 1OTUD 3ZUNC 4JE4B 4KPHH 4NUGH 4GUPA 4HZ1A 1XF5A 1J9QA 3AREB 5LCVH 1HHIB 1URIA 2L7UA 4OCSH 4QHUA 4KO9A 4Y4FD 4X2UA 4BELD 1P6AB 4TYUA 5HVGB 1XGUA 1A7BA 1ED3B 2BIOA 3GSVA 4XWOC 5GS0D 2CR6A 1N6QH 4BA8A 1IIIA 4DW2H 4NWTL 4K0OA 4WF7A 3NIFB 1BBDL 4JRYD 2E8YA 2W9DL 3BDBA 4JHWL 2AQ2A 3ZYOA 4D2NA 3FJTA 1TSHA 4Y1AB 1KBKA 5IT2L 3NFNA 1WBZA 1G84A 2ZF9A 2R83A 4WO4D 1E9OB 4FXGB 1QEWB 4IJ3B 3FHEA 5F6HJ 5TDPA 4IGBD 5AW3B 5E2UL 3GXTA 5J7CC 1MNUL 4HJ1A 1HH9B 3GUTB 1G5GA 1T7WA 4L0PB 1XD1A 5D5MA 4NQQA 1PW3A 1QZNA 1Q8MA 4G6FD 4QRRD 3KLHC 2DLIA 4DGWC 1S7VB 5EMYA 2ZXAA 4MNGB 4QWWC 1THCA 1R24A 3UO1H 2GI7A 1QRNA 3DMMD 3ET9F 1M7UA 3QUZD 4X7TB 4CVXB 3LNFA 4NQUA 3AWEA 4TNWK 3IJHA 4QHKI 1UZ6E 4KJWC 3HC0B 3D4CA 1UUNA 4M1DL 2APVA 3GM8A 4IRZH 3LVTA 3QIWC 3VWKD 3EH4B 1KIRB 2NY4D 3NCYS 4ISVA 4N8CH 1A14H 4F37K 2ENSA 3TZVD 1NBZA 1ZHNB 2B0SH 1UJ3A 2YPLB 1PCXA 2UX6A 3HNTH 3MFGB 5BS0D 4XE5B 5EZLA 1AQMA 4FNRA 1F56A 2PW2A 3TVMC 1AMXA 3MI6A 5HYJE 2WTRA 3HN5A 4K3EH 5DK0B 3FN0H 5DJ2B 4GJTB 1X5AA 3FT0A 3EJJX 3AACA 2DQTH 2ZUUA 1JZ6A 2FB4H 3OR6A 4JKKA 3IGAB 2EIZB 1B4TA 3IXAB 4E0RA 2QV4A 1CU4L 1E2WA 1SDDB 4U1JA 1J1OH 3FQWA 3ME0A 2CGRL 4X6CE 3ZKSD 4DGVL 2IAND 2LQRA 3GSQB 4QHPA 3JWNE 5B8CA 3DO4A 4L2LA 1SLWA 3DHPA 5C0FB 4ENZA 4UQ3B 5D1QE 1FYTE 2AVFA 1FORH 3MLUL 1C5BH 2HLFC 2CJTA 3IJSA 3KGRA 2BINA 4QRUB 4AXWA 2EXSA 2HJKB 5A2JH 4PJAA 1JPGA 3KGTA 1QSVA 1QBLH 4PW9A 4N28A 2XOTA 5EZOH 4JCLA 4L0ZA 2Q86B 3CC5A 4OLXL 1H0DB 1IQWH 2ISDA 4UTAH 5I76B 1MJ7L 1WEJH 3OM3B 2CR3A 4X9YA 4GBXB 4RMQA 1KGXA 2VMCA 2C4FT 2OMXA 2XTJB 5DO8A 4ODTL 5K1JA 4KROD 4Y4HD 5E8OA 2EAEA 3F7PC 4GT7A 4YPJA 2ADGA 2QFPA 2CCVA 5I16B 4FQJH 2R9HC 2ZG1A 2AK1H 4P9HH 1CDUA 5TF1L 1N3NA 2AQQA 2KS0A 4GRLC 1A8JH 3ETSA 2WXOA 1RK0A 2X53A 4M7KL 1UXSA 3PNWB 4P2OA 4PJDB 5J1AA 4UV4L 2ZD0A 4MAZA 1YYML 2JSFA 2X9XA 4TVPL 1I1RA 2W81C 4HCIA 4JFTA 4FYRA 3WUWA 1N6VA 2YAFA 3KPPA 4HGMA 5C2UB 4P23D 1IBGH 3ZE1E 1E5AA 3O9WC 4HJJL 1JWMA 4JVUA 2ATPB 4JFXA 4RGND 4Y5YB 2WQXA 4G5ZH 2UYLA 1KYDA 3QUXB 3AU1A 3EYVB 3NJFA 4ZFQA 4CU8A 5HVHB 5HVWA 1AY1H 5E94A 3FU0A 4PGBB 3D4ZA 4B9GA 2QLVB 4FZEL 5LG6A 4J1UA 3F64A 1IC1A 4FQ2H 3LZFH 3DX2A 4XVOA 2DQFB 1A7QL 2DAVA 4LARH 1XR8B 2G3MA 4Y9CA 1C12B 4ELDA 3BH9B 4AEEA 4OLYH 1JHKH 5B38G 3S2CA 1I8MB 1EAQA 3GTVA 3MLSH 4R2GB 2XI9A 2ZUXA 1NWPA 3P0YL 5EF1A 3EUDA 2Y69B 3DPBB 4W9JC 3SDCD 4ZW7A 3ULUC 3D85B 5CIPB 3Q06A 3ZYIA 4NAJA 1KENH 1NCJA 3F12A 1RJYB 2BNUB 3ESMA 3FQ2A 2A99A 3LD8B 2BSED 5C6TH 4ZOEA 3R7QA 5HYJA 3S96A 1A22B 4U33A 1LO3H 3DX7A 4B9FA 4PJ7F 4NWUL 3V8CA 4XB3A 2HYMA 2XRAL 5DJ6A 2A9DA 4A38A 1OTSD 4RQQB 4JM2A 3I50H 3EHBD 3NSJA 5K1NA 5EULV 2AGJL 2A4CA 1CFTA 5CUSL 3BKCH 3N9GL 2GSGA 3QE5A 5TGBB 4JB9H 4ELME 4FCAA 5D1QA 1FYTA 3S4SG 4ZG1A 4Z5RB 4KXBA 1G87A 1F3JA 3WHE0 4GO6B 3FK3A 3AU0A 4ZFGH 2HLEB 2GPZA 1QUNA 4ANXA 2R8SL 4F1ZA 4CVZA 1WA1X 4JDEA 4H8WL 1D5IL 1A02N 2DD8L 1HSBB 1NA8A 3OKNB 2I85A 4XNBA 2JI2A 1ZT4B 4L1SA 4I3SL 1KCVH 2H26B 4KZ0A 3OPUA 4PRHB 1Q0YH 5IK3B 2AXHA 4PBWD 1B6DA 4PJ6A 4YHML 1YLBB 3IDGA 5GGUA 1OSPL 4NNPL 5EU6A 1MRCH 2B7DT 2X4OB 4Y2NA 4RGOH 1YRKA 3H4FA 2F5BH 2R1XA 1ZSDA 2AERT 1D5XA 4D0DB 4DTGH 1E6JH 1FVEA 3BGMB 1TTGA 1A2YB 3SKJH 4LHUG 1U93B 4M9PA 4P4KB 2WLKA 2EC9T 2AQNA 4HUUB 2VDNL 2XNAB 3C6SB 4P46B 5CCGE 2Q6WB 2OXGA 2QQLL 3UTZB 1MCDA 1NEZA 1R5WB 1T5KA 1TQTA 4Z7OB 3TC9A 5KYWA 1MCOL 4S11A 5I1JL 3KL5A 1NCGA 2FJFA 3RURA 5IVXB 1CDJA 4K2UL 1LM8V 1F42A 4BZ2A 4JCWA 4JPIB 1PZBA 3GHPA 3UAFA 5C9KA 1HAUA 1J1XL 3D87B 2E9IA 4K7FB 3GHEL 5EEXA 2IOOA 1JTPA 4OF0A 3MACL 3WIIH 4PS7A 3X3GH 1BQKA 1DN2A 1EBAA 1Q0XH 1G7IA 4AIEA 3WJLA 3T09A 1JNNL 4R4BA 5ALBL 4DZ8A 5AG9A 1E3FA 2A77L 2IFFL 2C34A 3JYCA 3O41A 3VXUE 4G6AD 1Q9KA 1DVTA 3GEWB 2EDLA 1D2OA 1TT6A 1BPLB 5DUJA 1J8HE 1AOZA 1BG9A 5J12C 1UA3A 3O2VH 5DHYB 2Q20A 2XWZA 4K5MA 5E4EB 2KBGA 2BIHA 3S35X 3QISA 3SZKC 1NCIA 1YVLA 3CMOH 4YQXL 2Y06H 1H3GA 4R8WL 1MVFA 3OJDB 4NZRL 1I75A 3FF7A 2RFXA 4Z7AA 1Y18A 4BSWB 1VZIA 1MW3A 1GGTA 3FB6B 4X6BA 5EFIA 5GRJL 4AQOA 4LFHG 4U4IA 2OTPA 3VXNA 2UUDH 2EC8A 3KE0A 4JAMB 4GMTH 4NO2B 4OY9A 3TBSB 1T22B 4NKIL 4HKZB 4ELMA 4XCYA 1INQB 4ZMLA 4MCYB 3BPCB 3W56A 1AFVL 1ZT1B 3QG6A 4FQXC 1N59A 1NBYA 5BJTA 3TPKA 3TA3A 4JFED 5D7SH 1G9NH 2YHGA 1Q9OA 3MKKA 3FO1A 4UM9A 1OM3L 3FQTB 5INDB 3FCUB 2VDNB 2ZCKL 3IFNL 1Z3GL 2YKLL 4N0YH 4QXTA 2F0CA 1FCCA 3RDTC 3PWVA 3CBRA 3ZTDC 1FO0H 2NX5D 1YQVL 2VLJD 3WHXB 1UT1A 4MLSA 4XC3H 3BO8B 1KXTA 1CXKA 2Y5TA 3PREA 3NN8B 4R5VA 3S6CA 2VR8A 3D18B 1QFOA 4WU7A 4Y8AA 4WY7H 5SWSB 1KN2L 5EIIA 5C0AA 4AYFA 1Z9NA 3US1A 1X44A 4GRWH 1OOAA 3M8OL 2OSLB 4Q74A 1GA2A 4NDMA 3FB5A 2CK2A 4ZT1A 3UCRA 3ESOA 4B97A 1HJCA 1RULH 2C1OA 3FFDB 1GGBL 4UDUB 1IM9D 5C0GA 1E50A 4GMSL 1QX1A 3I9GL 2DKSA 4P8QA 5LGYA 1D3CA 1QHOA 3QJXA 1WD9A 2YBRA 2MHAA 2GAZB 3L4XA 4D0CA 1J8RA 1XDTT 3WN5B 1V55B 5JDJA 1NGQH 2J55A 1TJGH 1TJMA 3O6LL 3UYPB 1E5BA 1AXSA 4GG6E 4NFCA 5FB8A 3ZDZF 3SYOA 3SCMB 2HH0L 4XT1C 1SVCP 3CIQA 4HXBH 5IMLB 4FNQA 2WGNB 5D7LB 1MRFL 3RL2A 2MJWA 2Z91A 3IFLH 4XX1E 4C58B 3RGHA 2NXZD 4OFIA 3B2UD 4JFYA 1R34A 4A2FA 1UJ3C 2GJ6D 4N1HB 1DN0A 1S9XB 3IU3A 5C07B 4EQ3A 5D8JH 2CJSA 2Z7UA 3SDDA 4K3DH 3S3SA 2AJXL 4DCQB 1M9SA 1OP3K 4PRBB 4Y7MA 1CE6B 1E2VA 2QPSA 2FD6H 4G6ML 3V7MA 1DQIA 1QVOB 3CFBA 3U2JA 2Y9RT 1BYPA 1ZANL 4QHNA 2XZQH 1EDQA 2OL3H 4MDIB 4F1SA 1XSOA 3BQUD 3CHRA 1IMHC 4HSAC 3ALXA 1PEWA 1YC8A 5T5NF 4AKOA 4OZHB 3HMXH 3AT8A 5B8CC 1SRDA 1VGKB 3OF6D 1D9KD 3MRPA 1JF1B 5SX5H 3SKOB 5F0JB 2CA4A 4P2QD 5DRZB 5DT1L 3HG1B 4Z3IA 1O0VA 1BFOB 2HX8A 3P4MB 4YSTA 1X5GA 5IHHA 4PG9B 3PIQA 3QZBA 3RPIB 2W1NA 1YNTF 4ORGA 4D0BB 3G04B 3VH8B 4PS4L 3FB8A 5TE6H 2E7MA 2R29A 4H1LA 1PKQE 4BA0A 1FNLA 1HTYA 4KK5C 1XH1A 3IDXL 3O4OB 1FA4A 5E6ZA 3HOGA 3WFCL 4ZXBB 3D3VB 3QJHB 4ZMNA 2XFGB 1MLBB 2DWTA 3DVNB 1N26A 1SXNA 4HUVB 3BP4A 3HW7A 3LHPH 1Q1JL 2YD7A 4BUHA 1TVBB 4AIXA 1P7HL 3BKJH 1WA2X 2C3VB 2PPEA 3F5WB 1QUPA 1MW1A 4NI6A 3CXFA 4W4OA 4WIQA 4JDZA 4OV5A 5DJDB 1DEDA 4P2OC 2HMID 4KRNA 2KDGA 2BCMA 1AAJA 1Z9OA 5HD8C 1NICA 4NWTH 5DD1L 1SHSA 2GI0A 5F9WC 5I1CL 4U6VL 1BBDH 1X5MA 3QQDA 2TRHA 1JXDA 2W9DH 5F7EL 3A4FA 3FT3B 3V6FA 3IDIA 1X5JA 2QSQA 1OHZA 3WDHA 4L18A 1A6ZB 3GZKA 2ITCA 1WGOA 4ATWA 2Q8BL 5IT2H 4PJFF 1T4WA 1JXFA 5FFOA 4Y2OA 3ULVD 3MLWL 3U9WA 1QW8A 2F61A 4DEPB 4MJID 4N9GA 5C92A 3ML8A 4DESA 3ARDD 1PFOA 1NC4B 4KMLB 3RL1A 4PGCB 5E2UH 3Q3GA 2ICWI 3RIKA 4GG6A 1KACB 2YIHA 1MNUH 5CP3A 2Y2YA 4PVNA 3PHQB 4FQLL 3H7LA 3RPKA 1G1KA 5KJ7E 2H6PB 3DUSA 4UTBL 3ABGA 2R1YA 3H2WA 3QXTA 4LGPB 3Q6FB 4TLUA 3AFLA 4FTDA 4OLZL 4XMWA 2G4GA 5BXFB 1EQWA 4R83A 2P5EB 5BRZB 3KPOA 4M1DH 3QO0A 1N2RB 1B0RA 2RR3A 3PJSB 3QEHA 1J12A 3H8NA 2CBTA 3AS1A 2XG4A 1BDYA 4X6DE 1RK7A 4ZX4A 3IGLA 3KWVA 4PJHA 3WAJA 4G7QB 4JREB 4ES9A 1HE7A 1BXVA 1TCRA 3QJVB 4JM2C 2E7BA 3RZCB 2MTPA 4PRAA 5F8RC 2DYPA 4ZUUB 1H3PL 3FQXA 3BP6B 5F1NB 1OP3H 5CHNA 4HWBA 2IPTL 3NUKA 3MOBL 2BVPA 5D1QC 3W81A 4FFYA 4N2EA 2PCPB 1JV5A 4NQXB 5DVOA 4DGVH 5HHOB 2RHEA 1MI5E 1UHVA 2OLDA 2Q8AL 2XWEA 3O2DA 4RETB 2I9TB 1MSPA 2NTFB 4YSAA 4NAQA 3EOYG 1M71A 2R2HA 3MLUH 1SLUA 1JZEA 1PKQA 2A4EA 3IT8D 3MJ8A 4WLCA 5CU5A 3Q5TA 1E27B 2XXCB 2GEQA 3ECQA 4HFUL 3ZT7A 2ITEA 3MNWA 4ONGL 2VLRD 2WBJB 4FXKB 3SDXB 4GRWE 1WZKA 5GGSB 4OLXH 1F13A 2L0DA 1PIFA 3FUFA 4QYOB 1ID5I 1MJ7H 3BLKA 4AY0A 5EHFA 1TNNA 3M07A 5IIEB 1LO0L 4ODTH 3OKKB 2OI9B 4IS6A 1A64A 3SDYL 1QWUA 2YD1A 3TGXA 3PHOB 4AYMC 4I4WA 3QQ3A 3UBFA 3CZSA 1FAIL 1OK0A 4JCMA 5I1KL 1ZHBB 1XCQA 2VC2H 2NYKA 1ASOA 4M7KH 3PUCA 1MCNA 4IBQA 4N3TA 1AIFA 4MDRA 4LQFL 1JV2A 4UV4H 1YYMH 1A9EA 5C97A 1CURA 3BP5B 1RUPH 5SWQB 2EE6A 4PGEA 3KM2A 2D7MA 1TEYA 4U3HA 5ID0A 3I6LE 3SDAA 4XOCA 4GW5A 4HJJH 3HZVA 1W6LA 4PIBA 4FLRA 4L1HA 5SWZB 4CN1A 1OGTA 3HPLA 5JTWA 3WJLC 1MAKA 1IAOA 1EZSA 4P2RD 2F08A 3VFOA 4AEIL 2O1AA 3A23A 4WW2A 1A9BA 1JGDB 2X0UA 3C09C 3TN0A 3TM6A 1KNOB 4FZEH 1FN4B 1OM9A 3NIFE 4OFYD 4PP2B 1U8NB 5D2LA 1A7QH 4EN3D 4GUOA 1WAEA 3CFEA 1N64L 4ZFOA 1CI3M 1FZMA 2WB7A 2Y1ZA 3L4YA 3QS2A 5IB1B 3W0WE 4B0MB 1ZWIB 3P0YH 1U8CB 1CDHA 1I1YB 4OD3L 4UT9A 4IHOA 2OZ4L 1S3RA 5HGBA 1D5ZB 5EB9A 1Z9SB 3O6FB 4HUWB 1T80A 2WXRA 2QQKL 2ZCZA 4G8GD 4XXWA 4APQA 1RJLB 4MZRA 2WWMD 3UP6A 1HKLL 2X70A 1ADWA 4L1DA 4PP1C 2GTWA 3MRFA 4NWUH 1CDBA 2OV0A 2XRAH 5I15L 5J3HC 3CFTA 2ZSVB 3EYUL 4F33A 4Z7NF 1AIZA 1EUUA 3DSNB 1K4CB 5EEZA 2ZYSA 4Y2LA 5I8EB 2ZX6A 4NN6B 3MGAA 5CUSH 2B4CC 4NC1E 4ENED 3GRBA 3TA3C 2VSKB 3L3GA 1IKFL 2MOQA 2NXYD 5CBEA 2W9LA 4M7JL 3MO1B 1EXUA 2WCPA 4JZJB 2YPLE 1GZHA 4W4NA 5IEKB 4XX5A 2R8SH 1Z7JA 3GD1C 4H8WH 4N4YB 1O7DE 5FAAA 1D5IH 2DD8H 1AZVA 3HE7B 5C08B 2F5AL 4TN9A 4E41B 1OAXL 4I3SH 2DWDA 2GITB 2PTTA 5FA4B 4WEUD 1NUDA 4TL4A 3G08A 3B1TA 4YHMH 9CGTA 1R3LB 3AAZB 2BK8A 1D7DA 1OSPH 2BIPA 4HMEA 1UD4A 1DJWA 4NNPH 4QY8A 2WN2A 3DOIA 3UG5A 1UACL 1RD6A 3LV3B 5HGGS 3UO8B 3UBXA 5IVZB 2G2RB 4OZIA 4C59B 1U8KA 1PZAA 5KSUA 5C9JA 4PV9B 1GSMA 5AVXB 2GC7C 1XVSA 3EFOB 2WZ0A 4P5TB 4BK8A 4XPAL 4HBCH 3FQ4A 2VDNH 4N1CA 4YDKL 1VGEH 2M2DA 2QQLH 5G55A 1LE9A 2BSCA 3HVDA 4U1KB 5I1JH 1IBFA 4OZFA 1I7UA 2XTJE 2VMEA 4K2UH 5ANMB 2MNUA 3AREA 2BNQA 4OZGE 4JKWA 1J1XH 1HAWA 2PW1B 3RWFA 4HUCA 3GHEH 4U6YB 3F05A 4QI3A 4PTUB 4QRSB 3NJXA 3RY5A 2D0GA 3NA9L 4DKFL 1ZE3H 1HILB 3P0VL 4OF6A 1JNNH 3V9FA 5ALBH 3VD1A 4PJDE 3UXFA 1IC0A 1QACA 2XV0A 1VIWA 5I6OA 2XYBA 3W0WA 2A77H 3B2PA 2IFFH 1KT2B 1KXVA 3MCKB 3RWHA 3C6LD 3QYMA 1WZ1L 1SQ2N 2K6WA 1F4XL 1DVSA 4QOKB 4CC1A 3AQZA 5JOFB 3BFQG 3NIGB 2UX7A 1B0GB 2K3HA 3GUTA 2EYSB 4ANVA 1KCLA 5HI3D 3UG4A 5FECA 2HTLD 2MMXA 5ESAB 2W0LA 5I18L 1R3IL 4YQXH 3B3IA 4GAGH 5J6SA 4R8WH 4NO3A 2A38A 4NZRH 3SDDC 1XGZA 4QLRA 3T77A 1BOGA 2NXZB 5J9PA 1B2WL 1IBHA 4PRDA 5GRJH 2O6FA 2HAZA 3ESUF 1QSFD 4GXFA 4HGWA 5DQJA 3NEEA 4C56B 1D5MB 4W81A 1RZJL 4R7XA 4UINL 4PW3A 2XWBB 3DURB 4ZW8A 1J0HA 1KSRA 3ISRA 4GLRH 2HT2D 4NKIH 1M05B 5GHWH 4HW6A 4QCIB 4KH9A 5CN3A 4V1DB 3IB4A 3FN3A 1AFVH 2XWRA 1IE4A 1GMEA 5F1KC 2YPLA 1FRGL 5L2JB 1YEJL 2QSVA 2Z93B 4KKQA 2Y6TE 2WXIA 4F8QA 2OMWA 3QEGL 1OM3H 2Z4TA 1TEGA 2J25A 1UEMA 2ZCKH 3IFNH 4HJTA 5DS8A 1S7TB 1T1WB 1IARB 1Z3GH 4M48L 3IKCA 1SHMA 4GEIA 5HHME 3W39A 2WQWA 2BCKB 3AROA 4LLMB 4ACPA 3OZLA 4NOBA 5FGRA 3S36L 2Z8VC 5D70L 3OMNB 4OFQA 1YQVH 5F21B 3QPKA 4XP1L 2OYLA 2UV3A 5M95B 3B9DA 5AYUL 1ZGLB 3GRWA 4GQQA 4TULL 2EDRA 3CLWA 2ZNWA 1RJZB 5T1LA 3V0IA 2X6VA 1KN2H 2QELA 1YMHB 2Y24A 4WVRA 3U4EA 4OQ1A 4LPCA 1QPPA 4QXWA 4UQAA 4NHCL 4W6YB 4NXKA 4W4OC 3C5ZA 1SLXA 4RAHA 4TVPE 5L0QB 5EC1A 1RZFL 2ITDB 4NKDB 5I76A 1XB8A 3AWGA 4ODXA 3MUUA 2VN5A 3QNZB 3KYNB 2PETA 3V5KB 2P8PA 2VCOA 1GGBH 4JFQB 4MZ2A 3TBTB 1F45A 2B5IB 1NCHA 4GMSH 3TYFB 3FC8A 3I9GH 1EDYA 4OZGA 2YEZB 5DC2A 5E1GA 1J0IA 3GSOA 4ZMTA 1ECZA 4PV8B 1WD8A 3QRFM 2X5PA 4M5YL 4GSUA 4F7TA 35C8H 2ED7A 2FL5B 4LSVL 4LVHC 5ANHA 4Z7IA 1F02I 2F6AA 3VFWA 4XH2A 2AEPL 2L4OA 3ZZ1A 1SMAA 5KS9E 2EKSB 5I66B 2BS71 1VA9A 2D31A 1ZLVH 1DUZB 1MHHB 2ESVD 1I7RB 2Z3FA 3H0TB 5AOJA 5IMMA 5IVXE 5I75B 3MBED 2HH0H 1UOWA 2A4ZA 2MQGA 4WI9A 3AZUA 1X7QB 2IALB 2BW5A 2A73A 4UIKL 1AP2B 5E2WL 1MRFH 4I8DA 3QH3A 4LF3A 4PGBA 1ZS2A 4ZDHB 3B56A 2IAMD 3FOLB 1Z5YD 3RBSA 1G6RH 1C12A 1XCXA 5EZIL 4N0CD 3GS0A 1UOVA 3QCTL 2JJWA 2BHZA 4MDJA 4QXVA 4D9RD 3JVFC 3GC3A 4KDTA 2J5LB 3VO0A 4HSCX 2CUIA 4RGMB 3LX9A 4G6MH 3V7AE 4XNQA 3P77A 1ZANH 2DQ6A 1JTOA 4KNTA 4PJ9D 4WHTA 3D85A 3GTNA 1S5IL 5MP6L 3FQUA 4I7ZC 1RJYA 2JJUA 4E2OA 1PAMA 3UAJA 4KKPA 3B43A 3SKMB 2NZ9D 1BBJA 5LAXA 3Q7JA 5TPWH 5DT1H 3KHQA 3SPJA 3UACA 1EGJA 2W94A 3WHE1 5F3BA 1KB3A 2I25N 3WO4B 2AV1B 3TEXA 1K8IB 4PS4H 1KUMA 4TLKA 3UTSD 5D1XB 1I8AA 4P3DA 3UL4A 5DQDL 2IH9A 2I60L 3LKPA 1P69B 4GIPD 5D7JD 5TGBA 3ERXA 2NNCA 3IDXH 5E6UB 3VX0A 3PDOA 3WFCH 3RX5A 4CVUA 4A7UA 3ZTCC 1X7SA 2C9SA 4LPXA 2YN5A 1A0QL 1CMOA 3TF7C 2Q2LA 5I23A 15C8H 1JF6A 3VMNA 1P1ZA 1QI5A 3GGWA 2OTUA 4WKZA 3WKQA 4KTYA 5ECJE 5SX4H 5I6XC 4GUQA 4JPVL 3K0YA 4AW4A 4M8UA 6FABL 4IKLA 3LKQB 5GIRA 3K4AA 2H0FA 2I5YH 1FSKC 5E6RB 3LRKA 1VB9A 2JXMA 5KSVB 1DQVA 4H8HA 4NM8L 4RMRA 3IDJA 5DD1H 4U6VH 2NY5C 2WOBA 5F7EH 1OF0A 2EINB 3L4TA 3T0AA 3MRKB 2NR6D 3RG1C 4YSEA 3SDAC 2BSDA 3CZNA 2Q8BH 1U93A 4FAAB 1FFTB 4P4KA 3MLWH 2JK5A 2WVSA 5KS9A 4YHIA 3FSZA 4UWQB 5ESQA 4P46A 3K6FA 4PBDA 4FS0A 2WP3O 2WPGA 4WW2C 3TN0C 3KBFA 3M17A 1XV8A 3IJEB 4LZKA 4PRPD 4RX4A 4UT6L 1UH4A 4FTVB 5KEZA 3PNRB 5FM5O 3T2OA 2YKKA 1VZHA 1I1CA 1XGYL 2WTPA 4ICWA 1BA9A 1DBML 2BS8A 4YDLC 5FKPA 4UTBH 2Q87A 1MCJA 1ODUA 5A16A 1SVBA 3EOTL 1EEUA 1U8LB 2IWFA 2C9PA 2P8MA 1BLNB 3WKPA 4AQAB 4PJ7B 5E70A 5DHEA 1Z5LA 2UZYB 4EN3B 3DTXB 4FOMA 4DK3A 3H3BC 4UQ2B 3IDNB 2WKOA 2P45B 4PWJA 4HXAL 5KN5B 1U91B 4Y5XA 3T4YB 1ZT7A 4Q4EA 3OKMB 1CLYL 3SKNB 4XXWC 4APQC 2X4UB 4K3HA 1I1FA 4CADA 3TEYA 3MU3A 4LHUD 1W2KT 4I0PD 4CSSA 2ICEB 3PWLB 4XNZC 1KFAL 3S3PA 1R5IB 1OB1B 3U82B 2NSMA 3CGTA 5FV2A 2R0WL 2VKWA 3L16A 3IETA 1IE5A 5D7LE 1WT5A 4A37A 3FB7A 1AO7D 1PLAA 2LFEA 3VM7A 2YSSA 4EI5B 4BQCA 3MOBH 5I2IB 4Z95H 4YN3A 5ALCL 1QSEB 4MA1C 5DC9B 1I31A 1XGPB 1GZHC 1Q94A 3DX8B 5C07E 2Q8AH 1WUZA 3QIUB 1AR1C 3L2LA 2FHCA 3NJNA 1BM3L 1P0SE 3UERA 2C7UB 3AQDA 4R3SA 1WFJA 5F9JB 1OPGL 3E2HB 3QFDA 4HFUH 2AAAA 1C08B 4KK6C 4ONGH 2PN5A 3O4LD 2FEDD 3VQ2C 2NY1B 3MGOA 4ZO8A 3OMIB 3N04A 3KLQA 1SY6A 2O93L 2HA1A 2A9CA 4OZHE 4AYBA 4JO1H 1SJHB 5ADPL 1F58L 1JVKA 1Z9PA 2X44D 4WSGA 1LO0H 2JMRA 1IGYA 3HG1E 3FPYA 3SDYH 4CUCA 3HHSB 4WEBL 3D08A 5DWUL 3FHAA 2BP3A 4LGRB 3CZFA 4AIZB 2IANE 1FAIH 1OSZA 3FBKA 5DZVA 4MASA 4MBRA 3WHXA 2D03L 2E7HA 5I1KH 2BO0A 5L8LB 5T1KB 1OP5K 4AENB 3VSVA 2GIMA 5DURD 2MPAL 2WWOA 3VFSA 3VU2A 4LQFH 5EOCJ 4NQCB 2VXTL 1CICD 2YN3A 5E9AA 2N7BA 3AREC 3BUTA 3T2PA 5MENA 1YN6B 2QVFB 3MPCA 2EDYA 4NM4L 2XG5B 3U83A 2FNWA 4YXKL 4X6FB 3X14B 4F15B 3KPTA 4GIOA 1SJVA 3FFDA 5DFTA 3WTUA 2B59A 1QYGH 4AEIH 2VUOA 4Y4FA 2EIJB 2ENJA 2NUPB 3Q1SL 2COVD 3I75B 3MX0A 1KJ2A 1IAKB 1ZD6A 1QQDA 3NABL 1KXVC 5I1AB 2V9RA 4IJ3C 4JRYA 4ZUTA 3VI4F 3KWWA 3BW9B 1N64H 2R39A 2C26A 2W95A 3TEZA 4IK6A 3QQ4B 4FI8A 3MV01 4AQZA 1AOHA 3NFSL 2AQPA 2E27L 2H3NB 2P80D 3CZEA 3BEVB 1TTAA 1NIEA 3BUQA 4W1TA 4WO4A 4Y4KD 4O5LL 2VXUH 3APFA 1GJWA 4OD3H 5DRNB 2XY1A 4ZAKD 5IF0B 1QPXA 1ODAA 3OX8B 1NEPA 2OZ4H 3FFOA 1H3XA 4IGBA 1L7TL 5C0JA 3R8BB 4DF9A 1G7LA 2QQKH 4O02L 4BZ1L 1HKLH 3BZ4A 3DJ9A 4QRRA 1JN6B 2G75B 1E43A 3GMQB 3QUHA 5I15H 4KXZI 4ECNA 4CMHC 5EO1B 2CSPA 2X0VA 3MA7A 3DMMA 4ELKB 1F2QA 1MG2C 3QUZA 1ZDQA 3TCTA 2VZOA 1T0MA 2A9BA 2NY2D 4H13C 4BFJA 2YFOA 3L3KA 1OQXA 3V5HB 1IAII 4RSVA 4G43B 5CO1A 1SYSA 2QTVA 4GYBA 3BAXA 5G5DB 4G9FD 3O3BB 4N86A 5E2TL 1CE6A 4JQIA 2E59A 2WXFA 1OTTC 3VWKA 4M7JH 3X1NA 2WLJA 4EIUA 1QVOA 1WWCA 3TZVA 1CFVH 4W9IC 3L3HA 5JHMA 2NY6C 5F6IC 3KPMA 1UZGA 4PJEF 1U4FA 2F5AH 2DQJL 4H5SA 5AB1A 4FQHB 4NQDB 5J56B 1HU8A 1VGKA 1OAXH 3GSXB 4GSRA 4EMZA 1ZOXA 2DQUL 3H3KA 5CCJA 1C8PA 3DUUA 3FTGA 4NJAL 3TU6A 5HHOE 5K59F 3NQKA 4U6TA 2DBLL 2IANA 1UACH 1WP6A 2Z35A 1E5CA 1AZUA 2OSWA 2XDHA 3C5ZC 3WV0A 1I4FB 3PP3H 4GW1B 1GS8A 1PG7L 4RMVA 3CZKA 3DVNA 4PD4J 4XPAH 2PUQT 2H8PB 3SDXE 4HUVA 4YDKH 1C7SA 1AD0A 1YPZF 4YK4B 1VFUA 3BN9C 4Y16D 1AXTL 3QA3B 4HKBA 1MCCA 3ZE0F 1FQ9C 5DMGC 1N5AA 1S5HA 4OR1A 4YEFA 3NGBB 5F7WC 1TKWA 2OMTB 4I5BB 4N90E 3ZDZB 5JDSB 4WSKA 4BFIA 3IPFA 4BCZA 5K39B 4Y4HA 3KPRD 4O02B 5HGAB 5LNEA 4WFEE 1OGAD 1N70A 2OYKA 3QJZA 3NCXA 4IRSD 1IGFL 4ZMAT 1XR9B 2F54D 1ICTA 5DD0L 3NA9H 3SYAA 3JV5A 1SFDA 3P0VH 5HDRA 1G7QA 3P2BA 4DQOH 4XMKL 2CXKA 3DVFA 2RCSL 4NZFA 3CQQA 4BINA 5DRXB 3V10A 4B3VA 1F4XH 2DDQL 4PTTA 2XFXA 1SN5A 1WFIA 2NW2B 2OR9H 4GO9A 4I18A 4IMKA 4PJIE 5DRWB 3QT2A 3BHBB 5F0LB 2OW7A 5CILH 2F1AA 4YSSA 2NT0A 3EGDB 2R59A 1RV6X 3EO0B 4KI5D 5I18H 2Q5BA 3FULA 3TO4D 1R3IH 4WI0A 1GZQA 2EDXA 1NC2D 1MJ8L 2D0HA 1NMAL 1TZAA 3ZN6A 3RWIA 3E1ZA 1HNYA 2CO7B 4KDTC 4MXQC 8FABA 1TQBC 4JQVA 3ULUF 1HOCA 1B2WH 2Q3XA 1F6LL 3QR2A 5BXFA 4LSSL 3Q9PA 1YNLL 4LVOC 4YSPA 3GJEB 3Q0HA 1RZJH 4S1DD 4UINH 4LOVA 5HI5D 3WY4A 3WJMA 1A7OL 2NT1A 5F1OB 5IW6B 5DK2A 2ITFA 3ZHFA 3MJ9L 3OAWA 5JHBA 3UAJC 1FHNA 3CSTA 2YMXL 2QZQA 1YJDL 3DHUA 1NJ9B 3SDCA 1FRGH 1YEJH 3Q01A 4RH4A 2R4SL 1WAPA 3QAQA 5IHUL 5HDLA 4AZUA 2BSEA 2HJLB 3WNLA 3RZCA 3EG9B 2D3VA 3QJTB 3QORB 4M48H 5HHPA 5I0WA 1X9LA 2B39A 3TLRA 1CFSB 2BP8A 2G5UA 2K3TA 3MJ7A 3PWPB 5D70H 3S36H 1ZA3B 1JPTL 1D7CA 4XP1H 4PJ5B 2E9WA 3BLBA 1J87A 3H9SD 3OXSB 1FAKT 1KBGL 2MQ3A 5AYUH 3BE1L 4TULH 1Q9LA 3SKUD 1C7TA 2E7LA 2XN9D 5A40E 5CD3A 1FL5A 3F00A 1PY9A 4U1NA 3SE8L 1TQCB 1NMCC 4UB0L 4BH8B 5ICYA 1KEML 1KYUA 1TETL 4A2HA 1QOKA 4NUPA 3VA2C 1X9RA 1BWWA 1TJHL 1VRSA 1E27A 4KY2A 3JWOC 4NHCH 4MMXA 2J6WA 4PJFB 4ZFZB 1NPUA 5C08E 5E5MB 2GK0B 3G6AB 1RZFH 5DXWA 1AQDB 1SQMA 4M4PA 3QCUL 4EDXB 1UCTA 4F92B 4RDQF 5IIEA 5F8QC 4F3FB 4XHQA 5L8KB 3NCJL 1F0LA 4POUB 4AL8C 5H94B 4AMXA 3ULAB 1ZV5A 4P4KC 1JNLL 1QA9B 2YA1A 4JKLA 3DTUB 4XPHL 3SY0A 1G4MA 4M5YH 4P46C 4U05A 4G8FA 4LSVH 1KTBA 4RNRB 2GSIB 4Y19D 3VB8A 1VKXB 1KLFA 1T04A 3FUJA 2DI9A 1SXAA 1OAUL 2AEPH 5CGYD 4LEXL 1UD6A 1V3JA 1MVUA 3KLAA 4L3ED 5I1IL 1JZGA 1JZIA 3BP5A 5KSBA 4JFDD 2EIDA 2VLKB 1UXWB 3MNZA 4YFLF 5DD3L 4Z7UB 3VACA 2C3XA 4R84A 2NYYC 4JL2A 4PJIA 1AQHA 3UYOD 3AG4B 3FZUC 2UWEB 1OF2B 4HCGA 1ACYL 1TO4A 2DQCL 2WIIB 3GXNA 1DDHB 2WO4A 5E2WH 2DJSA 4Y5XC 4YE0A 3CVCA 2VN6A 5LO7A 1D5BB 1HEZA 5C8JB 1DL7L 2CUHA 2XX0A 4PYGA 2FEEL 2D9QB 5F6HI 3VFNB 3OKOB 3VDAA 43C9B 2DWXA 4EVNA 1IL1B 5IP4A 5BUAA 2Z8WC 1WZMA 4NENB 2A6DA 5EZIH 3F62A 1ETZB 3JTBA 3EJPA 3QCTH 1E4KA 3RTQB 2E47A 5F7MC 4HK3N 3LS5H 4MFHA 1K8DB 3FFCB 1N68A 2WLYA 1E5ZA 3Q13A 2VLMD 2OX5B 4UDTA 4DPBX 2X38A 2R23B 5ETUB 4JLRB 4QOKE 4HIHA 1W0VB 1WT5C 2ZPKL 1OD9A 1BX2A 4Y5VB 3NIGE 1NGWB 5DVKA 3T2QA 2FO1A 1S5IH 1CK0L 2P49B 5MP6H 2KERA 3SPVA 2WMPB 5BOZG 1RJLA 3OKEB 1U92B 1ZY9A 1F3RB 3BVNB 4FNUA 2VXSH 3VGGA 5ID1A 4GPVA 1ZLDA 4Y9FA 2DBJA 2FX7L 3B2MA 5F7DA 4UZUA 4PLOB 2Y3NA 3CVIL 4Y7OC 4ZMVA 1B4JH 4XGZB 3CC1A 3P3RA 4GAYB 2ZX9A 1EUTA 2I60H 2XN1A 4YWGL 3JTTB 4RRPG 1MFEL 4WI2A 4I13B 1EZLA 1IZKA 1A0QH 2VYRE 3PXHA 1FBIL 1SYVB 3DX4A 4AVIA 2UZPA 3KEDA 3L6FA 3H9YA 1AKJD 4JFFB 1JDCA 1UASA 2UXVA 1M56B 4UNVA 1BG1A 1JYNA 4JPVH 1I9RL 3MLRH 5GSRB 4P2QE 4RAUA 5AAMA 4AW7A 1KYFA 1LXMA 3DYPA 3GSWB 5EO9B 1I8IB 2FO8A 1CZ8L 2VXQA 4RIRA 2EDKA 5CLYA 2Z64C 2NX5A 5FYKL 3ZW3A 3F7YA 4NM8H 2VLJA 2L8AA 1U3HB 3SGEI 4DPAX 3L7FA 1JGEB 1UWXH 1P2CA 3ML9A 3N2JA 3QDAA 3BFWA 2YPVA 3GMRA 3LDBB 1OTUC 5AQ0A 2UY6B 3IMSA 3NOIA 3MV7B 3WDJA 1SHWA 4Q6YA 2BVQA 4TQ8A 2JELL 2OMYA 3FYIB 4Y4FC 1JWUB 4UQCA 5HHQB 1WBYA 4U1KA 4UT6H 3O0RL 1NUGA 3KLLA 5GS0C 1X5YA 4K8RD 2CKBL 3QEQD 5D7IB 4JZOA 2M26A 3MRBB 1XGYH 5D5MF 2D7PA 1DBMH 2Z92A 1XH3B 3QIBD 5EUKB 2XWJA 3IM1A 4J3TA 2WNXA 2CE6A 1T66D 1ROWA 1F4HA 5LGJB 4WO4C 3RJDA 2CKNA 2I9LB 4ZMQA 3CG8A 1M1XB 4IKJA 3ZT5A 4OI8A 3SODB 4KITB 4HXAH 4IGBC 4YSRA 3EO1A 1G4RA 3B5TA 3QNXB 1RP8A 2IWGA 3SGKA 1CLYH 2W0PA 3LPWA 5IOPB 4TVUA 1YDPB 4UANA 5AD0B 1IEBA 1KFAH 4HETA 1GKEA 5JOFA 5CR8A 1B0GA 3DMMC 2AXGA 3QUZC 4KMTL 2EYSA 4HIIB 2A9NL 5E6IB 1DVFB 3R7RA 4UOW0 3N40P 4H26A 2QHRH 4JFZH 1ZLWK 4NZJA 5J6GB 3RVUD 4JFHD 4WFFD 3BPOB 3MREB 1JI2A 5AW9B 3VWKC 2NY4C 2LV4A 5ALCH 4KRLB 4U0QB 4FXLA 1SXBA 2D7NA 4NGHL 1A4KB 5CKGA 2RMNA 1I9JL 3TZVC 4L1BA 2V8LA 1XF3A 4H20L 1MCBA 2GJ6A 1HYSD 2IDCA 4YH6A 3AG1B 4ZS6D 3DURA 1BM3H 1QFWI 4QF1A 4R97B 4ABUA 2XQBL 1HSAB 2K9FB 1RIHL 4NIYE 2E56A 3RWCA 3V5DB 1OPGH 2WINB 1IEAA 5E7BA 5I74C 5FDWB 3EAKA 3V0EA 3HG4A 4JMNA 3ZMNA 4JDTL 4PJAF 2G9KA 4K3JL 4XI5D 3QC5X 3BQUA 5DRXA 3VE0B 2YGNA 5ADPH 3QJFA 1F58H 5L6YH 1E5YA 5E4AA 5JHLL 2WXQA 4YFEA 1D9KA 3MFFB 4ONOA 3S8WA 4XN4A 4P2QA 3OQRA 2PO6B 4WEBH 5DWUH 3RUGA 2CKBB 2OP4L 1MLCB 1DUYA 1ONQB 4G80B 3JZYA 4MQ7A 1OAQL 5D7KD 2HJFB 4NPYB 1W8EA 2D03H 5D1XE 1BVLB 4H0LC 3VTTA 1ZGLA 5JHDD 1RAMA 4NZ8A 2IQAB 2MPAH 1XH2A 1YMHA 1TG8A 3VGAB 1P5UA 3WN6A 4OJDH 2VXTH 4M43L 2LU3A 1F2XK 3NG5A 1HI6A 5DJYB 3U7YL 2GB2A 3OHMB 4KROC 4Y4HC 4WENB 4NM4H 5JYLA 1IBDA 3V8OA 2V3EA 5GGVY 4YXKH 3EGXA 4NKDA 1FFRA 5HYEA 2PR4L 3L1EA 1KDIA 1ZK5A 3QAZB 4OGXL 1SN0A 1BZ7A 3V5KA 2BIQA 1WE5A 3MLYL 5T1DL 1EERB 3FO9A 5IB5B 5EDSA 3ECBB 1J5DA 3D39D 1XF1A 2J21A 3TYFA 2ZXWB 3KPRB 5E08H 1R75A 4QTHA 3VM5A 3LIZA 3IDUA 4IRSB 2WLNA 3NABH 4X8XA 1RZKC 2XKNB 5DQ9A 4DEPC 2BVOB 1BVOA 3CXDL 3IRZA 3QZWG 2FNBA 5FC9A 4P23C 4YAQB 1UZ6F 3NFSH 4IMKC 2JI3A 4I18C 3T2NL 2E27H 1YC7A 4RGNC 5AW5B 2A6JB 2EICA 4JFVA 4O5LH 4X98A 3ARGD 3O2WL 1NDTA 1YUHA 3ARDA 3BMVA 3K8MA 1GGIL 1L7TH 2E76C 2JQZA 4MJJA 4Z7VA 3P4OB 1ZA6A 2DEYX 1NKOA 4JQVC 5C0BD 4O02H 2Q1EA 4J3WA 2ZUTA 4BDVA 5HYIA 3D2UB 1S9YA 4HWEL 2YO3A 4Z76B 2W60A 3N42B 4P59H 1WISA 3B9KB 4X4YB 5FLVA 1G7PB 4PJ7E 3F2LA 2ICCA 3UEZA 1VPOL 3EJTA 1KCWA 1DQJA 2WAHA 4MHHI 4JM2F 3PABA 4OIBA 3SDCC 3VI3A 1RUQL 4MSWA 5JW5B 1BWMA 3ZRCC 4OZ4B 3MVSA 5T3XH 3VG9B 1V3LA 5I1DA 3P11H 1Y0LA 2FT6A 1KMGA 4WGVB 5E2TH 5B1BB 3RZCC 2MEJB 4BBWA 1X5FA 2VLLA 1RL1A 1VDGA 4QRPD 4JY5L 1LMKA 3PE9A 2QSCL 1M6UA 1I7ZB 4G8GE 4UI2A 1YHPA 4YGVB 4BSVB 4GIAA 2W91A 2ZSWB 1OTSC 3KHOA 4YO0B 2DQJH 3VFMA 1NDMA 2N56A 3EHBC 2BDNH 2E7LC 4D7BA 3SYPA 2DQUH 3OJ2C 1TJXA 3PWNA 4NJAH 5B3NA 1QSEE 4J3BA 2HB0A 4WNJA 2IDUA 4FJZA 1ZGLP 1YEIL 2DBLH 3UABA 4MMXC 3TNMA 3PJNA 1EAOA 5J5EA 3X3FL 2NNXA 3MV9B 3JV6B 1XZ0A 2VNCA 3AM8A 1MF2L 5A1AA 1LEKB 4DP4X 1I1AB 4IEFB 4LCWB 2VLRA 1EEZB 2E9JA 4WHYH 3BDYL 2DKMA 1AXTH 5E99H 3HZMA 2X2JA 4UZGA 3GI9L 3EFFB 1JZ7A 5KBDA 1K4DA 5G4OA 3ROOB 4XCFL 1CDIA 1NPNA 3K1DA 2OCJA 3AC0A 4HAGA 5H35A 4M8RA 3L9RB 4APXB 2IAAC 5C0RH 4A6YL 5JO5A 1IGFH 3U4BL 1L0XA 1FNAA 4WNSA 3SGDH 2N1TE 4CSZA 3IBOA 3LRHA 5DD0H 4HP5A 4UOQA 3OD3A 4K07A 5KBPA 4QRQB 5DYOB 4NQCE 4XCEA 5JLZB 3CPUA 3S3CB 5E8NA 4PU2A 1OCZB 3PGCB 1UD3A 3GK8L 3IMWA 2X1QA 4XMKH 2RCSH 2JCWA 3CNKA 2CNYA 2AZAA 4NN7C 4YHZL 5D93C 1KELL 1KY6A 5AOIA 2DDQH 4JO5A 1DVZA 1F6AA 1SVZA 1JFQL 1KG0B 4ZPVA 3DVGB 4GQ9L 2BFVH 4Y89A 1WZLA 8CGTA 2D7TL 5I26A 1T03H 4HC1L 3BKML 2ZXQA 4PB0L 1FH5L 4KFZC 3KPSB 4DP5X 4P48A 4P2RA 2FJHA 1E4KC 1G7JB 2AJSL 1NMAH 1MJ8H 1T5XA 5CR1A 3QFJD 3ARZA 1E8WA 3ZUCA 4UMSA 4PGZA 5CGBA 4MNHB 3KBPA 4OFYA 3STBA 2Z6FA 1S7RA 2ZOWA 4U3SB 4G6AC 4EN3A 2CDFB 2YPKA 4UQ2A 1YNLH 2J8UA 3IN2A 1SZNA 1JG9A 5IEHA 3J27A 3W5MA 1A7OH 1Y1UA 3MRCA 1FZOA 3MJ9H 4MCNA 3PYCA 3IDMB 3FRUA 3LEYL 2YMXH 1YJDH 4ELMF 3QNYB 3WG7B 1S7XA 4HDIA 3G5XB 4H0GA 5EOQL 1OB1A 1NCBL 4YDJB 2R4SH 2SODB 3ZMEA 4S1RL 5HHXL 4G8GA 5EA0L 1XEDA 4RMTA 1KIUA 5E9NA 3VFVB 3U2SB 5FOBA 3O8XD 2H9GA 3R1GL 4X5PA 1EHLL 1NGPL 1CT8A 2VQ1A 2D0FA 2J12B 3KLSA 2F19L 5CGMA 3IMBA 3EYSL 4KH2A 5GJSL 1JPTH 2VZUA 1IGJA 2XQYG 3VSQA 2BIIA 1ADQA 1KBGH 3D69B 2RJMA 3BE1H 1MCWW 2ZKYA 4JHVA 4KUCF 2K6YA 4JGJA 3SE8H 4A6YB 1CQYA 4UB0H 4MMZA 5GSVB 1KEMH 4NP4L 2YD5A 1TETH 5IZ7A 2FR4A 4N2BA 1LWJA 5B22A 1C08A 2IDSA 2DZEA 5AAMC 2Y2TA 5ENWB 1UKQA 4R7NB 5IB4A 5CD5D 3SY6A 1V7NL 1WFMA 1MQKH 5FW7A 2AQRA 3FTWA 5IJCC 4ZD3L 3DX9B 3QCUH 1LWHA 5BZDB 4K15A 4Z7QB 2J6EA 3FCTB 3T0BA 1DE4B 3NCJH 4HZLB 2IPKB 4O51A 2BOCA 1YMMD 4Y0GA 1JNLH 2A74B 4LQ1A 4DQAA 4XPHH 1TITA 3QGVA 3LKRA 3UZQB 1HL8A 2MOVA 2I24N 4L4TB 5EOCL 1WC7B 4UQEA 1OAUH 1XD0A 4XPFL 3BVWA 3A0OA 4LEXH 4N22A 1PD1A 5BVJB 4J8RA 4P5KB 4U1HA 2V3DA 5I1IH 3H7BB 4KOBA 1PG7W 4M61A 4Q9CA 5CJ5A 1G0YR 3P54A 5F72S 1JZHA 2BHYA 2ZTBA 4LIQL 4TXVB 5DD3H 6TAAA 1F00I 4PHXA 3IVKB 4LPTA 3Q2NA 5IQMA 3S8GB 2GYSA 2YZ1A 1BQHA 3W9DB 5IW1A 2OCFD 3ZDZE 2DV6A 2JJSA 4IOIA 2X42A 4K5NA 1ACYH 2DQCH 4X9IA 4JE0A 2HRGA 2PPDA 3QPQD 4FG6D 4NJ9H 4OUUB 3B8SA 3SGKC 5DZJA 4F20A 3M45A 5CKAA 2J72A 2C9VA 3T8MA 1WIUA 2PCYA 3OR7B 3WD5L 5E23A 2LLGA 3FT1A 2YUZA 3CFCL 4Z8FL 3OZKA 5GRZA 1NBVL 4HEPA 1PZCA 4IBLT 3WEAA 1U8HB 3D9AL 3LNGA 2PWFA 2Z0UA 4AV4A 2WANA 1IVTA 2VQTA 2W0FA 3C6LA 2ZPKH 2J1YA 5LN8A 3L7EA 3RVTD 4ZPTA 1CK0H 3CXHJ 1AHMA 2NXZC 5J11B 1A47A 3B2UC 4NNYB 3SO3B 4I0KA 2H4EA 3QHFL 4OSUL 1A65A 2HG5A 4A7VA 4KKCD 2AXJA 2FJGA 2XTLA 2FX7H 5E2JA 3CFKB 2X3BA 2IJ0C 3GSRB 1LO5B 2QR0A 1ZPLA 3CVIH 4MXVF 3KZ8A 1ZDSA 2N0MA 4WJG3 1MHEB 1QSFA 5EF0A 2EZ0D 4I3RL 32C2B 2ICWA 3A6BH 1R3KB 3ASOB 4X83A 4YWGH 4YVUA 4C83A 3BQUC 3O3BA 1FNEA 1IILE 3AITA 3MUHL 2WQUA 5TFSL 1MFEH 5IUCA 3U0WH 1M2VA 2AHIA 5I19L 4UU9B 3L1OL 1D9KC 1UT2A 2DIAA 2AC0A 1KJMA 3CSYA 3HI1B 1S9VB 4KZDL 1FBIH 2DIBA 3QS3A 3TESA 3WSQL 5EBMB 1PY0A 3WNOA 2AKRA 2QGCA 4HIEA 1FFQA 3MN8A 3WNNA 1FIEA 1FHGA 1CZ8H 3RILA 4OI9A 3DX6A 4PJ5E 1P5UC 5FYKH 2OXHB 5HYQA 4G11A 3FO2B 3V0VA 3IGUA 2H3KA 3UTSE 2HFEB 4LLWB 2QADD 2ILLA 1FIGH 3UGUA 2B3IA 2PTUA 3CFUA 1RHFA 3DRTA 3FSWA 1NTDA 3H9HB 3VI4B 1U33A 1ASPA 3WEXB 4PJFE 5DHVB 3WS3A 3CFJA 2HMIC 2BC4A 2XTSA 1K3IA 4HPYL 2WXKA 4J2QA 3WFEL 1XGRA 1QR1A 3L54A 5CFHA 4GG6F 2CGZA 3IGFA 2CKBH 4BZ2L 4CVWA 3QDJB 1D6EB 4ZYKA 2KUTA 1BJ8A 4IU3A 2VZ3A 4KK9D 1AGBA 3VXRB 1NM9A 5GRUH 4Z3EA 2F7IA 2MTAA 1D6VL 1EXGA 4HWUA 4L4JA 5DJXA 2ARJQ 3E1F1 4TNWF 4CA4A 1LO2L 3QIWB 1CDGA 3ULVC 1HCZA 1GRWA 5F9OL 2MH4A 3TT3L 3ARDC 3NEOA 4P2YA 3V4PH 4ZSOA 4F37F 5AAWA 2W88A 3TVMB 4NRYA 4BQ9A 3FOMA 4YDVA 3ZTEA 5IJBC 4M6OL 3MMEA 2Z9TA 4XZUA 2AQTA 3BUPA 4MKMA 5LWYL 2ESVA 3LXCA 5ADOL 4Z7UE 2YARA 3CFQA 3GQFA 4B0MM 4MD0A 5EZJA 1X5LA 3HTLX 3MBEA 1T21B 1E9PA 2EEAA 4KMTH 2UWEE 3KYOA 2A9NH 4OAWB 5DJZB 3WLWD 3WTTA 2N4IA 2GUYA 2VMFA 3QYCA 4UOZA 4U7MA 2VIRA 4PJEB 3N41B 2FTAA 4JRLA 3PGDB 3VDBA 4P9HC 3K5RA 3ULUL 2A9ML 2QKIA 4WWPA 2F53D 3DIFB 2X12A 3QW9A 2IAMA 4NGHH 1NKGA 2IMMA 1I9JH 4GEJA 3AB0C 4H20H 3RU8L 3D25A 3K74B 4E42A 3FFCE 2CWRA 2XQBH 1MJJA 3BFOA 4LP5A 1RIHH 4Y2DD 4YPGA 4OD2A 5E9DD 4L9LA 3VRJB 2Z4QB 4OVVA 3CFDA 2DWYA 2Y7OA 3RKPA 4AVJA 2C1PA 3ARBD 4PCTA 4PJ9A 4WK4B 5BV7C 4JHZA 1R3JB 3ZRFC 4KQ4L 4JDTH 2IWEA 4K3JH 5E1AB 4JK0D 4FQ1L 1T1ZA 2W07A 2XA8L 4R0LA 1A6VL 5DJ0B 5JHLH 3N0PB 5LBSA 4GRLB 4AMWA 5DHMC 1IC7H 1YQ2A 3PWJA 3ZE0B 3IAGC 1WA0X 3P4NB 4PH8A 1CFSA 1JCKA 2OP4H 3P73B 3AM8C 5K33A 2ZYRA 4X99B 3QC6X 4AKPA 3C12A 4QAMB 3UTSA 5FPIA 2AABL 2FSEB 2QVKA 5D7JA 3RY4A 3O9WB 5DR5L 4A68A 1Y6NR 4HOZA 1WCQA 2WZ6A 2XVBA 2LTQC 4M43H 5C09B 3IN0A 4FMVA 2DL2A 4G6KL 2X1WL 4PG2A 3U1SL 1QLRA 3U7YH 1HQ4A 2OMNA 5T3XD 3STLB 5JIDA 4L8BA 4JFFE 4Z78B 3MRLB 2WM0A 4OGXH 3VXOA 3STZB 5HHNA 1H19A 2H1LM 3MLYH 5ABDE 5L7XL 4YR6B 2BP0B 5FO2A 5FUZL 4BQ8A 5JPNA 3A6CL 3EOBB 4M3JA 4WW2F 5E8EA 2X7LA 2MQ0A 4GAFB 1Y1DA 3CXDH 4WI8A 1TZOA 1PQZB 5AW4B 1A3RL 5D2LF 2NR6A 1KTLA 3X13B 3VXQB 4KZEL 3MV7E 3T2NH 3CDGA 5KOVC 4F2FA 5L4JA 2OBGA 4NO0D 2ZAGA 1JZDC 3O2WH 1HQRA 3T3ME 5HYFA 4MYPA 2MWCA 5H2BB 3ZDWA 1GGIH 4WFGE 4KJYB 3RHWK 4X6DF 4KO6A 1MREL 5AG8A 5CSZB 3REWA 1M2OA 1A1OA 1IC5L 1IFGA 1IUZA 1HE8A 4PRPA 5D7IE 3RGVD 5IBTL 3ZZQA 2LLLA 2ADYA 4Q58C 4ADIA 1J18A 4EN3C 1WIPA 2J1KA 4PLNC 1OF2A 4OFVA 2IH8A 4HWEH 2XXGA 4MAYD 5DUBA 3AXIA 2ENPA 2R1WB 5GPRA 4N2GA 1VPOH 3VFNA 3LEXB 3TCXA 4WFHE 1KC5L 2Y7MA 1PF3A 3EDDA 4F5CE 1RUQH 1ETZA 5EUOA 2P7TA 1KGUA 3TCLA 1B9KA 4Q6IA 3IF1B 4RZCB 1E28B 3FFCA 5G4MA 2BWQA 3F3HA 4C4KT 2WWMC 4X5LA 4I0PA 3LSOB 2ERJC 4JY5H 1J5OL 3SEPA 3UADA 1LE5A 4I87A 3LZPA 3W9EA 2LW3A 5AZEL 5I1GL 1LK2A 4E9SA 3OMZA 3SE4A 3G5VA 4ENEC 1IM3D 1EZVX 1AO7A 1KIQA 3B2XA 4L37A 4TQEL 1KB5A 4MMZC 4WTWA 1T0NB 2NXYC 4QPEA 1MDTA 4G8IB 1YEIH 4F7PB 4X8JB 1CBVL 1CJYA 5C0CD 2I7OA 5FYKE 3BZFB 3MTRA 4O9HL 2WBKA 2LAGB 5C2BL 2CDGB 1MFAL 1UM6L 2Y1VA 2WZPD 1XF2B 1MF2H 3HJEA 5I5MA 3G7TA 4FHKA 3BH8A 4ZNCD 4WWKD 3PAVA 4M03A 3O4LA 3BDYH 4P2AA 1S4IA 3DROB 4U1IB 3GI9H 4G59C 2DLFL 1BD2B 5I6LA 2K8MA 1MCHA 1HH6A 1I8IA 5TE7L 2KHAA 4RDQG 2P47B 3ABZA 2PXYD 4G7YH 4A6YH 5M94B 2V7NA 2EDFA 3V0HA 4W93A 2JJTA 4KQ3L 2EYTB 3PL6D 3NIFF 4FJYA 2D2OA 5AOZA 5DSCB 2XQ0A 4WHCA 4F15C 2J2ZB 2R7EA 2JLLA 4MNQD 4RMSA 5J12B 2VDPL 3GK8H 1CICA 2JJSC 3DBXB 5JW3L 3DJTA 3L3DB 3U36A 4AUUA 1G9NC 3D52A 1DEEA 4KFMA 1JFQH 5HHQA 1HDMA 1NPJA 4GQ9H 1FG2A 3P1VA 2D7TH 4DH2A 4HC1H 3FU7A 4HKXA 5D7IA 1WZAA 4PB0H 1FH5H 2PYEB 3MCLH 5CCKL 2V5SA 1J0JA 4PY7A 4CJ1A 3KPRE 5C7ZA 2AJSH 2N1KA 1NKRA 2QSTA 2F54E 3P3UA 1W0WB 5DF0A 2YC1A 3C6LC 4FQXB 2AQSA 3DECA 3US0A 4AH2A 3HA0A 4O2CB 4F5CA 1PZDA 5IUSA 4MXWH 4YHPB 3J07A 4I0CC 2P80A 5HI3C 4GP4B 3LEYH 4UOW1 2ZUYA 3LVEA 2EEFA 2HTLC 3MNDA 1RMFL 4Y4KA 3VXPA 1G7HA 1GOFA 4L5FL 1F1GA 2R51A 4ZAKA 5AEAA 4GT0A 1JRHI 2OMVA 4IU2B 1I8KA 2G5BB 2O5YL 1NCBH 3AG2B 2FHBA 1ZS8A 3RDTB 1CO1A 2QMKA 4S1RH 5EA0H 1QLFB 5HHXH 3D30A 3BVXA 1RIUL 1UQSA 1W15A 2VDKL 4KI5E 4YIQB 1H6EA 4IHBA 3CTTA 1EHLH 3R1GH 4NQSB 5I1LA 2DPKA 1NGPH 4JQXA 4YHLL 4QHLA 5DI8A 1TU2B 2F19H 4CNIB 4OGAD 2HT2C 1L6XA 5JXED 5CWSA 3EYSH 3KCWA 5GJSH 4F8PA 2ALWA 3PXJA 4GUPB 1TVHB 3EJUA 4AEHL 1XF5B 4Z3TA 5BMFL 4RWHA 5I0XA 5C0IA 4QHUB 2I32A 4HU2A 1XGUB 2ZQKA 3GSVB 4G9FA 2RH0A 4NP4H 3KBHE 3S36X 3MBWA 4LESA 1N8ZA 2WINA 5BPPA 2H5UA 3TF4A 4HVBA 5L4FA 4M1GL 4ZUWA 1V7NH 5AB2A 2VDPB 4OLWL 1WBZB 4ZD3H 1UGKA 4XNMA 1I7TA 4OIIL 3BPNC 3LPPA 1G1CA 3QDGB 5HY9A 5ESVA 4K94C 2XV2A 3IWUA 5F0PB 1JHTB 3VFTA 3BZEA 4FD0A 2F74A 5D5MB 4OZGF 4EJ1C 5D4IA 2QDWA 2QADB 3EYOA 3MV9E 5EOCH 1FZKB 4XPFH 4P5RA 4L4VD 3KS0H 3RTLA 3H6AA 1HHHA 2IV9A 3KMDA 4LCWE 3IJHB 3BIAX 1EO8L 2GFBA 3BCFA 3DXAD 5D72L 4B5ZA 4LIQH 5FLUA 4F8NA 4YZWA 4ZUSA 4Y16A 1N8OE 4N2KA 3CLEL 3S35H 1TQUA 5GRYA 1UENA 1XSKA 4MBOA 1NBZB 5AVYB 1UJ3B 4JHUA 1A3ZA 1KB9K 5LAPA 3WFZA 4EOWL 2AK4D 2OMBA 5EZLB 5AAWC 3KPRA 5E5RB 1CCZA 1NANI 1OGAA 2PW2B 2VDKB 3C8HA 2WTRB 3N85L 5AYQA 4IRSA 4ZMPA 5T5FA 2MOGA 4JKPL 2F54A 2XHNA 5AW0B 4ORZC 4B9JA 3WD5H 3Q05A 3OR6B 1ND0A 5DHVH 4E0RB 4Z8FH 3HG3A 5B39G 1NBVH 4U1JB 4XAKD 3MBEC 2L7JA 1P5VA 5DFVD 3D9AH 3FQWB 3ME0B 4JZNA 5B8CB 4UUJA 4XNAA 3DV6A 1T1XA 4JM4H 3QULA 1ACCA 4JGUA 4O58H 4G82A 3B2VH 3P4OA 2QKIC 2AJ3A 2IAMC 3IJSB 2EIKB 3KPSE 1EK3A 4OLEA 3GFUA 3QHFH 4OSUH 4AXWB 4Z6AT 4N0CC 1NCOA 1JPGB 2QQNL 4O00A 4PJAB 3TO4A 4CC0A 3CC5B 3HUJA 2WO2B 4L9LC 3VD2A 2J4WH 1BREA 4PN6A 1D7FA 1VHPA 4LPWA 2OMXB 1SJEA 3QCVL 3V0FA 3VSTA 5AB0A 1F5WA 3A3YB 4PJ9C 1YYCA 4I3RH 5IQ9A 1G7MA 5E8OB 4JUSA 4KAQL 3RAJL 2ADGB 2O72A 2VLME 3V79C 1NAKL 5TFSH 4QO1A 4R0LC 1N3NB 1XH0A 2NZ9C 4G1EB 2OR7A 5I19H 3ISWA 3L1OH 2CH8A 2CHDA 1RK0B 1Z0NA 3V55A 1UXSB 1I7ZA 1RVFL 3N1MC 4P2OB 5AWNL 1X6NA 2KZKA 1EJFA 3OLIA 4PS3A 5J1AB 3RIAF 2D2CC 3B9VA 3KEHA 3ILQD 1CLVA 5F9WB 3WSQH 3WI9A 4XOAA 5FCUL 1D2PA 3KPPB 1TQCC 5D7JC 4KKLD 1JWMB 4ZO6A 2RIKA 2BVYA 2JCCB 3B9EA 4JFXB 2VM9A 4JG0L 1MIEL 2UVEA 4PG2C 3H9SA 1Q4NX 2P24A 1PJ9A 3B4NA 4W9FC 3TH2T 2UYLB 2WQRA 3AU1B 4F8TA 5EC2A 5DHXB 1KXQE 2XN9A 2DYSB 5E94B 5CEYA 1JZ8A 3D51A 4W9KC 3HFFA 2ORBH 4J1UB 5F71A 2AEWA 3QQNA 1OZTG 4PJBA 3NCEB 1VFAA 4IEFA 1XBDA 5KS9F 2X4QA 2VZSA 1RPUA 2AP2A 1MPAL 2J1ZA 2WVTA 4HPYH 3WFEH 5JPNC 2OK0L 2OSXA 3QK0A 1KCRL 3N55A 3UBGA 4BZ2H 2YRLA 3WUWG 4Z7QE 5E0FA 1O7VA 3IPEA 5E00A 1FZJB 4W70A 2XZAL 2NR6C 5FYLL 3HBGA 1JUFB 3F12B 2J7LA 1DR9A 2WZAA 4MMYA 1LO2H 3T08A 4MJ6A 4YHNA 4DN4L 3OB0K 1ZEAL 4HS8L 2Y6SD 1FFOB 2PP9A 5F9OH 5HYJB 4ZI8A 4FG4A 3S96B 4IBVA 3TT3H 4FKHA 3DX7B 5DD6A 3FUIA 4Y19A 4EZMA 4NKQB 5DJ6B 3MROA 4HKJA 5F89A 2JKTM 3NCFB 2WKOF 2IPUG 1KCUH 2WWNA 1BHGA 1GVIA 4M6OH 3VXTA 4JM2B 4DN3L 3AWFA 4L3EA 4KUZL 5LWYH 2J20A 5ADOH 3VG0L 3EKCA 4WTXA 4JFDA 2GSGB 1QHQA 1BP3B 2ZKMX 2NQ3A 2AJZB 5D1QB 1RUKL 1FYTB 4W9GC 5D7HA 1F3JB 1XEUA 4OB5L 4ES8A 5EU4A 5IREA 2FJUB 5E0QA 3QJSB 1WFNA 2ALAA 4PGDA 2B1OA 1GW6A 1QUNB 4OGYL 1G7JA 4Q6IC 4CVZB 3AXLA 4JDEB 1QSZA 3KLDA 3F6IA 1JP5A 3ULUH 2A9MH 2P46B 3FW6A 4FXTA 1IKOP 4I0PC 3HJ0A 4OM0L 3VD4A 1WIOA 1Y6MR 2DI7A 3RU8H 1BAFL 1GYAA 3IAQA 1AGDB 1MW2A 4GKZA 3IDGB 5GGUB 4XNUL 5EU6B 2VABA 1N0LA 2DS4A 2BRRL 3SE4C 4LMQE 3HN8A 3ATBA 1ZSDB 1D5XB 2PKDA 1FVEB 3G5XA 4E5XB 4HF5L 3BZ5A 4KQ4H 1QWHA 2B4CL 2FO4A 1C5DA 3WLBA 3FBQA 2WOYA 3NCBB 4OFPA 2XA8H 3O3UN 1A6VH 3L3OA 3MUZ1 2FJSA 3K8KA 2XWTA 5SV4A 1M4KA 2OXGB 4QNPE 1NEZB 1MCLA 2C3WA 5KYWB 2CUMA 3TPUA 4GSDH 3ZKQD 2FJFB 2NY3D 4RISL 4XBMA 4X9HA 4NUMA 2AABH 4M6NL 2FEDC 3FUDA 4M5TA 1KXQA 4N3UA 1K72A 4PVBA 2EVJA 5DR5H 3OVUB 2P5WD 2Y1AA 1SGKA 2P28B 4G6KH 4LOUD 3U1SH 1G7IB 4CU6A 4JR9L 1NCDL 4ZMZA 4R4BB 2EQDA 1K2DB 2B08A 4DZ8B 5LDUA 2Y7SA 4BFBD 3C09B 3RVWD 2OPCA 4L8SA 5LJYH 4LIQE 2JIXD 2ZX5A 1AKJA 2GHWB 3O41B 3A67L 4DUVA 2JJTC 5BZDA 3SOBL 1GCFA 2UZXA 4LEBA 1Q9KB 4DP2X 3BWSA 5L7XH 3E6HA 1S7QA 1DE4A 5DD5L 4PV1C 5D7KE 5FUZH 3PGFL 4TSAL 3A6CH 4TVSa 4CJ0A 1CICC 1P7QD 3P9MA 1G9HA 4G3YL 4QR7A 1T6VN 1A3RH 2AANA 3BOVA 4N8VA 4IOFD 2KT6A 4OLVL 2OTWB 4DP1X 1L9PA 1NUFA 3VI4E 2IGLA 2RFXB 5ICXA 3MR9B 4X6BB 1A25A 1H3WM 4P5KA 2JB6A 2VDLL 5EFIB 2EEXA 3N50A 3VXNB 3QUYB 2E5EA 1S8DA 1MREH 3II2A 3IYLW 1IC5H 5E6SB 3G6JA 3QDJE 5IBTH 4ELMB 4XCYB 5BVPL 3QEQA 1NCUA 3VXRE 2WUCL 3FN9A 3QG6B 1AC6A 1N59B 3QIBA 4HISA 2WZ5A 1NBYB 1SXSA 2NPLX 3TA3B 2J1WA 4OUUA 1A6TA 5AOLA 1S9WA 1Q9OB 3FO1B 3ZTNL 3RY6A 4UM9B 1E4WL 3NYKA 4RWYL 5F93C 4Y4KC 5HBBA 1A5FH 4ZAKC 1KC5H 1UM4L 1UEYA 4MB1A 2CNZA 3CQFA 5ELIA 1Z9MA 3EH2A 4QXTB 4F93B 5B21A 5MERA 3RYMA 4CGTA 5DMYA 3PWVB 5ISZD 3WY2A 2F18A 3QG7L 1MRDL 4OJCA 1KXTB 2XCMC 1GZPB 4JQXC 3OSKA 4NLAA 5HGHA 2X2YA 4D9QE 4WU7B 3BGFC 1J5OH 4LNVA 5EIIB 5C0BE 3V6ZA 1TLKA 3INUL 5C0AB 4AYFB 5JR1L 1YN7B 1BQLL 3KPLA 4NNYA 2EDDA 1BGXL 3MRGA 5I1GH 2R0ZH 4KJQD 1W72A 2NY2C 2ATAA 5KUMA 1CDYA 4NDMB 2X4RA 4OZHF 3FB5B 5T3ZL 4TQEH 4LSRL 2JKJA 5JIPA 1MG3C 3TIEA 4M8VA 3V0AC 3HNSL 3S7GA 5AW8B 4LLDA 1CBVH 4HPOL 2C1OB 1EFXD 4ESKA 1MHEA 5PAZA 4YLQT 1KZYA 5C0GB 1IFHL 3UTTD 1YEFL 4O9HH 5C2BH 1MFAH 1RFDL 4EUPA 1V54B 1H9VA 1J48A 2R29L 3NCWA 3HHMA 5CN2A 5DCCA 1IC4L 2YBRB 2YOAA 1CLCA 3GMLA 3PP4L 2VM3A 3CSFA 4X5XA 5ECGA 5K9KA 2MHAB 5EIIG 2YBGA 4D0CB 3AY2A 2VDLB 4BD4A 3WKYA 7FABL 1PG7X 2DLFH 5INCA 3ZL4L 4LLVB 4XC1H 5ERWA 3ZE0E 2HT3D 3KGUA 4P5SA 5J0BA 5IM7A 2PWEA 1AXSB 1UYWL 2VERA 3ES6A 4H8VA 1B3IA 4J28A 5FB8B 5TE7H 3CVHA 1X5HA 1FP5A 2H7WA 1UFUA 5C0EA 1R33A 3Q48A 2KPWA 2OJZL 4G7RB 3QZOA 5JHDA 3BP7B 3RL2B 1P4IL 2Z91B 4Y16C 4Z0XA 1TLMA 5LVEA 5C09E 1FC2D 1A7NH 2VDPH 4JFYB 3KXFD 2WVVA 1A7RL 3SOTA 3VXSD 5JW3H 3A4EA 2AVGA 3HS8A 3ZVVA 1CB4A 1KCBA 1DN0B 2Z1KA 3IU3B 4NLHA 5T1JA 3HHRB 3SDDB 1AVAA 5K9QG 5IROD 3BXNA 4FHJA 4IRSC 4Q89A 4A7TA 5ICZA 1GYVA 2YUWA 3CFBB 4GI6A 5CCKH 3ALPA 3U6RA 3WDIA 2P1YA 3VGDA 1YO4A 3D39A 3VRIA 2GABA 1IGTA 2EEBA 2G60L 2H45A 2B8OT 3BI9X 3MRPB 4ANWA 4XVUD 1X6LA 4PVMA 3KVPA 2QBWA 3KVDD 1QNIA 2CHWA 3HRPA 4DFIA 1ZCRA 2VL5A 1RK1A 4WI7A 3W1ZA 2CRMA 4ORGB 4EKJA 1RMFH 4KI5C 1HNFA 1OD7A 3PG2A 2YD8A 3FB8B 1GMIA 4L5FH 4ZO7A 2Z8SA 3TO4C 2W65A 2XACC 3VWJD 3D0VA 4AV5A 2XIBA 2O5YH 1WAAE 2Z31D 4H1LB 4UT7L 5EIQA 3T65A 1J05A 12E8L 1S9KC 2CHNA 1HHJA 5C0BA 5D96C 1RIUH 2VDKH 4RRPM 5HTSA 1I3RA 1A6UL 5LGKA 1BZOA 1KIPB 3BP4B 4S1DC 3QFJE 3IMVA 3UC2A 3VUAA 5HI5C 5EBWB 4PM1A 1JL8A 4OCNC 4HWBL 5FOJA 4AEHH 3QI9D 2ENYA 4HOMA 5BMFH 4JG5A 5EU5A 4BFOA 1FPTL 4OV5B 5FHBH 3FTYA 3O2DL 1E4XI 4ZQTA 2OJ1A 2OQJA 3ARFD 3TV8A 1AMYA 1W8NA 1WWBX 2GSMB 3SPGA 4LKXA 4MA7L 3V6FB 1BLIA 3IDIB 4QRPA 1AYRA 2VRKA 4M1GH 4OJAA 4OLWH 2ITCB 4AJ0A 3QXDA 3GSUA 1BZ9A 2A0LD 2H6UA 1J88A 4Y2OB 3ROLA 4OIIH 4N9GB 5I73C 4LVHB 4PWGA 2HVKA 1AXIB 2QKSA 4RMUA 2XA3A 4WW1A 2OS7A 3Q3GB 3V4UL 1CXIA 2WXGA 2XETA 4YC2C 1EAJA 5GZOD 5JW4N 4NUJA 2FECL 1L9RA 3QFGA 3DUSB 1DANU 4GOSA 2R1YB 2BOBA 3II1A 2VDQL 4FN0A 4RSYA 3GEFA 1A6WL 4PJCE 2EADA 3RPBA 4F7MA 1EO8H 5D72H 3KPOB 5KSBF 4JJ5A 2NY5L 4AE1A 5KAQF 2APWA 1B0RB 1QLEL 3QEHB 4DKEL 3CFIC 2CO3A 2XG4B 3CLEH 3X12A 2B20A 1BD2E 2NNAA 2XJKA 4EZJA 4PJHB 1J5HA 4AK1A 1T5WA 3R18A 4XO8A 3IJYA 4PJIF 2ZYIA 5BQ7A 5TQ2L 1DVUA 3C60D 3AG3B 3PJLA 3H9ZA 5CGYC 4G8AC 5GS1A 2EUVA 5CINL 1F90L 2EDQA 2W9EL 5ACMA 4XBGA 1TCRB 4BXSV 3N85H 4AJYV 5F1IB 3PUUA 4PRAB 2TRYA 2DYPB 4JKPH 1ASQA 4V2BA 4FADA 3FQXB 4HCRH 3CAFA 4E9YA 1X9QA 2LE9A 2WB1A 3SJVD 4ZFOL 1LEGA 2D9CA 2MNJB 3WTWA 3HBZA 1JV5B 3P3TA 2FBJL 3QXWA 5E1QA 3KWXA 3VGFA 1HNGA 4UT9L 1XGTB 1M71B 2R2HB 1P4LA 2R2EA 5T1MA 5GGQL 1PKQB 1WAAA 3T0DA 4KXAA 2XC8A 4CBPA 3MJ8B 1W91A 3T4AA 5CZVL 5AB9A 3CWGA 3MNWB 2QQNH 5I5JA 5HDQL 4WWOA 1R17A 3NZSA 3QFJA 3QWNA 4J4PD 1AG0A 3K2MC 3HAEG 3I3EA 4DGIL 3N40F 2JKLA 5DMJB 2IXQA 4W9HC 3QCVH 4RLDA 4R4FL 4IS6B 3AY4A 4KAQH 4I4WB 3RAJH 3QQ3B 4XNYH 5HJ3A 1NAKH 2F7PA 2WWKT 2Y5EA 3L3OC 1XSJA 2V9QA 4FABL 5I6XB 4TSBL 3BAJA 2ZXEB 1B6UA 2VDQB 3HG5A 1RVFH 3LNHA 1USQA 2EDWA 1AIFB 5FF6B 1JV2B 4PQXA 1OCOB 1A9EB 3OWEA 1LDPL 2X1PA 3V6BR 1FLTX 3C8KA 1A21A 4JJHA 3AMLA 4PGEB 5FCUH 3O8XA 3OZ9L 5ID0B 3F84A 3TONA 5IFAH 2OMUA 2WXHA 3N91A 4Q9QL 4NUQA 3SDAB 4QHKJ 4GW5B 4CMMA 3HZVB 3OAYK 1IGIL 1JOIA 1YY9D 4JFOA 1MIEH 4JG0H 5F9DC 2B1AH 1T83C 3HPLB 3I6SA 1CGXA 1IAOB 3BH4A 5LN4A 4EEEA 3VFOB 3BZFA 3E80A 5IESH 4WW2B 2VR3A 3GS7A 1A9BB 3TN0B 1ID2A 3I6GA 3MRMB 4HD5A 4L8SC 3VQLA 5D2LB 3KH4A 4K73A 4PJCA 4JPWH 2VWEE 3CFEB 4ZFOB 2LAAA 5I24A 1FZMB 1KFGA 3EYQD 3MZTA 1MPAH 3THML 2EP6A 2OK0H 1KCRH 2VE6A 3GMOA 3QDGE 4DZBA 1UCBH 4N5ED 2RTTA 2V5MA 4IHOB 1UKSA 2ID5A 2XZAH 2ROYA 3QXAA 3CHPA 4NNXB 5FYLH 2ZAIA 3H42L 3PRZA 1YMMA 4DN4H 4APQB 1ZEAH 4HS8H 4XRCA 1GOGA 4M7LL 2X70B 5FYJD 4LGSB 3NA4A 5CEZL 4WCYL 2GTWB 3CCHA 3MRFB 4QXUL 4XNZB 5DSCA 1XXFC 1BEYL 3BUYA 2BH0A 3PFQA 4F33B 4XODA 2XSKA 5B1KA 5DS1A 5J1SC 1MFVA 5JZ7D 4K8RC 3J7HA 4DN3H 1NIDA 1OL0A 3K6OA 4KUZH 4PRID 3IBEA 3QIBC 4MTMA 3VG0H 2IEPA 5BW7A 1CXLA 1QEXA 5DZPA 4BIKA 3L3GB 1TR7A 3WNPA 2F68X 1T66C 1RUKH 3BJ91 4L5FE 4LT7A 4PLKD 3RY6C 5CBEB 5JQIB 4MA1B 1LD9A 4OB5H 3VCLA 1EXUB 2M8XA 2ADJA 4CKQA 5LNGA 4KKZA 3T6VA 2K4AA 4OGYH 3UTPD 1AR1B 4Q2ZA 3UC0L 1U0QA 1N5YL 4H8QA 4X9FA 1NGZA 4PI0A 1PY4A 4B7IA 5EV7A 3Q43A 4PFEA 3FUNA 2PTTB 2J8HA 1BAFH 2YQGA 3G08B 3QZLA 5J11C 4XNUH 4DO4A 2GW5A 2DJ4A 4HIJA 4QY8B 3BVVA 3BVUA 2QEJA 2BRRH 1YEGL 2XPYA 3UBXB 4JRWA 3FSOA 4DP9X 1LHZA 3VGBA 3G5ZA 3RVUC 4HF5H 4I48A 4OZIB 1U8KB 2GBAA 2B4CH 5KSUB 3WL9A 5I8OL 1JVLA 3T0ED 5GISL 4PJAE 3J2PA 3LH2H 3TBYA 1HYSC 1LE9B 2FSDA 4TNFA 3T0XA 2F53E 1T7ZA 4OZFB 1I7UB 2R69A 2X6AA 1ET7A 4K9JA 5JYMA 4RISH 2ZG2A 3RUGF 1TVHA 3FO0L 3IRPX 4J39A 1GYUA 4PSRA 5E4OA 1ZJAA 3WOVA 2WW8A 4GW4A 4MWFA 2BNQB 1HJBC 4GS7C 4M6NH 3GRWL 4KGLA 3RWFB 3GUFA 4XI5C 4P3WA 3TT1L 2X09A 3WJJA 1NIAA 2N7AA 2DMKA 1NCDH 4U6HA 4Q14A 4HIQA 5H8DA 1I8UA 4X0KA 1A4JA 5B1CA 3QEUA 4WK0B 3O3DA 4N2FA 3W0WB 4BQBA 1IGCL 3A67H 4ANUA 3QDGA 3RWHB 3S2AA 3SOBH 1BFVL 2DIJA 1OT2A 3BX7C 3QDMD 2APBA 2CCWA 4OZFG 2V8MA 4GNKB 2JCCE 4CC4A 1JHTA 5EWIH 3M1OA 5DGRA 3BSZA 5FX3A 4TSAH 3IU4L 4GB9A 3L08A 5FECB 3FKUS 2Z7YA 4G3YH 3ETTA 1JBJA 2C7FA 3B3IB 3QB7C 4WTQA 4NO3B 1HEJC 1PX8A 2Q3AA 4OLVH 4P06A 1FZKA 1JXGA 5FXCH 1ZHLA