2CIPA

Structure of the michaelis complex of a family 26 lichenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
273
Chain Sequence
b'SGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title Substrate Distortion by a Lichenase Highlights the Different Conformational Itineraries Harnessed by Related Glycoside Hydrolases.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 110
structure length 273
sequence length 276
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cipA00
1W9XA 1SFSA 2WMFA 4ZENA 1ZB5A 1AVAA 1ZBWA 1CBGA 4WKHA 4M80A 2VO5A 5IHRA 1XRVA 1OGGA 1BYDA 2QV4A 3VIHA 1OT2A 1B3YA 4LYQA 3DYOA 4RL3A 3OLGA 4BF7A 2UY5A 1NQ6A 1BG4A 4TX6A 3AYRA 3CZLA 3PZMA 3WQVA 4LGXA 5HXMA 2XM1A 3HJEA 2EXOA 1MVYA 2D3NA 4QDMA 5FL0A 3VINA 2OLHA 4F79A 1B3VA 3L4YA 1LQ0A 1RP9A 1XC6A 5A8MA 1V02E 2QHAA 1SMDA 3NUKA 1C93A 1E6XM 4UZUA 2PBGA 1H1NA 1KFWA 4QCEA 4ZE4A 3VGFA 4N0RA 2CYGA 5CJ5A 3M6DA 1ISYA 1ODZA 2E9BA 3D3AA 3PTMA 1PX3A 1TUXA 1V3MA 3VDAA 2D20A 1BAGA 2VCCA 3VD9A 2UY2A 4DWSA 4AXNA 4J3TA 5BXRA 4PRWA 3WUFA 3CHFA 4OZOA 1GQJA 3ZJ8A 3W6MA 2NSXA 1H11A 1EGZA 2OWXA 2WKLA 1W9UA 2FGLA 2ZWYA 1UH2A 5A8QA 1BFNA 2PWHA 4B15A 1E56A 1DEDA 1W3HA 1XH2A 4UQAA 1AQHA 1VJSA 1VEPA 3RCNA 1V3JA 1WCGA 4KH2A 1HJXA 1TVNA 4QLJA 3TTYA 2CETA 3L4TA 3OLEA 4XZWA 3WF3A 1MW2A 3LPOA 5BXSA 3WL1A 4GZIA 4UNIA 3AICA 4PMZA 2DQXA 3VUPA 1IZJA 1CWYA 3O6AA 4PUEA 4DWSD 2FH6A 1CXLA 1DWFM 4E8DA 2X8RA 3RPMA 4CN4A 4D6HA 1KXQA 2PWDA 3GXDA 3SUVA 4NI3A 3TP4A 4AZ6A 2XFRA 1E6PA 4AZ7A 2RGLA 3SUTA 3AS3A 3ARSA 3SCUA 2ZXBA 1EXPA 2XVPA 1O7AA 4PMOA 3VMOA 2J62A 5HDRA 1IT0A 2ESCA 4UCFA 1WDRA 1HL9A 3OGVA 1US3A 2WSKA 4W84A 1PAMA 2IXVA 2ZXDA 1FP8A 1JZ4A 3ARPA 3GH7A 4WKAA 4W5ZA 1JAKA 3VTRA 4M56A 4UTFA 2MANA 4H8UA 5AC5A 1MWOA 4QLLA 1LL6A 1WP6A 3CZGA 1KQZA 5A6MA 1FH8A 1QI3A 3BAJA 1RH9A 2X2YA 3NYDA 1A3HA 3IJ8A 2D3LA 4ZFMA 4CD5A 2CCRA 3W38A 1US2A 2WWCA 1E73M 1FOBA 4J3VA 1E4MM 3EDFA 1CYGA 4U33A 4P7LA 1PIGA 3DYPA 2VVSA 1XCWA 3AHVA 1HJWA 1W32A 2C7FA 4YN5A 4E4PA 3L2MA 3ARQA 4HTYA 3W27A 4R5EA 3NJ3A 2ZX5A 1KWKA 2FHFA 2CHNA 3N9KA 3DECA 4PMDA 3HN3A 1VFUA 1N82A 1UOKA 3GTNA 1J11A 4LQ1A 2GJPA 1V6WA 3UETA 3WNPA 1E1EA 3ALFA 4M82A 3THCA 4CCEA 4KRUA 3W82A 1BQCA 1KXHA 2BVYA 1UQZA 3W81A 2XSBA 2XIIA 3VNYA 4AZHA 4AZIA 4B9ZA 5GNXA 1H2JA 1M03A 2AAAA 3U7BA 3WDIA 4HP5A 1HP4A 1HKKA 3B9AA 2DDXA 2GUYA 1UQYA 3WDQA 3GZAA 5E70A 1B3WA 4H2CA 3VDCA 4LX4A 1XHGA 2VQUA 1BGGA 3CUJA 2ZUUA 1E15A 5LYRA 2Y2WA 5JUVA 1AQ0A 5CPSA 4XUYA 4OBRA 4BS0A 5A2BA 1MW1A 1JF5A 1CIUA 3K8LA 2BY1A 3IAQA 2Y8KA 3WMCA 3BAXA 2EPLX 3OGRA 2PC8A 1JZ2A 1BLIA 4LXFA 3VD5A 1QI5A 2G8ZA 3WFZA 4UQ9A 1MQPA 4KWUA 1UYQA 1JNDA 3IJ7A 1FFQA 3CZJA 1SR0A 1UR4A 1V6UA 1WPCA 2GK1B 2VRKA 2WVSA 3QOMA 3N11A 4M81A 5ABEA 3CUIA 4D1JA 2J7GA 2YJQA 3WEZA 2DSZA 3W24A 2O9OA 3RJYA 3GBEA 4QP0A 4DUXA 1JL8A 5A6LA 1LL4A 4W7WA 1NOFA 1J0KA 4UOZA 4H7VA 5A6BA 3I3DA 3W28A 3FHAA 4J27A 1WDQA 2WCSA 4HMEA 1E5NA 1GNXA 3GXMA 4TVDA 3SEPA 4HA4A 3WL0A 3WIJA 2D0FA 3CGTA 2A3BA 4FK9A 5D9NA 2BNJA 5ABHA 1H0GA 4UFLA 2G4FA 1QI4A 1GOWA 3PTQA 4J7RA 2E0PA 5KZ6A 1E43A 4QAWA 3AMGA 3K8KA 4JKKA 1SMAA 3T0AA 1GONA 3ZMRA 2D22A 2XIBA 2QPUA 1K9FA 2WBGA 2XVGA 3RM8A 1ITCA 5LA2A 2JF6A 1UD6A 2EO7A 4NRRA 3VIKA 3ZT7A 3B9DA 1B9ZA 1E6QM 2EQDA 4MNKA 1GORA 4QLKA 4DWSC 1E72M 5DEZA 2BFGA 4AD2A 2OSYA 5D8WA 3ZSTA 1W91A 2D0GA 2WHKA 2YL5A 3U5YA 4PMQA 4AMCA 5A6BD 4FF5A 1HXJA 1HN1A 1ZU8A 2ZUSA 4WIWA 4C7GA 1V0NA 5ABFA 2BV9A 2JALA 1ZBVA 1PX8A 5D9OA 1U30A 1OD0A 3KL3A 3SUUA 3O9NA 4DWSB 4CCCA 2VCBA 1DP0A 3GH5A 3S6TA 1VF8A 4A4AA 2W92A 5FD0A 4PMUA 1B30A 2WCGA 1K9TA 1PZ2A 5D9PA 5EMYA 1EH9A 1JXKA 4AD1A 4W7UA 1VEMA 1YHTA 3RDKA 1KWGA 2D24A 2E4TA 1V0KA 2CITA 3LPPA 3SCVA 3SCOA 4X0VA 1CLVA 1JZ3A 4AIUA 5ABGA 2WAGA 1VFOA 4TVUA 1DWAM 1NOUA 2ZX7A 3JUGA 3SCRA 4CD4A 1EA9C 4MDPA 3VDHA 2EBNA 1XV8A 2WHLA 4W88A 4AD3A 5M3WA 2VZSA 4M29A 3MV11 1PX4A 4D6JA 3AISA 3WQ5A 1LL7A 5HPCA 2ZUNA 2CERA 3EMCA 1GCYA 3VD4A 4PMVA 4JCLA 4JHZA 4AY1A 1L0PA 3ZR5A 3PZGA 2DIEA 2X05A 4W5UA 1CEOA 1GUVA 3WH6A 3QR3A 3VDBA 4PEEA 1TE1A 3MV01 3ECQA 4GQQA 2WM0A 3N12A 2E8ZA 1OINA 4M1RA 5EFDA 5CLTA 4FMVA 3ZJ6A 4S3KA 5JBEA 4UFKA 3UESA 4WK9A 3AZRA 3WH8A 2WCAA 4WJXA 3OA5A 4U31A 1E4NA 1JD9A 1UKPA 4PYSA 2WLZA 1JAEA 4B9YA 4J28A 5FOOA 2TAAA 1DWJM 2CEQA 4CD8A 1Y7VA 2DIJA 5TD4A 2YDQA 3B9EA 2CHOA 4JFUA 2X0HA 2VCAA 1HJVA 3TA9A 3FN9A 2FGZA 2WVVA 1QNRA 1JFXA 1QI2A 5AY7A 3VO0A 1EOMA 1C8QA 1HL8A 2D2OA 1GVIA 3VMPA 2UY4A 1KCLA 1XSIA 1C90A 2DPEA 5A8PA 4J3XA 4AWEA 2DSWA 1XGZA 1H3GA 3MKKA 2WC4A 5AYBA 2OYKA 4N42A 2WSPA 5IFTA 5M5DA 1J01A 5JBFA 5I0DA 3N15A 5A6AA 2EJ1A 3L4ZA 1JYVA 4C7DA 1UHVA 1EDQA 3AXIA 4RE2A 1MXDA 1W1TA 4PCTA 3N04A 3GNRA 2W61A 1CTNA 4Z2KA 5A6JA 3ZT6A 3GH4A 5IXEA 2DT2A 3QHOA 4PMYA 2XG9A 4M8UA 1FA2A 3OLIA 2WB5A 2ZX6A 5CZKA 2YA1A 2VVNA 3POCA 5A8OA 3WDJA 2WANA 3POHA 3RIKA 1G01A 3CTTA 2ZUMA 4JAWA 3WY1A 3WD3A 3WDHA 3CMJA 5A8NA 1UD8A 1GQLA 1OGSA 1QI0A 4U3AA 1UR8A 2OYMA 1CLXA 1W1YA 4QCFA 1D7FA 1D3CA 1ZBKA 1OBAA 5BXTA 1UH3A 2WHJA 3SURA 1WZAA 4DUWA 4PSRA 2GDUA 1JDDA 1ISZA 3CZKA 1KR1A 3UEQA 4CVWA 3MANA 1J0ZA 3PZOA 1RD6A 4HZ6A 3ARRA 3VD7A 2BVTA 2GJXA 5LA1A 3SCQA 2V3EA 1WDSA 3L4VA 1V02A 2QMKA 1G9HA 1GOMA 1BVZA 1KGWA 1OD8A 1UKTA 3MSDA 1JYNA 1NARA 4AZBA 5A94A 5JIPA 1JYWA 1DTUA 3AS0A 2HVMA 3PZVA 3GNPA 3VIFA 4R27A 3WH5A 2WPGA 3KEHA 1LWJA 4CD7A 1MXGA 3MUY1 3K4AA 4LPCA 3BC9A 4OBSA 1W9VA 4D6IA 4UZSA 4BCEA 4H8HA 4U3CA 4GO9A 2WHMA 1V3IA 4P7QA 5DT7A 5BXPA 2Y5EA 5M17A 4HOZA 2O9TA 2YL6A 1KR0A 4AIOA 2VL4A 2G3JA 3VIGA 5BRPA 3WSUA 5AC4A 1K9EA 3OB8A 2D1ZA 3MO4A 4GZJA 1FHDA 1R8LA 4KMQA 4GZEA 2PWEA 3MS8A 4V2XA 4ZXOA 1CNVA 5A6SA 3DHUA 2W62A 1FH7A 4CUCA 4HU8A 2AMGA 1BTCA 3AXHA 1J18A 1F4HA 2ZE0A 4MNJA 4UR9A 3W53A 5ABFB 1UWIA 1OCQA 4WF7A 3WF4A 1GQIA 2E40A 1ZL1A 1B3ZA 2YIHA 1RP8A 1R7OA 2VRJA 3G6LA 1H4PA 3UR7A 2A3EA 3VM7A 1E0VA 4AD0A 2E9LA 1TR1A 1GOIA 2CPUA 1BHGA 2BY2A 1E9LA 1QNSA 3L4XA 2ZUWA 3AROA 1B2YA 2NW0A 1EIBA 1Q6DA 1C7SA 1HJUA 3ZIZA 2YA2A 4W89A 3WH9A 3BAYA 3A3HA 1VBRA 5A2CA 1UR9A 1B3XA 3WBEA 2VMFA 1JI1A 3WD1A 2V5CA 2WWDA 1MQQA 3FAXA 3VKKA 3TOPA 1OGBA 5A6KA 4CGTA 1WO2A 1M04A 3OG2A 1VFFA 3UG5A 1UH4A 1E4IA 1E4LA 1EQPA 2EPOA 2XJ7A 1NP0A 4P8WA 1E6NA 3PN8A 1JZ8A 2PWFA 4TTUA 2GFTA 3FHQA 4P7RA 3N18A 3BLKA 5HNNA 1QNOA 5HOSA 2ZXQA 3AXXA 5E9AA 2DSKA 1E6SM 3WNLA 4FLQA 3RMEA 3WNOA 4W93A 4A3HA 2XGIA 2J7HA 4HU0A 3FXYA 2OSWA 3VVGA 3CBWA 4BA0A 3I3BA 1XSJA 2J77A 3TTOA 4ACZA 1VJZA 5CPQA 4MJ2A 3L4WA 1QOXA 3T08A 1X6LA 2DEPA 2JF7A 4K68A 3W29A 4AW7A 3WENA 4MB4A 1UKSA 4UQEA 4L4PA 1NWTA 1UR1A 3VX0A 3VGHA 2W66A 2PI6A 4UQDA 3AOFA 3PTKA 1ISWA 1W9PA 1O6IA 2YDRA 5E6ZA 1VENA 7A3HA 4BZYA 3TTSA 2WK2A 1Z32X 3RO8A 2BS9A 2F2HA 2VQTA 4JKMA 4JFWA 3BSGA 2WVVB 7CGTA 1IV8A 1E1FA 1UUQA 4JL2A 4Z2JA 5CGTA 1H0IA 1UWUA 3HU7A 2J75A 5A3HA 5M03A 2W4XA 1BYAA 1GW1A 2WMHA 1UA7A 2UWFA 3U57A 1EDGA 4W85A 1J12A 3A4AA 1ZS2A 2VJXA 2CIPA 2CNCA 1J0HA 2FHCA 4XB3A 3QOKA 2V38A 3K8MA 4Z2LA 3KZSA 2WYSA 3CO4A 4CN1A 4BQ3A 1UD4A 3AHYA 4L4OA 2CESA 4TVCA 5I24A 1WZKA 3N1AA 4UFIA 1TCMA 4KGLA 4PBGA 3ARVA 3U5UA 1PEZA 4XV0A 1G5AA 1GOKA 2YBTA 1CXKA 3FAWA 4DUVA 4AEEA 2YOCA 4IUGA 2VX6A 2XFYA 3VGBA 2QLYA 1QHOA 2CKRA 4XZBA 5DT5A 3AQUA 3RILA 2YBUA 1U2YA 1TG7A 4Q7NA 3VMNA 2GDVA 1NWUA 4JZ5A 4OKDA 4CN6A 3KWXA 4W8AA 1HKMA 3WBAA 4V28A 1MFUA 5AYIA 2J79A 3D5HA 2V3FA 4WSKA 3II1A 3AJ7A 3W4RA 4PSPA 3S2CA 1P6WA 1VRXA 4OOUA 1OWQA 1FHLA 4TUFA 1MYRA 4B3KA 3IJ9A 2GJXB 1HJSA 1OSEA 3I3EA 4EAMA 3LMYA 4HA3A 3VGGA 3WNMA 3N17A 4ZEPA 3KE0A 1V6XA 4UOQA 1UWRA 2HISA 1ISVA 4D6CA 3VILA 3K4DA 1VAHA 1WNOA 3THDA 1JXJA 2AOSA 2PF0A 1LG2A 4CVUA 1MW3A 3F5JA 3BAWA 4JHOA 1KCKA 2V5DA 1XD1A 1QW8A 1CECA 4AC1X 1QBBA 2O92A 3VIIA 4X9YA 3VIJA 2BVDA 2CXGA 1LJYA 2ZICA 2OWCA 3PZ9A 3ZT5A 1GHRA 1QHPA 2YL9A 3MMWA 1S46A 5CGMA 3WD0A 3PBGA 2DSUA 1TZ7A 1H09A 5KEZA 1DWHM 2DGAA 2XVKA 3MMUA 4AD5A 1BG9A 1LLOA 2WW5A 2DH3A 2VX5A 1V3HA 3PZQA 2ZIDA 4HPGA 3VIOA 3SCSA 2ZXAA 1PIFA 2YLAA 1DWGM 2EPNA 4V27A 5FKYA 4B16A 3OGSA 3ZOAA 1K6AA 2PBOA 5I6SA 3OIHA 1M7XA 3F5LA 1FFRA 3SUWA 4OOZA 1BSIA 3VNZA 4EK7A 4LYRA 1CXFA 4NSBA 5HBFA 4DM2A 3AMCA 2IXUA 1OM0A 1JDCA 1TVPA 1E6ZA 1C8XA 2Y4SA 4QFUA 4AD4A 1CGVA 4Z2IA 5I77A 3M07A 3BCFA 1KBBA 4U5KA 2PB1A 3NSNA 1NOWA 2WMJA 1QBAA 4IISA 3O2LA 3IANA 4PMNA 3IK2A 2PWGA 3K46A 4RE3A 2G3MA 2ZX8A 3BSHA 4ACYA 3SCPA 4Y7EA 5GQBA 3WDRA 1OT1A 2WC7A 1PPIA 3BMVA 1UWSA 3UR8A 4MB1A 1XCXA 3M7SA 4GPNA 1ZJBA 5D9MA 4D6GA 2WZIA 5JIWA 2BY3A 1W3JA 1B90A 3F5KA 1ZBCA 1J0IA 2W91A 1QPKA 1EOKA 4BQ4A 3FY1A 3BMWA 1E5JA 4LYPA 4JCMA 3L2LA 1E55A 4U2YA 1A47A 2WC3A 5C8BB 3PZUA 1GOQA 1ISXA 5BYWA 4P8UA 1QNQA 5I5RA 3WQ8A 1BYBA 4ACZB 6A3HA 5C70A 2J47A 2CBIA 3GBDA 1BGAA 3G6MA 1R86A 1UWTA 4X0NA 1EO7A 2O9RA 3AIQA 3AFBA 4GI8A 2CBUA 4HA1A 1IZKA 1C91A 5BRQA 3NIYA 3WQ4A 1HNYA 1C92A 3WNNA 1W3LA 1W3KA 5GNZA 2J7EA 2JE8A 3ARXA 6TAAA 3W25A 4D1IA 4MNMA 4J3UA 4F8XA 2GJRA 4KGJA 3VU2A 4Z2HA 1W9DM 1Q6GA 3ZJKA 2J8GA 4YHEA 3GDBA 3EDJA 1OIFA 5DFAA 4OUEA 4W7VA 3UG4A 2J7BA 1M53A 2F8QA 3GXFA 4WLCA 4AZGA 1V08A 5JBDA 3VM5A 1V0MA 2J7DA 4JL1A 1BPLB 1TMQA 3CHCA 2W63A 5I23A 2WMIA 1C7TA 1HKJA 2J7CA 1CXIA 3N13A 3W0KA 1FP9A 1EQCA 4UFJA 3AMLA 2QPSA 1CXEA 2WZEA 4GI6A 1KGXA 2XSAA 3T2QA 1VFMA 2FH8A 1BYCA 4XX6A 1NWSA 1L8NA 1ODUA 3CZEA 2ZOXA 1UD3A 5LA0A 3EMZA 1E6RA 1CGYA 1R85A 3AYSA 3AIUA 4HOXA 3LPFA 3CPUA 1JZ5A 2DT3A 5CQ1A 3WNKA 4D72A 3EMQA 3E1F1 1I1XA 2E8YA 4AZCA 3ARTA 2NT0A 3T09A 1CZ1A 3DYMA 3W6LA 3EYPA 3ZSSA 2XUCA 1E40A 1WDPA 1WAWA 3BXWA 2FHBA 3UG3A 4J3SA 3EBVA 5F7UA 3LPGA 5I78A 1JNEA 3AHXA 1VBUA 3SCTA 2C0HA 1KGUA 4JFSA 1PBGA 1XYZA 4S3JA 1QHZA 3BLPX 3AZTA 5FCZA 1J10A 4CU6A 4H8VA 3PZTA 3WKZA 1DWIM 3BGAA 1JFHA 1WZMA 2EPKX 3WMBA 1Q6FA 4F9DA 4GKLA 2JEPA 1NM9A 4CU8A 1M01A 2Y8VA 4ATWA 5DMYA 2DT1A 6CGTA 1C8YA 3IAPA 3ZJ7A 1W1VA 3FW6A 1U33A 3BAKA 3F4VA 1HVQA 3VD3A 1DHKA 2WVTA 1ITXA 3CUFA 1TA3A 2E3ZA 3WEMA 2JEQA 5BWFA 4GINA 3VGEA 1CPUA 4AEFA 2VC9A 4GQRA 3AS2A 1J0JA 3WDPP 8A3HA 4F9JA 3NDYA 2GSJA 4UQCA 2VR4A 4JFVA 3A47A 1JDAA 3WN6A 4PMXA 3B8SA 5D8ZA 1G94A 1K9DA 4EE9A 1HKIA 3PZNA 1X6NA 2Q8XA 3T0DA 1Q6EA 3AZSA 5EBAA 5CPTA 1Q4NX 3WUBA 2Z1SA 3KL0A 2A3AA 5E0CA 4ATDA 3SCNA 1JYXA 1HX0A 2YDSA 3AIWA 4E8CA 4AISA 2Z1KA 2O9PA 3OZPA 2QF8A 4MAVA 4TOQA 5DO8A 1I1WA 3VIPA 1J0YA 2YLLA 2EPMX 3UERA 3FNDA 4UQBA 2VNCA 2BXZA 3ZM8A 1CGXA 2WMGA 3T2OA 2VZVA 3WF1A 3VPLA 1J9YA 1VB9A 1B1YA 5IDIA 3WD2A 1UD5A 5DF0A 3J7HA 4MDOA 4H04A 3NSXA 1W2VA 1UWQA 2J8FA 2V3GA 4PTXA 2BXYA 2A3HA 3DHPA 2DT0A 3AMKA 1E3ZA 5CSUA 4YPJA 5C71A 2WLYA 1E3XA 1UR0A 1GZJA 4IPNB 1R87A 5HPOA 2XM2A 2RGMA 4RE4A 1JI2A 4FLOA 1HIZA 1PJ9A 1JD7A 2YL8A 1V3LA 3QGVA 4E2OA 4PUDA 2WBKA 1EO5A 2XTKA 3ARWA 1LF1A 2XVLA 4IPLA 3AHZA 3PHAA 2DSVA 1G0CA 4PTWA 1WB0A 3M46A 2BHUA 4P7OA 4WKFA 5BCAA 1I75A 5E0FA 5EB8A 3AMDA 4NRSA 1CGUA 1VIWA 5GNYA 9CGTA 4JFTA 2F61A 2BY0A 2G3NA 1X1NA 3AI0A 4DM1A 3OZOA 3ARZA 3EDKA 1W9BM 3GXIA 2UY3A 4GIAA 1W2PA 1WZLA 1CXHA 5CLWA 3CLWA 3W26A 3AIRA 5EFFA 1H41A 4AYSA 2ZWZA 1BF2A 1WKYA 4MB5A 4B3LA 2OYLA 1LG1A 3WF0A 4EANA 1XD0A 2JIWA 1RPKA 3RM4A 2XHYA 2VT0A 5CXPA 3NDZA 3BH4A 2VZTA 3VOCA 3CHDA 2G3IA 1B0IA 3OLDA 5CG0A 4UOJA 2OWWA 2VX4A 3AIEA 3CHEA 3QHMA 3WF2A 4D6FA 1VEOA 2WKGA 4IM4A 3SCWA 2XGBA 1MW0A 1UZ1A 2W5FA 4P7NA 4TXEA 3TTQA 4GI9A 2X09A 1XSKA 2Y24A 2YA0A 2WMIB 3CH9A 1OB0A 2OSXA 2VI0A 4ZE5A 3BAIA 4OJYA 3AIBA 4HMCA 2CKSA 3OBAA 3TONA 1GHSA 1E70M 1GJUA 2VTFA 4W86A 1V6YA 4JKLA 4URIA 1UR2A 2VR5A 3SIMA 1EDTA 3DC0A 1JG9A 3MUAA 3CUGA 1CENA 2C8NA 1H49A 3UCQA 4W8LA 3ALGA 1ECEA 3MUIA 3GM8A 4P8XA 5A2AA 1GVYA 4TX8A 4HPHA 4CCDA 4D71A 1WE5A 1E0XA 2J74A 1GOOA 4AZCB 2B31A 4MPKA 2VZUA 4MAZA 1V3KA 1NP2A 1CDGA 4AIEA 5BROA 4GXPA 1JGIA 1EHAA 1HF6A 3WUGA 4PCSA 3NSMA 1ESWA 1OIMA 5I79A 2JFEX 1LWHA 4M24A 1KB3A 2ZUVA 2XWEA 1KBKA 1H5VA 5GPRA 1Q6CA 2CBJA 3CUHA 4D6DA 4UFHA 3APGA 3WH7A 4YHGA 1XH0A 2JIEA 1JIBA 2CBVA 4BQ5A 5A95A 1C3FA 4WSJA 3ZQ9A 3VX1A 4EKJA 4HMDA 4PMRA 1JF6A 5E6YA 2V3DA 3WFLA 2E9MA 1D2KA 4FLRA 1QVBA 5I3DA 3A4XA 1BVNP 5A69A 4PTMA 2BHYA 1SYTA 2VOTA 1V03A 1UG6A 2J25A 3KL5A 1V6VA 1YQ2A 5I2UA 4NZCA 8CGTA 3MMDA 3VIMA 5E09A 2G41A 2IUZA 1TA3B 3ARYA 3W37A 4ML4A 4Q22A 1QNPA 5FL1A 4TTGA 2VUYA 4FLSA 4H41A 4KRTA 1G1YA 2XVNA 1UZ4A 1PZ3A 4J3WA 1HT6A 3ZR6A 2XWDA 1HJQA 2GVYA 1GPFA 4U5IA 5ECUA 2ZUTA 3ZO9A 3A4WA 4U2ZA 1XYFA 1KXTA 2NT1A 4BQ2A 1E0WA 3CZ8A 1EHNA 1MQRA 1W1PA 4PTVA 3EDEA 2X1IA 1KQYA 3ARUA 3WQWA 1JZ6A 4C7FA 3WQ6A 3WELA 5CSYA 2VX7A 3AHTA 3T0BA 1V0LA 7TAAA 1R7AA 3MSGA 4CKQA 3EDDA 5IFPA 3AIVA 4JIEA 2J78A 1ZJAA 2FDMA 1JZ7A 1AQMA 3AS1A 3CMGA 3HMCA 1UKQA 4AZ5A 4MJ4A 4HOWA 3CIVA 1MFVA 3T2PA 1NH6A 4NF7A 2VZOA 3U7VA 3WMSA 1NWRA 3VGDA 5A1AA 4A3YA 2XYLA 2WVUA 3GYCA 1UD2A 2J4GA 1B31A 2A3CA 2WXDM 1GJWA 1QW9A 1CGWA 4PN2A 1UA3A 2EEXA 2XFFA 3PZIA 1GQKA 4CD6A 1AMYA 5D4YA 1E71M 4OIFA 3MU7A 2XPKA 3WD4A 1F4AA 3L4UA 4GO8A 4W8BA 4D6EA 2WNWA 1KXVA 5FIPA 3QHNA 5IHSA 1UKOA 2ZX9A 4MNLA 4W87A 1XH1A 3K1DA 3WUEA 4F66A 4HZ8A 4UFMA 2WZHA 4Z2GA 3WEOA 2DH2A 2VRQA 4P8VA 2GK1A 3A6OA 2QMJA 1CGTA 4MB3A 1HP5A 4HZ7A 2D23A 2WMKA 2D0HA 2YKKA 1FH9A 3SUSA 4MADA 4ZXLA 2X0YA 1HVXA 3BCDA 2VURA 3NCOA 4MTVA 3RJXA 2W67A 1TFVA 3MUZ1 4ATLA 2BHZA 3GNOA 2J7FA 3RM9A 4CU7A
chains in the Genus database with same CATH superfamily
2TRSA 4ZSTA 4Y9NA 4NASA 1VD6A 1CBGA 2QAFA 2KZHA 1ENUA 5IHRA 4HGXA 2BVWA 3FVMA 3VIHA 1OT2A 4LYQA 2RDXA 2HBVA 2IW0A 1BG4A 2HBXA 4TX6A 3C2EA 2DP3A 3CZLA 1GWJA 4GXWA 5HXMA 4UR7A 1FWNA 2O56A 2D3NA 2NUWA 1KBLA 1WBJA 5AC7A 2PLJA 3EB3A 3TXZA 3S6DA 4AX6A 2PGEA 3BLIA 1RP9A 2WSQA 1WKEA 2Q02A 2QHAA 3CWOX 3NUKA 3BLFA 3R43A 4RW5A 2XGZA 2CYGA 1Q6QA 2ZRYA 1ISYA 4FXJA 4X63A 3SRDA 4JTIA 1BQGA 3C8NA 2A2IA 3VKAA 2VCCA 3RPDA 2UY2A 1I2OA 4K38A 1AMKA 3M64A 3PG9A 4ECLA 1XGDA 1LWIA 4HK5A 1FDZA 3T40A 3EKLA 3LBOA 3CHFA 4XVDA 4XQ6A 2VDGA 3C2OA 2WNQA 1Z42A 1H11A 1EGZA 2WKLA 2XFWA 3KHJA 4CQAA 2VFIA 3A9BA 2ZWYA 2WNNA 4N2YA 2PWHA 4UTTC 1TE6A 5EYWA 1K7FA 4I6VA 4AHQA 1TPEA 2Z2BA 5HMSA 3M4HA 3TKFA 3LLFA 3RCNA 5H2ZA 1HJXA 1OYBA 3TTYA 1IHIA 5G2HA 2ZA1A 3L4TA 3WF3A 1L8PA 5BXSA 3D46A 4PMZA 1LUCA 2FH6A 1CXLA 4I7UA 3Q58A 1LZOA 4K3ZA 3LCIA 2WJDA 4E8DA 1AQFA 3KX6A 2X8RA 3DI0A 1V5XA 4CN4A 1IZCA 2HRWA 4AB4A 4MM1A 2J9XA 2XFRA 1E6PA 2RGLA 4W9TA 4UTUA 1WOAA 4DBDA 4RPPA 3SUTA 4DBEA 3AS3A 3LGDA 2ZXBA 4GG9A 2XVPA 4M6UA 4PMOA 2J9YA 4Q6JA 1I0BA 3VMOA 1GTEA 1JDEA 1OFOA 4UCFA 1NSJA 1CLKA 1US3A 3NNTA 2E6AA 4GX8A 2H90A 1PAMA 4YYCA 2ZXDA 1NDZA 3IJDA 1TPH1 3GUWA 1PHWA 2R9RA 4A8LA 3IUHA 1YXYA 4QXIA 4DB7A 4I8DA 6PTDA 1P5BA 3BOFA 3UZXA 3WYZA 2VEIA 2XISA 4LTSA 5AC5A 3CZGA 3ZWSA 4ADUA 3BAJA 1RH9A 4P61A 1A3HA 3IJ8A 1Q3NA 3BICA 4CD5A 4Y8EA 4KQNA 3LM7A 1US2A 3W7EA 2Q71A 2DZPA 3R79A 4PBFA 4J3VA 1E4MM 3TUUA 2E5CA 3H22A 4MZ1A 1PVNA 1PIGA 4NX0A 1HJWA 2HZGA 2C7FA 2XZ7A 4C5YA 3ARQA 3JZEA 1FWJC 4LC8A 3RNDA 3W27A 3ANYA 2GQ8A 3H6OA 4R5EA 3NJ3A 2FHFA 3EXSA 5H8MA 6ENLA 2QCCA 4C1LA 4UMBA 1VFUA 3WLTA 3E9AA 3SJNA 2GJPA 3DZ1A 3JZUA 4LFYA 3W71A 3LNPA 3ALFA 1Q7ZA 1X6UA 3SIZA 5FF7A 1U83A 2XIIA 4H00A 1XYCA 3F2DA 2AAAA 4JN6A 3U7BA 1HP4A 1HKKA 3IV3A 1ADDA 4HHHA 3C61A 2ZUUA 1AQ0A 4OBRA 2OZ3A 3EOSA 5T9CE 3IAQA 3UZYA 1RA5A 3BAXA 3MYOA 3I68A 2EPLX 2XZ9A 1OX5A 2PC8A 2CLIA 1BLIA 4O14A 2OQLA 5CAHA 3CZJA 5HANA 1V6UA 4C1KA 4NJJA 3N11A 4M81A 3IRSA 3TK7A 3E38A 1TMLA 1EWEA 4GUFA 4PCFA 2QDGA 5C54A 4DNMA 3FYPA 4CEXC 4QP0A 4DUXA 3PS7A 2E1WA 4JEQA 1JL8A 1LQ2A 4S23A 5A6LA 3CEUA 2PDQA 3WLLA 3I3DA 3W28A 5HQLA 4HMEA 3N6QA 1X96A 4TVDA 1EX5A 4C6LA 3CAVA 1KFEA 2FPVA 3CGTA 5ABHA 4Z42C 2HNEA 2I1OA 4J7RA 2E0PA 4LCSA 4QAWA 2D22A 2XIBA 2QPUA 1F6KA 1UD6A 2NV2A 1E6QM 1PKMA 1TZZA 4LAKA 3SQSA 1ZNNA 1E72M 3PPFA 1W1IE 4E4FA 1EEXA 3UWQA 1ZU8A 4WIWA 1LM1A 3KW3A 4H9UA 1AODA 1IXPA 1H1YA 3SUUA 3O9NA 4TMCA 2D69A 1I8JA 3GH5A 3UP8A 4DZAA 4O1AA 4C6CA 1BTMA 2ZDRA 1K9TA 1L6YA 1EH9A 1JXKA 5JVLA 4AD1A 3AC0A 1VEMA 3GXTA 3NPVA 2D24A 2E4TA 6XIAA 1V0KA 2CITA 4HNUA 3GG0A 5DELA 4X0VA 1CLVA 1JZ3A 3P67A 5BMWA 1DWAM 1NOUA 3DFTA 1EA9C 1SZEA 3VDHA 2EBNA 1RBOB 1EJTC 5B80A 2CZVA 1PX4A 2FJKA 1VRDA 3JRKA 2Y61A 5B7ZA 1YMYA 3KHDA 3OPSA 2INEA 3DESA 4XD3A 3EKZA 4LAUA 3SSZA 3ITVA 3ZR5A 5BRBA 4KWVA 1A0EA 3PZGA 2DIEA 1ZAHA 2X05A 1R3WA 3M0VA 5HMEA 2A4AA 3NL2A 1XIDA 3VDBA 5HQMA 3U2CA 3QGAC 1V93A 3M5VA 1LLZA 1XISA 4GY1A 1KO0A 1OK6A 2WM0A 3N12A 2CZ5A 1QOPA 1CB7B 3CPGA 3UFYA 4LRSA 3ZZ1A 3UT0A 3UESA 3MW7A 3WH8A 2OQHA 1CCWB 4MLJA 4V1XA 4N9DA 4REQA 1ICQA 3QZEA 5BWAA 1E4NA 2VM8A 4PYSA 2WLZA 3CL8A 4LBSA 4B9YA 4J28A 4IXXA 3M1ZA 1S38A 3IIXA 2RJGA 1Y7VA 5TD4A 2YDQA 3WQFA 4L65A 5PTDA 5DXXA 2CHOA 1GG0A 5H1WA 1FWDC 2FGZA 2WVVA 1QNRA 4XKYB 3H2OA 1C8QA 2WPBA 3NEHA 3E96A 3W2NA 1C90A 2OEJA 5C9RA 3R8RA 3L67A 3MKKA 1SJBA 4LB3A 3W7RA 1Q6OA 5A6TC 5IFTA 3ZLHA 1ONWA 4J9JA 2J6VA 3N15A 2H9AB 2EJ1A 1VPXA 1Z9AA 1EDQA 1Q13A 3TMQA 2QUNA 4K2SA 4PCTA 3W7MA 3GIYA 4Z2KA 3EWBX 4GCXA 3GH4A 5IXEA 4E2VA 3C2VA 5FF0A 3OLIA 2WB5A 5CZKA 2YA1A 1OFRA 5A8OA 4GI4A 2Z1BA 2J8TA 3NQEA 1VPQA 1S2UA 3POHA 4DUOA 2ZUMA 3WY1A 3UWZA 3WDHA 2PCEA 4KWSA 1QI0A 1UR8A 3R13A 5CC3A 1CLXA 3IIVA 3VNKA 5G5IA 3GTHA 4DI9A 3SFKA 2ABAA 3R12A 4DUWA 1ISZA 1KR1A 2QCLA 4A6GA 3UEQA 1QJWA 1J0ZA 4DJFA 4GIYA 1JPDX 1XDMA 3H2NA 3KTCA 3W23A 4QQUA 3CHVA 2BVTA 2HE8A 2I57A 3RX4A 2QDDA 5FACA 1KGWA 1POJA 2G50A 4M51A 4XWUA 1UKTA 4AZBA 3T05A 2A7PA 3VIFA 1O1ZA 4R27A 3HFTA 4Q4QA 4CD7A 2W27A 4LPCA 1ECQA 5C2XA 1TWZA 3QFWA 1MDLA 4BF5A 2PE4A 1PO9A 5REQB 2YFNA 3S2JA 3FA5A 1XM3A 5DT7A 3LSCA 5BXPA 1AFSA 4DJFD 1U5JA 1YDVA 4PUKA 4HOZA 4MFDA 1QW7A 2YL6A 1KR0A 3TYZA 1OVDA 4AYGA 1Z7AA 3WSUA 1F3EA 4RK8A 3U2EA 3B03A 3OB8A 2D1ZA 3T55A 1I2RA 1FHDA 4KMQA 1QUMA 4GZEA 2PWEA 4V2XA 3DHUA 2W62A 1H7XA 2HCVA 1O1HA 2AMGA 1ML1A 1AD1A 1UWIA 4WF7A 3WF4A 7PTDA 1GQIA 2XN0A 2E40A 5LGXA 2VD8A 4ML9A 1ZL1A 1B3ZA 1K8YA 1OCBA 2HK1A 2YIHA 3TSBA 1ADOA 3EOEA 2A3EA 5HJLA 3VM7A 2FJUB 1AL8A 2E9LA 1TR1A 2CPUA 1R2SA 3L7RA 4QQ3A 3NL5A 4AY7A 1TRIA 4MIMA 2EG6A 3MWCA 1B2YA 1W3NA 4H01A 1HJUA 4WY0F 3W7PA 3O0KA 3O6YX 3BAYA 3F4CA 3MY9A 3QC3A 4IT1A 4GBDA 1BXCA 1Y5XA 1B3XA 3WBEA 3KVLA 4RNIA 4GWEA 3DUGA 4Y6GA 1FWGC 3BCJA 1ADSA 3LN3A 1KM3A 3S5NA 1M04A 3FDGA 1A49A 3BL3A 1E4LA 1X8CA 3RRAA 1NP0A 4H9ZA 4P8WA 3N29A 1FX6A 1E6NA 5J5RA 5JH1A 4IQDA 2FZDA 3TQPA 3PAOA 1GEHA 4UTKA 4FLQA 2VYOA 3GVGA 1J79A 5FJUA 3FXYA 3VVGA 4QTGA 4BA0A 3I3BA 2J77A 4PUNA 4ACZA 1VJZA 1O5KA 4MJ2A 2DEPA 2JF7A 3GS6A 5F2MA 4E6MA 2QCEA 1P0BA 4UQEA 3G2GA 2O4MA 3DFPA 1C29A 1EC7A 3VX0A 2E67A 1DJWA 2W66A 4Q8PA 3AOFA 3PTKA 2QUMA 2QJGA 1EB3A 1O6IA 2BX7A 4G7FA 4RE0A 5E6ZA 4MWAC 2ISDA 1Z32X 1B3OA 3B4UA 3G8RA 5F2LA 4NUWA 2VQTA 4UCGA 4GYPC 1IV8A 4NYUA 1CW2A 4YTSA 4WY0B 2HROA 1UWUA 2DZAA 1EZ2A 3BJTA 3ONBA 1S5VA 3W7OA 1YPIA 1LT8A 4EACA 1GW1A 1UA7A 3ONCA 1S1RA 1FCQA 1A3WA 2CNCA 1PCKA 4J3ZA 4XB3A 4HIBA 3LOTA 3QOKA 2VKZG 2ANUA 4MY8A 2F6KA 2GYIA 3BARA 4Q6XA 4L4OA 2CESA 4TVCA 1MUMA 3K2GA 1TCMA 2P8BA 4EWJA 4KGLA 4PBGA 3VABA 1PEZA 4YMZA 2YBTA 1CXKA 3H8AA 1THFD 2VX6A 3ABOA 4LAZA 2YCIX 4KT2A 4I9TA 3HPFA 2GOKA 4XZBA 2W79A 3BLOA 1U2YA 3T8QA 3P7YA 3CASA 4OKDA 4KETA 3PJXA 2E6DA 4W8AA 2PUZA 1RVGA 2C79A 2FYMA 1DXIA 4IG2B 4GOAA 3TYDA 2J79A 3D5HA 3SW6A 2V3FA 1YNPA 4FXRA 3S2CA 1OWQA 2PTWA 2PMQA 3A9IA 1LBLA 4EX4A 3QY7A 2POZA 3QMSA 3IJ9A 3QW3A 1JEZA 3H2FA 1OSEA 1ONXA 5LIXX 1BSLA 8TIMA 3LMYA 1UPPA 1P48A 3DU0A 4HA3A 1FWAC 3H7UA 3N17A 4ZEPA 2OEMA 3ICJA 4H9TA 1OFDA 3TVAA 1EJSC 2VFGA 1P7TB 5AZ1A 3VILA 1EIXA 2ATMA 4GNVA 4CEUC 1FWCC 1JXJA 2OOFA 2PF0A 3BSMA 3A3WA 3MT1A 3M5ZA 5I3GA 3EX2A 3FVDA 1KCKA 2V5DA 4UIOA 3ANUA 3P74A 5AVHA 2BVDA 2CXGA 2OWCA 1KLYA 3AAMA 3MMWA 3WD0A 4EF9A 4Z0JA 2DSUA 5KEZA 2PDYA 1P0EA 2DGAA 3KOXA 3W7NA 2XVKA 4F4RA 5IBXC 3MMUA 4UTTA 4XIAA 4F0MA 1R38A 2OX1A 4GY0A 2PSNA 1PTDA 4F2TA 1PIFA 3DG7A 4JR5A 4B5XA 2R1NA 3OIHA 1FFRA 3BOLA 4WDUA 3R11A 4H6QA 2A85A 5I3HA 1ONEA 1BSIA 1YDNA 2PTZA 1SW3A 2OTDA 3AMCA 4DM2A 4Y8FA 3EA3A 4ZTYA 3U3HA 2IXUA 3GVRA 3S46A 4Z2IA 2Y88A 3PTDA 1KBBA 4YTRA 2QGHA 3LQLA 1R9YA 1RQBA 2GWNA 4O12A 2WMJA 3GU9A 1LOLA 4E38A 1IEVA 3KBNA 1TB3A 4GD0A 4ZQPA 4PMNA 3IK2A 4B2DA 4DYJA 2Z2UA 1QU4A 4G6CA 4OVXA 3UXDA 1JPIA 1UWSA 4MB1A 1XCXA 1P0KA 1SW7A 5JIWA 5KTLA 1BVWA 1QATA 4LBRA 1B90A 1J93A 1J0IA 3RLGA 3F4DA 5AECA 1R9ZA 4O52A 2ZQ0A 3BMWA 1E5JA 1UP0A 5FJPA 4JCMA 5RUBA 2Z0IA 1SR9A 1GOQA 4PODA 1F73A 3PUGA 4G7EB 4X60A 4DBSA 3T4WA 3WQ8A 3L65A 6A3HA 1L6SA 5K3VA 4B2DD 5C70A 3LHZA 3QBUA 1BGAA 3EKGA 3G6MA 1UWTA 3UGVA 2O9RA 2E7FA 2FB3A 2CBUA 3S1VA 3R5EA 3K5XA 4H6KA 4XKMA 3GNXA 3W1TA 1GG1A 5FEWA 1P6BA 3UPWA 3BZGA 1W3LA 5GNZA 3O6CA 1IXNA 3ARXA 3DC8A 3GHRA 3MCOA 4L9XA 3VU2A 3D6NA 3ZJKA 2QJMA 4O17A 3LMZA 2V68A 2E1DA 2ZVRA 2VC6A 1TO3A 5DMNA 1TELA 2FGBA 4IGMA 3UG4A 4JBRA 4Q8UA 2J7BA 2QDHA 1M53A 4WLCA 1TREA 5FF2A 4QBXA 1V0MA 1YXDA 4DQWA 2FZNA 1TMQA 4PGLA 3BW3A 3TEVA 2WMIA 1XLDA 1HKJA 4FP1A 3MP3A 4JYDA 4Z1BA 5GJMA 4UFJA 2YW4A 4GI6A 2XSAA 4H9YA 2PDJA 1ELSA 1W8SA 2UBPC 1KFKA 4JTUA 5HINA 1ME8A 1CGYA 2R8WA 3AIUA 2NQ5A 4IJBA 4IJRA 4D8ZA 3R94A 2E8YA 5KZMA 2QIIA 5I03A 3NQBA 2NT0A 3T09A 3DYMA 1JR1A 3W6LA 3EYPA 5J5DA 3ZSSA 1W1A1 1E40A 1OYAA 4L4LA 1GYMA 1HZYA 1TJPA 4RCXA 2FHBA 3KZPA 4YTQA 3EBVA 3Q65A 1VJIA 1TX0A 5BU9A 3TSMA 1A5UA 3FJ6A 3AHXA 3WQDA 4JFSA 1XYZA 4S3JA 4GNKB 5I02A 3MTWA 2L5HA 3V0TA 4EAYA 5FCZA 4CU6A 3VOIA 4H8VA 4E3TA 2E25A 2RUSA 3HPAA 5BOFA 1GVRA 4ERGA 3V1HA 3CMFA 3WLOA 3WMBA 3OVPA 1IWPA 4QE5A 4EXQA 3ABXA 4IFOA 1F3TA 4G2DA 4GKLA 2JEPA 3OJGA 2HVOA 3MJYA 1XFCA 2OGYA 1YNQA 2G0WA 3W75A 3LS9A 1M01A 1Z44A 2PRMA 4O54A 3GDRA 2G96A 3IAPA 1VCFA 1W1VA 3BAKA 3TN4A 3Q37A 1DHKA 4L9ZA 3S5ZA 3PJUA 2A6LA 3MI3A 1RCXB 3AXKA 2HSAA 3WEMA 2JEQA 5BWFA 3C3UA 3HQOA 4GINA 1ZALA 4AEFA 2V30A 4RNJA 3W76A 3AS2A 1TIMA 4WD0A 5EMMA 3HV8A 1PKLA 2VR4A 4AWSA 4JFVA 4LALA 3S1UA 3B8SA 1ZENA 5D8ZA 1UW9A 1G94A 4DXKA 4EE9A 3M7WA 1XLHA 3GHTA 3PZNA 1MXSA 4Z17A 3MVIA 3F2CA 2PPGA 1Q4NX 3GR4A 3M0XA 1T8XA 2A3AA 4GY7A 4RZ4A 3EOLA 1HX0A 2YDSA 3AIWA 4AISA 1LYXA 2Z1KA 2O9PA 4G5DA 4MAVA 1KKRA 5D04C 3VIPA 1J0YA 2XIOA 2B4GA 3MDUA 3W6YA 4XBJA 3G3DA 2EAWA 1XQLA 4ROQA 1J9YA 5IDIA 3NSXA 3IJ6A 3O06A 2BXYA 3LTYA 1J8VA 5CSUA 4YPJA 3TR9A 1D8WA 1DOSA 1E3XA 4TV5A 2AQOA 1IWAA 4OUIA 4IPNB 1F5ZA 1ZP4A 3E0IA 1A50A 4NT0A 3VZXA 2OFJA 1JI2A 1M3UA 2J88A 1P0NA 2OKTA 4PUDA 3W72A 3ATYA 3PC0A 2QGYA 4NKCA 3ARWA 5K7JA 3SADA 1K8ZA 3OYZA 1S3TC 1W54A 1Y5WA 3AHZA 4C1NA 4ZQMA 1DQXA 1G0CA 5KMYA 5CC7A 1RCQA 3QZAA 3R89A 5EB8A 4UNLA 3AO0A 3H2AA 4OT7A 1G7UA 4AMAA 3EZ4A 3AI0A 1QPQA 3AJXA 5HWNA 1K03A 5HUOA 1GT8A 4GIAA 1EJRC 3CLWA 1XC4A 3KRUA 3AIRA 3H23A 3S6OA 4AYSA 1YTKA 1QK2A 4IH3A 1RPKA 2VT0A 5CXPA 3NDZA 4ZZ9A 4ZOAA 3ATZA 1FVPA 1OCJA 2INZA 1WDWA 3CHEA 4D6FA 1VEOA 2WKGA 3SCWA 2CHRA 4UTHA 1U22A 2W5FA 3MI6A 3SGUA 4AU0A 3TTQA 5KZDA 3EWZA 3W87A 3CH9A 1OB0A 3TYCA 3CM4A 3E2SA 3PJWA 3AIBA 3TONA 5MKGB 1X1ZA 4PBEA 4URIA 2XIMA 1P4CA 3QV6A 3C6CA 3BE7A 3W7QA 4HHMA 3Q67A 1WKDA 4MMWA 3EWUA 2Z28A 1ECEA 1TUFA 4P8XA 3N4FA 5BOOA 1E0XA 2J74A 4GLEA 3O1NA 2VZUA 2XN1A 1Z8AA 4GXPA 1HF6A 3WUGA 5G1TA 4PCSA 5HK4A 5A8GA 2JFEX 1XDJA 3GB6A 5F4WA 1RAKA 3W86A 3F03K 1IT8A 3IJIA 2WJEA 2XWEA 4YYFA 4K7VA 3QV7A 3S9ZA 2HPMA 3HTWA 4FX6M 2DZSA 3APGA 3WH7A 3VNMA 4YHGA 1DL3A 2ACRA 3LCGA 4O4WA 2JIEA 4LVGA 1YBQB 2PDWA 2E6YA 2RDWA 1C3FA 3QMTA 5LIWX 3VX1A 4HMDA 1HL2A 2NV9A 4LANA 1Q8JA 2V3DA 5K9CA 3HZ3A 3WFLA 2E9MA 1D2KA 5A69A 4PTMA 2BHYA 2Y7FA 1SYTA 1V03A 1FHVA 1R3YA 4C6DA 4L1GA 3FOKA 2DVTA 2IUZA 1TA3B 3ARYA 4AFYA 2VDHA 2ZRUA 4ML4A 1XICA 4I7VA 4TTGA 2RJHA 4C6PA 4AAJA 4ZFCA 1JCYA 4J3WA 3CQIA 2BGSA 2VEFA 1GPFA 3I6RA 3T7VA 3BG5A 3RLVA 5IRPA 4H19A 3FK4A 4WDXA 1EHNA 4PTVA 3W22A 1M65A 3GDKA 3ID7A 2X1IA 3WQWA 4MY1A 1EWDA 3ZVHB 3GDMA 4NX5A 1V0LA 3I7QA 7TAAA 3MSGA 4CKQA 1E1CB 4F0KA 4DX3A 4HOWA 5TAOA 3WQGA 4KBXA 3I6EA 1TWSA 3TIMA 1F2JA 4IMCA 2Y0FA 4ZQCA 3VGDA 3VI2A 4AVNA 2XYLA 2W9MA 4CQDA 2YXGA 1UD2A 3HGOA 5I00A 2PRLA 1QK0A 1NAL1 2POTA 3OA3A 1F07A 1VGAA 2WXDM 1QW9A 4MWAA 2XFFA 5DMMA 2W6RA 4PUWA 3MWAA 1V77A 1A5BA 2D2HA 2YCLB 4KEZA 1A5AA 3ITXA 4RX0A 5XIMA 1K7XA 4M3PA 4A3RA 1E9ZB 4QG6A 3HG2A 4DVOA 4Z2GA 5FEPA 2VRQA 4C60A 3PNUA 2FDSA 1Q66A 2GK1A 1L6WA 1KNWA 4MUPA 1HP5A 4Q8QA 4WQ6A 4N9EA 1DJZA 1NFBA 4EXAA 1GVQA 3TU9A 3MPGA 4MADA 3CYJA 1NQKA 4MJMA 4MTVA 3USZA 1I2NA 1TFVA 3MUZ1 4MWAD 4IPPA 1W9XA 3N19B 4ZOEA 2XH2A 4ZENA 1AVAA 1ZBWA 1PL9A 4WKHA 1RJQA 4M80A 2W3ZA 3I4EA 2QV4A 2VDIA 2HS6A 3TJXA 1XLJA 1REQB 4BF7A 4UTMA 2UY5A 3DDMA 5FEXA 4JY8A 1SQ7A 3PZMA 3WQVA 4PFHA 1BRLA 4DF0A 5I3JA 2EXOA 1MVYA 1XLBA 1K6WA 1SZGA 3R10A 5E5CA 2OLHA 1B3VA 4JQ2A 2Z6IA 2QCDB 4DBUA 1XC6A 2DZUA 1GW9A 5A8MA 2GDQA 1ZGDA 2PLCA 2DUZA 4QCEA 5C9XA 4ZE4A 3VGFA 5CJ5A 1L6FA 1XYBA 1ODZA 3PTMA 3W1LA 1SJCA 2ZTKA 2NSOA 1BAGA 5TF0A 4DWSA 4A8NA 4S3GA 5CAKA 3WUFA 4OZOA 1ZHAA 3W6MA 4CNOA 2PZ0A 1LRQA 1VR6A 5A8QA 3WJSA 1FRBA 4B15A 1DEDA 1W3HA 3STCA 2Z7KA 4WXZA 5FJOA 1QRQA 3HURA 1V3JA 3QQ0A 1D7KA 1TVNA 1FCBA 4ZGYA 2QV5A 4F0LA 4GZIA 1JCXA 3AICA 3PPCA 3VUPA 1DJQA 3NOYA 4PUEA 4DWSD 4KEMA 1DWFM 3U6WA 1YEYA 3U4FA 4D6HA 2P50A 3GXDA 4KWOA 3SUVA 2KAUC 4NI3A 3TP4A 2I5GA 4X61A 4AZ7A 1U5VA 3LDVA 3QYQA 1TPFA 3G0SA 3ARSA 3NZGA 3SCUA 5F2GA 1EXPA 1O7AA 4Q33A 2J62A 3O15A 1QCWA 4K1WA 3OGVA 3P84A 4IQEA 3MHFA 1XBVA 3TC7A 3GH7A 1IIHA 1JAKA 3LCHA 4WDTA 4WOQA 4XTDA 4RNFA 1UBPC 2OXNA 1RLDA 1KQZA 3L12A 5A6MA 3CAKA 5CSRA 1AUSL 4FX7A 1QI3A 4LUTA 2IPJA 2REQA 3W7DA 5JU6A 1NEYA 2D3LA 4ZFMA 2CLMA 1TR9A 1E73M 3RLUA 2OGJA 1TYGA 1UWAA 3S4TA 3EDFA 1CYGA 5AYZA 1KLZA 3QF0A 3VKCA 3VFCA 2VVSA 3O0FA 4E4PA 3CV1A 4C5ZA 3CV7A 2BOGX 4HTYA 4GZ7A 2BDQA 4PUMA 4HCHA 2GWGA 4YS1A 1O95A 4XO7A 1SGJA 4ZQRA 3WK3A 3GTNA 4LQ1A 2IQDA 4BR1A 3N2MA 3N2TA 3UETA 3W84A 4M82A 1RD5A 2FIQA 1I6NA 3TTEA 2HXTA 2XSBA 4AZHA 3BV7A 4AZIA 4XSLA 3RX2A 4A21A 4GC4A 3TX9A 4JX5A 4BK9A 3WX7A 2VQUA 1BGGA 4Q4MA 3WLHA 1EGVA 1E15A 5LYRA 4NZ1A 4JN7A 2P76A 4S3CA 1CIUA 3ITGA 3PP7A 2BY1A 1TV4A 3CEPA 5FEZA 2Y8KA 6ALDA 5HR6A 4Y9OA 4QJ3B 4YWIA 3OGRA 4NXSA 4LXFA 3AWOA 3VD5A 4JIIX 4BI5A 2G8ZA 4UQ9A 3UXIA 4K6AA 4C6QA 1UYQA 1WA3A 3C0SA 2ONEA 4RDYA 1UR4A 1WPCA 3LHUA 4WCJA 4HPXA 2OO6A 4RW3A 1TTIA 3A64A 3OQEA 3G5EA 4L61A 1DIDA 3IGHX 1SO5A 1W56A 2O9OA 3DIPA 4DZHA 3RJYA 1PWMA 1RJPA 4I9AA 3NL3A 5FJIA 5D33A 1IF2A 1T5AA 3BWWA 1QNVA 5A6BA 2ALRA 3GG7A 3H53A 1GNXA 3GXMA 4CLMA 4KCWA 5HULA 1GVSA 4HA4A 3WL0A 3IRDA 1MRAA 3EGJA 4FK9A 2A3BA 5D9NA 2X30A 1I60A 4UFLA 1QI4A 1GOWA 1HGYA 4C6OA 1Y5VA 3CT2A 2H3DA 3AMGA 3EOOA 3K8KA 1SMAA 3ZMRA 3GK0A 3IGSA 1T96A 2PLKA 3ZXWA 3B9DA 4MNKA 2G4JA 5ABTA 1K4HA 3W1MA 2OSYA 3ZSTA 3IJLA 1JGMA 3M5YA 2O7QA 3LHVA 3U5YA 4PMQA 4AMCA 5A6BD 1RQEA 1HXJA 1XG3A 2ZUSA 5T26A 3TNOA 5ABFA 1ZBVA 3ZR4A 3W74A 1IEQA 1SM9A 3G1DA 3KL3A 4OHQA 2CLOA 2VCBA 1EP2A 1DP0A 4WHBA 3UJ2A 3BJFA 1VF8A 4A4AA 5FD0A 1B30A 2WCGA 1PZ2A 4QE1A 4AHOA 1OCNA 1JRBA 2VFFA 3QYSA 3NQGA 3GZ3A 3LPPA 3SCOA 4AIUA 5ABGA 3SCRA 4RUBA 4C6JA 2GUBA 4WDWA 4W88A 1R2RA 2VZSA 2DJLA 3MYPA 4IZGA 4NVTA 3AISA 3WQ5A 4UTWC 1LL7A 5HPCA 2CERA 3EMCA 3HM7A 5CBIA 2VEGA 1LUCB 3S1WA 4AY1A 1L0PA 1O94A 3GC4A 2FQIA 1R47A 2OB3A 3ZYZA 1JPKA 1DTNA 1GUVA 3LZ5A 3WH6A 2X1SA 3M0KA 4LY8A 2VUNA 1UR3M 1UZHA 5G4EA 1OX4A 3MZ2A 2PP0A 4GQQA 3UZZA 2E8ZA 1OINA 2ON3A 4NZ4A 5EFDA 3KDOA 4FMVA 3ZJ6A 3F4WA 3XISA 4WK9A 3AZRA 4NJKA 2WCAA 1UKPA 4KEUA 3IIPA 3APYA 4IL2A 4U4MA 3SR7A 2V69A 5FOOA 2TAAA 2CEQA 4IXHA 4CD8A 3RPTA 3NO5A 2NQLA 3KP1A 1WKFA 3ITLA 3PUDA 3TA9A 4PE8A 2FPTA 2HPIA 1YKWA 3GYEA 4GH3A 4LRTA 1QI2A 3F2BA 4GK8A 3VO0A 1EOMA 5BMXA 2BWGA 2C19A 4CQCA 1GVIA 3VMPA 1XBYA 4J3XA 2OEKA 1RXOB 1H60A 1XGZA 3WK0A 2WC4A 4WGXA 1DQWA 5D02A 2WSPA 5M5DA 5F1UA 5JBFA 5CC5A 3UZWA 4QDWA 4RE2A 1MDRA 5CH9A 4HU4A 3M0LA 3FV9A 3TN5A 3NQFA 4QS6A 5A6JA 3TDFA 3DFHA 1Q7QA 2R1MA 2J9ZA 2DT2A 4PMYA 2CLHA 3WDJA 4A3UA 4ZTXA 2ZRXA 2WANA 5C2GA 1YPXA 1LQAA 2R1LA 3CTTA 4B5UA 3WG6A 3WD3A 3CMJA 2C18A 1UD8A 1ZQ5A 1I4NA 2CLEA 4FNSA 5JH2A 5FSEC 3DN5A 4MY9A 2OYMA 4DHGA 5JQ9A 1K02A 1OBAA 6REQA 1UH3A 1RHCA 2WHJA 3SURA 5FF3A 3FJ4A 3EPOA 3E0FA 4J35A 1QXLA 1NDWA 4IGSA 2WZMA 2IKIA 1AH0A 3ARRA 4X22A 1A3XA 3T78A 2GJXA 2Z25A 3S47A 3CJPA 1F8IA 1WDSA 3KCLA 3NZRA 1G9HA 1GOMA 1AJZA 3TAOA 4JX6A 2B7QA 3MSDA 3WQCA 3A23A 1JYWA 2ISFA 2HVMA 3GNPA 5EMJA 4HK6A 1MXGA 3MUY1 2DJXA 1NELA 3B8DA 2YCEA 3LLXA 3TJIA 2PD9A 1EA0A 3RITA 4WSHA 5LHEA 3M6YA 2WHMA 3LB0A 3P2VA 4P7QA 4R34A 3RR4A 3GR7A 5M17A 3G1VA 1LRNA 4C6FA 2O9TA 1NF7A 2G3JA 3KBWA 4RV8A 4DO5A 1IGWA 1K9EA 3CV2A 3S42A 3UWEA 1J2WA 3M0MA 3C2YA 4XZNX 3PBYA 1NJJA 2VD9A 3MS8A 5A6SA 1CNVA 4L7ZA 3WLNA 1FH7A 4CUCA 4HU8A 4ZO7A 1BTCA 3QW4B 3V16A 3AXHA 3MSYA 2ZE0A 4UR9A 5CZJA 3MBFA 1UROA 5CBJA 3LX9A 4NAEB 4FF7A 2VRJA 3G6LA 3TQVA 1H4PA 3UR7A 3NVTA 3E0VA 1T99A 4AD0A 4NJHA 1UUMA 1L2UA 3SQMA 2BY2A 2P0IA 4Q4SA 2QUTA 1QNSA 5D2TA 1O68A 1Q6DA 1C7SA 3ZIZA 2YA2A 3WH9A 1VLWA 2CWNA 2VR2A 4JIRA 2A79A 4GFSA 5A2CA 1VHCA 4WX2A 3WD1A 2V5CA 2WWDA 1FHUA 2VWTA 3FAXA 3TOPA 4MJZA 1T8QA 5A6KA 5CSSA 3INPA 3LLDA 4B4HA 1EQPA 4FAMA 2J27A 4QX4A 3GG1A 4R85A 4PMJA 2QDEA 4UR8A 4AF0A 3PUEA 4TTUA 2GFTA 1MZHA 4A8IA 3N18A 4HKPA 2DVUA 2J13A 5HNNA 5HOSA 2FTPA 5E9AA 2DSKA 4IIGA 3RMEA 2HS8A 4H8NA 5MHBA 2XGIA 2OSWA 3L21A 3B06A 1ZPTA 3LTPA 4XAPA 1YDOA 4Q8WA 1XIFA 1QOXA 1KBJA 4A05A 4EXBA 4REQB 4FNTA 3IARA 1UKSA 1XPYA 1IIGA 1NWTA 3HQNA 1FTXA 3VGHA 1IE7C 2PI6A 1EP1A 3KUMA 1WYIA 1S5TA 2V8ZA 4Q8VA 3G3MA 2YCJA 3UA4A 2YDRA 2OJPA 7A3HA 2IPGA 1XLLA 3TYAA 4QJ4B 4GE8A 1HKWA 3TTSA 3RO8A 1RZMA 1LDCA 2P53A 3GIQA 1FDJA 2WVVB 4IMEA 2CZDA 5I7GA 1ZCOA 5CGTA 2YCKX 1H0IA 1HO1A 4JX4A 5GJNA 1TVLA 1XRFA 4LSBA 4UTLA 4D8LA 3BV4A 4XVEA 2WMHA 5D09A 3U57A 1EDGA 2PU0A 3W7CA 5LIYX 1J12A 2Y7DA 2CIPA 2AAMA 1FQ0A 2FHCA 5A5WA 3GVVA 1GKPA 4Z2LA 3LCWA 3L0NA 3OYXA 1PKYA 2D2GA 1UD4A 1Q8AA 3AHYA 5I24A 4Y9AA 4LVFA 2QJJA 4MZ8A 3E74A 3UCDA 2OU4A 3UJEA 4DUVA 4AEEA 4KESA 2VGIA 4N6EA 2P88A 3R4IA 1Q45A 1XP3A 5DT5A 4QEHA 3UY8A 1EC9A 1YE4A 3VMNA 1NWUA 4JZ5A 4G8TA 2DVXA 4CN6A 1OK4A 4TIMA 2QT3A 3KWXA 3M5XA 4ZB5A 2PDLA 1HKMA 3NZ1A 1TPC1 3IIZA 1MFUA 4I7WA 1RBAA 4WSKA 3II1A 5U4NA 4PSPA 1DKWA 3NM1A 4NZ3A 1FUYA 1P6WA 1VRXA 3FA4A 3GNNA 3WLJA 1FWRA 1FHLA 2JQXA 4DNHA 1KFJA 4Q8TA 2V2CA 4B3KA 4PULA 3I3EA 1KV5A 4CQ9A 3VZYA 5DQPA 4GJ1A 1W0MA 1RCOB 4S3BA 2OVLA 1IQ8A 1V6XA 2CFFA 2PTYA 1VAHA 1WNOA 3THDA 4Q4OA 4IWWA 3F5JA 3DI1A 2R91A 1E0UA 3BAWA 2FFIA 2Z27A 3W2UA 4YTTA 1XD1A 1Z6KA 4HD5A 3TCSA 5HJYA 2W0UA 3VIIA 2FVKA 2OLAA 3USBA 1MRQA 1F74A 1LJYA 4HNLA 4ENLA 3VNLA 2EGZA 5HNRA 3IVTA 2CZFA 3ZT5A 5I3KA 1Z48A 1VS1A 2YL9A 3CYVA 3KOYA 3RF9A 1UC4A 5CGMA 2OCZA 3M0JA 3PBGA 4UB9A 1LCOA 4ICMA 2F7FA 5FI8A 1EBHA 4AD5A 1YX1A 2P3ZA 3KCJA 2VX5A 1V3HA 3PZQA 3FXGA 3MZNA 4HPGA 4YCPA 2NX9A 3VIOA 3SCSA 3W00A 1PWLA 2PGFA 2GVJA 2EPNA 4V27A 3E6EA 5FKYA 1QO2A 3DCPA 3ZOAA 1K6AA 2PBOA 4XZ9A 1UZDA 5MF5A 1VKFA 4OOZA 3IPWA 2E5BA 3URBA 3DERA 4RDVA 4PUJA 1SW0A 4NSBA 3W7IA 5HBFA 3UA3A 1JRCA 2INFA 4M0XA 3NZPA 3TN3A 4UMCA 4QS5A 2QCMA 1C8XA 2Y4SA 1AW1A 1ZUAX 4J40A 1VCVA 3M07A 1MEHA 3BCFA 2NVDA 5K9DA 2HDJA 2YB1A 3C0QA 4HK7A 2Z29A 1QBAA 2B7PA 2Y62A 3IANA 1QWKA 2PWGA 3K46A 4RE3A 5HUPA 3BSHA 1O12A 3W73A 2Y7EA 3P0WA 5C55A 3SCPA 4Y7EA 1QOQA 4FNUA 1PPIA 2YFOA 4MYXA 5ECVA 3CUZA 5TIMA 1XRSA 1VBHA 1ZJBA 3F5KA 3LM3A 4NP7A 4MZYA 2XIJA 4N02A 4N4PA 4U2YA 2WC3A 4HN8A 4I9MA 3H4XA 4I3GA 1SO6A 2CWXA 3BZJA 3AWNA 1BYBA 4ACZB 3O3RA 3NWRA 3KFTA 2IMRA 2WO5A 1DHPA 2EG8A 1DVJA 2CBIA 3GBDA 3ITCA 4PL2A 4X0NA 2I7GA 4GMEA 1EO7A 4INFA 1R9XA 3FEMA 3S5SA 3AFBA 4GI8A 1SO3A 4A35A 1IZKA 1C91A 3VFLA 4JYFA 4R9XA 2V9DA 2WM1A 4QE4A 4B90A 3NQ2A 4UC5A 4I5UA 4IP4A 4QHRA 3G22A 4DF1A 3FEQA 4WVXA 5H6HA 4F8XA 3HMJG 2NXHA 1XS2A 4GUGA 3G77A 2F6UA 4D8AA 3PNZA 4LUIA 1OC6A 3KRSA 4O8RA 3ITYA 1TV5A 1XPGA 5DFAA 4K7YA 4W7VA 1XBZA 2Q3RA 5CKSA 3GXFA 5XIAA 3WJXA 3VM5A 3OVQA 1RR2A 3UWYA 1BPLB 2ZYFA 2W63A 5I23A 1XLCA 4H7CA 4QGCA 1CXIA 4DZ5A 1AH3A 3SI9A 4O8AA 3W0KA 1EQCA 4UUIA 4EPEC 1CXEA 4DYEA 2FFCA 1FXQA 1SZNA 2FH8A 1A5SA 4XX6A 4QG8A 1KBIA 3VOFA 3S3GA 1E6RA 4US5D 3FSTA 3CQHA 8XIAA 1R85A 3BPWA 1R5YA 4K8EA 2ZFAA 1K70A 3H2CA 1DJGA 1IR2A 2DT3A 5CQ1A 4TO8A 3WNKA 4B5TA 3E1F1 4JNZA 4RXFA 4AZCA 3ARTA 1US0A 3TJLA 3KTSA 1EYWA 3PBMA 2XUCA 4RXGA 3DFOA 3KBMA 3UG3A 3H2MA 3NYZA 5LXXA 2CU0A 5I78A 1S39A 2HQAA 1XKJA 3AZTA 4XISA 1J10A 1QPRA 1GVEA 3PZTA 1CT5A 4IMAA 6XIMA 3WKZA 3BGAA 1JFHA 1VHNA 1WZMA 2EPKX 1H5YA 3RCYA 4RZ6A 4ZL1A 4DF2A 4CU8A 3HFYA 2GQ3A 4ZQOA 5DMYA 2DT1A 6CGTA 3T6CA 3I7SA 3FW6A 1ITUA 3F4VA 5G4HC 1OHLA 1SFJA 1Y0EA 2WVTA 2ZZ7A 4Y90A 4KIRA 1VLIA 2E3ZA 1ZY9A 1EYEA 4QDPA 2SFPA 4PB4A 2VC9A 4GQRA 3SDOA 1N7KA 2QKFA 8A3HA 3LRKA 3W1QA 1B4KA 1A5CA 1PSCA 4TX9A 5FJJA 3CB3A 4UQCA 4KFNA 1R3TA 1FDYA 1JDAA 3WN6A 1H62A 3PR2A 2DIKA 4MHBA 4UTWA 1OABA 4S2BA 4GUIA 4S39A 3RU6A 1I45A 3S0CA 2VFDA 2C1IA 4IIDA 3AZSA 3EPNA 5EBAA 3NQ7A 2JKEA 3ELFA 2NQJA 3WUBA 3KL0A 5E0CA 4KFPA 2EPHA 3SN1A 4HT3A 5AYYA 3KRBA 4JTAA 1I1WA 5U7SA 4L1WA 2EPMX 2VNCA 2BXZA 2Z1XA 2ZA2A 2QEZA 2WMGA 3OODA 3T2OA 2VZVA 2PDFA 3R8GA 3WF1A 1B1YA 3WD2A 5DF0A 3J7HA 1EFZA 1UWQA 4PTXA 2A3HA 3DHPA 3AMKA 1E3ZA 2PRHA 1J4EA 5C71A 2WLYA 4HSHA 1UR0A 3LV6A 3NFUA 1GZJA 2I16A 3HBLA 1WUEA 3WQPA 1OJXA 3B0YA 1GVOA 4RE4A 1PJ9A 2YL8A 1V3LA 4M7TA 1PHQA 2Y8UA 4E2OA 3M16A 1J96A 2XTKA 2QCGA 2C91A 4QITA 1RLCL 2DSVA 3H70A 2FZMA 4NNBA 3TW6A 3B0XA 2V5KA 3LHTA 3P8JA 2QQ6A 4C65A 3A4JA 2Y89A 1RY8A 2VEKA 2G95A 1CGUA 1M7OA 3HG4A 2FTYA 4F48A 7XIMA 2F61A 1NFGA 2G3NA 1X1NA 3DG6A 2O0TA 4AXKA 1BWLA 1W2PA 5CBBA 1PZ0A 5LNUA 1H50A 5F2IA 2PDGA 3W26A 5EFFA 1KRAC 2CLLA 1BF2A 4MB5A 3KM8A 2YXXA 1LG1A 3L23A 4OE7A 4TQTA 2XHYA 3U4AA 5T8GA 1G7VA 2E6FA 2VZTA 4AQLA 3CHDA 4H83A 3ZWTA 1XIBA 2ICSA 5CG0A 1P1MA 4UOJA 4BY3A 3AIEA 1UBSA 7REQB 1KW1A 4IM4A 4XTIA 1D8CA 2VXNA 1MW0A 1OFBA 3G1HA 4FX8A 4Z1CA 2X09A 2D2JA 4DO6A 2WMIB 2VI0A 4ZE5A 3BAIA 5J8LA 3SQLA 4IF2A 3S8HA 3OBAA 5F4XA 1GHSA 4R7OA 2VTFA 4LNCA 3EB2A 3ZVIA 4JIQA 1R6WA 1VYPX 2ZDSA 1B5TA 1M7PA 3R8HA 4L6HA 3PPHA 1CENA 3VKDA 2C8NA 1DXEA 3CNYA 4EVZA 2Q3OA 4LS2A 4W8LA 3KLKA 1HUVA 1TJ0A 3ALGA 1FCVA 3B97A 3GM8A 1GKRA 5J04A 4GQGA 4HPHA 3H7RA 1WE5A 1TMHA 2AL2A 1GOOA 4FZIA 3URAA 5H8UA 3L0GA 4K37A 1EHAA 1TV3A 1ZFJA 3GU2A 5HQEA 3G0UA 5I79A 4LVAA 3CXOA 4PC8A 1KB3A 2ZUVA 7ODCA 5C7HA 2VP8A 1Q6CA 1XFBA 3CUHA 1GVFA 3EWDA 4D6DA 4UFHA 4BI6A 3DEQA 4NAFA 4XAGA 4ES4A 2BP1A 3I7RA 3A13A 3IJQA 4NHVA 4BQ5A 3ZQ9A 4EKJA 3CS2A 1W5OA 1R3QA 5AB3A 5E6YA 4HPJA 5D2YA 1AD4A 5HWMA 4E5TA 3EWXA 3FGCA 3TQ0A 4S3AA 3LU2A 1BKSA 3KS5A 3TWBA 2OODA 3VNIA 1V6VA 3UZ5A 3VIMA 4DAIA 3GLCA 4N4QA 1H7PA 4Q22A 3TZNA 1QNPA 2GGJA 5FL1A 4E8GA 2UV8G 1XDLA 2VUYA 4MPQA 4H41A 3AXMA 3IUIA 1UZ4A 3VDGA 1HJQA 2GVYA 4LW7A 1F9CA 1QPOA 2ZUTA 2JK2A 3ZO9A 3A4WA 1XLAA 2NT1A 3H4GA 4ILSA 3CZ8A 3TFCA 1MQRA 4H4IA 3FLUA 4ZOCA 4A2RA 3QJAA 1RA0A 4ORIA 1KQYA 3ARUA 1MEIA 1W1B1 4IGNA 4GIEA 4CNSA 4J1OA 3BLEA 1KFCA 1E0TA 5EPDA 1Q63A 1XYLA 3AIVA 4JIEA 2J78A 3AYTA 1PS9A 5G2IA 1JZ7A 4LCRA 1AQMA 1OEPA 3AS1A 9XIMA 2FTWA 3CMGA 5E0KA 3HMCA 1UKQA 2AMXA 4MJ4A 1D3GA 2DW7A 2YW3A 4JPGA 4BHYA 1ME7A 5LGZA 4NF7A 3WMSA 1NWRA 5A1AA 1XIHA 3GYCA 3UJFA 1UB3A 1IEXA 1LP6A 2GLKA 2WNZA 3UCCA 1GJWA 1CGWA 3YPIA 5K4XA 1UA3A 4U10A 2EG7A 4OQVA 4CD6A 1I0DA 2QULA 4L6OA 3GKFA 3MUXA 3PVFA 3WD4A 4GO8A 2HVNA 4Q8NA 5FIPA 1KXVA 4C1NB 1LBMA 4HPNA 2ZX9A 4MNLA 4W87A 4F66A 4HZ8A 4S38A 1W6TA 2WZHA 3WEOA 3EWCA 1I9CB 1XUZA 3OBKA 3VCCA 2QMJA 1CGTA 4MB3A 1V79A 5CPNA 3QC0A 3E12A 2WMKA 3BW4A 2YX0A 2YKKA 5D38A 5BZAA 3EAUA 4M19A 4ALDA 3S2LA 4ATLA 2A7RA 3WJYA 2BHZA 3HA1A 3RM9A 4XAZA 2YGYA 1NVMA 4HHPA 3W02A 3NA8A 1ZB5A 3GC2A 3K4WA 4NL1A 2GVEA 1EF2A 2VO5A 1XRVA 4NQ1A 4IFRA 1B3YA 3DYOA 4RL3A 3OLGA 3IWPA 2Z1WA 1DPMA 3BUVA 2PDIA 2XM1A 3NQ6A 3F7JA 3QN3A 5FL0A 8XIMA 3VINA 3L4YA 2QJHA 3P80A 4Z1AA 1KV8A 3W85A 2NQHA 5K4ZA 1V02E 1SMDA 1E6XM 4UZUA 1M6JA 2PBGA 1H1NA 1KFWA 3QM3A 3EX3A 3WJWA 4N0RA 2PDCA 1YRRA 1N8FA 5KITA 5EA9A 3R58A 1YIXA 1G4TA 1TUXA 2D20A 2GQ9A 1JDFA 5C2CA 4AXNA 4J3TA 4PA8A 1B57A 2V67A 1VH7A 1GQJA 2OWXA 1W9UA 2FGLA 1UH2A 5EGRA 1BFNA 1TQJA 2Y5SA 1XH2A 2ZZ6A 4ZA0A 3NTYA 1VZWA 4UQAA 1VJSA 2NLYA 4G9PA 2NZLA 2Y1HA 1VFHA 1E9YB 2VGBA 1WCGA 4KH2A 4HNVA 1Q85A 4X2PA 4HSNA 4QLJA 1K8XA 1VFLA 1XIMA 3BG9A 2CETA 3OLEA 3RLHA 2EF9A 2GGIA 3M44A 4UNIA 3PPGA 3W3OA 1IZJA 3NPUA 3O6AA 2ZRWA 4GYJA 4AWUA 3UD6A 3R25A 1U1HA 2PWDA 3QPYA 3KOZA 1A80A 4M5PA 5D30A 3GW3A 1POKA 4Z1YA 4J4KA 5HDRA 2V5BA 1XYAA 5LHFA 1IT0A 2ESCA 1GEQA 3N14A 5EMLA 2WSKA 3W70A 1JZ4A 3ISIX 4WKAA 4HNCA 3P60A 3A5FA 1LRTA 1HTIA 3VTRA 2YZRA 4DJEC 4UTFA 3VNDA 4H8UA 2PEVA 1MWOA 1LL6A 4RJEA 2NX3A 1M7JA 2X2YA 1J6OA 4O10A 4QNEA 3T44A 3NYDA 3EX6A 3MI2A 3GHSA 2F84A 3N9RA 5EKYA 3F1QA 3VYLA 2WWCA 4RR4A 4N6FA 4DZIA 1PV8A 1FOBA 2R94A 4U33A 3DYPA 2Y85A 4Q3MA 1W32A 4YN5A 3L2MA 4HNTA 1SU5A 1XLFA 3OEXA 2ZX5A 2CHNA 4CNNA 3RHGA 3N9KA 4GIRA 3B4YA 3L68A 3HN3A 3BO9A 1Q5MA 1UOKA 4FOUA 3H12A 1V6TA 3DBPA 1EX1A 3THCA 3OO2A 4CCEA 3W82A 1LT7A 1KXHA 2NUYA 3W81A 3WBWA 4R33A 5GNXA 3ZLFA 3V35A 1F3WA 4HP5A 3C8FA 2DDXA 4FO4A 2Z26A 2GUYA 4LY4A 1U1UA 3T0CA 1UQYA 3GZAA 5E70A 3CB8A 3O6DA 4LX4A 4MWAB 3VDCA 1SFTA 4LU0A 4KW2A 3CUJA 2EHHA 2Y2WA 3RR1A 3TE9A 4FOKA 5CPSA 5A2BA 1MW1A 4KPLA 3K8LA 3T9PA 1EGMA 4KF1A 2E09A 3KWSA 5L9FA 1JZ2A 3AU6A 1MQPA 1DV7A 4IFKA 1WX0A 3GQYA 1JNDA 3IJ7A 3TLLA 4MYAA 2GK1B 3PM6A 2VRKA 5ABEA 4ZBCA 2ACQA 3WEZA 1KM5A 1TJRA 3W24A 3SN4A 3GBEA 2GSEA 3A24A 4L80A 3GFZA 4W7WA 1NOFA 2YB4A 3KTXA 4H9XA 2WJFA 3FHAA 2AKMA 4IIBA 1E5NA 1TV8A 3O7UA 3Q94A 2AKZA 3SEPA 2ZZ3A 3THAA 4C6MA 1VBJA 3WIJA 1ZP3A 1H0GA 2GPTA 5KZ6A 4IUOA 4Y2WA 1B9BA 3R1ZA 2JKPA 4E2DA 5SWUA 2ALDA 1GONA 3PSWA 3N9SA 2HTMA 1BRLB 1K9FA 3RM8A 2CLPA 5LA2A 2JF6A 1VBGA 2FKPA 2EO7A 4NRRA 3VIKA 3ZT7A 2F2KA 1QFEA 1B9ZA 2OMAA 1GORA 4QLKA 3W2KA 4DWSC 1DIKA 3UBPC 4M7SA 3QVQA 2D0GA 3WLIA 1V51A 1HN1A 1RJRA 3RCMA 3HGRA 1V0NA 3LGGA 1ZRQA 3V3WA 1PX8A 2PURA 3GFYA 1NU5A 4IGHA 4DWSB 1MUCA 1S2WA 2AQVA 2OZ0A 5AC6A 3M0YA 4JTSA 4PMUA 1NFPA 1H51A 3SO7A 1QR7A 1GYLA 4W7UA 1YHTA 1F8MA 3L0KA 4JTGA 5HA7A 3SCVA 5XINA 1VQTA 3PWAA 1GPWA 2I17A 1XRTA 1MO0A 1VFOA 4JGDA 4TVUA 3JUGA 4CD4A 5LNWA 1TJ2A 5DCDA 5M3WA 3W83A 3W7HA 3G1RA 3OTRA 1Q7MA 2VELA 3P82A 4GGBA 4YCOA 1GCYA 1ZZMA 3BGGA 3N2BA 3UXLA 4PMVA 4JCLA 1DJHA 3GHUA 1C8VA 2BSLA 3T42A 4NU7A 4IQJA 3BQ6A 4W5UA 5AHLA 4HU3A 1F7BA 1SUXA 3RX3A 1TE1A 1PCWA 3PF3A 1TWWA 3ECQA 4PL1A 2ADAA 1VC4A 9RUBA 3C86A 3K30A 3RGTA 4JOMA 5CLTA 3WBYA 4C91A 3CIWA 1EEPA 5JBEA 4UFKA 4OV9A 4NIRA 2YSWA 2Y63A 4XD4A 1JD9A 1OYCA 3PBUA 1C9DA 4XUGA 2DIJA 2Y6ZA 3B9EA 2BASA 3GRIA 2VCAA 4JTQA 2HXUA 4NNAA 4LUTB 2REQB 5DMLA 3FN9A 1IXOA 3OIXA 4JTDA 1M1BA 3MSRA 4B4FA 1XIJA 3S83A 1W37A 3OHMB 4PTDA 1KTCA 2AGTA 3OZYA 1HL8A 2TSYA 2CZEA 4Q7BA 2UY4A 1KCLA 1H61A 1XSIA 4A3QA 2DPEA 4FNRA 2DSWA 1H3GA 2C1GA 4N42A 4K8HA 3EXRA 3LCFA 3VA8A 1AL7A 1EP3A 4D2JA 3NOEA 2AGKA 5A6AA 3L4ZA 1JYVA 4KCVA 3P5YA 3RUBL 3AXIA 1R46A 1MMFA 2HNHA 1W1TA 1Z69A 4S1FA 5C9UA 3GNRA 2W61A 1CTNA 3BQ5A 2NUXA 1LTDA 2NVAA 4ASTA 3DENA 4DBWA 1FA2A 2ACUA 3POCA 3U2ZA 3B8IA 3CK5A 3SBFA 4GCAA 3RIKA 3BMXA 1G01A 3BJSA 1F61A 4JAWA 4K36A 4U3AA 4O1CA 5E9XA 4QCFA 2DZBA 4XD6A 2XIQA 1D7FA 1ZBKA 3KVMA 4PSRA 2GDUA 1HQTA 3BLLA 3CZKA 4GC3A 3VNJA 1D9EA 1SZRA 5KZEA 3S9IA 3GU1A 2F6XA 5HATA 3JU2A 1ITQA 3SCQA 4JTCA 1V02A 2QMKA 3CQ0A 1OD8A 1XIGA 3ME3A 1O5XA 1NARA 1W5NA 1X7IA 2F9RA 5A94A 1A4LA 4MSSA 5JIPA 1DTUA 3AS0A 2WPGA 1KM0A 4RPQA 2HWGA 5HNTA 2ZBTA 3K4AA 4GFIA 3BC9A 3T4CA 2X7VA 3TNBA 4D6IA 3W2LA 4JDYA 4BCEA 3HF3A 1RK6A 4U3CA 4GO9A 1OX6A 1V3IA 3BTNA 2E77A 2A5HA 4HZMA 3IK4A 5CGQA 2IPFA 3S9YA 1OG6A 2VL4A 1SZFA 2Z7GA 3VIGA 1MSSA 1XQKA 5BRPA 3IIOA 3G1XA 1K4GA 3C52A 4KCUA 3WK2A 3MO4A 4GZJA 1R8LA 1SSDA 4BI7A 1FWSA 4ZXOA 3URNA 3HG5A 2ZC1A 3P0XA 1J18A 3E5BA 4JTKA 3W53A 5ABFB 4BFAA 1XIIA 1HG3A 1R7OA 3LI0A 3T1GA 1E0VA 1UC5A 1KM6A 2OOGA 5EL1A 3L4XA 3TROA 2ZUWA 4JTEA 1UIPA 1K1DA 2C1HA 2WQDA 8RUCA 2NW0A 1EIBA 4JTRA 2XINA 2BBFA 4W89A 2A1YA 3TCEA 4B5SA 1Q4WA 4C6BA 4GVIA 1MQQA 1JULA 4CGTA 3AU2A 1CX9A 3OG2A 3UG5A 5LNVA 4HCDA 4RZBA 5AHMA 1OY0A 4GA8A 4OU1A 1SSGA 4JTJA 2BZNA 4DJDA 2QF7A 2EPOA 2XJ7A 3PB0A 2A0NA 1ZTVA 2QAPA 1BEUA 3FHQA 3A21A 3BLKA 1DIOA 3AXXA 2ISVA 1E6SM 3WNLA 1OX4B 1M68A 4A3HA 2OZ8A 2J7HA 2Q01A 4HU0A 2PP1A 1XSJA 3TTOA 5CPQA 2GOUA 3OU8A 4JTTA 4ZQNA 4JHMA 3P14A 3T08A 5KINA 1JQVA 3OHIA 4B5VA 3W29A 4MB4A 2R14A 3NQVA 2G37A 1GOXA 5BNKA 3GAYA 1FWWA 1L6GA 3R0UA 3QH2A 4DJDD 4UQDA 2WSYA 4ADTA 1ISWA 4B92A 1LBFA 3P93A 1VENA 2WK2A 1QPNA 3KLLA 3NGJA 1UP3A 1R2TA 4JKMA 4R7WA 4JFWA 3BSGA 1PDZA 4KCTA 4HVXA 4Z2JA 1W3IA 5DY2A 4P2VA 1UPMB 3GAKA 2BMBA 1XWYA 2PWVA 1M41A 1O66A 1OC5A 4W85A 3A4AA 4DO7A 1XLKA 3B0VC 3K8MA 1VYRA 2C3ZA 4KRZA 3KZSA 2WYSA 3TR2A 4Q4PA 3A5VA 5HNUA 4BQ3A 4R7JA 3RYSA 2ZZ5A 1WZKA 2FVMA 3VKBA 1OF8A 3ARVA 2CLKA 1GOKA 4IUGA 3I4KA 2XFYA 3UG8A 5IM51 4XG1A 4R3UA 4JQAA 3VGBA 2DZTA 3C2FA 3L2IA 2WQPA 3W01A 2CKRA 1X8FA 3U2OA 3NXLA 3MKCA 3AQUA 1X39A 4LS0A 2XH4A 3DKJA 4Q7NA 1TRDA 3CC1A 6REQB 1KCXA 2QXWA 4OGZA 1S1PA 1TTJA 2QJIA 3W88A 4XBSA 3LRMA 4OTKA 4A8RA 1FWBC 3AJ7A 1M9HA 3UWVA 2GSHA 5LIKX 2PFHA 3SRHA 4OOUA 2PDBA 3CH0A 1G4EA 3EWWA 2GJXB 1DIEA 1HJSA 4EAMA 4UMAA 3FIGA 3WNMA 4LOCA 3TSDA 1UWRA 1XJBA 4D6CA 1ISVA 4TR9A 2DUAA 1SJDA 3HB9A 2AOSA 1LG2A 4CVUA 1MW3A 1QW8A 1CECA