2CHDA

Crystal structure of the c2a domain of rabphilin-3a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
TLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords RABPHILIN-3A
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2chdA00
3GPEA 4TUUA 1E7VA 3QR1A 2K8MA 3L08A 4PS3A 4F1SA 2A4ZA 2WXIA 2WXPA 1DJHA 4NPJA 3TWYA 4EZLA 3OHMB 3L54A 1DJGA 1DQVA 3PREA 4XE0A 2FK9A 4QJ5B 1QASA 4ICWA 5CCGE 4NS0A 1TJMA 3QR0A 1BYNA 3FBKA 1TJXA 3DPDA 5H4YA 2ENPA 2LHAA 3P2BA 2CM5A 2RD0A 4G11A 2YOAA 2QZ5A 2Y3AA 2ISDA 3KWUA 4WEEA 3RDJA 3L13A 4GB9A 4F91B 3NZSA 3L4CA 3PYCA 2V4LA 3QAQA 4BFRA 2NQ3A 1DJIA 4HVBA 5EDSA 4IHBA 4ANVA 3APCA 1DJZA 1E8WA 2Q3XA 3ML9A 2WXFA 2Q0ZX 1E8YA 1YRKA 2YRBA 4NPKA 2QZQA 2NCEA 4L1LA 1BDYA 4FHKA 3W56A 5CCJA 2ENJA 2EP6A 2WXOA 3IBEA 4ICXA 3B7YA 4QJ3B 4TS6A 4TV3A 5T8IA 3ZVVA 4KITB 1V27A 4F93B 3CSTA 4QJ4B 4L1BA 2KI6A 4URKA 4Y1TA 4L23A 4IQHA 4KZCA 3QK0A 1DSYA 4XX5A 4F92B 3ZIMA 3HIZA 3APDA 2FJUB 1RSYA 4QAMB 4GNKB 1WFJA 1UOWA 2X38A 2CHDA 2CHZA 2WXKA 3R7RA 2JQZA 4PS8A 3FDWA 2NSQA 3HN8A 4L2YA 4ANUA 1DJYA 4WWOA 1E8XA 4WAFA 3TL5A 2N1TE 3NZUA 2DMHA 1DJWA 3M7FB 4JPSA 4OVUA 3HHMA 3L16A 4BGDA 4A55A 1E8ZA 2WXLA 3L17A 3T8MA 4FA6A 4MJJA 5H4ZA 3F00A 3APFA 3LJ3A 4PS7A 5G55A 2B3RA 2CJTA 5G2NA 2CHXA 3SD5A 3S2AA 1QATA 5CCHE 1HE8A 4LDCA 3N5AA 4EZKA 2CM6A 1W15A 3ZW3A 5KJ7E 3QJZA 4Y1SA 4FJZA 4HLEA 1RLWA 1UOVA 5JHAA 2UZPA 1BCIA 4LCVA 4AJWA 2CHWA 4FADA 1A25A 1E90A 4J6IA 4ANWA 4FHJA 3OAWA 1RH8A 4KZ0A 4DK5A 2WXJA 3F01A 2WXNA 2CJSA 3PRZA 4FULA 3TJPA 4NP9A 4AOFA 4ANXA 3RPBA 1WFMA 3ML8A 3DBSA 2R83A 4OVVA 3W57A 3PS6A 1K5WA 2DMGA 3L9BA 2A5UA 4WWPA 2WXHA 2WXGA 2BWQA 2K45A 3MJWA 4DNLA 1DJXA 3R7QA 2Z0UA 2ENQA 1GMIA 3F04A 1E7UA 2D8KA 2WXQA 3ENEA 4WWNA 2ZKMX 1W16A 2WXRA 4EZJA 2K3HA 3QARA 1CJYA 3F05A 3NSJA 4FJYA 4LT7A 4XZ4A 4V11A 1UGKA 2WXMA 3PFQA 2K4AA 3JZYA 3KWTA 3IM1A 3CSFA 5JHBA 4FLHA
chains in the Genus database with same CATH superfamily
3F12B 3E7JA 1YAZA 4U6XA 1VERA 5F7EL 1MAKA 4I88A 2YS4A 1AFVL 5CGYC 3GSVA 3S5ZA 1LO4H 2AJ3B 2JTYA 4M8QB 2VQ4A 4OW6A 2R15A 1QKZH 1KIRA 4L1SA 2VZTA 1MCOH 4ORGB 1V3JA 1K8IB 3WFZA 1I7TA 1MHCB 1HSBB 2I07A 1QFWI 2VISB 3FN0L 1J87A 2Y5QA 3HI5L 1BVNT 1BP3B 1N7ML 3VSTA 4GRMB 1OAZL 3BE1H 2KL6A 3DX0A 2BIOA 4MJ2A 4X8JA 4Y88A 3OPZL 4KDVA 3SDAB 5EHFA 1PY9A 2HA1A 2CNZA 2VKXA 1EAQA 3VXSB 2RMNA 5DJ2A 4AYDC 4BV1A 3D51A 4HJJH 1IM9D 1IC4H 4LLYA 1RL1A 3JWNE 1IC7L 1G7MA 1U8LB 4LEOA 4W9FC 1BECA 3BUIA 1YPZB 2VLLB 4BWUA 4NWTH 3C6SB 4OI8A 2QR0B 4QRBA 1XAUA 4G2AA 4XX1G 1XSJA 3GSVB 4KI5C 2Q76A 4MD0A 1WGVA 3EFFA 5DMKB 5I6MA 1JVKA 3NJVA 1A4KA 3OMIB 4Z7AA 2Y1ZA 3JV5A 1W6WA 3FRPG 4HLJA 4NDMA 4QRPD 3IGFA 5DK3A 3T0ED 3WOVA 3FUMA 5ICZB 5CCHE 4GKZB 1KWGA 1KELH 2APXA 3HC4H 3GLEA 4JZJB 4KAQH 1CFMA 2BM3A 4DETA 4OFKA 1BCIA 1OWRM 1P2CB 5JOFB 1HIMH 4JREC 1JTOA 2MOQA 2FBOJ 3KWVA 1CLOL 3BXNB 4KZ0A 4DCQB 4ELKA 5AFAA 3RGVD 4CN4A 3MTRA 3SOBH 3C6LC 3QZLA 1BEXA 3P54A 1F41A 4E0RA 4HPHA 1UWYA 3ATAA 1JV5B 3CN1A 3EZ8A 1KC5L 4FYSA 4IDJH 4GMTH 4AYSA 5KVFL 2R1WA 4I0KA 3DGGA 3Q2WA 2XPYA 3MJ8B 2ICEB 3UTSE 1L9QA 4OT1L 3QDJA 2F1BA 4NCC2 2O30A 4PTUA 3JT0A 3LZLA 2NUPB 5E9DE 4NOFA 5EUOB 3D87B 3IK2A 3L3HA 4JFPA 2ITDB 3QNXA 3QUYD 4Q4EA 4YLQT 3T09A 3BGFB 4FNQA 1U42A 3AB0B 4O2CA 1G9NC 3EFDH 4FABL 3WFBL 2EDFA 5CFHA 3K1KC 1WAAE 5EC2B 3VFNA 2RHEA 4ELMF 2PPAA 1DQVA 4RDBA 3B1TA 4XMPL 3BXNA 1KTDA 1AR2A 4UIKL 2HN7A 5KTEL 1MCCA 1FYTB 1NOFA 3DVFA 3IF1A 4RRPG 4WHYG 4UZSA 1BYNA 4K71B 3P2BA 5ETUA 1CI5A 4HKBB 4POZD 1DQKA 2LQRA 3RPIB 4GAJL 4LKCB 2ODHA 3KCPB 1TJIL 2HKHL 3IVKB 3H2PA 4WUKH 3K2UH 4ZFFA 3O2DA 1LQBC 1E6OL 2IG2H 2IIJA 2ESVB 1ZTXL 1NLDH 2Y1AA 1M1SA 1IKFL 3QYMA 2J8HA 5DD3H 4P9HH 4UBDC 1L0YA 2EYRA 2BFVH 5DQJB 1R17A 5IG7A 1ZIBA 4PH8A 1FYTD 2Y7QA 4GBXD 3UBXI 3FQYA 3N6YA 5EUKB 2GHZA 2OJZL 2E5EA 2X6BA 1W72B 4N8VA 5D7JC 1UZ8A 1AQKL 1R19A 4JFDA 3QB7C 2UX7A 4HAFA 5I19H 2AZUA 3N0PB 2CK0H 1FE8H 3RL1B 4WKZA 4YHOH 1UM4L 1V5JA 1FYTA 3EIFA 2XUWA 4PLJD 4PS8A 1YQ2A 1V7ML 3O9WB 4JM4L 4FQIH 1X5ZA 3UDWC 3T9WA 3VFUA 5C97A 5CXPA 4P3CH 3ASWA 2VN3A 5A6IA 1I4FA 1VPOH 3QISA 1ZLDA 1I7RB 3AB0C 1IE4A 1J86A 1SMOA 5J0BA 4X6DA 3ARFD 4UOQA 2MWCA 4LL9A 3RKDC 1BAFL 4EZKA 2A83A 2LLGA 3GMOB 1BJ1J 5I73C 2CNYA 5K1VA 2X44D 3UZVA 3U2SB 3AABA 3KHQA 1T83A 2DW5A 1TENA 1UC6A 1HINL 4TSBL 1QNZL 3PIQB 3H3PL 1ACCA 1T5XA 3CZEA 4FC3E 4HBQA 2BIHA 3PRZA 3VXNB 1R4XA 3KVQA 1MOEA 2D3LA 2X2IA 5A2BA 3BZFB 4IBTA 4LFHD 4OJYA 3B9KA 4ZUWA 4DKFL 3L9BA 1TPXC 2G4EA 4PB0H 3BWZA 2NR6D 3CC5A 2K45A 1DJXA 3IJHB 3W9DA 2OR9L 3WY2A 1FGVH 3E8UH 3GXNA 4DVBA 2G60L 5ID1B 4XCNB 2XWJB 3OR7B 3BP6B 3D4YA 5CUSH 5D1XA 3U9WA 5J11C 2FGWH 2VR4A 1KXTB 1MW2A 3DIFB 3W2DH 4J3TA 4G80B 2MRYA 1SY6A 1KENL 3OG4B 1H3XA 2YR3A 2PWDA 3F2LA 3AXLB 3ZQXA 1I7UB 1GHFL 4MNQD 1DQJB 5BPPA 4LPUA 2QGCA 3WO4B 1FFQA 3CBJB 1DO6A 2QTEA 2ZQKA 4MA8L 2COQA 4HWEH 1RJLA 4MQ7A 5MEPA 5EOQH 5T3XE 2OYLA 3QDGB 2AI0L 3S37H 4YSOA 3VXSD 5BV7B 1TYRA 5CBAA 1VB9A 4ACPA 4H8VA 2YAMA 3BT2H 3LKOB 1R5VA 3L4VA 2ZCLH 3HZMA 3NFSH 1JPFA 4GQ9H 3ARWA 4WV1A 3M45A 1P53A 3QEHA 5FM5O 1NAMB 3CH1B 2YBRB 4JPVH 1UD5A 2VM9A 4FI8A 5FYKD 3S96B 3ZTEA 3IDYB 3VYPA 3ULUE 4OIIH 4W4OA 1YNLL 5KJ7E 3QO1A 1H3GA 4B3VA 1XTLA 5IVZB 3HNTH 2EIBA 2C34A 4G6JH 4NIYE 1KG0A 1F8TL 4AT6A 4M7LH 5DFTA 1JMXA 1KLFB 2FJFB 3IMSA 2E56A 4X6FB 1J1OH 2WLKA 3NIFE 5KUKA 4Z95L 2HLEB 3BAKA 1RZ7H 4OZHB 1T04A 4NO5A 3L3DA 5JMRA 3O4LB 2EUVA 5K5YA 1IJNA 4K7PY 4PJAB 1V7NH 4BD4A 5DJDA 3O3BB 4H25A 4K8RH 3NZ8A 2IVFC 3GLAA 4KRPB 3TBSA 2GBAA 3W5MA 2W65B 4K3JH 3VWKC 1EFXD 1L9TA 4PJXF 3DV6B 4ZYKA 3TNMA 1ULVA 2W88A 3OPZH 3PXJA 1CXEA 2X05A 3ZGIA 1DDHB 1QHQA 1MWOA 2EVJA 2BSRB 1A4BA 5CP3H 2RFXB 1KGCD 2VIRA 4H0GA 3MRJB 4D0CB 2I5YH 1BQKA 1P7KA 1FV1A 4YLCA 2VM3A 1ADQL 1L4IA 1N18A 5E00B 4ABVA 5I30L 3KPOB 4I85A 1ETA1 2FT7A 3IU3A 1R24A 1DBML 4PY7B 1PYWA 2WXQA 1N64L 1SHXA 1DEDA 3NGBC 3UTTD 4E9RA 12E8H 1UXSA 3O6ML 3QRGL 4Z7VB 1HDMB 3CQQA 1RULH 2AXGB 5F6HI 1F18A 3GC3A 4MB1A 2MCPL 2J1WA 4W9JC 2UVFA 2NR6A 5FYKE 1XGTA 2PKDA 4KTEL 1VJSA 3H0TA 3ECVA 4JRYB 4U6TA 4D7PA 1O9VA 3FNKA 3R1GL 3WDJA 3WY1A 3SKMA 2ROYA 4ZFGH 1U8KA 1BVKB 1X4ZA 2ZYRA 4HLZG 4BJLA 3PDOA 5GRWA 2VLRE 2ZX8A 3K72B 1ZWIA 3HKFA 3QJRB 1NIEA 1KBKA 2C4FU 4GFXA 1H8LA 2C1OB 5DS1A 3FUDA 3PGFL 1IGCL 1NUFA 1FL5A 3QUXD 2ISDA 5JR1L 4KQ3H 4CMMA 1K6QH 2BSCA 3N06B 4OFIA 2W0KA 5E9DA 2W5PA 3HHRB 1ZHNB 2UYLB 1F58H 2VDOL 3KJ4C 3PPSA 1NOLA 3UTSA 3IMUA 1RUQL 4XCYB 4H8WC 2ZNWA 4HIXH 3RURA 4F7CA 4L4TA 3Q2CA 5ACLA 4OV5A 1BM3L 3DROB 3NIDE 4IU2B 4RAUB 1CD1B 5L0QB 2JCCA 4KJPC 2IGFH 3B5HA 3PGCB 4PJ8A 2G9KA 5KSBB 1CGXA 3OKKA 1IKNA 3G04A 4WF7A 3LMJL 2ZP0T 1EAPA 2WZPD 1ES0A 2Z35B 3D25B 2OXHA 4KK5D 3UADA 1JCKA 1ZT1B 4IGBB 1NANH 2FB4H 3OKOA 3SJVA 5BRQA 4Q58C 3HRZC 1E4XL 2DLGA 2G5BB 1H3PH 3UH8A 4L37B 1UD2A 2WQXA 1MLCA 1A4CA 4FQXD 2I60H 5F1NB 4DK6A 1THAA 1LDPH 1QBMH 1IVLA 1DZBA 1BF5A 1NL0L 4DGVL 3QUYC 1S9WA 4JUSA 5ESVB 4WFGE 3QJZA 3FSZA 4OJCA 3H9HB 1SBBA 1U8PB 4NQEA 3VD2A 5IF0B 4H8QA 1Y6KR 1A25A 2KBGA 2YD7A 3PGCA 4FNPA 5DD1H 5D7HA 3HG3A 4R26L 2YA1A 4ZXBB 4MVBD 2QHRL 1JYVA 4JG5A 4XGZA 1CICA 2OMUB 4JJ5A 1L9MA 2NY3D 4OM1L 2GT9A 3QRBA 1G7MB 4JFUA 3TNMB 2UXVA 2WGNB 1FYTE 3MRMB 4Y2DA 1CB4A 1NBYB 3OMNB 1YEHL 5CLZA 1EEZB 3T08A 3VXQA 4QYAA 1NGPL 3FB7B 4BHUI 1JHKH 3DBXA 3ESPA 2WSKA 1HHJB 1EEYA 3MCYA 1XH0A 3HI1A 5I76B 2A74C 4OF3A 2ZYIA 2Y6SC 4OZHE 2J20A 5IMOA 1T5WA 2EIMB 2ICEC 2YPKB 3EOTH 3EJRA 4QHLB 2VE6A 5DEGB 2ED6A 1BZDA 3CVDA 3H56A 4GG6E 1UXSB 1OTSC 4EI5C 4XB8A 4Q56A 4ERSL 1D5MB 4IGBC 4LVNC 3QJOA 4WWID 1TNNA 1ZDSA 5FB8B 1N9PA 4XXCC 1MFDH 3BGMA 2DJUA 1IAKB 2FGWL 1E5UI 3GSWA 1QR1B 2EICA 4ZFOB 3LNDA 1JWUB 1FNAA 1GGCH 4OCRH 3TPUA 3JVFC 4U05A 2XZCL 5TD4A 1FDLL 3TU6A 2WYIA 2BC4A 1VFBA 4LGSB 3EO1B 1CXFA 2OJ1A 2CUIA 4ABUA 4EO5A 4PB0L 4QXGH 3ARTA 3B4NA 3AWFA 1AQMA 3KLAA 1F45A 1FGVL 3GTNA 3Q8BA 4U1HB 4W81A 5DRNA 3E6HA 4F7PA 1O0VA 1QRND 3G9AB 5I15H 2AI0H 4NNXB 3S37L 4N28A 2F54A 4U1JB 1KENH 3FONB 2NUPA 1A7PH 1PZBA 4M5YH 4YSRA 5I1IH 3O11B 3EXLA 2W07A 3GBLA 3PWVA 1RHHB 1EAOA 4N2FA 2QKIC 3S0PA 1MJUH 1AQHA 4DO6A 5L88H 5EC2A 1QG3A 4ZFQA 3QJXA 3LNHA 3NZUA 1MFNA 3LV3A 4X0NA 1LE9A 4PN6A 1NEZG 2R29H 3HE6B 3SJVD 5FF6A 2HN7B 2X2UA 3ROOA 3HPLA 4GKOA 2XI9A 4IU3B 5EG6C 5T1MA 1SHWA 3PWPA 1F4HA 3R06A 5DLLA 5FWRA 2DH2A 1YY9D 5I8KL 5ES4B 5DFWH 4JKWA 2EDDA 1U4EA 4PJCB 4RGNC 2CXGA 2DD8L 1BOGA 2IMMA 2XN9D 3Q2VA 4LB8A 4NHCH 3ZKSD 4J39A 4L37A 2J21A 3DOSA 1ZT7B 5C08B 5ADOL 4J2XA 4EOWL 3RJDA 2O5ZL 3DX9A 3GBNH 1DQIA 1QSEB 32C2B 4QXUH 1ETJA 4JVUA 2M8XA 3PFUA 4L8DA 4JY5L 3FFDB 1F8TH 4PJIF 5IFJB 1MZZA 1XFPA 5HJ3A 4BKTC 3WJMA 3MA7B 4A7TA 5KW9L 1X3DA 3QI9A 1Z5LA 5DZVA 4ZW6A 1CGYA 2PR4H 4MSWB 4ZMYA 3VFOA 1WA1X 3K6DA 3C5SB 1NM9A 3AG2B 3WU1A 2WLMA 4M3HA 4X7SH 3S36L 1CJYA 1IC5H 4QRQB 3VD7A 3G5XB 2A6JB 4P2YA 1JDDA 3MUHL 4R7LA 4YGAB 5KANI 3FSWA 2D0HA 4HXAL 3GMQB 1AKPA 1MCPL 3F7VA 3K6OA 3U0WL 1MCFA 2BNRE 5F1KC 3UG4A 1B0RB 3MACL 1XH3B 2WBKA 5I1JH 2C4XA 4CN1A 2DPKA 4GAJH 1CICC 4RFOH 5I17B 4YBQC 1A7OL 1D5BA 3UZVB 1N2RB 3GDCA 3BCFA 1MHCA 2N0MA 2YOAA 2DYRB 4FG0A 2N01B 3TGXA 3NCYS 2UXFA 1ASPA 1T5XB 4P9HL 4RAVA 1SVZA 5E8PA 1XT5A 1EFQA 1QAWA 2FT6A 5I30H 1RZQA 1YEFH 5H94A 2X2YA 5LO7A 2FRGP 2Y2TA 4NKQB 2XYBA 1XIWA 3MLZH 1U3YA 4M7JL 4P57A 4K94L 5DJ2B 1VHPA 4XCNA 2DZEA 2OQJA 3CCHA 5E8DH 3ZE1F 4QGYA 5IB3A 2HJFB 1CR9H 3BPOB 2CRMA 3QK0A 4TQEL 3EGXB 3PUUA 3VFWB 3JWDH 2GUOA 3GIVA 1Y6NR 1EHAA 1HEZA 2OMTA 3BLKA 3G6JE 4X6CE 2WO2B 4WW2A 2JF1A 4OD2B 1NICA 1OQOA 2CJ3A 3LKQA 5IHUH 4HHGA 1CG9B 4G8IA 1MH5A 2AXHA 5C0AE 1S9YA 4F2MA 1NCJA 4GG6B 1X5AA 1FIEA 1MEXH 3VH8A 4C83B 2OCCB 2WKLA 2FIKA 4IOIA 3QIBD 1TT6A 5GZOD 5LDSA 3ROLB 4LASH 2EKSB 1OAJA 5MERA 4IKNA 4PJ7F 3IPBA 2BOLA 3MRNA 4MZ2A 2QFRA 2OBGA 4YEEA 4BFBD 4CBZA 3MXWL 5FM8A 1F3DH 5D9SA 5F97E 4HU8A 4PLNC 2HH0H 4NM4H 3DJZA 3ULVE 4C58B 3BEVB 3ARBD 2ZWNA 2ZG3A 3CQPA 4JY4A 4TLKA 3Q6FB 1A6ZB 3WUWG 2FTAA 4LGRB 3UEQA 3JVGC 4F8NA 1GW0A 2HFTA 3S4SB 3TZVD 4Z7OB 4PB9L 1GYUA 1F4XL 5E8EA 3ZLQC 2PYFB 3FRUA 4XODA 2AEQH 2R0KL 4QRPE 1R9FA 3V6FA 2X9YA 3X17A 2WWMD 2JLLA 4X6DF 4XNZC 2F7OA 1HI6A 4WNSA 3QDJB 5EC1A 4E9VA 1S9XB 3FH8A 1HL5A 4O2CB 4ISVA 4KHTH 5HI5D 1T89A 3RVVC 3I6GA 4DP4X 1MHEB 5AKSA 5DD0L 3SBPA 3Q8FA 2J2ZB 1X9RA 3JTTA 3U82B 2RR3A 3OB0K 1E4WL 3TWYA 3TEUA 3QUXC 2AABL 3VFNB 1I82A 3O9WC 2YK1H 2AQSA 2E27H 4A2FA 4PGDB 4HKBA 5AYUH 1JGVL 1MFEH 1XBDA 2QSVA 1OSPL 3DO3A 2BHFA 3L1OH 1SYSA 4JKPH 2QZ5A 4B9PA 2WUBH 4Q0XL 4QWWC 4RZKA 1JZ6A 4FHBD 2BVOA 4NQCA 3LSOA 4EVNA 2EDNA 1HT6A 6TAAA 3I3BA 2PCXA 3SIKA 3CGTA 5SX5H 3OHXC 4WI0A 1Q8MA 2KMWA 4BQBA 3MA9L 4YHYB 4F9LA 5I16A 2QZQA 4MDIB 1WP6A 2QFPA 5C09A 4L3EA 4PV9B 5K1JA 2K7PA 2ZX7A 1KXVC 2WLIB 1JPTL 2CR6A 4HK0A 2Z92B 2CO3A 1T7ZA 3FO9B 3HIZA 3OG6B 2CLZB 3QULA 3HBZA 4X9GA 3EOAB 3D30A 2CBPA 2WMPB 4GQPH 1YUHA 2OTWB 4YC2C 3MOQA 1AGBA 1SYSB 1ZVHA 4LVEA 2ZKHL 3DYPA 2HFFA 1JF6A 3MREB 3SKMB 5GGRY 3EGXA 2GJ6D 1M6OA 2DWDB 2PWFA 3BGFC 2MMXA 2FQEA 3MRHB 2ZUSA 5F7HA 5JZ7D 3JUYA 2YJQA 1N0XH 1IGYA 3WKMH 1WAEA 4PJ7B 3R4DA 5D1QB 4G5AA 3QIBB 5EO1B 3BQVA 3VXSA 1L0PA 4GQRA 2JV6A 5E9DB 3TBVA 2X4TB 4FJ6A 5T33H 4KJYA 1JNLH 3TJHD 4AYFB 2R0ZL 3BGAA 5FXCH 5LGHL 5IMLA 1Z9LA 2X12A 2H3NA 3V5KB 1IGJB 5KVDE 4XNYL 4AG4H 3ZDZF 2VR7A 2H0PA 4E41D 1YYCA 3AT0A 5KG9A 3QNFA 2GAZB 1I1AB 2W80C 2ZOUA 35C8H 4KXCA 5IBUG 4NNPH 5LBGA 4AZUA 3L7FA 2F5AH 5DRZB 5GQBA 1LO0L 3W9DB 4HFWB 2NY0D 1A7PL 2H1PH 4M5YL 1TR7A 1IQWL 4WFHE 2EDJA 1E27B 4POUB 3MRQB 5ABAA 2VDOB 4YUEL 1UQSB 3MV8D 5CP3A 4G80A 4M9PA 1UWGL 1S6NA 4AKQA 1KY6A 1MHPH 3BVDB 4G8EB 3OR7A 1YDPB 1H5BC 2W60B 3VGBA 1NKOA 4XRCA 5J12C 1OCWL 4LBAA 4OQ1A 3H85A 1J5DA 4PRHE 3VI4A 3LKSA 5F44A 4KKZA 4IMKA 1JAEA 3BFWA 3H8NA 3INUH 4NN7C 1KBVA 1IGJA 5D1ZA 1TEFA 3BAIA 4UDTA 3V4VA 2W0PA 4YX2H 3HE6D 2GTQA 2X4QB 3ULVL 1K5NB 1WV7T 3NJNA 4YFEA 2AQQA 2W94A 2JJSC 1MF2H 3LZPA 2IDCA 4OJFL 3UJJL 3A3YB 3ARFA 4B9ZA 3K2MC 2VH5H 1PAZA 2HVKB 4HMEA 3RNQA 3G5YA 1KGUA 4OAWB 2MHAB 3II1A 1T4WA 3WEOA 4A7GF 2VXTH 3QEQA 4XMWA 1HEJC 5DD6A 2IV8A 1QOKA 5H8DA 4KXAA 4D3CH 2G75A 3HPJA 4JFPB 3B2VL 4NCC1 3TEWA 4BSVB 1KG0B 1NDGB 3G6AA 1FORH 4MQXC 5GJSH 4YHMH 3L2LA 4KVNH 2Q9OA 2VSKB 4P46D 4CJ0A 4OCYL 4XX5A 3BMVA 1JPST 1AC6A 1T2XA 1WSST 3RWJA 4UT9H 3EADA 1KXQE 2ZCKH 5T3ZL 3BW9A 4WNJA 3ZL2A 5I1LA 5IMOB 1QQDB 1PG7L 2JJTA 4MB3A 4ZMWA 4ZUUA 1CL7H 2YD9A 4YLBA 4UT6L 1OARL 3MRLA 4GEIA 3NZHH 5E2UH 4H26A 4ODSL 4G1MB 4MJJA 4S1RH 2J6EH 1BV8A 2R2HB 1BJMA 3LH8A 3VXUA 2D7TL 3ZDYF 1AOHA 3KS0J 1IEBA 2OMZB 2ZCHL 1T7VA 5CEZH 3QEQB 1IT9H 4FKEA 4UU9A 4HC1H 4YR6A 2WWNA 4P5MB 2MOVA 3N9GL 3IDMA 4NKDA 1A6VH 2DICA 4LKCA 3WNLA 4N0RA 4FDWA 3TCLA 3OJ2C 4IKLA 3VXRE 4J6IA 1RH8A 2Z3FA 3MCG1 4IRZH 4PLJC 2C3VB 2J1XA 5E99L 4Y2OB 1BD2E 3W39A 4JFYA 1WHOA 2HFEA 1M2VB 4HJJL 5HDBE 5L4MA 1UEYA 3TF4A 3D4CA 3GXDA 1PZDA 2HTLC 4BH7B 2JXMA 1FCCA 3HS0C 5D7JD 5EF3A 1K5WA 5C7ZA 2DMGA 2VLJD 5IQ7L 2VM4A 3BCDA 5FO7A 3RIFK 2OL3L 1G7IA 5DD5H 3EGDB 3Q3GB 1UXLA 4Z7WB 4P4RB 1LK3H 2BCKA 5FGSA 3BRGC 1RZGA 1MVUB 2F7PA 1SDDA 4M62L 3PDOB 1JZ7A 1W0WA 3KPPA 2UWEF 1N6QH 2WCSA 1E6JH 3KS0H 3HR6A 3TH3T 5ENWB 2ZXGA 4XO9A 3TBYB 4NPYA 1C1EL 1J88A 1G0YR 1XGTB 1QLFB 3GFUA 4FNTA 3PWPB 1P5UC 3S5YA 1XSIA 2XG4A 2Z4QA 5IM7B 3ARDA 3ECWA 5H2BA 4KVPA 1PLCA 5JIQA 3FTWA 4M1DL 4PJCA 5LAXA 1MJ7H 4XCFH 5LKNA 1A7QH 2X53A 3MXWH 4JFQB 3TO4D 4F7CB 1D5ZA 2NX5A 2OZ4L 3P9MA 3B8YA 4IGBD 1OTSD 3N43F 3HB3C 3KWWA 5IEHB 3T0EA 5D7KE 3CZJA 3ME0B 3RAJH 4AM0A 1NSNH 3A6BH 3KPMA 2R23A 2Y6SD 2OV0A 2ETWA 1E6OH 2IG2L 1DBKL 3K91A 3BKCH 3DO7A 1EEUA 5HJ3B 4AGMA 4H88H 5EWIL 1ZT1A 1AZNA 5I5RA 2WJ5A 4TV3A 2EADA 5DHVB 5K69A 3G04B 3IPEA 4E42A 5HHNB 1P6AB 4G6ML 2ZX9A 3ZZ1A 2K9FB 5K9OA 1CLYL 2PYEB 3BPNC 5JPNC 4YK4C 1A0QL 2QQNH 3N40P 5DEZA 3MI6A 4C56B 4BDVB 3P73B 1FO0A 5J6GB 1RK1B 4NUGL 3O2WL 2XV0A 4LSSH 4F15C 3DRTB 5LWYH 4N5EC 3BZDA 5E1HB 1HFUA 1E28A 3C5JB 1I3RA 3QFGA 4N8CL 4C4KT 3ARED 5KS9A 1AQ8A 3IDXH 1E8ZA 3QR2A 1TVHA 1Z9NA 1NBCA 2VDNB 4KO6A 4X7CC 4KX9A 5DQ9B 3QCUH 5KYWB 2B2XH 1AZBA 3CFKB 3MV01 1VRSA 1SBSL 3TVMA 5EN2A 1PQZB 4HUUB 3HEIB 3JSSA 2IANB 4NHCL 4GAFB 1OM9A 2VQUA 2J6WA 3WMQA 5DZNA 3CSBA 3HAEH 5E08H 1XIWD 1JPTH 2BMKA 3RI5K 4QXWA 3HNTL 2QVKA 1FG2A 4FULA 2V3FA 4L4VE 2XQYK 1VCBC 4KI5D 4EIGB 4PVLA 4ZPVB 4Z78B 1DANU 3HI1B 1HWGB 2EO9A 1G94A 1NMBH 5ICXB 1RPKA 2BWQA 5AAMA 2MCAA 5TQ2L 1TYEB 3EFOA 4JJHA 5LGKA 3V6OA 4JY6A 3KL0A 1DVYA 1D5MA 4QRSA 3V4VL 5JXEC 4PJDB 4ZMZA 2Z8RA 5D71L 1YEWA 4Z3TA 4P46A 1FP5A 3MNDA 1TQBC 3U9UA 5J11B 3AU1B 2E9BA 2AK1L 5LVEA 2EABA 1HSAA 3FOMB 2JKIS 1D5XB 1KN2H 4NLAA 3EYQC 5CR1A 3S37X 4GOSA 1KLGA 5EEXA 1WE5A 1DDHA 3AS1A 3B1UA 4GJTB 3C60A 1SUJA 2WINA 3QUXB 4AEIL 3D39B 3N50A 1YSOA 4XNAA 1CD8A 2GEEA 5DQDH 2FX9L 1J5OL 2GB2A 1IGFH 1Q9LA 5K9KA 3OKMB 5HVHC 4NFBA 4KZEH 3FW6A 4FFZL 2DQDL 1S78D 4L8SA 1AR1B 3B7TA 3DURB 3NFNA 3BAJA 3L48A 5I8OH 3ULVD 1A1NB 3BUPA 4UM8B 4LLAA 1MIML 3DWTA 2MTAA 2W07B 3U46A 3SY0A 4LBEB 4RMRA 3V4PL 3TEXA 1RUAH 2YGVA 1A6AA 4L1LA 1S7VA 2QLVB 3FO0L 1SRDA 2FECI 3MV11 5J9PA 5DS2A 4A2HA 3TS8A 4Y5YC 3DMMD 2P5WA 1P5UA 3PWVB 4FNRA 4RWYL 4TUKL 3FONA 3A67H 2H3XC 3AGWA 5LXVA 4R6UA 4HD5A 3BFOA 5J13B 2H32B 3CPUA 2XXMB 5DTFB 1J48A 1C12B 1OGPA 1H19A 4DEPB 5DJ8A 1ZGLA 1A8JH 5F3HA 3T4YA 4LARH 2D73A 1S5IL 5HHXH 3AT8A 1BFVH 4E9SA 3AS2A 3M88A 3OMZA 5FWQA 1M3IA 1EFXB 1MJJB 4N0CD 1XF2B 4BDVA 3QNYA 4WFGD 4HGKC 4UNUA 4GG8A 4KRPD 3SY0B 5INCB 3K8LA 2NNAA 1B2YA 1CXHA 3OX8B 3CLFH 2R59A 2V7HA 4XMKH 2WLHA 3U7YL 3QQ3A 3NG5A 1J10A 1Z5LB 2E76C 3O45B 4PY8I 5CLXA 4X99A 3IMVA 4OF0A 5HDOA 4JHWH 1T0PB 1NGWB 2EEBA 5E9AA 4HMDA 1O9ZA 4GRWF 3WJLC 3RL2A 1P1VA 1DVQA 2ZCKL 1FIGH 3BIKB 1E3ZA 5B7EA 5JNYB 3VTTA 1D6EA 2XZAL 1GOGA 5IV2A 3QEGH 2BK8A 1MCWW 2FLMA 3VSQA 2A9BA 1HZHH 5DZ9A 4WUUE 3WHXB 4RSVA 5AG8A 3ZRSA 1AO7D 1JHTA 1FFPB 2NY1C 3B43A 2ICWJ 2A1WH 4BH8A 1K4DB 2WYHA 4N2KA 4BRJA 4YBLB 1EAPB 3SGJC 4HS6B 3VXRA 4MASA 2HT2D 5MP6L 2XWDA 4F9PA 1OLZA 3G08B 3A24A 4TUUA 5MHSE 4OF7A 4Y8DC 8FABB 1FZJB 1HNFA 3HN5A 4XAKD 3OF6A 2R1XA 5AVUB 2FNWA 1MRCL 5BS0D 2NNXA 2YC1A 3VDAA 1EZVX 4JG1H 1NGWA 4NQDE 5B39A 1MLCB 2N1KA 4L9DA 5CP7B 1DVFB 4PJXE 4R26H 4U1LB 1HKLL 4A6YB 4UNVA 4M5TA 2GT9B 4UQBA 2P42B 1U8JA 4ZMNA 1VFAA 4FLSA 2WIMA 1ACZA 3QA3B 1SXCA 5CJOH 3SDYH 3KW7A 5EDSA 1RV6X 4WO4B 5E5UB 1OTUC 4NKIH 2Y72A 4DP0X 4HGWB 4LLUB 3LHPL 2ZOLB 1B0GB 1AGCA 1BPLB 4JVWA 4WK0B 1U30A 3GIVB 1O9WA 4MMYB 4M62H 4GQQA 2NNCA 1H0DB 1YCSA 2CKNA 1DBMH 2X0WA 3DGGB 4NX0A 4U1GC 5I6PA 4EKXA 2HJFA 4KQ0A 4URTB 2LLLA 4DKFH 4EDXA 2MOGA 4NQED 5A16B 3RG1C 2ERJB 4O02A 4YDNA 3NCYP 4IK6A 1F4AA 1XMWA 5HHOA 1U8QB 3IN0A 5F0LB 2HG5A 4FQXA 5FB8A 1I75A 2EEAA 4RGNB 3B2PA 4FZ8L 2PW1A 4KTDH 5HVWA 1S9YB 2D9QB 3EBGA 4L8SC 2AEPH 4N85A 3GDBA 1YMHB 2EAEA 3GSWB 1QR1A 4MHHG 3NESA 4NLHA 2R27A 4QHLA 4K3EH 4P5RA 3HMXA 3LNGA 3FO2A 1NGXA 4JKMA 2BIMA 4G43B 2WBJB 1GYVA 3KCPA 3W11C 3UPAA 1ADWA 2ZTBA 5DDHA 2EKSA 1W2KT 2L0DA 4YFLF 4U6YB 5HJGA 1GS6X 2CHWA 1E90A 5AW1B 4TTGA 4OZFB 3RZCC 1YQVH 4QF1A 3VFPB 4MYWB 1BVZA 2FH6A 2CJSA 3O9WD 1OD9A 4K3HA 4ANXA 4S0HA 5MI0C 4I3SL 1PLBA 1CO1A 3PV6A 4GXVH 3UJTL 2PUQT 3W57A 4AJYV 5CN3A 1DN0A 2DWYA 3AG3B 4EBQH 2BHYA 4N24A 2IOMA 3AUVA 5BS0A 2EINB 1BYOA 2Z91B 5L88L 3K2KA 1S7RB 4HUWA 4CILA 5ID0A 1HOCA 2P49B 1RIHH 4FQQA 4UV4L 1J1PH 3KPSD 3IDGB 5C92A 4GXUM 3A4EA 6PAZA 3BO8A 3EGSB 2R29L 5D2LA 5AAWA 2P47B 5C0EA 4UBDD 1D5IL 2FWLB 1L9NA 1RJZB 3I6KB 3C08L 3O3EA 5IV2B 4H5SB 4OFYA 3CBRA 4YMPA 5FGCE 2ESVD 1QZ1A 2P8MA 1RCYA 1X9QA 4X4ZA 1EXUA 2BS71 5CR8A 4NXSA 3KPLA 2N59A 3GSUB 3SZ6A 5DHDA 3ZK0A 3R06B 4EI6A 1AS7A 2VH5L 3IDMB 2EIDA 1S9VA 3ZTNH 3SDDD 2APTA 2IAAC 4PV8B 3SOTA 4HETA 1EJ8A 1G1CA 2WNWA 1XWVA 2OP4H 4KDTC 3U1SL 5PCYA 4WI0B 2DMKA 4IHBA 4I77H 3B2VH 3BLBA 3ML9A 3ISRA 1COBA 2DBLH 3ZO9A 4PJ8C 4GRWH 3DX9B 1AIZA 2FR4B 4R4BA 3FB5B 1MKFA 4L3EB 4OFYD 3ZL4L 1BZEA 1SEQH 1F00I 4J3BA 3T0AA 4KU1A 4W9GC 4WTZG 2G0LA 3VU2A 4URKA 2XPGA 2CKBB 5EU6A 3S4SG 3P9WB 3VE0A 1RZJC 3APDA 4CVXA 1XH3A 3UO8B 2V33A 3LIZL 2LAAA 3MLVL 4OM0H 3U25A 1XCQB 2WY3B 2ZWKA 1N26A 1Z5YD 4NRXA 5EORH 2XTSA 3RU8H 2E7BA 1WS7A 2BNRB 4DQOL 4QO1A 3GD1C 3PWPE 3QAZB 5GS0C 1EJOH 2HFFB 4HUXA 3S7GA 4X4ME 2CR3A 1AKJB 4XB3A 1AZRA 2ZOKA 1EO5A 1U8QA 2A2QT 4G7QB 1T22A 3VWJC 5KYXA 1PJ9A 1KB9K 2AJSL 2X40A 4J8RB 2OK0L 3OKDA 3KHOA 4W9KC 3CLEH 1I9JH 4U3HA 5F9OH 3T0EB 4DZBA 3MRDA 5E2VH 3RUGA 5E8NB 1OP5H 3K6NA 2W9EL 1KULA 4UYPA 2A9CA 2J55A 4YBQD 1G9MH 1MELA 2K1MA 2YZ8A 4XPBH 3RVXC 5J5EA 2B5IB 5ICZA 4KROB 5HYJD 3EYSL 4P99A 4UYQA 4OLYL 2BO0A 1MWAA 4LARL 4BFFA 1WWBX 2KUTA 1S2EA 3BSHA 1JP5A 1RZ8B 3TLRA 2CGRH 4X9FA 2DIJA 4RWHA 1MREH 3ALWA 3GHBH 5EZOL 1A7NH 5C8JB 1S46A 5FR3A 4MZIA 5JIMA 5FO9A 5F7FA 4HZAA 4IRSB 1MUJB 4Z7QF 4F9PC 2K6ZA 2ICEA 1R3IH 4N8VG 2OM5A 3CZGA 1U8HB 2DIAA 2EE6A 5EMYA 4BE5A 3MLSL 1K5NA 2DQTL 2DWXA 1NFDE 1YDPA 2A38A 1TQTA 3L3HB 2ITDA 3QNXB 4W9HC 4WW2B 3BC9A 2F8OA 1TZGH 4W9ZA 3E0GA 2X1OA 2CBOA 4DGIL 2F7QA 1ZSHA 4F5CA 2FSDA 1QFWL 1PD1A 2JH2A 5EZPA 4GG6A 2AMUA 4L0PB 3ARGA 5E4IA 3KEHA 3QDMA 4EJ1C 3GGWA 1KTLB 1KPRB 3P9LA 4KMLB 5F96H 5SWQA 1MWAB 5FDYA 4G11A 5DJYB 1ZLUK 5LQBL 2WN2A 3EDEA 1X5XA 3LXBA 3KWUA 1LXMA 5K33A 1NDMB 5FYKL 3VTAA 3TTSA 1FL6A 1WTLA 3P30L 2HAZA 4MCYB 1CBJA 3BKCL 3X11B 3TA3C 4P2OA 3WFHA 2IO5A 1HQ4A 5AB9A 1PS3A 1F4XH 4UDUB 3FT4B 3QGVA 2FO1A 1NUDA 4ZODA 1CYWA 1PG7X 3IGAA 4V1DB 4P05A 4ZUUB 3NIGF 4PJFB 3BH8B 1RP9A 4NI6A 3TA3D 4QMEA 3CN2A 3GO1H 4KO9A 1A1MB 3UBXG 2L3BA 4H1LH 3QUZA 3GSNA 2GIMA 4G7YH 5DJ0B 5KANG 3UEZA 1A5FL 3SPGA 4A66A 4YHYC 3RYMA 4OZIE 3V2AR 3SDAC 3AITA 3HG1D 5FGCB 4ZOAA 3EOTL 3FN3A 4GI9A 3IDNB 2Z34A 3ZDXF 1C16B 1I1AC 1RI8A 4PJDF 5D7LA 4GRWB 3OZLA 3HUJE 2EDLA 4Y1AD 3BSZH 3LIUA 4Z8FH 2J73A 4PP1C 4W70A 1FWXA 2D7OA 3LKPA 5A2KH 2AVGA 3WUWA 4HJGA 4PEEA 4PGEB 4NQCB 2WXJA 3FRPA 3WTXA 4XCYA 3FF7A 4GRLA 5J89A 1X9UA 2VDPB 3AAZA 4HIHA 3P4MB 1MQKH 4KGJA 3QC5X 25C8L 1KACB 3VFTB 3RVXD 1MJ8H 2EXWC 2I25N 3CC5B 4GFTB 2E46A 2Q86A 3RFZA 2JE8A 2WSDA 3CUPB 4G5ZH 5JIIA 5JO5B 5B8CC 3KYOB 5KSAB 4XBGB 3BFQG 1E40A 4OV5B 4NP4H 3ZRCC 4EI5B 1L9RA 5GIRB 1HK6A 1MJUL 1IC4L 2P5EE 3IJHA 3INOA 1SN0A 2P8PA 3PL6D 4I1RA 1JRHI 2WQ8A 3ZTJG 4MA8H 4FQ2H 1LK2A 4ZUTB 4X7DC 4KK9D 2HWZL 3MMEA 2A3TA 4PIBA 4PJ7E 2F7IA 1ZLWH 1YNKH 2FYYB 5H4YA 5CILH 2GYSA 4TSAH 3HCVB 5DMIH 1N3NA 2Y3NA 5AB2A 1NPJA 2WQWA 5A2AA 3FOLA 3L13A 1NCTA 3MJ7A 5TH2B 1JFQL 4WK4B 4Z23A 2PXYA 2IQ9L 3DX4A 1HE7A 4P04A 2EDKA 1OOAA 1ML0A 1IQWH 4FABH 3O4LE 4O2EB 4M4PA 3MNWA 1KTLA 4PLOB 3FZUD 1HZLA 4JN2B 1J5CA 4JCWA 4G82A 5GGVH 3DO7B 1QHOA 1MHPL 2BZCA 2QSTA 1J8KA 4LVHB 4PJ9B 3GHPA 4ES8A 2OAAA 3ECBB 2KI6A 4XVTH 5JMOC 5IVZA 1NMCB 2ZOOA 3BD3A 3V7AE 2X42A 1E27A 2E6JA 4AGNA 3RX9A 3JWNG 4GNKB 4I7ZC 5EOCJ 4HQQL 1QI4A 2LGNA 2YBRA 2GW5A 3GM8A 5CWSB 4YN3A 3VYNA 4GSQA 3WNMA 1WVZA 5FYLE 1F13A 1U3HA 4IRSC 5GPRA 4BGLA 4LCUB 3ZE2E 3MRFB 2GI7A 4YHOL 4DEPC 3FOLB 2FHBA 4Y4HC 2BCMA 3PHSA 3S34L 3O4OC 2BRRH 4G70B 4HV8B 3PP4L 4R5XA 5FUOH 3ZDXE 4QGTA 3KLLA 3SGEH 2X6VA 1OGAE 2OJZH 4B9KC 4TNWF 5F7LB 2Q3AA 3S88L 3O6FB 2BVPB 3GM0A 1I3GH 2O5XL 3WKML 4KO5A 2CGYA 2DL9A 1W8OA 2I32A 4BSVA 3VM5A 2EE9A 4ZPTA 1LO3H 2P5ED 3ZN6A 2EC8A 1ROCA 2J5LC 3TO4A 5JIKA 3I9PA 5FLVA 2VZ1A 3D52A 4QLWA 4XPTH 3RWEB 1UXWA 1IM3A 5EPMA 4CKVX 1F3JA 2V7NA 1N5YL 5BVPH 2TSBA 1KGYE 2VLRB 3OM3B 1EGJL 4ZW7A 2HJLA 3I84A 3I74A 3M1CA 2H45A 3MRRB 1KOAA 1TLKA 4IYKA 4M1CD 1T03H 3AAZB 4FE9A 4LVHC 4PJ9C 4LOEA 5DI8B 3VI4F 4FN0A 4WWKA 2J44A 1UA7A 2V9UA 2AJXL 1KCUL 3GI9H 2YGPA 3VFVA 1HXYB 1K72A 3T4AA 1A6TB 1EBPA 2Q8AH 2HLFC 3QUMA 4KOCA 1EXHA 5DSCB 2A99A 3MRLB 3QH3A 2GJZA 1MAMH 5F7AA 5L9DH 1XH1A 1WWCA 3RVWC 3NIDB 1ZS2A 2IWFA 1WWAX 5KBNC 1OVZA 2LU5A 1RLBA 1FE8L 2HJKB 1E9OA 2MPAL 2IJ0C 1LO2L 3FQNB 3OWRA 4PUBH 4YXKH 3T0WA 2BSSB 1R3IL 2E74C 4Y19B 4YHKH 2YKLL 2VLRA 3EYSH 4BFRA 4ODVH 1OAQL 2YEVB 1AHWC 1KSRA 1REIA 3MRRA 2UYLA 3PGDA 2BCKB 2YQ3A 3D8MA 2JIXD 2UZIL 4XMVA 1UFGA 1GIGL 5B8CA 4QNPF 2J5LB 2YD8A 4QUOA 4P8QA 5FUCC 3TCXA 4YDMA 1FQ9C 4GSUA 1F90L 3IDGA 2V8MA 1D3CA 3L3KA 5EO9A 3T0EE 5FYLH 5IMMB 3KL3A 4TTDD 5DSCA 2GJZB 3GK8L 5FK9B 3ARZA 2X4RA 4YHLH 4YDKH 2H32A 1BGXH 2AF2A 4AJ0A 2NY5C 2CO4A 2WO3B 1NBZB 4P59L 1XVSA 1U91B 1LM8V 3GPSA 1A3LL 1A14H 3M7FB 4P5TB 4HUCA 4BK4A 1Y6MR 2JI2A 3OWEA 2PETA 4IS6B 3LS5L 2N7AA 4OLWH 3ETTA 3ZZQA 3QAZC 2XACC 1QBML 1W15A 2I9LA 3M8OL 1W0VB 2Q10A 3MRFA 5CGMA 1UT2A 1ZK9A 3B3IB 3VXMD 3S9DB 1E30A 5C6PB 3ZHDA 3PQYB 3T0XA 4LEEA 3MLWL 1RUPH 3OJMB 3SKNB 3NJLA 4S2SA 4L8CB 2PWHA 4XCCH 3T6VA 2KLRA 4HFUH 5HDLA 4ENED 2F19H 4B9IA 4RMBA 4ZFZA 4Y2DD 1OW0C 4N68A 4NQSA 3NDYE 4NN7B 43C9B 5J3HD 4FP8L 3ZTDC 3CWGA 1ZHBB 1YMME 4GPVA 4EUPB 1ZDQA 4TYUA 4TXVB 5EFIA 1FZJA 1KCLA 3BKYL 2DWSA 5KVEH 1HH9A 3MLXH 4AQZA 4LT7A 4C56E 1YYLH 3G5VB 3Q1SL 3X3FH 4NC1E 1U3NA 4TF4A 2XY2A 4N0CC 1A1OA 2AQ2A 3GMMA 3GXPA 3WFDH 3OC5A 4BUHA 3OC8A 4NPJA 3RTQC 4ODXA 5DRXA 1DJGA 5DEGA 3UC2A 1G1KA 1O7VA 2Z64C 3B7SA 1AP2B 3WFEH 3FU7A 1YEJH 3QUMH 4WWKB 4LLUA 1CL7I 1IGIL 4L3CA 5I0XA 4FOMA 5F7WC 5B39B 1JZ5A 1OWWA 4S0SD 4G8IB 4WGKA 2WIIA 4ANKA 5FUCE 5E99H 1VFAB 3VI4E 3HR5A 1C5BL 2OMVB 1E8WA 4L4VB 5D1QC 3V0AC 5F7YC 2DQIH 3O6LL 3TNNA 1AE6L 4DWHA 4MD0B 2VDRL 4WIQA 3S3CB 2VIRB 4LSTL 4P3DA 4D9RE 1RUML 3PWLA 5I9QB 2XKNB 1NC4B 2NTFB 2VDNH 1I8UA 1USQA 1CYGA 1CFVH 2VL5A 3CVIH 1JXDA 3OJDB 1O7DC 1RHHA 3UTSD 5IHBA 3QUZD 2CG9X 2AAAA 1MFVA 5F7DB 1BMWA 1UCBL 1LNUB 1I3UA 1SFDA 2HPOA 1OTTD 2VMJA 4PR5A 2JCCE 2QQLH 3OF6D 5TGBA 3MRBA 3IXAA 2DM2A 5TDPA 3HFFA 2FNBA 1CBVL 3GJFA 3AADB 1FNEB 4PRID 4X0KB 1PBYA 2H41A 2GSGB 1Z3GH 4IJ3C 4A55A 3QXAA 2OK0H 3HLKA 5BNXD 1H6FA 12E8L 3O6MH 3HR5B 4A39A 1NCAH 2CHXA 3CH8A 4GLRH 4PRHA 2N7BA 3Q43A 5I8KH 1JZGA 2IBGA 2BVOB 4PJEF 4X5LA 4BINA 4U6XB 2APBA 1ZEAH 5DK0B 1TZIB 2DB8A 5E6IA 4HCRL 4RX4D 1A9EA 3BAYA 1EX0A 1SLVA 3PV6B 5AW9B 3ZTJH 1BVLA 4U3CA 4LNRA 4K5MA 5EU4B 4UMGA 2ZXWB 1KWKA 2WLIA 3C12A 2I07B 4NO3A 5IOPB 5C7XL 1X7SA 4GW5B 4M5ZL 3WJMB 3F04A 2Q7YA 5DJ8B 1ZGLB 3NA9H 2UV3A 1CD1A 1FORL 1FFOB 3O0LA 3MLSH 5FA4B 1A7RL 4XPAL 3RY6C 5IGXL 3D48R 3WTYA 1B0IA 1I3VA 1UB6A 1XCTB 3SE6A 5DVOA 2E8ZA 4HPOH 4OJDH 4PV9A 4NT6B 4XP9H 3OLEA 3MRIA 3FFCE 3OX8A 1YPZF 1YEEH 4M7ZB 7FABH 5E0FA 1JVLA 4QCIB 1X5IA 4EZLA 1QRKA 3CK0L 1FL3B 4LVOB 4G1EB 5FFGA 5BJTA 5CCGE 1D9KD 3GEWB 1EGJH 3MCLL 1F2QA 4A2EA 2OSWA 3TURA 1AGBB 5FCSH 3NVQA 1IFHL 2EYTB 5DUBB 1GZQA 4PP1D 2GEQA 1WG3A 2Y7QB 3L9YA 1AGFA 2WQAA 4WHDA 4NJAL 3VXOA 4YO0A 2DTML 2VITB 1WT5C 1NBVL 2ZKXA 3V4PA 2O61B 2H7WA 4GUOA 3DNKA 2CIKB 1YEFL 2DBJA 4OUUA 3BDYH 4PJAE 5GRJH 3BEWA 3QC6X 5IIEA 5HYQA 1V3LA 1AQDB 3QQ4B 2R8SH 1Y0LB 1MFCH 1CF8L 2F8IA 1BFOA 4QRUA 5EU6B 3SKJL 4AYFA 2XG5B 2Z7UA 4GS7C 3HA0A 3CFIC 3WJLA 4F92B 5C0ND 4YQXL 2OMWB 3B83A 3PABB 2P24B 1XF1A 2YA0A 1U3ZA 4RWYH 1J05A 1SQMA 4U6VL 3NCXA 4XVSH 2EH8H 4RNRB 1OZTG 5F0JB 3EJZD 1FA4A 4RAHA 1IE5A 3EHBC 3KGUA 1PY0A 1JGDA 3JYCA 3GUFA 3PP3H 4TNVK 1Y18A 3KPNB 3VMPA 4PMEA 2EDXA 1FZOB 5GS1C 4OGXL 1EERB 3SD5A 1A6WL 3VH8B 4C83A 5T3XD 4DVRH 1DP0A 1U41A 4FERA 3FQ4A 4MMZB 1GJWA 4ODVL 4MMZC 3B6SB 1RLWA 1CG9A 3FT0A 5C0AA 4Q9RL 4D2NA 1H6UA 1AQDA 3LNEA 5E4EB 3ZDWA 4AVJA 5JLZB 4G6AD 4I48A 2H0JA 1QSED 4ZFOL 2FBRA 1SPDA 4B9JA 1ZS8A 4R96A 5CIPA 3DVNA 2HT4C 5E4AA 1WEJH 1JN6B 1S7XB 2WXNA 3EW3B 1NLBH 4FXTA 3AMLA 4M3JA 3TIEB 4A7VA 4RX4A 4RMWA 3EO1A 4QOKB 5F6IC 2TRHA 4JMXA 4QT5A 1G84A 4LCYB 1XSKA 1GKEA 3L1FA 3AXLA 4OFVA 1TKWA 1UM5H 2F6AA 1A4KB 3U9PL 5JW4R 5LN4A 4JFEB 4PJFE 2WOBA 3G5YB 2NUTA 4FQ1L 2V5MA 2NYYC 2ZUQB 4UT7H 2D7NA 3BW9B 2WVUA 2HX7A 5A3IC 5EV7A 4ZT1A 1SNRA 1IQDA 5I28A 3SPVB 2A7BA 1TPXB 2CUMA 1GCYA 5CF3A 3MRKA 3AACA 5GGRB 3WY3A 3E2HC 1IM3D 1UWEL 2EVGA 3DVGA 2FL5A 3MV7E 2WXIA 1CGVA 1E4WH 1R5VB 2QKIA 4Z77B 2DQUH 5FKAA 2C9SA 5IFAL 4GW4B 2QSQA 2AXJA 4XCCL 3CXHJ 1OP9A 3FTGB 2LHAA 2ODIA 1FNSL 4IHOA 4YVUA 4ZD3L 4A67A 3QWOA 3LEYL 5M7QA 5DJYA 3EFDL 4HFUL 3S8GB 4NQQA 5IBLC 1QTYT 1FUNA 3LQAH 2YN5A 1DFBH 4QD2E 3QG6B 5BJTB 3APCA 3DUHA 4M4RA 1MCQA 3QHFH 4KRMB 4A2DA 1GGUA 1HQ4B 3SDXB 5DUML 5KVEL 1F3JB 4MJ5B 1KEGL 3SGJA 3UBGA 1Z66A 1KPUA 1TVDA 2BNQD 3CHXA 1J9CT 2A9ML 5EBMB 1LWRA 3UZQA 1YEJL 3QUML 4A38A 1YEDA 4PBXA 1WTGT 3DXAB 4KMQA 1TMCB 1TO5A 1KIQB 2EH7L 3CZLA 4PAZA 2YD3A 4AYEC 5TPWH 1BLIA 1F4WH 4IRZA 1FNHA 3MGTB 4KDWA 2E6QA 1LD9A 3U7WL 2J8UE 4UANA 2A9AA 1DSFL 1IKOP 1H3UA 4WK2B 3PP3K 4ETYA 5LAPA 2P28B 1DL7H 2IH8A 4UQIM 4XNUH 4U1MA 4TVUA 1C08B 3E2HB 3VWJD 1IC5L 3JWOC 1P7KB 1HKFA 3ABZA 5D7LB 4N0YH 3P11L 3IAGC 1NGPH 2WNGA 3OXSB 3SDYL 3WDHA 3JWDL 4Y19E 4DPAX 2D2OA 2HRGA 1ZJBA 3A47A 5MENB 2VAJA 3MPCA 3LKPB 1K8DA 1P4BL 4PMFA 2WVSA 1ZLWK 3V55A 3GXUB 4N2OA 4D0BA 2E7HA 2Z7YA 3PJLA 4OKVB 5J6HA 5AL8A 3FBQA 1GZPA 4CGTA 1PKOA 2B9BA 3GHEL 2C7FA 3FCBA 4MA7H 1V55B 1LILA 5DJCA 3RHWK 4GAYB 2B1AH 4ETQB 1RURH 2J7LA 4TL4A 5IB1A 4DNLA 1FVDB 2V2XB 3FUFA 2D03L 3LKNB 1EJ6A 4Y5VA 4WV1B 4FFWD 2MCG1 2BJMH 5C0CB 1AKJA 1FAIH 5GS1A 1A64A 3JV0A 3P1VA 4Y9EA 3IRZA 3VI4B 4FXGC 2EE0A 1AHMA 2W60A 4PTTA 2Y2YA 2VZ3A 1XCQA 2AQNA 3VDCA 1L7IH 3GPEA 3QPKA 1G9NL 1DLFH 3QR1A 4JPKL 2GIYA 4G9FB 4AT6B 4OU3A 2YSTA 3SDDC 3FUJA 1UQSA 3E38A 3HG4A 4XMZA 4TQEH 3W5NA 3ESOA 4N0UA 3HMWH 3G7TA 3IRPX 4DFHA 5FO8B 2H0EA 1S7SB 3FPYA 4KTYA 1YZZA 2J25A 3D34A 4F8TA 2WAQA 5I1IL 1OLLA 1E4HA 2DQJH 3MC0A 1AYOA 3S3JA 2WNXA 1FBIL 1NWOA 1R3HA 3ILPA 3M46A 4OLUL 3WG7B 2YXWA 4RFEB 1IEAB 2JCCB 3BVNA 3LZRA 4J6RL 5GRVK 2XA3A 4B5ZA 1ZVYA 1KIPA 3NZ8B 5CSZA 3TBSB 2Y06H 3L3OC 3F83A 4PWJA 2B16A 4YZFE 4FYQA 4EBQL 4MXWL 1N6UA 1PAMA 3CFBB 2VR5A 4RMSA 1ET5A 1ZHBA 1AAJA 5GJTH 3U4BL 2HX9A 2HVBA 4LCUA 2BW4A 4L1BA 4DAGL 3FU5A 1MY5A 2VW6A 3KJ6H 3ZIMA 3C9NB 5GSVB 1U6AL 5CWSA 3RWFA 2C9UA 3AQZA 1F56A 5DD6B 1UKSA 2A77H 4AM0Q 5B3NA 2XQYA 3BKMH 2VJ8A 1O6TA 2DQCH 2FBJL 3RZCD 1PG7H 1U93A 4UQ3B 5JORB 4AXWB 2YD6A 4BGDA 3BAEL 4ODSH 3P0VH 4FA6A 3V7AG 2HTKD 1X7QB 2JJVA 3QXUA 1KN4L 5D4HA 4ZXBA 5L2KA 3G6DL 4W9IC 4WVRA 2ARWA 1LD9B 3KW8A 3FCSA 4RLDA 2LFEA 2JMRA 3MLWH 4MMXC 5AYTA 1T7YA 3KJ4B 4J12A 1DLHB 3W0WD 3H1ZA 4YQXH 1XGQA 3QO1B 2YD0A 1JGEA 1MN4A 1DVZA 1I7RA 3F62A 1ZHKB 4IMLB 4N2BA 4KJWD 3TBWA 3TCTA 3ZBMA 4Z7UE 4OTXL 5GRUL 1GKOA 5A6MA 3H54A 2QADB 4EVNB 2XLLA 2FJFA 3STZB 2JXMB 2BLFA 1V7MH 1SEBB 4JDEB 5F72S 1AYRA 1ZT4A 1PMYA 4LOVA 3W39B 2YEZA 3WKPA 4LRNL 2EIJB 2IXQB 3LHPH 4TOYH 1CGWA 1NH6A 4TN9A 5BMFH 4JQIA 5HVFB 4KNQA 3NFNB 1TU2A 2WV3A 4XNMB 1MFMA 5E24E 4HAKA 5JW4Q 3JWOL 4PJFA 2HVJB 3EDFA 1D7CA 1IAOA 1AG0A 5SWSE 3V0JA 3Q6GL 3X12B 5L7XH 4FYTA 1J8HB 4P4RA 4HWBL 4RETB 3EOAA 1PY4A 1A1MA 1WZ1H 3T4AB 1OAUL 1SQ2N 3ET9F 3WIIL 1T20B 3DK2A 3S3DB 3CSFA 4NC2B 4JPIB 4GT0A 4WW2F 2GKIA 4DGUA 1YEKH 2GCYB 3QXWA 5IZ7A 2OL3A 2V8LA 4P23C 2D4FA 5E7BA 5ITFB 3QH3B 1DTUA 2QDVA 4D0DA 3MRHA 5FHBH 3OHXB 4OI7A 4IOFC 3AS0A 2PYEE 4XI5C 4HSQA 5IW1A 3KPOA 4IJTA 4JDZB 3L7EB 1WD8A 1IGMH 4GO8A 3T0DA 4HT1L 1CYXA 2X4UA 1XF4A 8PAZA 4X4KA 5EU5B 1JE6A 5KN5A 1FYHB 1S7WB 2ARJB 1JIBA 2RH0A 4B53A 3H9ZA 4ZMOA 4KZDH 2YMXL 1ZIAA 1D9KA 3MRCB 2ZXAA 5HHNA 4X5WB 1CE6A 3B2MA 3LAFA 4QRRB 3SYOA 5EF0A 5IK3B 5K39B 5BW7C 5IBLD 5EOQL 2IWEA 1HX0A 4BH8B 3ULUD 5C9JB 4AQAB 2CIIB 3OV6A 2CMRL 4LAQH 4DN4L 2AXFA 2QGBA 3QDMD 3MNVB 4NFCA 3H9SE 4WTXA 4ZX3A 5I75C 4Y5YA 1KJ3H 2ZXDA 3DMMC 3UC0L 3G08A 2C1OA 1CICD 4DP8X 1F11B 1G5GA 4YNYA 2VAAB 3B3IA 4PIRF 2XNAA 3RVTD 1WUNT 5IROD 2QQKL 3MJ9L 5EN2B 5TF1L 4HS8L 1UD8A 4JHVA 1DN2A 3HAEA 5D1ZI 1I1CA 4AL8L 4YH6A 2EJ1A 5DQ9A 4YHML 2RAMA 2VOTA 4X8XA 4YSSA 5D1ZB 4ZNCD 5C3IA 1UD3A 3MFFB 4Z7WF 5ADPL 3GJFH 4PJIA 2H8PB 3ZDYE 1XR9A 5E4EC 2VDLB 1IILE 1N10A 3CFDA 1RK7A 1EDHA 3CFKA 4P2RB 5B3JE 5IR1A 2NW2A 4AVKA 2M26A 4JFXB 2R2EA 4LAJH 4LLYB 1MVYA 4H1LG 1JCVA 3ARDD 3EH5B 4HWNA 1OP4A 1TTCA 2AABH 5FFOA 1UB5B 3DOHA 5GGUB 3VX0A 3EYFB 3RUGF 5LGJB 2AITA 1YJDH 4UTAA 5AL0A 3TV3H 4NQXA 1JGVH 1IT9L 2XBTA 5LCVL 3ATEA 5BUAA 2ZX5A 5JHDD 2JK5A 1J8RA 1UM4H 2NY7L 4A2GA 1QVOB 1YN7B 3L5XH 4M6AA 2W0FB 2E47A 1P4UA 3K4DA 4JDEA 1X5HA 2H2PC 5EIIG 1FAKT 2C1PB 1N59B 4PD4J 1BEYH 3MDJA 4JPWL 3F6LA 3BUTA 4BRVA 3RA7L 3EH1A 3SDXE 1KLGB 3MX0B 2YEQA 1A66A 2BY2A 4PRBB 5BZWA 1KXHA 3ESNA 2BP5M 3WS3B 4TRPL 4NQEE 2LVEA 1EDYA 1VFOA 2BP0B 4PRNA 2Z8SA 3QJSB 3DPDA 3NQIA 1UUSA 2P80D 3HJ0A 2JQMA 4QRFA 4ZRGA 5T3ZH 2VQ1B 5LBSH 3Q8CA 1HH6A 1MDTA 4HIXL 2IPKA 2ZUWA 5EOTB 5BOJA 2NYZA 2QPUA 2XX1A 4C57C 4NQXB 1OIOA 1WISA 2FEDC 1M2OA 4RCAA 4FFVC 3D39A 5EH1A 2AJUL 5DYFA 3NFPB 1A1NA 2B1AL 2QPSA 5FKPB 4QOKE 2BJML 4X5PA 4ZSOE 4F3FB 1G5AA 5C2UB 1A8ZA 2X6AA 1FZKB 3UBHA 1XF5B 2WTRA 2XICA 4LBEA 1ZCRA 4W68A 2JKNA 4XAWH 5D72H 3FCTB 2BY0A 4WU5A 2VL5B 5IKCA 4AQ8A 4B5EA 1KYOK 5KJ4A 2IDUA 1S7WA 2ARJA 5B1BB 3VRIA 4L4TB 1JGUL 5FM5M 5F7DA 1SLXA 1WDAA 2R69A 1QTSA 1W0WB 2P26A 3KPPB 5IHWA 3QPQC 4JB9H 1L0QA 5IESL 3P2TA 5ID0B 1FN4A 2JKXA 5I1HL 1XGYL 3QUGA 4IRJC 1YAIA 4TNFA 5DFVD 5JW5B 2J4WH 5DO8A 5AOJA 2CM6A 4ZMTA 1A3ZA 3ZT7A 3NEEA 1JG9A 1TEYA 3KLAB 1UWGH 4FXLA 4OM1H 3UG3A 3NRFA 3KEDA 2VW4A 1SHSA 2CLVA 1F42A 3KGTA 5CKGA 5E70A 5E8EB 5C3LD 3W0WA 2FBJH 4J3XA 1RMFH 2F54B 4U1JA 4U1NA 3PUCA 3KNBA 3SGEI 3UAJD 1S7UA 4K71C 1WJ3A 2Y5EA 3AWGA 5B38A 2V2WA 5E08L 3MRPB 5EC1B 1S9XA 3FUHA 4NRZB 2F74B 3A23A 3LXAA 3RFZC 4R7DA 1W72A 4WWPA 4ZUVB 3NK3A 3I3EA 1MDAA 2WXGA 5LDUA 3WLBB 4MVBC 3D85D 4YS4A 2P7TB 5AWNL 3DXAE 4ZNEA 3ENEA 4BXVA 3RAJL 4JRWA 4LQFL 5EA0L 2F5BL 3GSNL 4HIPA 2M83A 4LEXH 2NTSP 2Z8VC 4UI2A 2DLFL 4PJBF 2VZUA 4XZ4A 5C6TH 3B2UC 2H4EA 4TUOB 1OALA 2Q8BL 4J1UB 3EYFA 3BHBB 2RCSL 3B37A 2Z6FA 4G6KH 1ZRUA 1IAIH 3FU0A 2R1XB 2QVMA 2CKBA 4ZQTA 4G1EA 5LGYA 2DYSB 3BVUA 3VXQB 5C07E 4G6MH 2PO6B 2Q2LA 3FB8B 1WK0A 3MLPA 3ZYOA 1XGZA 1PLAA 1N59A 5DUBA 1MAML 4ZTPL 4HS6A 3TONA 5L9DL 3RGVA 4P2QB 5KS9E 3AG1B 4PYHA 3P40A 4EN3C 1MH5B 5DHVH 4HKZB 4NNYB 2R9HC 4LCWB 5ILTH 3L45A 2PP8A 4KJPD 1RZPA 2EXYC 3WIIH 5CMAB 4YJZL 3LPFA 3VB9A 2QPDB 2QSCH 5KVGH 2V3DA 2NCEA 2BPBA 4N5UA 3PE9A 3RUGB 4ZNEE 4L8BA 4TS6A 5INDB 1YMMB 5M94B 3QUYA 5CEZL 1IAIM 4PRDB 2VDLH 3ES6B 4QXVA 4JLRB 4AYID 2CE6A 5HYIA 1XGRB 1UH4A 3ARDC 4NQDD 4PHXA 3N9GH 4WDIA 2QMKA 2KS0A 4O02B 2B1HH 3N85L 2LLNA 2AS5M 4PJDA 4ALAC 2BXYA 4X5RA 4YEFA 1BGXL 2BIIA 3ZZLA 2WYTA 3N44B 4RISL 5CSGA 3LZOA 4A63A 3VSUA 4AL8C 5KYUA 1ETB1 2Z7WA 2OSLB 3WIHL 4GKZA 2B3RA 3X13B 2JB5H 3AROA 4O02L 5ICUA 4JHAH 5LXGH 3KPSA 5KBPA 4NDMB 2ZCZA 3LS5H 3SPJA 5DMGC 4UOJA 4GMSL 2WD0A 4XWOC 2X6UA 5SWSB 4Z1PA 1XGUB 2P8LA 1JF1B 1J8HE 2OMNA 2IALA 5IHUL 1KB5B 3LH2L 1ZLUH 5AW0B 5LNGA 1KJ2B 4Z0BL 4GMTL 3DARA 4MA7L 3P3YA 4KY1H 5I18L 1BX2B 5HGGS 3KPRB 3N40F 3WEMA 4ZG1A 2CUHA 2QMJA 4Z3GA 1PCSA 3KXFE 1XO8A 3BH8A 2FDBP 4NHUA 4WUUD 2P5WE 4MKMA 5KYYA 4LEBA 1TZHB 2R51A 3GJFB 1TKWB 4M6NL 2VSDA 1BQHG 5AG9A 5BS0B 5BQDA 4YDKL 4JL2A 1JHLL 1CFNA 5E2WH 4XNQA 3MJ9H 3SPVA 4ZSOA 4WQOA 3FQ2A 3F05A 1J18A 1QFPA 3J8F7 1MFBL 3LPGA 3B7RL 2RALA 5DLMH 1M57B 3EBAA 4GUQA 1HNGA 3TEYA 4X7TB 4BFEA 1F6LL 1IM9A 5DU7A 1U8MA 3QIUB 4XZUA 5CN1A 2OYPA 5JHBA 2ZUXA 1IB5A 2W81C 3IVKA 1B0WA 3MROA 1JF1A 3ZE2F 1G4RA 1BXVA 4K15A 5F8RC 2ADGA 3K2UL 2RA1A 3QULB 3WFDL 3IF1B 2DQGL 3KPTA 1KJMA 3Q9QA 2MHAA 4ICWA 2N0KA 1CDYA 3RTLA 4KNSA 1T5KA 1DLHA 4UQ2B 1C9SA 2ZG1A 1JVOA 3VXMA 4H5SA 4MXQC 3ZTNL 4KX8A 2JCCF 2NNAB 1OM3L 4JCMA 4DFIA 3WXWH 3KZ8A 1WBZB 2C4FT 1QFHA 4F7MB 1LO3L 2YWYA 1PZ5B 1OE1A 4CADA 3CFEA 2NXZB 4PS4H 1HJBC 4OIBA 1MCPH 1INEH 3II2A 4GO6B 1D7FA 1WIUA 2DEYX 1H3VA 3BSZA 3DXAA 5IMLB 1HDMA 1N5YH 2NY0C 4K9EH 4N20A 4IIQB 1OKEA 1DSYA 3T8VA 2DQCL 3AMKA 3OLGA 3O3UN 5CD5D 1GS8A 1XZ0A 4HJEA 3LIZH 4GT7A 3BESR 3VFUB 4FLOA 5DMJB 3GMLA 4JPIA 2KQMA 4NZRL 1KB5H 1ZANL 2NZ9C 3FFCB 1I9RH 3R0NA 4ZQKA 5KSBF 3TJHC 3ZE0E 2EDTA 3SKUD 1AGFB 2Y1VA 1B6DA 1JV2A 1IBBA 4L05A 4XWOD 4ZW8A 2MKWA 3K72A 2IH1B 1CD9B 4JMNA 4LCCB 4PJGB 3WV0A 1BIHA 2ZOKB 4R90L 4Y4KD 3VGEA 3LDBC 4LHQB 3UXFA 3WNJA 5IW1B 1NCAL 1RZKC 3QXDA 4JM2B 2X28A 4Z7NF 4ZMPA 4J3OC 2TRYA 4KKLD 1DQQB 4FQCH 4D0BB 4OKVA 1NFDB 4R7XA 1U95A 3VJ6B 5J6HB 2ZE0A 5IEKA 4PJHF 3FQUB 4IKIA 1K8DB 2NR6C 3QWRD 4Y4KA 1NCNA 3MV7B 1E42A 2AJZA 4S1SH 4X8JB 3E6FA 2MFNA 4XC3H 2GSIB 4PCSA 2JI3A 2R2BB 2VZVA 1HHKA 5IJVB 1H0DA 2FX9H 5ELIA 2Q7AA 3RNQB 1HHGB 5C0CA 5AEAA 4HEMA 3ARXA 1UH2A 5HYFA 5AW4B 1XB8A 4TVPD 4AK1A 1JZEA 2DQDH 4Y5YB 4I87A 2G3XA 5F70A 1ZHLA 2YD4A 3BP4B 4AY0A 3HFMH 5C0IB 2VLKD 5BZDB 3SPHA 5F7KC 2V2TB 1YNTA 4ONHB 5CZVL 1UM6H 2F8VA 2BS8A 3QQDA 5DWPA 3AREA 1NBQA 4QWWD 3KGSA 5D5MA 2DL2A 2FWUA 3CXDL 1BBJB 3U4AA 1X4XA 3QRFM 3BSGA 1T1WB 1LO4L 3W38A 3QIUA 4XZUB 4F33A 5IF0A 1YO4A 1EUTA 3BVXA 3DRQA 3QE5A 4LEXL 3PJSA 2VSCA 3L4CA 3QAQA 1L6PA 3MJ8A 2ALAA 1CLOH 1V54B 3UAJA 3RY6A 5T1LB 1ACYL 5AZ2L 4TQIA 3INUL 2GIXA 3O2VL 1RHFA 5GRYA 1S7XA 5IREA 4OCSL 3ZR5A 2DLFH 5C6TL 3RZCB 1WBXB 3P02A 4G72B 4GRLC 4CVZA 4E0RB 1U93B 4QJ3B 5EA0H 3ATFA 5ESAB 3A4FA 4U7MA 4DO4A 3FUEA 6CGTA 3HUJB 5ANHA 1NDTA 1ZY9A 1KJ3L 5HPMA 5FCUL 2QKSA 2FZ3B 2IPUK 3GMRB 4JRFA 4M1GL 4YDJA 1G0DA 4LDEB 4OBRA 2E7LA 4BQ6A 3B9EA 2DMBA 4EAEA 3VDBA 1E0OB 1I8LA 4MNHB 4DP9X 3D3VB 4L4JA 4NQCE 1E8XA 5LG6A 5C0RH 1GAFH 3LIZA 4IHOB 2YJLA 2OXGB 4WZ9A 1RJZA 2DLIA 4MFHA 3N1QC 3EOYG 4RDQF 5D7LD 3N0AA 4QPEA 5HDQH 4AUJA 5IQ9B 2P8MB 1DVXA 3CZKA 2QKIB 4RMQA 1NIAA 3GSNB 4QKTA 2QL1A 4NJAH 1M7UA 3FTGA 2MNWA 3A6OA 1LEIA 1ZHKA 1A6TA 4I18C 4KPHH 1P7QB 3U6XA 1UJ3B 5D4IA 3QPQD 5BZXA 4FADA 3H6AA 4XVJH 3ILEA 1J0HA 4DK5A 5CGBA 5H2BB 3RU8L 3EF4A 4JDVB 1R3JA 2DWEA 2W9EH 4JFHE 4NUMA 3F6IA 3C2AL 3I2CL 3T6QC 1ZXQA 3D85A 4LVOC 3DIDA 2EYRB 5DQJA 3VUAA 1EJFA 1ND0A 4UM9B 2XQYG 2ENQA 1RUMH 1MPAL 4Y8AA 1JRHH 4Z7VF 4YGVA 3QARA 2X1WL 1Z9SB 1PIGA 2XQBL 3FT1A 3SCMC 4YIQB 3LRSB 3CFMA 2XZQL 3M1BA 1WGOA 4HFWA 2ZUUA 4NENB 4DSYA 4TRPH 2PTVA 3QDME 4AEHL 3O3DA 1W91A 5IQ7H 2VRAA 4U1IA 3T2LA 4AGQA 1CD0A 3TJEL 4CRPA 3EJCA 3MV8E 4E2OA 4TNWK 4JFTA 1YECL 1GJIA 3O0RH 3HCVA 5KN5B 2D7MA 1T0NA 3MZTA 5CLYA 2R4SL 5HVHB 4HCRA 3GSXA 3QJVB 3OD3A 2DI9A 5F96L 1CE6B 1LL1A 2BHZA 3AY4A 5IQMA 1FGNH 1YY9C 2R0WL 3HLAB 4I0PC 4JDZA 1X7TA 3H3PH 4UF7C 4AQ1C 2FQGA 3IAQA 3GXFA 1DJZA 4DUXA 1H3TA 1HQRB 1RU9L 1PDKB 4L8DB 2FYYA 2QT6A 3A0OA 1P7QD 3ZDZB 1XXDC 3JWNC 5EBWB 3KWXA 3QS2A 1AXSB 1HS6A 4HS3B 4KQ4L 4CMHB 1T1XA 3SDCA 3B7YA 1MLBB 4Q97A 1MI5A 4OLVL 2OR9H 1B2WH 4NPYB 4IU2A 4RAUA 2ROXA 5I74B 2PW2B 3QWQB 2H6PB 4FL4C 5IBTH 4Z3JA 1B90A 3DYOA 5AVXB 2EDRA 3WIFB 3QDGA 5I19L 3WE6B 3NPZB 3O6KL 1Q1JH 2OZ4A 3AM8A 4WLCA 4MS8C 4XVUD 2YSSB 1PCXA 4XP6H 4YXLH 4LK4A 4LXFA 3MOBH 3T8MA 4CC0A 2DEWX 4PJBB 4WU7B 5E1AA 5DVLA 1SLWA 1FRGH 1G7HA 3D3VA 5HDRA 3DSNA 2ZZUT 5TDOB 3PU7A 4LP8A 4G3YL 4K23H 4LZKA 4JPVL 3NIGB 3B9KD 4RH4A 4XP4H 5FYKU 2XV6B 4KKCD 1BZ9B 4GAGL 5HGBB 4OF5A 4R7NB 3WHXA 5ISZE 2YUVA 1J1XH 3PLYA 5CFAA 4AOFA 1UB5A 3L3GA 4U31A 1IFGA 5EZIL 4BFOA 2BNUB 2ADYA 2R83A 4BELD 4FTVA 2W91A 2I9TA 1PIFA 3TT1H 3WUZA 1C8PA 3QHTC 1KCSH 3NPSB 2D7TH 3IGLA 3LKRB 1CF8H 2VT0A 4NQUA 1VZIA 3VVVA 5DI8A 4Z7UF 3RWEA 2Y36H 1AIFB 3MV9B 3SDCD 2F2HA 5EUOF 1Z5HA 2IAMC 5TDPB 3QORC 5C0BB 1HC1A 4BWWA 3GI8L 3C5ZC 4LSRH 3V0WL 3KLDA 2A9DA 2ITFA 1BFTA 2X88A 4WW1B 2W92A 1KGIA 2WBJC 4TVPL 1FDLH 3LN4A 2A4ZA 4WEBL 2OX5A 3LPPA 2VMCA 1KCWA 2GTWA 5HYJA 4PRNB 3VAEA 4KJQD 5AOZA 3IFNL 3BQUB 4N0FB 5D6CA 1CTMA 5EEWA 1WFNA 1TETH 4FQ2L 4S1DC 3D69B 3TVMC 3IXAB 2JB6B 5DO2D 4ZFOA 1I31A 4DEUA 4KV5F 3KR3L 3NT0A 4QTHA 2DQHH 4U1HA 2VQ1A 5HP5A 3H9SB 3FYIB 1OB0A 5T1KA 4GKLA 5KBDA 3D2UA 4U4IA 1N12A 2OTPA 3P77A 1MCHA 2D31B 3RKPA 4K07A 2EXSA 3LB6C 4N6RA 1G0XA 4Y4HA 2OA9A 4GQ9L 2BC4B 1MSPA 5EU4A 3RBGA 1D6VL 2UZIH 1H15A 5F7MC 1CGSL 4PGCA 2BSSA 4FS0A 2H32H 2VCOA 5B8CB 1H8OA 1U8CB 1WHPA 4NWUL 3L3KB 2ZAGA 4JQXC 5EO9B 3V6FB 4CSPA 5EIIA 5LWYL 4HJ0D 2RJMA 2XN2A 4KK5C 5DC4B 1UVQA 2EXTA 1CE1H 4W1TA 4X7FC 4AIZB 4QAMB 4FGMA 4ZAKD 4YFDB 3VWKB 5GZNC 4Z7VA 5EBWA 5EU6D 2CDEB 5J6GA 4UT7L 5HYSB 4XN7A 1A9VA 4Z5RB 2XWTA 1DQDH 4NUPA 5JDJA 2XPZA 3BKML 2UUDK 4XMLL 3U0PB 1Q72H 1A4AA 1VZGA 3AY4C 3HG2A 3HS0A 4G8FB 3L7EA 4M9OA 4MNGA 1JD7A 1G6RL 1GVIA 1WQVT 5AKTA 4HHAA 5C9KA 4U1NB 1KFGA 3HS9A 1WA2X 3S2AA 4ELDA 5CD3A 4YK4B 1E9PA 4GIPD 4F9LC 2AQPA 4UOW1 2MQ0A 4BUQA 1CIDA 1OQXA 4D3CL 1E28B 2NDFA 3F12A 5KS9B 1SXAA 3DOSB 2QQQA 1D9KB 3ISWA 5C08A 1EQWA 2MEJB 4KY1L 1WBZA 5I18H 1CQKA 2VDQL 1BJ8A 1JFHA 2VDOH 4KFZC 3TVMB 1GAFL 3CN3A 3L4UA 5ERWA 4GP8B 3C8DA 2JI1A 3QUZC 4NGHL 4GXUN 1PEZA 1VENA 4OCYH 5DUMH 1KCBA 3C09C 2KPNA 4ZFZB 3OZKA 4AH2A 3GZOA 2QVTA 2WWKT 4DN3L 3UC0H 4B41A 1L0XA 2IGFL 4FQHA 4X9HA 2BMKB 2WZAA 4H4NA 2GK2A 3MR9B 3BQUD 2AK4D 1UASA 2Y7MA 1A4JA 1YHPA 3BEWB 3BISA 4ZDHA 4JFFB 4M7LT 2VR8A 4BKLB 43C9A 4N2NA 3ZQWA 3QCVH 4EI6B 1ZOXA 1TG8A 2GUYA 3KWTA 4S1RL 3HE7B 2YZ1A 4AUYA 1IRAY 4HXBH 3L1GA 3QJHB 2DWDA 4DKAA 5FYLD 3CFJA 1U2HA 4PRPA 4X5QA 4KMTL 4YDZA 4N6QA 3N91A 3MOAH 5FUZH 1NQBA 4X99B 3TXAA 3FH5A 3DJ9A 5D93B 4KUCF 43CAA 4QJ5B 1AG6A 1N2RA 5CMAA 5HHVH 5JA9A 3HN3A 2GBUA 2OZNA 4LHUB 3RWGA 1NMBL 1K3IA 3VB8A 2OYMA 3GSOA 2W8CA 1TO4A 4WW1A 1ACXA 3CVHA 4I5BB 3QZWB 3DETD 4F91B 2RGSA 1VGKA 3ARBB 3HI6H 4EUPH 1K85A 3CJJA 4N2EA 3GI9L 4OUOA 1FFNA 1ORQB 2GQHA 4PWFA 4H13C 2K8QA 1QA9B 4JO5A 3DJSA 2XQBH 3MLRH 1JRHL 2NZ9D 5CS7A 3LKQB 3OSVA 1CDUA 4QJ4B 2GJ6E 4OZFA 1U36A 2XWEA 4Y2DB 3WO3B 5L7XL 2OMVA 2GPZA 4Y2DC 3LEVH 2R4SH 1TXKA 2GC7C 4YHNA 5SX4H 2C5DC 2IH3A 1RERA 2DQFB 5H35A 3LHAA 4GLRI 1LO5B 1M7DA 2ZXQA 4LASL 4N26A 4XPTL 2F54E 1S7VB 3HZ3A 2NY1B 3J27A 3LQMA 4PCKA 3TJEH 1JPGB 1LGVA 3ULAB 5IQLA 2VXUL 3KVPA 1CK0H 4N8PA 2OSLA 3L16A 1ECYA 1CDBA 1X5MA 2WC7A 4LHUG 5I1AA 2B4CH 4Z76B 3D09A 2V5SA 1RAMA 5JHDE 2I24N 2PCPB 4NZTH 3P3SA 5HYSA 4JHWL 3NRQA 5KS9F 2NNFA 1MZYA 4B0MB 3FN9A 5IOKA 2D2CC 3MGAA 4HT1H 2HJKA 5EWIH 3RP1A 1MCIA 3C8HA 4MXQD 4XXCA 5DK0A 3ZIYA 4ODWA 2FL5B 5D9SB 1DBKH 4DTGH 1WITA 2DLEA 4U0RC 4O5LH 1ZTMA 2X1XR 1GGBL 2GY7B 5KZCB 5I66B 4N2IA 1T83C 5MI0B 1QRNA 4ZSOB 4H20H 5KJRH 1U8HA 3DBSA 4XAWL 3DMMA 3V0FA 3NSDA 5C07B 1JNHA 2QQNL 1A0QH 3E9TA 1TCMA 5IJKC 5EUKA 2VDQB 4Z7OF 4UB0H 1U8NB 1ZVSA 1F4YL 3EJQA 2YPLB 1JGUH 2EIZA 1URLA 5GJTL 1YMHA 1LE9B 2PO6D 4K5OA 4WWNA 4D94A 5L8LB 3NABH 1EHLL 1AY1L 1M7XA 2K7QA 2CU9A 4BFJA 1Z9MA 1E4KC 4GY4A 3V6ZB 4MJIB 3GB7A 2DM3A 4EN2A 4UCFA 4APQD 1AZVA 2APFA 1IGTA 3TT3L 5DDHB 1QBLL 2R2HA 4KDTA 3S3BB 1HEHC 3LV3B 1JHTB 3L54A 4PGDA 4JPQA 1PFCA 1MW3A 1CURA 2FK9A 1RJYA 4DW2H 3ULUL 3VXMB 3A21A 4H1LB 3CDGA 3CZFA 4G42A 4P2OD 1W0VA 5C0JA 3NTCL 4ZTOH 2DD8H 4QO1B 2R0LH 2VITA 4AMWA 5GRZA 1I1RA 4UAOB 5TE4H 1QKZL 3REVA 1AVAA 2PNDA 4LSRL 3SKNA 5CHNA 5C08D 2G9HA 5IIEB 1XZ0B 4MDIA 4AV0A 3TA4D 4YFLI 3VRLF 1SF5A 4MJIA 3SE9H 4J28A 3WXVH 5F9WC 1FVDA 3MRPA 3FMGH 4X7SL 1WWWX 4P49A 5LCVH 5MENA 1N7MH 2DQ6A 2XN0A 4J3UA 4F93B 3CSTA 1INQB 1JZIA 1AD0A 3ZT5A 3ULVC 4A7SA 2YRZA 4UTAL 1O6SA 3FCUB 1JDCA 3VFMA 1WFJA 3GRWA 4WUUA 3RX5A 4E9LA 2KZWA 1HH9B 4ATWA 4L2LA 2EH8L 3Q9PA 5I1KH 3NGBB 1HWHB 2D7QA 2YPVH 2VMFA 4G6AC 4PV8A 1GTNA 1BZOA 4RDQG 3L17A 3O6FD 1Z0MA 3U0TA 3BWUF 3EG9B 4WENB 1YQVL 2VLJA 3MN8A 1OB1B 3D6GA 3MLXL 2NX5B 1JZ4A 2V5RA 3PNRB 5I8OL 3H4FA 4Y1SA 5CSBA 4NKOB 4GXVL 3UJTH 1UOVA 3HKZA 5DRZA 2GJJA 3X14B 5I1DB 4JFHD 1XR8B 4P2QA 5D1XC 5I1AB 5D70L 3V4UL 1H6TA 1VF5C 5I0VA 5GGTL 3SJVE 1SXNA 4PRDA 2YLKA