2CHDA

Crystal structure of the c2a domain of rabphilin-3a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
TLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RABPHILIN-3A
publication title Structure of the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2chdA00
4WEEA 3RPBA 4ANVA 4PS7A 4F92B 1DJYA 2DMHA 3PFQA 4FULA 1CJYA 2WXMA 4Y1SA 2K8MA 2WXJA 3SD5A 5KJ7E 4DNLA 3LJ3A 4ANWA 4KZCA 4OVVA 2B3RA 2QZQA 3DPDA 4ANXA 1E8YA 4LCVA 3HIZA 2ENQA 2CHDA 4BGDA 3QJZA 4EZKA 2QZ5A 2CM5A 4QJ5B 1E7VA 3JZYA 1E8ZA 3FDWA 2CJSA 3PYCA 4G11A 4L1LA 5T8IA 4AOFA 1A25A 4F1SA 2NSQA 4NP9A 2WXGA 4PS8A 1K5WA 3QAQA 5CCGE 1TJMA 4FLHA 3R7RA 4GB9A 5JHAA 3DBSA 3KWUA 1DJGA 1UGKA 3APDA 3FBKA 3APFA 2V4LA 3PS6A 4ICXA 2ZKMX 4NPJA 2ISDA 3IM1A 4F93B 1DJHA 1DSYA 4DK5A 1UOVA 2RD0A 1DJIA 3L17A 4FADA 2D8KA 1UOWA 3GPEA 4TUUA 5G55A 2X38A 3L9BA 4GNKB 5G2NA 4LT7A 2Q3XA 4L23A 2WXHA 4XZ4A 2WXPA 2Z0UA 4JPSA 4WWPA 3R7QA 1QASA 2WXLA 2WXNA 3L16A 2K45A 1W16A 3MJWA 2YOAA 1BDYA 2ENJA 3F04A 3P2BA 3NZSA 1E90A 3CSFA 5H4ZA 2N1TE 4FHJA 4XE0A 5CCHE 4KITB 3L54A 2DMGA 2A5UA 2WXQA 3L08A 3QR0A 4FJZA 4QAMB 4FA6A 3F01A 5JHBA 1E7UA 3NZUA 3PRZA 4XX5A 3RDJA 4NPKA 1DJXA 2WXKA 4FHKA 3NSJA 4L2YA 1GMIA 4EZLA 3S2AA 4AJWA 1RH8A 2CHWA 2Y3AA 4QJ3B 1E8WA 2BWQA 2EP6A 5H4YA 3ZIMA 2ENPA 4LDCA 4TV3A 3W56A 2LHAA 4PS3A 3CSTA 1W15A 2FJUB 2CHZA 2WXIA 4URKA 4WAFA 4HVBA 4EZJA 3N5AA 1DJWA 3HHMA 3ML8A 2CJTA 4FJYA 1QATA 2WXRA 3ENEA 3W57A 4HLEA 4MJJA 4IQHA 3PREA 1DQVA 3TWYA 1V27A 3ZW3A 4KZ0A 4BFRA 2KI6A 4IHBA 3OAWA 2CM6A 3IBEA 3HN8A 2WXOA 2YRBA 3T8MA 4QJ4B 3KWTA 3L13A 3F05A 4WWNA 3QK0A 4OVUA 4A55A 3OHMB 3F00A 3QR1A 3APCA 2NQ3A 4WWOA 4Y1TA 3TL5A 3L4CA 2UZPA 3M7FB 2WXFA 1HE8A 3ML9A 2A4ZA 2R83A 3B7YA 5EDSA 2K3HA 2K4AA 5CCJA 2Q0ZX 2JQZA 4J6IA 1BYNA 3TJPA 1WFMA 1E8XA 1YRKA 4ANUA 4L1BA 3ZVVA 4F91B 1WFJA 4V11A 2FK9A 2CHXA 3QARA 1RSYA 4NS0A 2NCEA 4TS6A 1RLWA 4ICWA 1BCIA 1TJXA 1DJZA
chains in the Genus database with same CATH superfamily
3RPBA 1AQDB 4LLVB 1CICD 1JXGA 1XR9B 3QFDA 3GZQA 4XCYB 3WL9A 5F88A 1KCBA 2CK0H 3QEQA 5D6DC 1TSRA 4S1SH 4TULH 1BAWA 1FAIL 2QL1A 3A0OA 3FT9A 4APQA 4WY7H 1SJHA 3WJJA 3LZOA 2BSCA 2YJQA 3JTSB 2XXCB 4ANXA 3D39A 3HE6B 3NRFA 3CDZB 3HW7A 3NIFB 1E7VA 4GQQA 5CGMA 2XG5B 3C5XA 1K4DB 5TTRA 4WW1A 1NGXB 5CD5D 1DJGA 3IMUA 4GRWB 3BJ91 3D69A 3EYVB 4UTAL 4M3KB 1J1OH 3FS9A 1MDAA 1C5CL 1NBZA 3EDKA 2D8KA 4JKPH 4L4VA 5E6IC 3VGEA 4X9FA 2OW6A 1J8HD 2ZOKA 1ACZA 3BMWA 1R5WB 3QDGB 1HTYA 5GSVA 3S36X 4J2QA 2DH3A 4KKAC 1THAA 5T3XE 4XPAL 3QFJE 4PJFE 3DIFB 1ONQB 3AUVA 2I24N 3WD5L 2WVVA 1GAFL 3OB0H 3QUXC 1CR9L 2EVHA 5E56A 3S9DB 1TQBC 3L3HB 4RX4D 4I2XB 2V0AA 5CFHA 5AAWA 2BS9A 5MERB 3OAZK 4Y4HA 3PGCA 3ZDXE 4N6QA 4RFEB 1AHWA 3RL2B 3ARZA 1BQUA 4I9XA 4R0LB 4E41D 2EDQA 4L1HA 1MJ7H 1S7UA 1UH2A 2CBQA 1WZ1L 3D5OF 1KYOK 4KROC 2IPTL 5DMJB 3FUDA 1MFAL 2AEOA 5GJTH 2J2ZB 1XL4A 5I6XC 1LO3H 3F62A 5DUJA 1W91A 3FSZA 1ZLDA 1IFGA 4P57A 5GRZA 3TA4D 2AV1A 1NUGA 4X4YA 1SBSH 1FC2D 4O5LL 4UNIA 3QK0A 2WOBA 2ZXWB 2VSMB 2IBGA 2GB2A 2KDGA 1IGTA 3ZZQA 4ECNA 3ISWA 2LFGA 1C12A 2BNRA 4KNTA 4UV4H 4WGKA 5LWYH 1UM6L 2R1YA 3UZQA 4NQCB 5I5RA 2D2CC 4FTDA 5TF1L 1LDPL 2A3TA 2D73A 3DJZA 1CT8B 4JG0L 5AW5B 2CIKA 3EO9L 2PCFB 1LE9A 2OYLA 4MQXD 2E27H 3BT0A 4ZUWA 5B8CB 5DS1A 1MF2H 4P4KA 4MJ5A 3WFDL 5F9JA 1UATA 2AJ3A 3KBPA 4X99B 4KI5C 2G2NA 5KSAC 2IDQA 1R9FA 2HFEA 2MPVA 2C34A 4OCMC 1NGQL 5DLLA 4FNPA 2ZWLT 3VFVB 2VMEA 3BZEB 5JXEC 3WJLC 1H6TA 3FO9A 5B22A 5B7MA 4YHML 1KNOB 3BQUC 4HALA 4MD0A 4ZMPA 5I75C 3NRPA 3RVXD 1NLBH 3CFQA 5IB2B 3GMLA 1E2ZA 2ZP8A 5GJSH 1KULA 1FZJB 5JW4N 3V4PH 4Z5RA 2IAMC 1QSFE 3U9UB 3RTQC 3FBQA 3BWAB 2B16A 5DD3L 4MS8D 2FNBA 4N25A 1DHKA 4ZQKA 2FVNA 4NO5B 3CSGA 1T04A 2O5XL 3MTRA 5AAMA 4K3DH 5MEOB 1PAZA 1SUJA 1G7PB 1A7RH 3C8HA 1IC5L 1WO2A 2A83B 5ABDE 1P7BA 4UOJA 4JRLA 4JPQA 3EJUA 3TTSA 5ICUA 4UAOC 1G7HA 2VDLH 3WN5A 3MJ6A 2D2OA 3L5XH 3CD4A 3QIWD 4QIRA 1JE6A 4OFYA 2R51A 5DO8A 1ADQH 1DN2A 4Y4KA 3NCBB 3I50H 3RZCA 1OAZH 3C60A 3F7LA 2E7BA 5CCHE 1A6WH 2X42A 1FL3A 2ZX8A 1HWGB 4XX5A 5HYJE 4JAMB 4UTAA 1EHXA 3EJRA 2NNCA 2DBJA 5ETUB 5EZIL 3NH7H 1HHHA 4KKZA 4ZFGH 3FAXA 4PVMA 1PD1A 1GIGH 3GSWA 4DK3A 2OTUB 4MRCA 5JHLH 5FYJD 1AGDB 3D4CA 3ROOB 1INEH 1NM4A 3EGSB 3VMPA 4NN5C 5KS9B 3UZVB 3R4RA 2YUWA 2Q2LA 5EO0B 3WDJA 3UBXA 3ROLA 4LP5A 1YEFL 4JM2A 4XBEH 1Z5LB 5IG7A 4E9QA 2Y69B 5ITFB 5HYJA 2EH7L 5J1SC 1T2XA 2EO9A 2ATKB 3RVUC 5KBPA 5SX5K 5B38G 4RDBA 3RP1A 4XB3A 1MCIA 5DEJA 1CVRA 1LP9F 2Z93A 3CXDL 4FRWA 4YHLH 2N7SA 3MA7A 5GGTL 5BCAA 2GT9A 2DQUL 3FOMA 1CICB 1KZYA 4FQ2L 2FX9H 1ETB1 2C9SA 3QI9A 3SO3C 4EDXB 2OL3A 3JTTA 3L3JA 4X7SH 3V0IA 3QG6A 2BWIA 4LEXL 5GRJH 5DFVD 3HPLA 1E6JH 4A7UA 3WTTA 1ZT1B 2Z31A 4ZJ9A 4OFKA 3G5WA 1WCBB 4TTDD 4NKIH 2X3CA 1EZVX 3IPBA 1BIIB 2J20A 4WUUD 4HOMA 3KPQB 4RBPK 4QOKE 1UCBH 3PF2A 2HKFH 1XGTB 1HCYA 1YEGH 4QHMA 3ZHNA 1MCBA 1YQVL 1PF3A 1QW8A 3JWOC 1S7TA 5CNHA 2NSMA 2IO5A 3CLEH 3UABA 4FA8A 2V2TB 5DHXB 5DEGB 2C5DC 3AXIA 1J8HB 3OPZH 5FEBA 5JZ7D 2HT4C 4OLVL 4UZGA 2EDMA 4AC2A 3CZEA 2OV0A 3TBWB 4GG8B 3VD0A 3CHSA 4QY8B 4LOFA 4P99A 4X6CF 3S3DB 4EQ2A 4N5EC 5HP5A 5SV3A 3G9VA 4KPHL 4KX9A 2NUPB 3WNMA 1YEIL 1D2PA 2OSXA 2R69H 4XRCA 1CF8H 2NPLX 4IJTA 2X1QA 4PFEA 4ELKB 4E41B 5FLUA 2VW7A 3BX7C 4FOMA 4ALAC 2FJGB 4FQHB 5HY9B 4H0HB 1MRFL 5I1AA 4Z7VA 5T5NF 5I9QC 3FUNA 6PCYA 4G43B 2RHEA 1OWRM 1ESOA 4QRSA 3BI9X 1DN0A 4DKAA 4Q9BA 3QUYD 4LLDA 4XN2A 5GHWH 3EFOA 4EBQH 3CPLA 1WHOA 4EN3D 4WENB 2DWYA 3HI6H 2WCPA 5B39G 5HYQA 3ESMA 2Y5EA 4JPWL 4PVNA 3RBSA 3AM8C 1UJ3B 3OKNA 5HJBA 1EAQA 2YSTA 4JN1L 1HEZB 5B1BB 3ZQXA 3VNYA 2BXZA 5C92A 4QXTB 4HIIA 3QDHA 1R3HA 4L29B 3EDDA 4MZIA 1KBPA 4XODA 2X87A 5CSZB 4UILH 2XBDA 2UY6A 1JYXA 3DNKA 3HE7D 2YGVA 4LF3B 5MI0B 3DECA 2YAPA 1U8OA 1WWBX 3GC3A 1T6WA 5INCB 4OZHB 1U2YA 3IDXH 1GGTA 1FZMB 3NJVA 4RGNB 5IHBA 3O6LL 1LJMA 4WTXA 2ROXA 3IDMB 5HHNB 4PBVC 2ARJB 2L3BA 1E9QB 4YAQB 1IBYA 2HA1A 4G8IB 3H0TB 3L5JA 4TSBH 4Q9QH 2IJ0C 4BV1A 4IBTA 2IAND 2Z8WC 5D1ZC 2ICWA 2XJKA 5KVFL 1AS7A 5F1OB 2A38A 5D1XB 5IB1A 1UM6H 3MMEA 1CG9B 3S34H 3VXUE 2B4CH 4M5YL 1MHEB 1W0VA 3EOYG 4PG2A 2XC8A 3CVHL 3MU3A 4AUYA 1UT2A 5EBWA 4CW1B 2ZUQC 3QNYB 5GGTA 4A7QA 2R4RL 4URTB 3ASWA 2HSIA 3ABKB 4GS7B 5IVZA 1K2DB 3DX2A 2QKIA 4YHIA 3LD8B 3PHSA 4PJEA 2DIJA 2YC1B 1VKXB 2JE8A 2MQ3A 5B1AB 3CH8A 2VABB 4M93B 1JGEA 3SCMA 3AG1B 4I0PD 4OZFA 1T03L 1T6BX 2HXAA 3C6SB 3BH4A 5JHAA 5DJZB 4YDIH 2VZOA 1N18A 3RHWK 2OMUA 4D7BA 1J11A 3MRLA 1ZDQA 4PJCA 2ZOUA 3K6OA 3H9SE 3L3DB 4XPHH 1A7PL 1FUNA 4PGDA 4W9LC 3WSQH 3A5VA 4GXVH 4FFWC 2F7OA 3T9WA 1BX2B 1FG2A 3TCTA 2HH0H 1WG3A 5EULV 4JFHD 5FUCE 1PYWB 4J3OC 3VO0A 3GKWH 1OQXA 1A4AA 3LNHA 1XHHA 1KCSH 3DIVA 3TNNB 3H9SA 4NHCH 1PZ5B 3B37A 4Y5XB 4ZO9A 1CK0L 2EUZA 2ZP9A 1IARB 1ZVSB 1BEYL 4KBPA 3N1MC 3F7PC 2CKBL 3J2PA 5C0FA 2VISA 1J0ZA 1UEYA 2VLKD 1SEQL 3F7VB 3KPSD 2A73A 1I8LA 2DPKA 4G70B 1E6OL 3MGAA 1CQKA 1R75A 2WXIA 2FIRT 3BUIA 3ESNA 3UPRA 1DDTA 2NNFA 5C0GB 4MAYD 3DV6A 1R3KB 2VKWA 1GGBH 1PEWA 1GZHC 3H4FA 4NX0A 2HTLD 1C16A 3UG5A 2QKSA 5DFWH 5B7EA 1QFUH 1J88A 1NC2D 4KZ0A 1NTDA 4ENZA 3ES6A 3O3DA 4LEEA 3T77A 3MV7D 3FFCE 4FXGC 3S3BB 1IJNA 3QHFH 4XP1L 4ODHH 1IGFH 1N5AB 1UXWB 5AW3B 4WHYG 1U8JA 5EN2B 2H3NA 2ZSVB 4Z3TA 1KEMH 2G30A 1PZBA 4GH7B 1Z9SA 2OMYB 4GMTL 6TAAA 1U95B 2QVTA 1MFEH 1HOEA 3CZGA 3KW8A 4WUUB 5JQ6H 5I1LA 4WZ9A 2O61A 3O11B 4L5FL 1XAKA 5GGSA 3VSUA 4OGYL 3BLPX 3FFCA 1X5IA 4WEUD 5BPPA 4H2CA 4QR7A 1JF1A 4ZAKA 2GBUA 1XCXA 5L2JA 2WUBH 3HPJB 1XGUB 2VO5A 3SYPA 2E3VA 4PUBH 1YJDC 1LNUA 2FIKB 2KLSA 4XI5D 4Z9KB 1NANI 4PJ9B 5ID1A 5JOPE 3TO4A 3VXSE 1ZLVH 4G42A 4Y9FA 2YRZA 4FDWA 2V37A 1ASPA 4BKTC 2I7SA 4DPAX 1KPVB 1ZDSA 5B3JE 3B7UX 4Z95H 1J5IA 4Y2DA 5DDHA 5T8IA 1KYUA 1DQML 3K6FA 4HJUA 5D6DA 4WRLA 2IQAA 4PV8B 1JWUA 1CC3A 4HIXL 4ODWA 1NMCB 1B3IA 4S0TD 2DJ4A 3WG7B 2IQ9H 5CD3A 4LLWA 1EZSA 4DK5A 2EO7A 4ZMVA 2PP8A 1DDHB 2P49B 4ZTOH 2EXYD 3ISYA 1A65A 2GUOA 2WCGA 5HHME 3B3IA 1KCUL 1M2OA 1UASA 2C3VA 3CVHA 3MGTB 1D5IH 3P69A 1HZKA 3O9WD 2A99A 2Y7NA 3QUYB 3QQXA 1N0LB 5AKRA 5L0QC 3PJLA 3LRGA 4D8OA 4BYHA 2PP9A 2ITCB 4G82A 2DLIA 3FTWA 4C4KO 3AU1A 1VFBB 4NIYE 2C9QA 2CA4A 4J8QA 5E6IA 4X9YA 1UZ6F 3MBWA 5DQ9B 3C9NA 3F01A 1E2VA 4Z3IA 3AGWA 1JYVA 2FUTA 4G59C 1S3KH 4JE0A 3OQ3B 3SDXA 4PVLA 1NUNB 2DKSA 2VYRE 3MJ8A 1M7DB 1CB4A 1D7DA 5B1KA 2A6KA 1L5GA 3HE7B 4KV5F 4M29A 2EYSB 3MLYH 3C5ZD 3GHBL 2KHAA 1OQOA 3O0LA 1JNHB 1KTCA 1AR1D 3ATEA 2VWEC 4YBQD 3ULUF 4EUPB 4P5MB 2CDFB 3UP1A 5D1QB 1MW0A 3CUPA 5F7DA 1HQRA 4JO3L 4XPGL 1RZKC 2KZKA 3QZWB 4U1MB 2QSCH 4H8WL 2YRBA 4HPHA 1FJ1B 5D2NB 3VD4A 1T83A 3EGDA 2AFNA 2IGTA 2WHVA 4CGUB 4DKFH 2CKBA 4PGEA 1CU4H 2BNQD 4ZFOB 4WUKL 3E0GA 3F7YB 2E9WA 1QP1A 1XH3B 1NJ9B 1QHOA 3ATBA 3ZE0B 1GKEA 2IMNA 1DBJL 3WI9A 1XD0A 4AK2A 2BSSB 1DSWA 1KSRA 1OGAA 4L3EE 5I5IA 2UY7B 5EMYA 5I1GL 1OP4A 1DR9A 1U8HA 5CJXA 1HH6B 3HZYA 2ZX7A 3P73A 1PTZA 4XVUC 2IXQA 4Y7MA 4ODVH 5IVXE 3TZVC 4I0PB 3ARUA 4XTRD 1U3NA 1MCSA 3WXWH 4YR6A 5HVHC 4NQED 5JXAL 4YH6A 4ANWA 4KZCA 3KPLA 3KZ8A 2V8MA 4UQAA 5DSCA 3IKKA 4M4PA 4OJYA 4WK0B 4Y9BA 4M6OL 1BSIA 5KYXB 4L2LA 5F71A 4F1SA 5IJVA 1OY3B 3WUZA 4HETA 4JFDE 3H53A 4LDOB 1T3FB 2WVSA 3TBSA 3VG9B 3LMJL 4ZS6D 2NX5B 3WJLA 1OGTB 5JQHC 4G83A 1NL0H 4JFPB 2VN4A 4MA8L 3HB3B 5F1NB 4ACPA 4UBDC 1OVZA 2Z8SA 1DEEA 1OK0A 3GGWB 1GCYA 5GS0C 4MS6A 5PCYA 1R3LB 3D1MC 2VR7A 4W93A 2XTJB 4WKZB 2IAMA 4BDVA 3EOTL 2A6JA 3RTQA 5GRUH 3QXDA 1ITBB 3IMTA 4P2RE 2EUWA 2VLKB 2CNYA 1JSYA 3KPSB 3MCKA 3AACA 2XX1A 1IKFH 1HOCA 4HFWB 3R1GH 4JL2A 3K46A 1SF5A 5JR1H 3IS0X 5HHOA 1A7PH 3PXHA 2AEPL 2ADGA 1KB5L 1I7ZA 3D2UD 5F6IB 5HYSA 4MAYB 4RA0C 4E9YA 2P8LA 3UTTE 3GSQB 1OP3H 3BVXA 4J7RA 3NEEA 5IW6B 1N67A 2GSIB 2FQDA 3HRZB 5IEKA 2CGRH 5C09D 3M46A 3WJMB 1SJMA 2YBRA 2ZCLH 4AKPA 1DLHA 2EXWC 2MCAA 3FQRA 4PV9B 2W1NA 2EIMB 3ARFC 1NCWL 4RGMB 2GVYA 2JVUA 3QUZA 3HE6C 4M8QB 5IK3A 4L8CB 3MV01 1J0IA 2CR3A 2IV9A 5F7EL 3V6BR 2NTFA 1S9YB 1E5BA 2WM0A 2W92A 3T2NH 4WDIA 3SE8L 2DBLL 1IAOA 4XNQA 1PG7W 3T1FA 2V3EA 4JW3A 4W9GC 3OWRA 4YFLI 3T2QA 2X9XA 1I9IL 1E65A 3TJEH 5I0DA 5KYUB 5IESL 4AEIL 4IMKC 1OAYL 1C7SA 2XN0A 4KKLC 1NAMH 4W70A 5D7LB 4XPTH 2FZ3B 4PJAE 2OP4L 3P0YL 2ZT9C 4XMXA 3RDTA 1WK0A 4AQ1C 2OCCB 5GRYA 2BX5A 3T3ME 2NR6D 2FD6H 3FRUA 3ZX1A 3K80A 2ZYIA 3V0JA 2R29L 1EFXD 3AGVA 3QARA 1NBVH 2BJML 1TQSA 2ZUUA 2DTMH 3NFPA 4X80L 4OZHF 5E4IA 3MV9D 4XXDB 1C8QA 2O6CA 2W07A 3HA0A 1FL6A 2QPEB 3DVNA 3HZVB 1BFVL 3MLSH 4HIQA 3KBEA 4QRAA 1QLRB 1Z32X 4UOQA 3UC0L 2F0CA 4NERA 4ZNEE 2ZNWA 3ZYOA 2SODB 1T22B 3UTZA 1NPNA 4F7TA 4R0LC 2LU4A 4J3SA 4V1DA 4XNXL 2BZ7A 1GYVA 3O9WB 5DR5H 2Y24A 1WEJL 3DX6B 5H35B 2ZXBA 2H32A 5C08E 3FF8A 3IGAA 5F44A 3MCG1 1GYUA 3LRSB 1G9MH 1TZIB 2XDHA 3WDHA 1MNUL 2X41A 3ZHLA 1A64A 4KTGA 4ZNEA 1ZEAL 3U1SH 2EYRA 4U7SA 1WTGT 3NESA 3VFSA 3MAWA 4FQQA 1SPDA 4M8VA 2CNZA 3D48R 2C9PA 5C0DB 3QISA 3K6SA 1Q0EA 4WNQB 1UXLA 3C5ZB 3DI3B 5IBLC 3ABMB 1JNNH 2X4RB 3IKCA 4LEOA 4HIPA 4X5XB 5F93C 1A6VH 4Z78B 2EVIA 4Y89A 1G9NC 1BG9A 1AR1B 4JZOA 5EOTA 4QCIB 4HS3B 2MPAH 2D31B 1JS4A 1NFIB 4KMTH 4M61A 5I8KH 5IW1A 3ERXA 4CVWA 2X89A 4F8QA 1B2WL 3MYJB 3BKML 2JI2A 4XP6H 5C0BA 3JUZA 3NAAL 3WY4A 1KJ3L 2AV7A 1F02I 2NY7H 4LPTA 4YO0B 1KXQE 1UUNA 3KGSA 4JO1H 4ZODA 1AXTH 3KPPB 1CYWA 3GMQA 5AW8B 1J1PL 2EEXA 5TDOB 3X12B 4LBEB 2KZWA 1W6LA 2BNQB 1CL7L 3OLIA 5D70H 3MUY1 5DTFA 5ILTL 3WNNA 1FORH 3QORD 4F9LA 2J8UA 5GPRA 3O41B 1U58B 1MRDH 1U93B 3VXOB 3HN8A 3T4YA 1KB5A 3AM8A 2ZTBA 5AKTA 1BBDH 4BH7A 3EDJA 2D7NA 1U8NB 3QEUB 3U4AA 2X6VA 4LU5L 3E80A 4JVPA 1SYSB 3IF1B 4FYQA 4Z3JA 1TZGH 4K3EL 4GIAA 4KK5D 4JANA 1M42A 1MFCH 4ETQB 5AW9B 5JW5B 5GZOC 5DJ6A 4N90D 5DD6A 4NNPH 2VDLB 3DJSA 1VIWA 3BC9A 3M7OA 3CFKB 1A4KA 1NCDL 3WIIH 4BSWB 5DD1H 4YX2H 3EO0B 1BQHA 1RIHL 2Z9TA 1R5VA 4NRYB 2VZUA 4YL9A 2GSGA 3C8KB 4GEJA 3ULUC 4XMKH 5HDQH 1OCZB 2ESVA 3FQXA 3PHOA 3HC4H 4PN6A 3NCJL 1LEGA 2EDDA 3S36H 3QNXA 4NQDE 2AXWA 3BGMB 3C6EA 4I8DA 4KXAA 1IJ9A 5E00A 3T3PE 2GITB 2NYKA 3R8BB 1UVQB 1AKPA 5D1ZA 2NXZC 1D5MA 2X09A 2WW8A 3BN9D 3CSYA 2K9FB 4YDJB 1IE4A 4PTUB 5ALCH 1IGYB 4ZSOB 3KWUA 2X3AA 1SMOA 5IIEA 3VDCA 3H42H 5KYWA 2P3YA 1DZ0A 3FZUC 3EJZD 3MRBB 3W9DA 3IDIB 4R90L 5HI3D 4HA1A 5BV7L 5IKCA 2A9NH 4PD4J 4GXUN 4OCXH 3F83A 1Z0NA 3D18A 3UBXG 1KXTA 3D2UB 4XHJD 5I73B 3RPKA 2J44A 2VDML 1QKZL 4ZZFA 3CWGA 1QA9B 3M86A 4GMSH 3BH8B 1CVSC 3OXSB 1IVTA 1UA3A 1U3HD 1AD0B 3GK8H 1Q1PA 4JB9L 3EJQA 3OD3A 3CVBA 4UQEA 5HHQA 4KQ3H 3D33A 1H6UA 3X11B 2K6ZA 5ABAA 3D07A 5KJRL 3UJTH 1QLFB 1JZHA 3JV6B 2YAMA 4K9EH 5FUZH 2I9TB 4NO0B 4GOSA 4OIBA 5E8PB 4A66A 2UYLB 3D12B 4HV8A 1MH5A 2N4IA 5FO9A 4YHZL 5I1HH 5CD5C 3QQDA 4PRID 3O2WH 4F8PA 3VXNB 1FE8L 2YD8A 3O81A 1H19A 4IKKA 3SEPA 1NFKA 3DWTA 4NEHB 2PWEA 1XF1A 3CZFA 5AWNL 1G6RL 2HLAB 3P4NA 4EI5D 3U4BH 3T5WA 2G60H 3HMXL 1HHKB 2KZ1B 1OE3A 1TMQA 3ETBF 3KR3H 1EFXB 4LEBA 3DI2B 2A77H 1GZHA 1QFOA 1EZUA 2VR5A 4LP4A 4IBQA 3UBFA 4EJ1C 1Y07A 2R1XA 4X0KB 1OCWL 3P0VL 2HPTA 4IBWA 3PQYE 4NM4H 5EDSA 1ZXKA 5J9PB 1B0GA 2DY2A 1BYNA 4X8GA 1QFWL 4G9FA 2BVOB 2B1OA 2XZQH 2FEDC 1A9EA 4E9LA 2IH3B 5JIKA 4G3YH 1Y6KR 1HHJA 2X9ZA 5BRQA 2XU9A 5I18L 4W1TA 2BHUA 4FG2A 4YE4L 1KCWA 1CLVA 3OF6D 4TNFA 1FFPA 5I66A 1J0YA 4ZYKA 3LJ3A 3MLRL 4PJGA 5IFAH 1K72A 1FNHA 5T3ZE 1UB6A 1DVZA 4HHAA 2W60B 4YMPA 3RKDC 1EXHA 2YEQA 1F42A 1FVDB 4AKQA 1FWXA 2MNJB 4X9BA 2Q8BL 2YIHA 3FSWA 4U3HA 1IBHA 1IB5A 2V7NA 1C1EL 4TNWF 2KL6A 1NAKH 1HYRC 1WZKA 4HJ0C 2VLME 3DO4A 5B4MD 4OV5A 5MI0C 4KX8A 3BVNA 1USZA 2YLKA 2WXPA 1NICA 2WZPA 1WD9A 3QEGH 2BRRH 2RR3A 2X4TB 3REWB 2ZUWA 1X44A 4RGNC 4MB4A 1O0VA 1VGEL 2VH5H 2BDNL 4HQQH 1P4LB 2C4FT 1YC7A 3NRQA 1NLDL 4G6ML 2V2WB 5EU4B 1AHKA 5DUML 3KYAA 4YSPA 3V7AG 5TQ2H 4BCYA 4P5KA 5CZXD 2EH8H 3IB4A 4QJ3B 5FYKE 3UX9B 2E74C 4MJ4A 5D1XC 4X6CE 3ZUNC 1DL7H 4NIKB 4JFFD 6PAZA 1K9TA 5F7BA 3NPZB 2GI7A 2WTOA 3WS3A 3KDMB 2WNWA 4PP2A 4MJJA 5IWLA 2IALB 4IRSB 3H9YA 1SLWA 4GS7C 1XF2A 3PAYA 5JW3H 5T1KA 4AYFB 3LD8C 1CLOL 2G5RA 3EUDA 3DYOA 4KNSA 5LN4A 1JAEA 1LXMA 4NQXB 4AH2A 4M93C 2ZG3A 3ZDYE 4OD3H 4NZUH 2EO1A 2VQ4A 2BH0A 3CFMA 3CBKB 1IGCL 4KUZL 4DN3L 4MKTA 4CVZB 3GNML 3RG1C 1Z7JA 3VD1A 4YSAA 2K7PA 5K5YA 4HWEL 2NT0A 2WK2A 4CJ0A 4AE0A 1Q9KB 3Q1SH 3SDCC 2AQRA 5CN1A 4XH2A 4ZI8A 4L3FA 1UXMA 2JQMA 2HP4A 3BZFB 3DDGA 2BERA 3VFGL 1FLTX 2L7EA 5FA4B 1JPSL 4ZD3L 3ZE2F 5IGXL 2ZAHA 2VW4A 3SE6A 3IJ8A 3KXFE 2QHRL 3HMXA 1MJJB 3CG8A 4UZUA 4Y1SA 5BOZG 1QZ1A 4N2GA 1OSPL 3M8OH 4W9IC 2BLFA 1JWSB 4OGXL 2QQKL 1I8KB 2IMMA 3SPHA 5DO2C 1NFAA 2WO3B 2EE0A 2K6WA 1WC7B 5J1TC 1WE5A 1YHPA 4NI3A 1JZ7A 3C8DA 4QF1B 1JMZA 1H0DB 1T5KA 3FQTA 4CU8A 1VENA 1U3HB 2MH4A 2VZTA 4XNDA 4MJ6B 1ETA1 3HI5H 1MPAH 4R5VA 2V5TA 5EB9A 2YGPA 2VM3A 1HSAB 4GNKB 1HC1A 1S78D 1MFBH 5E6UB 3SQRA 2QTEA 2YUZA 4RWYL 2ZX5A 5I0YA 4ONFH 1QASA 3GS0A 5DFVC 4UU9A 3GSUB 3V9FA 2YHGA 4JM4H 3MJWA 4TNGA 2A9AA 2P5WE 3SKOB 3LS5L 2RCSH 2HWZH 2K70A 3NFNA 4KDWA 5IMOB 4PJIB 3FCUB 4WWID 2O5ZH 5AB2A 1JGDB 4PRIB 2F1AA 4YEFA 3WTSA 1ID2A 3IDGB 1KCVL 3H2WA 4HISA 5CN2A 2WQVA 4O2EB 5HVFB 3ALWA 2OTWA 4G6KH 1PQZB 2P8PB 2H1PH 5E9DA 5F7FA 1B4JH 4WHYH 4E2OA 4LIQL 1IIIA 1JMXA 2ZCKH 1M05B 3EBIA 3FTYA 3AXLA 3JV4B 3LRLA 4HBCL 4GLRI 4PJ9C 4YSDA 3SBWA 1EEYA 3NIFE 1OSYA 3N0AA 3DARA 5F9OL 4F7MA 4MJIA 3POHA 1KN2H 3T65A 2BCKA 3ZW3A 3KPRD 4QXUH 2UZIL 3LKQA 1NPUA 3KCWA 3NP4A 3OKMA 5EWIH 4GRWE 1XGQB 3NGBC 2W9LA 4G6JH 1G84A 1RU9L 2BS8A 1L9MA 4D3CH 3ARFA 2NMSA 1NMCC 3SPGA 4OCSL 5DC4B 4N2LA 4QEGA 2TRHA 3QJOA 4MXVE 2R1WA 4ES9A 2XV0A 4JY6A 3QDGE 1NBYA 3TIEA 1U2HA 2HMIC 3EFFA 2APTA 4M4RA 3QUYC 4MCYB 1RZ8A 4XPFH 1GGCH 3TV3L 2DQJL 5K9QG 3EYVA 4XNYL 3RJOA 3RI5F 3E3QE 4F58L 1BHGA 5C0CA 5KWYC 3P3UA 4IMKA 4S1QL 3FU6A 4I2XE 1I85C 5E51A 2VCOA 3P30H 1PSKH 2DWSA 5DK2A 5ESQA 1ZGLB 1KJ2L 4FQJH 4R7NA 3FU7A 1XGYH 4AQ1A 4UAHA 3VFMB 3GPSA 4DCQA 3S35H 3GD1C 4TVUA 1SLVA 3SGKC 4E36A 1UD6A 1HNGA 3EJYD 2NDFA 3DIFA 3II2A 4OLXL 4EZKA 3Q3GA 4HKZA 4LCWB 2B3IA 2XG4A 2N0MA 3H7BA 4EI6B 1GPOL 4JZJB 4GB9A 3HN5A 4R3SB 4YE4H 4GPVA 2Y6TE 1UWEL 4I89A 1RZJH 4PIBA 3NDZE 3KM1A 1XVSA 1DUZB 2OMZA 3ET9F 4WFFE 2DLFL 4TQ8A 4N0CC 5D1QC 2P52A 4X98A 4KZDL 3IJEB 3Q5YA 3WAKA 4IIQB 4MX7B 4OR1A 1WZAA 4BH8B 4NNYA 1A7BA 4HJJL 4BXSV 1MVUA 1JGVL 4NC0B 5D2NC 1OKEA 1N0XH 3RFZB 1BZ9A 2J2ZA 3DO7B 1Z9PA 3VWKD 2B5IB 5EOCL 4F80A 3AB0B 4V33A 1M6OB 3VSTA 3FFOA 1ACCA 3OAZH 2PUQT 4RSYA 3BQVA 3WKQA 2DB8A 1CLYL 5TFSH 5D71H 4JFFB 2CCWA 4OLWL 5GSRB 3VFUA 5M95B 5DJCB 4DGVH 3U0TB 4XP5H 3AQYA 1Q4NX 3QZOA 3STLA 1N5YL 2W8CA 3NCYP 3O2DL 5D7JA 3WE6A 15C8L 2JXMA 5I0WA 3ME0B 4NQUA 3OXRB 4MLIA 2H1LM 3LCYA 1PNDA 2AK4D 3DOHA 2VQ1A 2P4AB 1IKNA 1MHCB 3OKDB 1MFNA 4M7JL 3KYMA 3ILPB 3GI8H 5DMKB 2BDNH 1Y7VA 4DERA 2OR7A 1X5MA 3HRPA 3NVQA 5IP4A 1W6WA 3SODB 4FMVA 1J1XH 1ODAA 3WIHH 3BYYA 4NZRL 1VLXA 3STZB 3TESA 3WEMA 1WBXA 5FYKU 3UGEA 4JFQA 3BEVA 1S9WB 1CO1A 1ZKAA 3BZEA 1RUQH 4R4FH 4OSUH 4CU7A 1UWXH 1NCAH 3POCA 1KBWA 3N42B 3PNRB 5DHVA 4ZDHA 3HB3C 5SX4I 1YEKL 4YPGA 1TSHA 3BP4A 3WFEH 3QJXA 1FRGH 2VMJA 1F5WA 3PUUA 5ECGA 3UGXA 1K8DB 5CIPH 1EHKB 1ROCA 2Y5TB 1WAPA 3HVNA 2XTJC 4CMMA 2R0WL 4PRPB 4PY7A 1JV2B 2KMWA 1QSED 3RNQB 3LKSA 2VN7A 1NWOA 1T7XA 2YD6A 2WLHA 4N8PA 3A67L 5DJ2A 1T5WB 2J8HA 3ULUE 1TYEB 3MACH 2Y6SD 2GBAA 3HBZA 4H20L 1RLWA 5F7UA 4D8PA 3FNKA 3MBED 1MCLA 5GZOA 1AOZA 3MQIA 4WFED 1W8NA 1OAQL 1QTPA 2GK2A 4F8OA 5F6IC 2JJTC 2BIQA 1XZ0A 2WLJA 2I60L 1Q94A 3B83A 2HTLC 5HYSG 3GSNH 5E5UB 1RK1A 2ICEB 3HRZC 3CC5B 3WLBA 4HWZA 4MA7L 5KS9E 2F61A 5DWUL 4F9PC 4CVXB 3BYTA 2ENYA 1JRHL 4G9DA 4PLNC 1KFAH 1M9WA 4YHKH 3MRPB 1R3IL 1S7VB 2QHRH 4RGMC 4C56B 3DRQB 4BFIB 3ZUCA 1KN4L 3VW3H 3I3BA 3GMPA 4XC1H 4PH8A 1ASOA 3CIQA 1MSPA 3LNGA 4OU3A 5EU5B 2J5WA 1YECL 2BO0A 4NHUB 3UZVA 2F2HA 1LE5B 4DN4L 1BMWA 2G2RA 4N2MA 1BXVA 3HCVB 3BH9A 2E46A 1V3KA 3PWPD 1Z5LA 1YAIA 2YAQA 4LCCB 4XN7A 5E94A 2Z35B 1E43A 2VXSH 3SKMB 1QBLL 4F33A 1BAFH 3CBJB 4NSKB 1ZLUK 2QPDB 4OM0L 5DFTA 5JHBA 1DSFH 3VI4A 1JZ5A 3FT0A 4JFZH 2B8OT 4NO3A 3TBVA 3EW3B 1U8QA 5A6MA 5CFAA 4FLSA 4NWUH 1IIKA 2EDTA 4YHNA 2E0PA 5K39A 1AGBB 2BSEA 1BFTA 3IETA 2D3LA 4BZ2L 1MXDA 1X5KA 2XPGB 1Q1JL 1JIBA 4RMSA 5L6YL 3BD5A 1TUPA 1YDPA 5ANMB 4S0HA 2FJUB 2WZAA 4R8WL 3QO0B 5JW4R 1RHHA 2WIIB 2NNAA 1WRFA 3SHSA 3BE1H 1G5GA 1VGKA 2FWOA 3GEFA 1HU8A 1J8HE 2R23B 4ZUSB 1KBGH 3MBXL 4K2UL 4K9JA 4KVCH 2HAZA 3RIAK 1MCPL 2WQRA 1QWHA 3KPQA 3MNZB 1DLFH 2GJZA 4UNVA 3NJHA 4YXLH 2Q20A 3KPMA 3O2DA 3WO4B 1PKOA 1ZLWK 2Q7YB 3F00A 1E4XL 4X6BB 2W0KA 3KYNB 5A3ID 4U1JA 4JS7A 4PW3A 2AQ3A 2R83A 3B6SA 4OFPA 4U6HB 3MNVB 3VB9A 3QHZL 3LQAH 1HH9A 3G5ZB 4RBPH 3J27A 3O6ML 5JNYB 5KZCB 3CFBA 3UJIH 2DWDA 3ARDD 1K5NA 2HRLA 1N10A 3C5ZC 3GLEA 4DJMA 3TYFA 4AI7A 4K94C 5T3XH 2A6IA 1AR1C 3ATAA 3E8UH 3B7SA 3JWNG 4PJ5B 5AVZB 3QNZB 4YBQC 4L8DB 5JORB 3ATFA 4DP0X 4QKXB 4ELKA 3FOLA 2WV3A 4FFYH 1Q9LB 1TETH 3VTTA 4ZQTA 5C3LD 3HMWH 3WIFA 4YDKL 4F15B 1K5WA 4FXKB 2CLZB 4EE2A 4UCFA 4MMZB 3VGBA 3VWKB 1IL1B 3LAFA 4UYPA 3LHPL 3AFLA 3R7RA 1IM3D 1FLRL 3HS8A 3FBKA 1INDH 3EOAA 3FXIC 2ODIA 3RWEB 3JYCA 5GXBB 4I18B 4UMSA 4MQ7B 1HXYA 3BUQA 4X8CA 3GFUA 1U92B 4RH4A 4JFYB 1NIFA 4PHXA 5LLIC 4MMXB 1C7TA 1KIQA 1HYSD 4OZHE 5D5MA 3H7LA 2AQTA 3CBRA 5FFGA 2EKSB 43C9B 4DGYL 5AVQB 2C9VA 4LLUB 4AGNA 4RGNE 3L3KB 2PYED 5FM8A 3SBPA 4E9SA 1AO7D 3MRCB 5CGTA 4NBZB 1J18A 2K1MA 5CU9A 4I88A 5CSZA 2AK4B 3OZ9L 1CTOA 3CTTA 2QADC 2DS4A 3QQ9C 3TPUB 3TWCL 1ZS8B 3CFEB 1BD2A 3JXAA 4LF3A 3FH7A 4HPYH 3UCQA 1AANA 3UYOD 4QAMB 1RP8A 2IOIA 1BVNP 1AZCA 2F74B 2XN1A 3FCBA 3V0AC 5INCA 1PDKA 2J25A 4Y16A 5D1XE 4NUPA 3GMOA 5FWQA 1RH8A 3F58L 3HZKB 3SBRA 1MCWW 3MOBL 1RIUH 2CXKA 2NDGA 3PP4H 4XWOD 1IEAB 1BQHG 2P1YA 2ZWZA 1E9QA 3U6RB 5LUMA 4PRDA 3HG0A 4HIHB 4LB8A 1SHSA 1XZWA 2OXHA 2UUDK 3VE0A 1RUAL 1OZUA 3OKKB 4RFOL 5K1VA 4H2AA 1PL3A 3EBHA 3T8MA 3MRFA 5IJDC 1H3TA 2OMXA 3QIUC 5LCVH 5KVDL 4OVUA 4TLUA 1Z66A 4HZLB 2V2XA 4JFTA 1RZ7L 4W4NA 4RDQG 3HI1B 4UOW0 4BZ2A 3LSOB 2VLLB 3MBEB 2IDSA 3MRKB 4LAQH 2ZIDA 1R17A 3FN0H 3VG0H 2BSRB 4FE9A 4QPEA 1UEMA 4AG4L 5I17A 5IB5B 4ERSH 2NSXA 3WHXA 1HIMH 3FMGL 3BDBA 3FT1A 4LPWA 1TEGA 1W2KT 1OARH 5CEZL 2X7LB 4UTBH 3VU1A 1IFHL 3RZWA 1ZSHA 3BSZL 4NN7B 3BISA 4FZ8L 1CI5A 1KZQA 4Z77A 2FL5B 1GZPA 4L3CB 3SDCA 3SE4C 4MQTB 1BX2A 2NUTA 5KSVA 2VZSA 4U6XA 1SGKA 4MDJB 4AMXA 4XNMB 2YD1A 5DJ0B 3MUUA 2BC4A 4IS6B 2NY2D 3V9CA 2Z65C 1XEUA 4YGVB 5B38B 4QHUB 3OLGA 4M5ZL 4IHOA 1EEZB 1NC4D 1XMEB 3GO1L 4JLRB 3LEYH 2XA8L 1YUKB 1ZVSA 4LGSB 4R2GD 5KUKA 4FFZL 4ODTH 2J57A 2VR4A 32C2A 3RPIB 3BAEL 5FGSA 4OLUH 5I0VA 5EA0L 3RUGB 2OL3H 2DEWX 2VDRL 4O2FB 5DRZB 5J13C 1XSIA 4I77L 5FHAH 4JPIB 3CMGA 1UKQA 4DETA 4WUUE 3P4OA 2YOAA 4L4TD 4H13C 2B0SH 1CFNB 2OJ1A 4NRXB 3MJGX 4HK0A 4HW6A 5I1IL 4RAUB 3NYKA 1L4IA 5KAQF 4B3VA 4GAYA 3QZBA 1EDYA 1P4BH 1PIGA 3BGFB 2E9JA 2UWEB 1EJ6A 4G7SB 4XO4A 2P7TB 4N4YB 1H3GA 3WEAA 1JDAA 5DZVA 1JV5B 1Q72L 4C83A 2VLJA 2ZSVA 1ZWIB 3AREC 5ADPH 5C8JB 3K6IA 3O4LA 3DOSA 1KYFA 2W9DH 1CD1B 5GS3A 3SDAD 3N91A 3PP3K 5IJBC 1I1AC 2F6AA 3ALXA 4I7ZC 5IQNA 3T08A 1JPGA 3EAKA 1P6FA 2P24A 3G5VB 1OK8A 1P7QD 2HKHH 4PG9A 2AJYH 1MAML 3W82A 2WB1A 1CE6A 2KI6A 2JKRM 3TIDB 1G87A 1TZHA 2PXYD 1W8OA 2H2SD 1QRND 2XIDA 3ESUF 1LK2B 4FZEH 4HAKA 4PJDA 4XOBA 2A9DA 3CHRA 1JI1A 3VYOA 3HG1A 4L1TA 2BIMA 5AZEH 5FDWB 4D0CA 2R0KL 1AP2B 3ARDB 5T1LD 1AZVA 4R26H 4LQFL 2UV3A 4LSSH 5CZVH 1IT9H 1EMTH 4YHPA 1A7QH 3LKPA 1MFUA 1CFSA 3BKYL 4W9JC 1MHPL 5FA3B 5DK0A 3V0DA 1JD7A 3ARBD 5B39B 4L1BA 5EBMA 1EDHA 5EU6D 1A3LH 4N2CA 3SGJA 3S3PA 3EBGA 3WTYA 1I8MA 4J5VA 3EKCA 3PV7A 5IT2L 5E1AA 4KTDH 1U8IB 2IDTA 2O1AA 4NC2B 1U8MA 3L48A 4HK3J 1I1RA 3BIKB 3WS6C 3MFGB 1BZOA 2EDJA 5SWZD 1UC6A 4GAGH 1R6VA 4P46A 1X5XA 3LN4A 2R2HB 3Q9PA 3A4FA 4GBXC 2EE9A 3DJRA 4IDJH 4KXBA 1I85A 2L8AA 3QIBB 4JFED 4U33A 1ES0B 4PYHA 3FQNB 5D1QE 1YYML 4XE5B 2PYEB 2FHBA 1GC1H 2VDKH 5L4MA 1QRKA 1AO7B 1PNCA 3SGKA 2OCJA 2C3HA 3BSZA 2MCMA 1RCYA 1INQA 4IRSC 3N2JA 3P9MB 4KK5C 5D2NE 3I75B 2Q5BA 4ENED 2X0WA 1AY1H 5HGDA 3C5JA 2AXJA 3SDDD 2P5EB 3ZK0A 4OI8A 4LT7A 2ZXCA 3RGVD 4P05A 3V6OA 2IDFA 5C2BL 1RVFH 1IEBA 1TTBA 1JBJA 5CEXA 1PLGH 1CXKA 2Z8VC 3HC0B 3BAJA 3D4YA 3ZE0E 4GW1B 4PLJD 4R7DB 5J0BA 1EEUA 3L3GA 3AAZB 4Y2NA 2AJVL 1UB5B 1WFUA 2EDRA 2YQ2A 4AGOA 5KVEE 3LPPA 4TOYH 4B5EA 1MCOH 4XPBH 1Z3GL 1A3RL 3PRZA 1A5FL 4RGOH 5FF6B 4HWBL 1DVFA 2ZUSA 1UM4L 5CMAA 1RPUA 4ZFOA 1RJZA 3BN9C 2CUIA 2H3XC 5DFAA 5FK9A 3R18A 3AY4A 5CSGA 4MCNA 2P26A 5EN3A 3LIZH 5J1AB 2OQJA 5D9SB 4OZFH 4EZJA 2MTAA 3QDME 2BMKA 2R56H 3EJZC 3E1F1 5AYQA 4NCC1 2HX9A 5HI3C 5LBSL 1RZFL 4AMKL 4QTHB 1JDDA 1MJ8L 1CDIA 3PY9A 3X3GH 2QPSA 4JO4L 2DQDL 2NX5E 2WWMD 4LHUA 5I2IB 3W9EB 5TE7H 4AXWA 4K8RD 2BP0A 3CFUA 4YDNA 3BKJH 4PEEA 4LQ1A 3L7EB 5JIQA 4OIIH 2WINA 1GJIA 1SY6H 3B2MA 2VUKA 2R7EA 4H1LA 3KH3A 1ILSA 1U3HC 2EDWA 2XTJE 4MSWA 2VLRA 3OAYH 5E99H 1HVXA 3QDMA 1S5IL 3GMNB 3L4CA 3PHQA 4MB5A 5AVVB 1CIDA 4U0RB 3MRQB 4FYTA 4OD2A 3U7YH 3WKMH 4AYGA 1T3FA 2VLKE 3NA9L 4BWTA 4OQ1A 4NUQA 1SDAB 1IGML 2NX5A 3I02A 2V9UA 3KPSE 3LB6C 4U4IA 2N3JA 2XT1B 3GB7A 1F45A 2NY2B 4B9YA 4M48H 2Y7SA 2ZG2A 1AIFA 5ELIA 4F92B 2AXFA 4OM1H 4B7IA 3ZIYA 3D2TA 3HKZA 4XP9L 2D7TH 2J1WA 4GRLB 1M1XA 3DMMB 1HL8A 3VRJA 2G2PA 5FYJU 3PWUB 4JZNA 4JJHA 2FECI 3TH3T 1CGXA 4Y4FD 1V7NH 4WJKB 4OZIB 4I3RH 1G9EA 3AW5A 2JJTA 2JCCF 4EPSA 1FGNH 3QEQD 4UIKL 2PTTB 5CCKH 4L4TB 5E03A 4APQD 5FOBA 1KYAA 3MNMA 5D8JH 3KVDD 4PLKC 4XXCA 4JL1A 2ATAA 3D39D 1WFTA 3WJMA 2LV4A 2CIIB 2NY6B 4KJPC 1S8DB 3LZFL 2JKXA 4KY1H 4HMDA 3ZL4H 3FO2A 3K72B 2F7IA 2LR4A 5D7LE 4ELMB 3BUYB 3T0AA 3ZPDA 4LSQL 4PRHB 1CF1A 2PTUA 4PR5B 3BXNB 3RAJH 2XUWA 3QT2A 5ESAA 3SDAB 1WBZA 3E6FA 4IOFC 3TYGH 4P23D 1JNLL 3UBXI 4FQLH 3R06B 3H3KA 5AEAA 4DHLA 1P7QB 1KUMA 5AUMA 1A14L 1JHKH 1DQTA 1GMIA 4FQIL 3AZUA 3NCFB 2PXYB 3V52H 1QRNB 4B27A 3H9HA 5D7LA 25C8L 2QSVA 4L1SA 2Y5QA 4B97A 1HN1A 1AXSB 4L18A 1TQVA 4A7GF 1I3GH 1BA9A 3VYNA 3DVGA 2PPFA 2XKNA 5T1LB 2VL4A 4N8VA 5AVWB 1B6DA 3D08A 4JFWA 3QPQD 3MREA 1XB6A 2WVUA 4AVJA 4B9CA 3DK2A 4ZMLA 4YDLC 5IW3A 5EF2A 2WUCL 5LGYA 3X2QB 2VE6A 3FCSB 5CJOH 2CM6A 4C55A 3OGCA 2OR8A 1GHFH 1I8UA 5FCUL 4AGMA 5DRNB 3ARBB 3GMRB 4BELD 2YPLA 4HWBA 4AL8C 3L4TA 1OT1A 3QFJD 1UFUA 5EU6B 4Y5XC 1AGCB 3BN3B 3SE3A 3APCA 3ZE1B 1KPRB 1XSKA 4HIJB 4FX5A 4IIQC 1JTOA 4RMQA 1UWYA 3FUIA 4MWFB 5KTEL 3TF4A 1UWFA 4TNVK 3EH3B 4LDEB 5SWZB 4OTXL 3RFZC 5IJKA 2CBMA 2EVJA 3DX4A 2EILB 5D7KD 5LBSA 5MEPA 3AB0C 5D7IB 3QJSB 1ZT4B 3K2UL 4HC1A 5CZXC 1FHGA 1S2EA 1P69B 3IFPB 3K81A 5TQ0L 2BNRD 4JFEB 3V4VB 2H47C 1S7XA 2V7HB 3H8NA 3VD9A 4AM0B 4TXVB 5AFAA 2CH8A 4ZW6A 5G5DA 1MCDA 3SGDI 1TTCA 2FGWL 1T4KB 4PJ7A 4O4YH 1AZRA 2ERJB 3SBQA 1AACA 4A2HA 2CAKA 4PHZA 4QNPE 4P4KD 4WNQA 2J43A 5C6TL 3SDDB 1IBGL 8CGTA 4G11A 1OTUC 8PAZA 3II3A 1VESA 3AWGA 2BNQE 4FP8H 1GTFA 4CSSA 1KJMB 1H3PH 1SM3L 3CXHJ 3X13B 5ID0B 2Y1AA 4ICXA 4HS3A 3ZYZA 2ZKMX 1JXJA 3CLFH 3FT3B 1E28B 2VC2L 1OHZA 4GP8B 1PD0A 3VVVA 2OTPA 1EXGA 1T1XB 4ATWA 4KUCD 4PGBB 2J56A 1QFPA 1QLEB 4ZPTB 2Y7OA 1C5DA 4LASH 2VITB 4HAFA 4MBRA 1RZQA 3FQ2A 4NB7A 5ESVA 4KWUA 2ZKXA 5D2LB 4TRPH 4LOUD 4QUOA 2F53A 4LBEA 3RVVC 2H5UA 1MHHA 1A6AA 4MJHA 1WA0X 5C0EA 1DO6A 3R0MA 2IPKA 1E3FA 4M6NL 4F7EA 5JDJA 3VACA 3O41A 2VDPH 3C75A 3HNSL 1U3JA 1EUTA 1HAUA 4FHJA 2VXTH 1CFQB 3K6DA 3N9GH 1EJOH 4O51A 1LDSA 3GKZA 1FN4A 3FCTB 4ZUTB 5LQBL 2QVMA 3TVMB 2AXHA 1S9XB 3RUGF 3L9EA 4OGZA 2DD8H 1FL5A 4CNIB 5BW7A 2AJUH 2NTSP 1FO0L 4OFYD 3LKRB 1MCQA 2DQGH 4PGCA 4Z0XB 3TXAA 2HYMA 2ENPA 3WNPA 1GOHA 1NEPA 4N85A 4TSAL 4Y4KD 3UJJL 3ZTJG 4Z7WA 4NCDA 3RZCD 3I6KB 3FO0L 3C60D 3MOQA 2YXVA 2XWZA 2F5AH 1SJEB 4QRUB 3PWJB 4ZUUB 1L7TH 4L8BB 1BVZA 1Z3GH 3GHEL 2UWEF 1T1YB 2EE3A 2Q86A 4NRYA 2ICEC 4ZSOE 1UM4H 4WTWA 2A9CA 1S78C 4POYA 4M00A 4GY4A 1D3CA 2VR9A 3HS0A 4EMZA 1G0YR 4OF0A 2GY7B 1SXBA 2XPYA 3RWFB 3U7WL 1CTMA 3QR1A 4B9FA 2OK0L 4JHWL 3KYKL 2DQIL 3P2TA 2GFBB 2J8OA 1JHTA 4HDIA 4JM2D 3PV6A 1IC1A 2V9RA 2XRAL 1J05B 2F54A 5HYJD 3BPCB 1IZJA 3QIUA 4PTUA 3ARVA 4PRBB 5C3IA 1DQDL 3RNKB 1OPGL 2H4EA 2O5YH 1MY5A 3MRBA 2HG5A 3IDIA 4LCCC 2PP7A 1QTYT 4NKOB 1BZQK 1YEEL 5AYUH 4G6FD 3SB3A 1G7LB 3A4DA 3EHBC 3C2AL 3PJSA 3D34A 4L9LA 4N6RA 3ZKMD 4OCRL 4OLYL 3LZLA 3QFDB 3NZ8A 4NGHL 3QI9D 5F88B 3QEQB 1D5XA 5I19L 4ZTPH 4FNSA 1HKLH 4RISH 1I3RA 5JUEL 4APQB 4DAGH 1SJHB 1JWMA 3OXSA 3HIZA 4Z8FL 3D39B 5JPMA 3EH1A 3UP6A 4LSVH 5I1KL 2Z31D 5LAPA 3SE4A 2NZ9D 5DHYA 5EEUA 1L3NA 1CYXA 1JHLL 1R24B 3DBSA 2XETA 4WW1B 2VL5B 3WY3A 12E8H 1SJVA 5F70A 4DEUA 1R19A 3PPEA 2R8SL 3RBGA 5E8PA 3D69B 1P1VA 1Q38A 2Y7MA 2A1WL 1NBZB 1RKRA 4BK5A 3FTXA 4ZFZA 2OJZL 5CUSL 4L4VB 3OB8A 2ROYA 5KVGL 1CBVH 3QRGL 1B0IA 2ZOKB 1DQQA 5FUOL 5EFIA 3VQMA 5GSVB 3WO4C 4JCLA 1WIOA 2P44B 2JI1A 3MLVL 3PU7A 3T71A 2IEPA 4KFMA 5AOIA 1DFBH 3V5DA 1F8TH 2HJFB 1A9VA 2ZCHL 3WENA 2CJUH 3F7RA 3EJSA 3MODL 3QEHA 3SY6A 2WVVB 4XMWA 1DVTA 4RWHA 1VACA 1KMGA 1F2QA 3MC0A 1HHKA 2IDCA 3OKLA 5E2TL 5JIHA 3UAJC 5T5FA 2DIEA 2GTZA 2WIMA 3HVDA 3QSKB 2X4OA 4HWNA 2EIZB 3IN0A 3B9DA 3EJYC 4Y4HB 5GRWA 5D4IA 1WPCA 3FUFA 4X0KA 2HTKD 1AHWB 3QO1A 3ETBJ 4MNQA 3FFDA 3GSRA 1MEXL 1J5DA 1S7UB 5DD0L 3WY1A 1IAIL 5F96H 1V7ML 4Q9CA 3HC3H 4XVJL 4PTTA 1SHMA 2H32H 3IFOA 3AREA 1FYTA 3UTSE 3JWOH 4EF3A 4LFHD 4GKSA 2IH3A 4NOBA 4P57B 2OYMA 5CSBA 2AV1B 3IWVA 1I9EA 4X4YB 1BVOA 3JWDL 1I1AA 3TT3L 3U9PH 5E24E 1YEHL 4MMZC 1WCQA 1WBYA 2DH2A 3VWKC 4PY8I 4FQXC 1PKQA 1IGTB 1C12B 1FO0A 2BNRB 4MD5A 2R1YB 2UX6A 3UZQB 4F37F 4IBUA 4NKQB 3UTSA 2X53A 3MRRA 3FUEA 2CIKB 1LE9B 3G08A 2WZ0A 2FATL 3T0EA 4P4KB 1IC7H 1B9ZA 4MJ5B 4TQHA 4TN9A 2WP3O 5F9JB 4TS6A 1E4JA 4U1NA 1LK3H 2DIBA 4JFUA 2B2XL 5SWQA 2HFEB 4RSVA 4ALAH 3GUTA 1OSZA 4XCCL 5G4NA 2MSPA 4J8RA 5JOFA 2LLLA 1W9XA 4LCUA 3OX8A 4A6YH 3FO9B 4FHBD 2XTSA 5F3BA 1JYWA 3QCVL 1RUMH 4RAHA 2OZNA 4FFTA 5K9QI 3REWA 4Z7OB 1ILUA 4MD0B 4AK1A 1FNSL 2CM5A 2CGZA 3K2UH 4HJIA 4BFFA 3GMLB 2GIXA 3MLXH 3O8XA 5CLXA 2I5YH 4Z5RB 2UVFA 1U8KA 4WQOA 5BO1L 5FOJA 3NACL 1NKRA 1K6QH 5MHSD 5DA0B 4Q9RH 4GBXA 4ZQKB 4P49A 3WE1A 3B1TA 5DMIL 1T04B 2IWFA 4FNQA 4LRNH 4PB0L 1D2OA 5EDXA 2E59A 1YUHA 1IC4H 4HPOL 3WN5B 2JKSA 1TO5A 3SCMD 3U82B 4BZ1L 5GGQH 1H9VA 4J3UA 3O3BA 1H8NA 4IRSA 1EV2E 3RVWD 3S4SA 3VXUD 1XF4A 4XO8A 3P2BA 3ZRSA 2LAAA 3MBEC 4Y4KB 4UM9B 3RZCB 1TYJA 2DM2A 3C60B 5TK2A 1TENA 1V3JA 4N0FA 1NCBL 4G6AC 1CURA 3GDBA 1HNYA 1AI1H 3ECVA 1ACYH 1HHHB 2IFFH 2AVGA 4O00A 1C5BL 4LCIH 4F2MA 1YLBB 3GSWB 2VZ1A 3TFKD 1T0MA 4P2AA 1GGIL 3MX0A 3F8UB 1W15A 3OC5A 4ELMF 4FG4A 1KBKA 2AEQH 2WLLA 2AXGA 3AWEA 3H9SD 1F6AA 1E5CA 4UINH 3WLWC 5LXGH 4A39A 4IRZL 4N2DA 3UBXB 3ROLB 4JM2B 2JWYA 5DRXA 5IG7B 3RB7A 5HYJB 3ZLQC 1DBKH 2BY2A 4JQIL 1NA8A 3GIZL 2VMFA 3LS4H 1WIUA 4QAWA 2EDYA 5E5RB 3OSVA 5K59F 3I9GH 1ZGLM 3MA7B 1XR8A 4AWJC 3FW6A 1WC7A 2GT9B 4JRYA 2ZONA 3FOMB 4F5CA 3QI9B 4ZMYA 2OL3B 4B9PA 5DUBA 4YQXL 4OUUA 3JTTB 4I0CC 2WTPA 3L3JB 3HR6A 2MQGA 3QG6B 4C4UA 4LE8A 4PJIE 5CR1A 2PPCA 4J3OH 1MCEA 1KF9B 1YEJH 3MNWB 3HPLB 4PRIE 3S37H 5B1JC 4PS7A 3TBCA 1TJIL 4TQEH 4CVUA 3JVFC 1KIUA 5BMFH 3BGFC 4QRFA 5I30H 4JR9H 1CGWA 3IJSA 3MLZH 5JYLA 3MCYA 1R4XA 2B3RA 2H0EA 3QUML 5DMGC 3OJDB 4TPRL 1YQ2A 3FFCD 3TBYA 4QHMB 2JTYA 3SKOA 4XCFH 3ELQA 3GRWA 1E8ZA 3DUHA 1JGDA 4PS8A 4JPKL 5IZ7A 3UPCA 3P3TA 3FU5A 4UNUA 3CE1A 2B20A 5D4JA 4NXSA 2CPUA 4PS4H 1NGPH 3F12A 4F93B 2ISDA 2DWEA 1BQ5A 1X9RA 1MWAL 3TO4D 5A3IC 3IJYA 1DJIA 2FT8A 4Y19A 2NY5L 2RAMA 4YEEA 3BPLB 1RZPA 1M05A 3ZY7A 4KK8C 5CJQH 5C71A 1BVLA 1J7VR 2DJUA 5A2FA 3CK0L 3ARDC 2M1KA 4RESB 4XVOA 4XRCB 4NKMA 1AQKH 1AS6A 3APMA 3KLDA 4P59L 3VXSD 2FHCA 4I3SH 3QYCA 5I1AB 1NCHA 4Z7VB 5T33L 4KVNL 4ODUA 4QRSB 3H3PH 5FO7A 1DN0B 1KJVA 4LLDB 3CVIL 3EFOB 4JHBA 1GKOA 3CPLB 4MD4A 4M62L 5D2LF 2QDWA 1FV1A 3PL6A 5CLZA 1G1OA 5HYQB 4AENA 1F3JA 1YJDH 5CKAA 2HJLA 4LESA 2DTSA 4ONGH 4RRPM 4XMLH 4E5XA 1C9SA 2LABA 5E6ID 2J1YA 3MLTA 3N5AA 4LL1A 1TU2A 3CGTA 4U1LA 5EC1B 4MXQC 4BZ1A 5PAZA 4LCWE 2GJ6A 2FWLB 3VRLF 4ZFFA 1N68A 1A7NL 2OSWA 1M9SA 1D9KC 2HFGH 4HIIB 1R3HB 5HHMD 4KKAD 2CDGA 2ZSWA 2QQLL 1GH7A 3IXAA 3O2VL 4GT7A 4ZK8A 5IREA 2EUVA 3QIBC 4GSDL 4XNZB 4JG5A 2UY6B 1QUNA 2MNWA 2VSCA 3D51A 3QWOA 5T3ZH 1JF5A 3U0WL 1AVAA 4PJ8A 3QUXD 4JGJA 2E8ZA 3ABZA 3GIVB 4ZS7H 5TGBA 5AD0A 3D87B 3QPKA 2FB4L 3US0A 2UX7A 1WQVT 3O6FA 4H25A 1Q0YL 4WWOA 1QPKA 4XVJH 3L9YA 4HWUA 5J57B 3DXAA 3HNTH 4Q0XH 1VDGA 3I2CL 3IPEA 4Q97A 5L8JB 2AGJH 5AQ0A 3LPWA 4HUNB 4EI6A 1NMBL 1MQKH 1A6UL 3DTUB 4KROD 4IRZA 2Z34A 2BFVH 1DO5A 1EO7A 4JFFE 5J8OA 3PGFH 2D0HA 3DX0A 4WEEA 2ICWB 2DMHA 1CJYA 4TLTA 5E8OA 3MMEB 4ONHA 1T7ZA 3EFDL 4WEBL 2BVEA 1W0VB 2EIJB 5JMOC 1F4YH 1NGZA 2V5SA 4KJWD 3PWNA 3FT2A 3EYQC 5EBWB 4M1DH 5H8DA 1OGAD 5F7NC 1OAKH 1JVOA 4X5WA 2Y36L 2QKIB 1FVCA 4FNLH 4YHIB 2Y4SA 3H3BC 3D7PA 3QAQA 4PJEB 3G7TA 4Z0BH 1JGEB 3U0TA 4A38A 3B9EA 2IV8A 4LPYA 4OZFB 4OIFA 2XV6B 3N1QC 5FYKH 3FH8A 3U1PA 3O0RH 1JZFA 2OMUB 4LOVA 4UWQB 3MRLB 5FYLH 4PJCB 4HCIA 1JGLL 2GAZA 3MLUL 1RZKH 3QUGA 4KI5D 4PGDB 3SQOH 1BBJA 5BVJA 5LO7A 3KJ6H 5HDBE 4LHUG 3QUMA 3MXVH 2VJXA 4BJLA 4DP1X 1VZGA 2B39A 3LEVH 1DBAL 3TP4A 3X14A 4PRPE 4R84A 1V3LA 1OP5K 3SYAA 3BQUD 2E6PA 3VM5A 4NYLA 1L3WA 1I9JH 1WAAA 4H1LG 4U0RC 4XMZA 3O45A 4OGQC 4KMQA 1AD9A 3ZO0A 3WKNA 2APVA 2IAMD 2XN9E 1CQYA 3RTQD 4LBAA 2NY2C 3AU0A 3E2HB 1KTRL 5C0FB 2VISB 2NNXA 3Q6GL 1HEJC 5H4YA 2VXUL 5HSFA 2Y5TA 1X9UA 2A73B 5TPWL 4NJ9H 4XMTA 1VPOH 4L0PB 1E2WA 5HHOD 3UPRB 5I26A 4OUOA 2Z1PA 4H5SA 3DV6B 1ZOXA 2EC8A 1FSKB 3DMMC 4GRLC 2JB6B 2P80A 4NQVA 3DV4A 1JD9A 2R0ZH 7FABL 1C16B 5IMMA 1JZ2A 1KEGH 2MQCA 2XN9A 4U1SB 3BVUA 4RIRA 3O3DB 3KWVA 3T77B 4QJ4B 5CP7A 4GI6A 4MXWL 4GRMA 4C56E 1FNEA 1I4FA 3CHQA 2YFOA 4KDTC 5IQ7H 3ARRA 4N2EA 1MY7A 3MJ9L 4KKNA 2FR4A 4XWGL 2H3NB 1JK9A 1HINL 2ZG1A 3VDBA 4PJFF 3CCHB 3QUZD 3SOBH 1Z9SB 5A40E 5GS0H 4AT6A 6FABL 2NY6C 4FMFA 4KRPB 5I1LB 2O61B 3DIDA 5DUPH 2AANA 3MRPA 4S10A 5DEFA 2I26N 5GGSB 1S7VA 1UQSA 2ZPKH 4P2CG 4UQ3A 4XNAA 1XBRA 1WFMA 5HHVL 1P4IH 5D72L 4C56A 2E9GA 4WW2F 3ZDXF 4ZAKB 1XGRA 4QLWA 4M6ML 5L2JB 1RIVL 3SDAC 2NNRA 4JDTL 1XH0A 3RVUD 3V0WH 3LEXB 1LNUB 3K0YA 4KKPA 3UYRL 4HKXA 2WBJA 1FGVH 4Q89A 1RHFA 5ACMA 5ID1B 3TO4B 1D7CA 3RDTD 4G42B 4XOCA 1N19A 1MOEA 4IU2A 1G7MA 4LCCA 5ANME 4OH2A 1U21A 2Z35A 2PXYC 1RUKH 3SKMA 2VJ8A 3VX0A 2FEEL 2IWEA 3MV8A 1B4TA 3QCUL 4Y2DB 5DDHB 5DMYA 1F6FB 4LSUH 4P9HL 3J07A 2IQAB 1JWUB 1PPIA 4CMHB 4NWTL 1UM5H 3RLSA 4ODWB 2OLDA 1CWVA 4KOBA 2YPVA 2OW7A 4I9WD 5CD3B 4LLWB 1DQLL 2OSLB 5TE6L 2XPGA 1BQLH 4LAJH 3IMWA 4N8VG 1CD8A 4PGJA 4LARH 3CMOL 2GUOB 4KUCF 3ARGB 3B3IB 2WLIA 2C3VB 2JELH 3CVHB 3ARBC 4JG1H 4GRWH 5BUAA 4LMQE 3KYOA 4JBSA 3V79C 1RK7A 5EV7A 1IBBA 3EUUA 4UB0L 2P8MB 1G6VK 2C4XA 1OOWA 1W72L 3AU1B 5GZNC 1UYWH 4QTIH 5E6IB 1KG0B 5FHBL 3MBWB 3C9NB 1QHPA 4G1EA 1HZHH 3X1GA 2HT4D 4W9HC 3V9EA 5CBEA 5HI5C 3VXMA 1F4WL 3SDXB 3MJ8B 1N3NA 3H54A 2HLFC 1CGSH 4PJ5E 5K9KA 2A6KB 1L5GB 2DQEH 4ADGA 3CSTA 4L48A 5C08D 5L4FA 4HMCA 3UAJA 5C0AA 1TQBB 1G7IA 4MA1C 3VUAA 2VB5A 3KLAB 2G3NA 3UOAB 4X9IA 2DI8A 1S46A 3CUPB 1HQRB 3N40F 2X89D 1CL7I 1CIUA 1FNAA 4DW2H 5C0BD 4KK6D 4XMUA 1OL0A 3BOVA 1NKGA 4BK4A 3MGOA 1R46A 3QNZA 3EGDB 1P1ZA 2FBJL 1LTXA 2BSTA 4PLJC 2CKBB 1ZT7B 2EEBA 5I6XB 4PGEB 3ZJAA 4PWFA 4PPTA 2YQBA 2X0VA 43CAA 3RHWF 4U3SA 4ZMNA 3BAIA 4MMZA 4X4ME 5MP6H 2AAVA 2LGNA 2WTRA 2IADA 4JM2F 4WWKC 2VDQL 4QMEA 3RWEA 4W9EC 4FQXA 2AK4E 1OGAB 4WEMB 4XC3L 4A7TA 3MTXA 1CYGA 4JDEA 2VDOL 4KVPA 4UV7H 1FDLL 3HZYB 2QVFB 3AQDA 1WDAA 3VB8A 2IXQB 1NCJA 2VKXA 1JZ3A 2OULB 4PM1A 4OZ4A 3QCTL 3QQ4A 1G9NH 3JVGC 3UAEA 2IOOA 4BRVA 4YR6B 3MJ9A 1BAGA 3T6VA 4U3XA 1LO4H 1OAXH 2IH9A 3KPLB 3TVMC 4AV0A 4HS6B 5DSCB 1CFVH 5L8KB 5F8QC 2QFRA 4FTVA 4K8RC 2IH1A 3Q01A 1ZS8A 3CFEA 1T5XA 5IJVB 3TT1H 1G1YA 3EADA 4KTEH 4TL5A 5FECA 2F74A 1EXUA 2AJSH 2ESVD 3TBSB 1TXKA 4PU2A 4WEBH 3W2DH 2QR0A 2Y1VA 3BUBA 5EPMA 1J5OL 4C59B 4QRQA 2X6UA 3P77A 5I75B 2VDNB 5D1ZD 3MA9H 4X8XA 2E6QA 3MV11 4I13B 4DQAA 1ACXA 1DQKA 2IAMB 3MLWH 5F7AA 4HZ1A 2A6JB 4P2QB 3RTQB 4DOHB 3QXDB 4JPSA 1ZTXE 1I31A 2Z92A 4OCYH 3OZKA 4WFEE 5JLZA 2EDFA 2IPUK 1E9OA 1KCRL 2DWXA 4FQCH 4JKNA 5FYJL 3ZTJH 3NK4A 2H3KA 3MCKB 3K8MA 1HOCB 2ZWYA 3VX1A 2JI3A 4DQOH 4NQDD 2AP2A 2FQGA 4NDMA 5E6SB 3RU8H 1TDQA 1MAKA 5L9DL 1A47A 5HHOB 3NTCH 1WVZA 2ADGB 3UTOA 1I7ZB 5HYSB 4UAOB 2DLGA 4PSRA 5EEWA 4M3HA 3LRHA 4U6VL 2P8LB 1CBJA 2YKLH 4AITA 4ZOEA 1CDJA 2UUDH 1A22B 4RX4A 3LSOA 1H3VA 4O02L 5IEKB 2BIHA 4OF5A 1QACA 3GI9L 3ULUH 2YBRB 3VTMA 4K3JL 1QNZL 1KELH 3ILDA 1DLHB 2WOYA 2GEQA 3FQRB 1SOKA 5GIRA 4APQC 3MN8A 5AALA 1OTSC 3KS0H 2DDQH 3PREA 3QUZB 4Z7VF 2AK1L 1N26A 4J3OD 5IK3B 1BECA 2H6OA 1O6SA 1BJMA 1G7QA 4UTCA 2NTFB 4WK4B 1KGYE 2IG2L 2ZWKA 1QO3B 1ZANL 4K15A 4WDIB 1IAOB 4XNQB 3T1FB 3ZQ9A 3N85H 4UQDA 3T2PA 2CMRH 3EYOA 4TVPE 3RUGE 2IWGA 4IS6A 1SVZA 5EIQA 3ULVC 1SF3A 1Y6MR 2HUEA 4KRLB 4JFXA 3A3YB 3HUJB 2G3MA 2UXGA 4NKDA 5L88L 2MOQA 1PZSA 2OS7A 3RDTB 3WGVB 3NCXA 2DL9A 4YIQA 1FFTB 3FRUB 4EOWH 4NZTH 3EYSL 4GO8A 1RURL 2C9UA 1MREL 2LTQC 4KJYB 1R0AL 3SZ6A 1QFWI 3NFPB 1H8LA 4TSCL 3LVEA 3CHPA 5HJ3A 1G0XA 2B1AH 3S2CA 2LVEA 1HXMA 2W07B 1HHGA 1BOYA 1FL6B 1MRCH 3AC0A 3DVNB 3X3FL 5CILL 4P5TA 3QPQC 2KPNA 5AAWC 5A2AA 3VM7A 2X1PA 3X1EA 4QXGH 4Y4HC 2Y72A 4G9FD 1TIUA 4HX1A 1AHWC 2COQA 3UTZB 3VFOA 4F7TB 3I9AA 2GBTA 4V1DB 4A68A 4KZEL 1ZK9A 1MG3C 4UF7C 5GGVH 2XVKA 1TJMA 5FX3A 3WFBH 3NFSL 3ARXA 3DDFA 3GBML 4I0KA 3BSHA 4KAQH 3LIUA 4LNRA 2H32B 1ZWIA 3IGAB 1H8SA 4UT6H 3V6FA 3DYMA 4FLRA 3NEXA 3BGAA 3OMIB 1CFMA 1YG9A 3A22A 2XWBA 4XAWH 3BVDB 1CD1A 5JW5A 1U42A 3KLQA 4U1HA 5E8DH 5G2NA 2EYRB 3T4AC 2APBA 3DUUA 1YPZA 5A6LA 2Z0UA 3VFSB 4LPCA 3ZDZB 4LLYA 2WXNA 3PJNA 4PJEF 3ARQA 4HEMA 3TH4T 4FQQB 4F57L 1BGXH 2YK1L 2RFXA 3GZPA 3K6SB 5AW7B 2F5BL 3IKCB 4LEOB 2EE6A 4PJCF 2OZ4L 2Y0SA 4W9DC 4HXAH 4JZOB 5EOTB 1DJXA 1AP2A 2APFA 3KNBA 4NAJA 4OJAA 1DQJA 2PCXA 2KH2B 4M61B 3VCLA 1NGWA 3Q9QA 5IW1B 2DQTH 2WZPD 5C0BB 1KC5H 5MENA 2F19H 5I9QB 1F6LL 1JDCA 5TH2A 4PREA 1UD5A 5J6HA 3GMQB 2XLLA 1BVNT 2LT9A 5LGHH 1L7IL 3MFFB 1AG0A 1DJWA 2Y06L 2K6YA 4MLSA 4PMEA 4Q14A 3UACA 4ADJA 5A2CA 3B5GA 5DTFB 4IQHA 1JGUH 4FA7B 2VLMD 1KWGA 2HFTA 4PVBA 2J8UB 4GG6E 2PYEE 2J5LB 5MEQA 2UXFA 1FNGA 1EO8H 3P02A 4WGWB 3T4YB 1X4ZA 1KB5B 2XJLA 1SXZA 4BH7B 1GY1A 1RJLB 2A9MH 2YD2A 1D9KA 1E4WL 5HD8D 2P5EE 1M53A 2EE2A 3RJDA 4DVBB 1GGUA 5DQDH 4IIZA 4M3JA 2XN2A 3DX7B 4JANB 3PGDA 3GS4A 1ES0A 2N7BA 3ZZLA 5DJ6B 2K4AA 5DD6B 4GG6A 2I69A 5KVEL 1H5BA 5BVPL 3WN5C 1A4KB 2QTVA 5FYKD 4HXBL 3P9MA 4E0RA 2RJMA 3JZ7A 3THML 1BQHB 1SVCP 5FYLD 1R5VB 5AOZA 4Y4KC 2GSGB 2H45A 3S4SG 3QULB 3C60C 3SKNA 2ESVB 1ZXQA 2PR9A 3FQXB 3PHOB 5EORL 1LEGB 4AQAA 3QNXB 4BCZA 1YN7A 2FX8L 1A7OH 3HC0A 3IE9A 5E00B 2J6EH 3K2IA 5EIIA 5D1ZB 1D5MB 1WD8A 5AZUA 3CSYB 3UIYA 4OB5L 35C8H 3JYBA 4R5XA 5KSBA 4GAJL 3CZUB 1FBIH 3T8XA 3DUSA 1TZ8A 5LDSA 5IIEB 5KYWB 4H7VA 4I3GA 3K0WA 3P0GB 3CQPA 5IKCB 2PWDA 3BP6A 4GSXA 5D6CA 1JL8A 3D18B 3TEXA 4XVUD 1TEFA 1ZA6A 3O3EA 2ZE0A 3TBBA 3TZVD 2G9HA 5FO8A 5ERWB 3D50A 5T1DL 2UZYB 3EH5B 2EADA 2TSAA 3HNVH 2D9QB 3V0FA 2CO3A 5IFJA 5DJXA 2J1ZA 2C1PA 1OOAA 4ZPVA 3ZKMC 2XI9A 4NZDA 2ZOLA 3QI9C 4NM8L 2WXQA 2AABH 4KK9C 1AC6A 3T2LA 4D7PA 2IGFH 4HCRL 5FFLA 5F9DC 1X7QA 2ENSA 4G5ZH 4TVSa 4JCWA 1UADC 4WCYH 3IXTA 5HBBA 2DLHA 3WMSA 1M56B 2Y2WA 3IRCA 6CGTA 2WD0A 2CK0L 4HJTA 3UH8A 4S1SL 2NZ9C 1MH5B 4HV8B 4TULL 3C09B 3QBTB 4LLQB 3S96A 5GS0D 1Y0LA 4EN3A 1NCUA 2ARJQ 4WY7L 1P84K 3HEIB 4GT0A 4WV1A 4URKA 4IGBA 5AOJA 4W6YB 3QQDB 4HU8A 3OTTA 4UIMA 5JTWA 5F0PB 4OZIE 1LD9B 3K74B 1WGOA 4Y2OA 1T20B 3CZFB 1EJ8A 3LXAA 4ZX4A 4WU7A 2BZCA 4OLZH 4L4TE 2OZ4A 3P4NB 3SDXF 5E9DD 2ORBH 2P5WD 9CGTA 3X1FA 4JDVA 1J1OL 5JIPA 4GRLA 4JKPL 2ATPA 1JF6A 4U2YA 2R1XB 3TEUA 4MJID 2XWDA 1E0OB 2A4ZA 2I27N 4IU3A 3IE4A 1VRSA 1SUHA 4ELME 3BPLC 1FG9C 4DPBX 3QXAA 4PRHE 1Z9OA 1X7SA 1B0GB 2EXWD 1JI2A 4F91B 1QEXA 4G9FB 3ARFD 2ZJSH 1BFOA 2E5EA 3BZ4A 3QH3A 3GF8A 1SXNA 1A9EB 5IOPB 3HE6D 4GUOA 1WZLA 1HHJB 2FJHA 5E95B 2LU3A 3BRGC 2CCVA 2IANA 2C1OA 4RAVA 4DNLA 4L4JA 1ETJA 1KGIA 5I66B 2C3GA 1Z9NA 4H40A 4ZYKB 4GUQA 4PJGB 5K59E 5T5NG 3I85A 2FNWA 4BGDA 1UB6B 1OXYA 3LZNA 1MJ7L 2ZICA 4HHAB 3A23A 5GJTL 3TX4A 1LHZA 4KKLD 2XX0A 4Y1AE 3R06A 2BOBA 3NA4A 1LO3L 4WI7A 3H2QA 4M1GH 5F97E 3LQMA 5DD5H 1DSYA 2V7NB 2J88H 4E5XG 3OMNB 1SBSL 3QJUB 1TYRA 4Z76B 3KLLA 4XNZC 4NUJA 4Y2LA 2PWFA 3FQUA 5IV2B 4KI5F 3GJEA 5H94A 3ZE1E 4OV5B 3BVNB 4UV4L 4YSEA 2VZ3A 5LWYL 4Y1AA 3GM8A 1W80A 3WUWA 4LL9A 2Z6FA 3EZJB 5SWZE 5I1DA 3OKYA 2NXYC 3B1UA 4CRPA 5IVXF 1TITA 2E27L 4YXHH 3KGTA 5D7IE 1MF2L 2PPDA 4GSUA 3MJ7A 5B7FA 3D4ZA 3Q2NA 3N3EA 4L2YA 2WLKA 2X12A 1KPRA 4G8EA 5BV7B 5KYNA 1SEBA 4P5KB 3B2UD 1KGJA 3IU3A 4HHGA 3W56A 3U9WA 4PCSA 4Q6IB 3TEWA 4AGPA 3B8YA 1IQWH 1GRWA 2AQ2A 4XVTH 5IM7A 2VDMB 4WFFD 4PG2C 2QGBA 1YN6A 2BNUA 3DRTA 3WS3B 1NLBL 2P47B 3IFPA 4PP2B 4ZMWA 3FN9A 5GJSL 5D7JD 1M7UA 4U1KA 3CV5A 4CSZA 3V4PL 1XF2B 1HQ4A 3UO1H 2QKIC 5DK3A 5T1KB 4OJEH 1BVKA 2B9AA 5IBLD 4HCRA 3CFJA 4AH2B 1CE1H 2CSPA 5IUCA 4ZO7A 1QBMH 3DBXA 3MV7A 3MOAL 3RVWC 3CQQA 4KHXH 4K3DL 1XTLA 5IUSA 2B7DT 3TL5A 1A7RL 2B1HH 1Y1DA 4N2BA 8FABA 5B1CA 3JBG7 2DIAA 2AQQA 2VDLL 1KYDA 1FPTH 1RK0A 2F58H 2K3TA 3L5XL 2GW5A 1BXXA 4IRJC 2H6UA 4XN1A 1EO5A 4XH2B 1ADQL 1EERB 3L2MA 4LSTH 5E2UH 1KGWA 2FRGP 3I50L 5DS2A 3TFKC 4EN2A 4Q2ZA 3HFFA 5C0ND 2J12B 5H2BA 1A6WL 5JYMA 1RI8A 3SN6N 1TVHA 4WWKA 1CGVA 2WCSA 3NH7L 4ZFGL 3GM0A 1GIGL 5KVEH 4BM7A 3E2HC 3BPNB 5EBLA 1PZCA 5BVPH 5JHLL 3W5NA 2RGSA 3M1CA 1INEL 3W81A 1E30A 4B9ZA 1I8LC 1BF5A 1ND0A 3JVGA 5GZOD 4FFVD 4AQ8A 5HVWA 3FCTA 3FUJA 4XBEL 3BHBA 4PBWD 1U8LA 5LG1A 1GJWA 2B59A 3FQTB 3LKOA 1IGJA 3EZ8A 1FZOA 4LHQB 2W91A 4OQTA 2P48B 2EJ1A 1N4XH 4E9RA 4YHLL 3T3MF 1PLCA 2ADFH 1SJEA 4QRUA 5A16A 2X4NA 2DICA 4TMPA 5BNXD 4IBLT 2Z91A 2QSTA 4YSTA 4UU9B 2FX9L 3F04A 3IFNH 1BZ8A 2NXZD 3IS1X 3NFNB 2IPUG 3L54A 4UT7H 4KRPC 1WHPA 4LKXA 4XHQA 5F3HA 1UZ8A 3GYRA 4RMBA 5GRJL 4ZX6A 1AYRA 2DI9A 2Z3FA 1E6JL 2EIEA 4QHKI 2Z4TA 4CDGC 3ZXAC 4AW4A 4N2FA 2VAAA 4ZAKC 2OTWB 4NKIL 1QHQA 2VXVH 5CO1A 1PJWA 3QEQE 4GP4B 4U1GB 1UCBL 2QBWA 3D9AL 5E9DB 3S8FB 2HKFL 3QB7C 2WYTA 3IRZA 3ARWA 1YEGL 3D39E 3L6FB 3AXLB 4CADA 4TLKA 1G94A 3C08H 5J6GA 2CCLA 1EEYB 1SFDA 3CLEL 3GXDA 1ZAGA 4OZGA 4BFRA 4L3AA 4MJIB 1NCCH 4IHBA 4F7MB 3T65B 2BCKB 3OPZL 3A47A 1URZA 3IJHA 5JHDB 3LKQB 4Y2DC 3OKMB 3ULVE 2LE9A 1NOLA 4CMHC 3ARFB 3QAZB 2FECL 3S0PA 1UXSA 3BJLA 4F7KA 1A2YA 1GS6X 2J73A 4AEFA 1VFMA 4L4VE 1GVIA 2R1WB 4M03A 4BFGA 1E4XI 4JY6B 3B56A 1JPTH 4HT1H 1NBYB 4MHHI 3ARGC 5CGBA 4OAWA 1R24A 3TIEB 1SMAA 2J8UF 1CF8L 2R69L 2VL5A 3EFFB 4M4RB 5DHMC 1RZ8B 4ANUA 1SJXA 5E7BA 5C0CB 3BO8A 1QAWA 2IF7A 1T1WB 1OW0C 4RZCA 5DK2B 2AAAA 5ESQB 5H37H 4R7NB 5GHWL 2PN5A 3FU7B 4AQ1B 3OGOE 3RIFF 4EBQL 3ZYJA 4X4XA 3HI6L 4EI0A 5IHHA 4DCQB 2XQYA 5E70A 2CR0A 2X70A 2V2TA 4NQEA 2HJFA 2WO4A 5IQ9A 3V0GA 3Q3GB 4HKZB 1JTTA 2XG4B 1D6VH 4NJAH 2X4UA 3L3OC 4A2FA 3H7BB 2ZKHH 3IM1A 2EIZA 4CN4A 4WU5A 4TF4A 2LAGB 4UILL 2OMZB 1KT2A 3KVQA 4X98B 5G55A 2FEDD 5D7KE 1LO2H 4P3CH 4S1DD 3L9BA 2M26A 4NNYB 1ZPLA 3UG3A 5JO5A 1XB3A 2BNRE 3IDXL 1MVUB 5DQJA 3EF4A 5EZOH 1T83C 4ONOA 2EDKA 1BZ9B 3ZT7A 2L7UA 2WQXA 4NAMA 5DJAA 5JHLA 5G4MA 4HC1H 1MN4A 5DF0A 3EOBA 2EUXA 4DSYA 4KITB 2FH8A 2YN3A 3V0VA 3T4AA 3RKDD 4TSBL 3VFUB 4Q9QL 2YRLA