2CIPA

Structure of the michaelis complex of a family 26 lichenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
273
Chain Sequence
SGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title Substrate Distortion by a Lichenase Highlights the Different Conformational Itineraries Harnessed by Related Glycoside Hydrolases.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 110
structure length 273
sequence length 276
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cipA00
1GORA 4P8UA 5M3WA 2PWGA 1QI5A 1ITXA 1E3XA 2J47A 2J8GA 1VFFA 1QOXA 1EH9A 4KMQA 4UQDA 3UR7A 1W2VA 5D9NA 1XH0A 3IAPA 2CNCA 1G1YA 5DF0A 1TZ7A 1VFUA 4HA3A 1HJVA 1OT1A 3AOFA 3PZUA 3VX0A 4CCCA 3KWXA 4IUGA 1RP9A 5CPTA 5AC5A 2XVKA 2IUZA 2YLAA 4H04A 1V0NA 4JCMA 3MS8A 2GJXA 1QNSA 5A6MA 1TG7A 1UWSA 4C7FA 1W3LA 4AZCA 3WUGA 3I3DA 2ZUSA 1V0MA 4KGLA 4OBSA 3SURA 4MNMA 3IJ8A 4W7VA 2BHZA 1V3LA 3QHMA 4CU6A 1UWQA 3PZOA 4MNJA 3VIHA 3T0BA 4DM1A 3W53A 2XYLA 3T2PA 2PWHA 4OUEA 1W3HA 3SCSA 1LG1A 3WIJA 5D4YA 1J0HA 3ZT7A 2G8ZA 3ZMRA 2WC4A 3NYDA 4YHGA 2WANA 2G3JA 5IFPA 6A3HA 2WSKA 4LXFA 3ARRA 2O92A 3VIJA 4JHOA 5EBAA 1FHLA 3SIMA 4B9YA 3VGEA 1CNVA 1OB0A 3VMNA 2YL9A 1J0ZA 3K4DA 1B3YA 3AHXA 1NH6A 4CD6A 3OB8A 2WMGA 4JFSA 4F79A 4H7VA 4D72A 3SUWA 1H1NA 3WMBA 1XCXA 1MXDA 2BHYA 4WKFA 2E3ZA 4UZSA 3T08A 1Q6DA 1FHDA 1XC6A 1C8YA 1J0JA 3RM9A 1TA3B 3CUIA 3WBAA 2WMKA 3HJEA 3RJYA 1KXHA 2ZX8A 1JZ8A 2WXDM 4MDOA 2WWDA 1JG9A 1RH9A 3OBAA 3VU2A 2OSYA 3OG2A 1HKKA 3W26A 1LL6A 1BGGA 5E6ZA 1EDTA 2VX7A 4HOWA 5ABGA 1GW1A 3M6DA 3U5UA 5A6BD 3PZQA 1JDDA 3RPMA 1KWGA 3KZSA 3OA5A 4JAWA 2VR5A 1VBUA 4N42A 4QFUA 4IPLA 2OYKA 3BAXA 4V2XA 1EGZA 3AJ7A 1TA3A 4BZYA 1KXQA 1VB9A 1ISVA 3L4YA 4H8VA 4HMEA 4PMOA 3ZOAA 1D3CA 2CIPA 4M82A 4ZFMA 2JIWA 2CYGA 4W87A 3TONA 1E5JA 2E8YA 2XTKA 1JF6A 1MVYA 4W93A 3GNPA 3U57A 3VIGA 3CH9A 1ODZA 1W9BM 3WDHA 4D6JA 2DPEA 3VGGA 4LYPA 2X8RA 1W3KA 1TVPA 3BAWA 2BV9A 1OIMA 4KRTA 5FIPA 3WUBA 2WYSA 1XH2A 4TTUA 5ABHA 1CDGA 1H0IA 1HN1A 3ARWA 4W84A 4JFVA 2UY4A 4U3CA 4W89A 4X0NA 3WD2A 1MQPA 1EQPA 1C3FA 3ARZA 4BQ2A 2Y24A 3VGBA 3AMCA 3KL5A 3TTQA 1VAHA 1X6LA 1UQZA 4Z2HA 3UCQA 3WH9A 3GXDA 3ARXA 2CETA 1KWKA 1CGWA 2ZUWA 1GHSA 1OGSA 1BF2A 4M1RA 4AIEA 3W6LA 2WAGA 1EDQA 3NDYA 2J4GA 3RIKA 3CMGA 1L0PA 1J0KA 5E0CA 1MWOA 4DWSD 3SCUA 3T2QA 4E2OA 1W1PA 1UKSA 3CTTA 3OGVA 1JF5A 1QHPA 3AIQA 2J62A 4PBGA 4CCDA 1B90A 1CXHA 1PZ3A 1SMAA 3WNLA 3GXIA 1VJSA 1V6YA 4PMDA 3WELA 1ZU8A 1A3HA 1QNRA 1YQ2A 1UR1A 1UWIA 3GXFA 3MMUA 3ZR6A 4W7UA 5GNXA 2V3GA 3F5JA 3MU7A 4HZ6A 4AD1A 4W7WA 2MANA 4AZ6A 2CCRA 3AMDA 3THDA 1HL8A 2ZX7A 1J10A 4H8UA 5D9PA 1V0KA 2D23A 4K68A 2ZX5A 3NSMA 3T09A 2EQDA 2Y2WA 3UG5A 2VUYA 1HVQA 1J18A 1Q6EA 1PEZA 3ZJ8A 1CLXA 4GO9A 1IZKA 5D9OA 2EPNA 3G6MA 3E1F1 3NIYA 4L4PA 5I6SA 1EDGA 4MAVA 4HP5A 5JUVA 3WMCA 1NOUA 2JEQA 4PTMA 1QI2A 5GQBA 1C7SA 1UWRA 5LA1A 5JBDA 1JYWA 3EDFA 1E4NA 1WDQA 1E5NA 1Q6CA 2WC7A 9CGTA 2YDSA 2VZVA 4UQBA 4IPNB 1UD2A 1E6XM 3BLPX 1W1TA 4F8XA 1BQCA 1BYAA 2WK2A 4P7OA 4UFKA 1M01A 4J28A 3L4XA 2E0PA 1ISYA 4PEEA 5AC4A 1JGIA 4W88A 1XYZA 1HVXA 2WVVB 3SCNA 1JIBA 3OGSA 1H2JA 2YOCA 3L4WA 2A3CA 1JL8A 2QMKA 2RGMA 3WDIA 4HOXA 2WBKA 3FY1A 1W9VA 4QAWA 2XM1A 4BF7A 3ZT5A 2J7DA 3CMJA 3PZMA 2ZXDA 2VR4A 3DHUA 1YHTA 3BAJA 3GBEA 3AYRA 4HTYA 4MTVA 3VD7A 4HOZA 5BXPA 2AMGA 1NWRA 1B3ZA 4GI8A 2WB5A 2FGLA 3VTRA 3WNNA 3W27A 2W91A 1H4PA 5DT7A 3W37A 2WW5A 5A8QA 1E3ZA 2QLYA 1MYRA 1CTNA 3HMCA 3NUKA 1J0YA 3WBEA 2ZUTA 1JXKA 4MNLA 1U2YA 2XWDA 3CZKA 4M8UA 3CHDA 4DUXA 2DEPA 2WHJA 4W85A 4AZIA 1J0IA 2WVVA 2W67A 3CPUA 1DWHM 4AD4A 3EDJA 2YL8A 3CHEA 1I1XA 4AD3A 1UR8A 3ZQ9A 1UR0A 2X0HA 3WH7A 4MJ4A 1E71M 1XCWA 2BXZA 1WPCA 4CCEA 3D3AA 2WWCA 2VX5A 3W0KA 1OINA 2ZX9A 1GHRA 5BCAA 4CU7A 1C8QA 2XM2A 1R86A 3N13A 4AYSA 4PMVA 2IXVA 4QLKA 3RM4A 1V03A 2O9TA 1B30A 1QNOA 5FD0A 3OIHA 2VT0A 4XV0A 4C7GA 3BCFA 4MB5A 4HU8A 2TAAA 4GZJA 2D1ZA 1WNOA 2ZUVA 3PBGA 3WN6A 1XSKA 4AIUA 4OBRA 3GNOA 3ARTA 3QOKA 2X05A 4GZEA 1E4MM 1E40A 1JZ7A 2BS9A 2FHFA 4UQAA 1BYDA 2EBNA 5BXRA 1KCKA 3VDHA 5ABEA 3SCWA 3GH7A 1S46A 1TMQA 5IDIA 1WKYA 1QVBA 3BGAA 4CD7A 1ODUA 1QNPA 2EPLX 3L4UA 3D5HA 4UNIA 1NP2A 4Q22A 1UD6A 3W25A 4BS0A 2WHLA 1E15A 2XSBA 4D6EA 1W32A 1K9EA 4LQ1A 4HZ8A 4AEFA 3TP4A 3EMQA 3QHOA 2BVYA 4TX6A 8A3HA 2CITA 4U2ZA 3LMYA 2XWEA 4HMCA 4Y7EA 1GZJA 1ISWA 1J9YA 5HNNA 5HPOA 3CGTA 2FHBA 3VDAA 3WH6A 4MB1A 4ZXOA 3F5LA 1E0VA 2WHMA 4PMYA 2YL6A 4S3KA 1CPUA 1QPKA 1GOWA 3CZ8A 4F66A 4GPNA 5JIPA 4P8XA 3AI0A 1CYGA 1CGYA 3BMWA 4D6FA 3WD1A 1E6ZA 5C70A 5A2BA 2C7FA 3VPLA 2HVMA 4PTVA 5KEZA 2J7EA 4PN2A 1UWUA 3SEPA 3AIRA 1CGVA 4WK9A 3SCQA 2XG9A 3AS1A 4PTWA 3PZNA 1W3JA 1BPLB 1XSIA 3WQ5A 4CVWA 5C8BB 3PZTA 4Q7NA 3VIKA 2X2YA 1JD9A 5JBFA 3PZGA 2PI6A 4UFHA 3GH4A 1E6RA 5CPQA 3NSXA 4PMXA 3AFBA 3ZR5A 4UOZA 1UZ1A 1BGAA 1R7OA 1VIWA 4P7QA 5HDRA 1MW0A 4KWUA 4PUDA 3DYPA 5I24A 1NM9A 1HJXA 3WF4A 1KGXA 4H2CA 3WF0A 1B0IA 3MUAA 1D7FA 2VX4A 1CXLA 1AVAA 4NF7A 1RP8A 4NSBA 1EHNA 4AY1A 4HPGA 3RM8A 1CXIA 1V6UA 5A95A 3N04A 3CHCA 1JYVA 5M17A 1GVYA 4X9YA 2Y8KA 2J74A 2VRJA 1KBBA 4ZXLA 1ZBWA 3B8SA 4L4OA 2DGAA 1GONA 4F9JA 1B3WA 5C71A 4W8BA 3SCTA 3IAQA 2CBJA 3SUUA 2CEQA 3WEZA 4JFTA 3AIWA 3EYPA 3AZTA 2XVNA 1E0XA 1H09A 2VO5A 2D20A 1UHVA 3QHNA 1H5VA 1P6WA 5DFAA 2GUYA 1VF8A 1DHKA 4PMUA 4EK7A 3EDEA 3W38A 3A4WA 3PZVA 3DECA 3HN3A 4EE9A 4TVCA 1D2KA 1V6VA 4Z2JA 1FA2A 3MUIA 3VVGA 3AXHA 2CKSA 1GOMA 2OWWA 1JFHA 4JL2A 3VM5A 2DH3A 3U5YA 1HKIA 1BTCA 1XHGA 4LYRA 4AD5A 3NJ3A 1B31A 1EOKA 1Y7VA 3VUPA 4YPJA 3BCDA 3RO8A 3ZO9A 4GINA 1ISXA 4CD8A 2DQXA 1C90A 2X1IA 4JKKA 1ZBKA 4ACYA 5BXTA 4CU8A 2YBUA 4JKMA 4PMNA 1E0WA 4XZBA 4TOQA 4U5KA 4U31A 4CKQA 2WC3A 3PZ9A 4AMCA 1CWYA 1BHGA 4HMDA 1CBGA 1K9FA 1HJSA 2PBOA 3IANA 2WMHA 3WENA 4V27A 4JHZA 2J7FA 2D3NA 3ZJ7A 2WM0A 2Q8XA 1HJQA 2C8NA 4U2YA 1EXPA 2YA0A 2QHAA 1GOQA 5E9AA 3VMPA 2XUCA 3WNPA 1WCGA 3MANA 2G3MA 1V3IA 4D1IA 1E43A 1UKQA 3T0AA 2O9PA 4KRUA 2J75A 1PX3A 4UR9A 1OCQA 2FH6A 1OM0A 5CGTA 3O6AA 5E70A 1PIFA 3BSGA 4J27A 5CLTA 3K8LA 1VFOA 2GDVA 1CXKA 2E40A 3BAIA 1MW1A 4LYQA 4QLJA 4TX8A 2VZUA 5HBFA 1HT6A 2W61A 1OT2A 3VM7A 4MNKA 2VURA 2YBTA 1QBBA 2GK1B 2CHOA 4R5EA 5IHSA 3RCNA 5A6SA 1AQHA 5I23A 1C8XA 2XVLA 4P7LA 1W1YA 4B3LA 1L8NA 1X1NA 3VD4A 1HNYA 1KFWA 2WMJA 3UG3A 2JALA 4WIWA 3AS0A 1V3HA 3WFLA 4F9DA 1WZLA 4QP0A 2DIJA 4GZIA 2GVYA 3II1A 1W2PA 1GQLA 1CECA 1US2A 2YDRA 3MMDA 8CGTA 5I78A 1UUQA 2DDXA 3GZAA 3CZLA 3PZIA 2ZXAA 3BAYA 1WO2A 4D1JA 1CENA 1JI2A 1VJZA 4M56A 1W9XA 1US3A 2GK1A 2CBUA 1QBAA 3OZOA 3ALGA 1XGZA 4ML4A 1LWJA 3ZJ6A 2WVTA 5A6LA 2W92A 2PWFA 3AZRA 4CN4A 2JEPA 4M80A 1DWAM 4NRSA 2VJXA 5BWFA 1NP0A 2VI0A 4PUEA 3OLIA 4LX4A 2D0FA 2ZXQA 3BMVA 3FHQA 4AZBA 4GI9A 4FLQA 1VEOA 2CBVA 3A47A 1GNXA 2ZE0A 3WKZA 5LYRA 1EOMA 3VIMA 3CUJA 1KXVA 1PX8A 4HA4A 3AIEA 2J77A 1ZBCA 1MXGA 2VRKA 3DYOA 5A8NA 2BFGA 1EO7A 1JYNA 3AIVA 5LA0A 2YJQA 4W86A 3DYMA 1X6NA 4KH2A 2RGLA 4PSPA 2J7GA 5D8WA 4OZOA 1W9UA 5A8PA 1QW8A 5M03A 3AXIA 1OD8A 2J7CA 3MUZ1 4B15A 1UA3A 1R7AA 1H11A 1V08A 1LLOA 3U7BA 1E4IA 1M03A 3VD3A 1QW9A 3MKKA 4OIFA 4DUVA 4J3XA 1JAKA 3BH4A 2ZICA 2XVGA 3AIUA 2VQTA 3N9KA 1JZ4A 2XIBA 4HA1A 1ESWA 1JDAA 1O6IA 2J7HA 3ARPA 3MO4A 1K9DA 1BFNA 2W66A 3SUTA 3CO4A 4U5IA 1H49A 2CERA 1OGGA 4MB4A 2VVSA 4HZ7A 2EPOA 4ZE4A 1E72M 1W9DM 3TTOA 4FMVA 2QPUA 2ZUMA 1BYBA 2IXUA 4RE2A 3LPPA 5FKYA 2NSXA 2CPUA 4GO8A 1ITCA 1CGTA 1PPIA 3EBVA 3W28A 1R85A 3K4AA 1BSIA 2XIIA 2JFEX 1V3KA 1AQ0A 3W29A 1FP8A 1E4LA 1KQYA 2DH2A 4NI3A 4X0VA 3NCOA 1BVNP 2HISA 3AMKA 3W6MA 1K6AA 1QI0A 2O9OA 2V5CA 4JCLA 3WNMA 2Y8VA 2EPKX 5I0DA 3TA9A 4TUFA 3OZPA 3APGA 3AMLA 2V3FA 3DC0A 5A6AA 3SUVA 3WL0A 4OJYA 3EDKA 1KR0A 1JZ3A 2ZIDA 4ZE5A 3G6LA 1SMDA 4UQCA 1MFUA 4UFJA 3WEOA 1CEOA 1QI3A 2WKLA 1SYTA 3PTKA 4S3JA 5DO8A 2VRQA 3T0DA 1TUXA 3B9AA 1JFXA 1DEDA 3S2CA 5CSYA 1PX4A 4MPKA 3IK2A 4A3YA 3WQ8A 5IHRA 1AQMA 4U3AA 1KBKA 3WNKA 2BVTA 2JF6A 1H41A 3CZEA 3NSNA 1E73M 3FN9A 5E0FA 3VGDA 2WLZA 1OWQA 3WH8A 3VO0A 4CN1A 1FH9A 1C91A 1Z32X 3WH5A 2G3NA 2F61A 1GVIA 2DT0A 1WZMA 2Z1SA 1EIBA 1BVZA 3J7HA 4R27A 4D6DA 3N15A 3WUEA 1XSJA 4B16A 1UD8A 4NRRA 1E6NA 2E9MA 1UYQA 1UH4A 4W5UA 3W24A 4JFWA 2Z1KA 1V3MA 1UA7A 3VOCA 6TAAA 4ATDA 2PWEA 2UY2A 4D71A 2AAAA 2CXGA 4E8CA 3BAKA 1QHOA 1JZ5A 2OWCA 5AY7A 1H3GA 1SFSA 1JYXA 3MSGA 2E8ZA 3AROA 4V28A 4AZ5A 1V0LA 5CJ5A 1TVNA 2W4XA 4RE3A 4AEEA 4WJXA 1PJ9A 3GYCA 4D6IA 2DT2A 1JD7A 3UEQA 2VMFA 1NARA 4UOQA 3SCPA 2PB1A 5IFTA 1E6PA 1J12A 1LF1A 1JDCA 1K9TA 5EFFA 2X0YA 2NT1A 4XUYA 2EO7A 3AHYA 3VIFA 2WLYA 1U30A 1WDPA 2YIHA 4DWSC 2OYMA 5I77A 1XH1A 1GOKA 4BA0A 1NWSA 5ECUA 1UKPA 4AIOA 3VNYA 3QR3A 4PTXA 4PCSA 5FL0A 3BXWA 2PC8A 1E1FA 1I1WA 1KR1A 3L2LA 3I3EA 2V3DA 5DT5A 4J3WA 4EANA 4B3KA 2D3LA 3WNOA 5A94A 1HIZA 2J78A 1EQCA 1M04A 1NOWA 1N82A 2WMFA 3A6OA 3VD5A 4GQRA 2YL5A 4HU0A 4ATWA 3GBDA 3B9EA 5HXMA 4A4AA 4MADA 5M5DA 2PF0A 3T2OA 2DSVA 1E6QM 1QI4A 3CUFA 3RILA 2BY0A 2YLLA 1E1EA 3BLKA 3AZSA 2EEXA 2VTFA 3VIPA 2ZX6A 2C0HA 5A8MA 1G0CA 2D22A 1KB3A 2BXYA 4W8AA 2FH8A 4P7RA 1ECEA 4MAZA 3K8KA 4RE4A 2VQUA 1GOIA 3L4TA 2J8FA 4BCEA 4NZCA 1QNQA 2QMJA 3ARUA 1WZAA 2Y5EA 7TAAA 1MFVA 1NQ6A 4UFMA 3WY1A 3WDJA 4BQ4A 3LPGA 4A3HA 1FFRA 2W63A 2OWXA 2QPSA 5GPRA 1E70M 1WAWA 2D0GA 2JF7A 2WMIB 3ARYA 3UG4A 1DWGM 3N1AA 5E6YA 1TR1A 4ATLA 4TTGA 3EMCA 2WNWA 4M81A 2YA1A 4IM4A 1VEMA 3CZGA 4FLSA 4GKLA 4OOZA 3WEMA 4OOUA 4DUWA 5I3DA 2DT3A 5A1AA 2ZUNA 1HX0A 2VCCA 5CPSA 1TCMA 3PHAA 3VILA 3WDRA 2XPKA 3LPFA 1UWTA 3I3BA 1SR0A 4JKLA 1RPKA 3TOPA 1OGBA 4UTFA 3K46A 4UOJA 2B31A 4EAMA 4AC1X 1C92A 2DSUA 1XRVA 2D24A 2WMIA 3AISA 3GXMA 3ARVA 1G94A 3ALFA 2VZTA 5CSUA 1GQJA 3VNZA 3CUHA 3WD3A 1E9LA 4JIEA 5D9MA 3N18A 5I5RA 3WFZA 1GQKA 4MJ2A 2E9LA 1LQ0A 1CXFA 1BG9A 2VVNA 4ACZB 3TTSA 2YDQA 4AD2A 3RMEA 1OD0A 1W9PA 4PSRA 1IT0A 3MMWA 4AZ7A 4WLCA 3A4AA 4BQ3A 1PZ2A 4DM2A 2Y4SA 2VCAA 3UESA 3CZJA 4LPCA 3F5KA 1CXEA 1G01A 3AS2A 2DIEA 4C7DA 2ZWYA 2AOSA 4D6HA 2XHYA 3WQ4A 4YN5A 2ZWZA 3AYSA 2WCGA 2FDMA 3IJ7A 1UR4A 5EMYA 5CZKA 1UD5A 1JZ6A 3KEHA 4TXEA 1V3JA 2F8QA 2UWFA 4FLOA 3EMZA 1MQQA 1E55A 5BYWA 1V6XA 1CIUA 1FFQA 4ACZA 4Z2GA 2DSKA 4WSJA 4JZ5A 3AHTA 3FAXA 2BY2A 4H41A 1MW3A 1ZBVA 2ZOXA 2WZIA 3MUY1 1HJWA 1V02A 2BY3A 3VDCA 1HKMA 1XD1A 5CLWA 3CIVA 4TVUA 1XYFA 3VX1A 5EFDA 3BSHA 1ZB5A 1TE1A 3AQUA 4MDPA 1VEPA 2V5DA 2JE8A 2OSWA 3BC9A 1ZS2A 1UD4A 4PCTA 3LPOA 3RDKA 5A8OA 2G41A 5FCZA 4J7RA 4UFLA 2XVPA 1B1YA 1H0GA 1OIFA 3NDZA 3AMGA 4UQ9A 3GM8A 3A4XA 4J3VA 4CD4A 2XSAA 3OLGA 3WF1A 4HPHA 1VFMA 1WB0A 3ECQA 1PBGA 2JIEA 3QOMA 1V02E 5AYIA 2DSWA 2CKRA 4Z2KA 4W5ZA 4EKJA 4PMRA 3VIOA 1NWTA 4M24A 1JAEA 3CHFA 4BQ5A 2NW0A 5A2CA 4WKHA 4ZEPA 1UG6A 1BG4A 1WDRA 2NT0A 3DHPA 3W4RA 2BY1A 3M07A 5GNYA 3ZIZA 4N0RA 1UZ4A 3S6TA 1B3XA 1FP9A 2BVDA 4Z2LA 2X09A 4FF5A 1Q6GA 5BXSA 3F4VA 2D2OA 5D8ZA 1JNEA 4JL1A 4U33A 4W8LA 1G5AA 2XJ7A 1NWUA 4QCFA 1QHZA 2J25A 5HPCA 3VMOA 5CGMA 2GJRA 2VZSA 5JBEA 3K8MA 4MB3A 4AZGA 1B3VA 1C7TA 5EB8A 5BRPA 1UH3A 1LL4A 1UH2A 4H8HA 3O2LA 4GI6A 4RL3A 2WHKA 2UY5A 4XZWA 3WQ6A 3CLWA 2GSJA 3AS3A 2VCBA 1B2YA 4LGXA 2VOTA 3K1DA 1CLVA 1GUVA 5CQ1A 4FLRA 3WL1A 1EO5A 1RD6A 1GPFA 3VKKA 1Q6FA 2BNJA 3WF2A 3ZM8A 3O9NA 3JUGA 2W62A 3ZSSA 4WKAA 5GNZA 1C93A 1FOBA 3WF3A 1UR2A 4CGTA 1KGUA 1WP6A 3L4ZA 3N12A 3FXYA 3PTMA 1AMYA 1UKTA 4UFIA 3U7VA 5A6JA 1OSEA 3POCA 1VRXA 2XGIA 3UERA 2EXOA 1HKJA 4CN6A 1GCYA 2A3AA 1LG2A 3M7SA 1VBRA 3FHAA 5A6BA 1GJWA 2QV4A 4CUCA 2A3HA 1HP5A 4TVDA 4QLLA 1F4HA 4OKDA 5A3HA 1IV8A 3MV01 1B9ZA 1V6WA 3AHVA 1DP0A 2VNCA 1E6SM 4AZHA 2WVUA 3KL0A 3GNRA 4J3TA 1XV8A 4CD5A 1TFVA 2DT1A 4ZENA 4XX6A 1DWIM 3UETA 3ARSA 4AW7A 3POHA 4QCEA 1WDSA 2XGBA 2CBIA 3VDBA 1IZJA 3AIBA 4GXPA 1KCLA 1KGWA 2VC9A 2F2HA 4JFUA 2GJPA 3M46A 3W82A 1WZKA 1ZJAA 5IXEA 5DMYA 2WPGA 1EA9C 3ZT6A 2CESA 4J3UA 1UD3A 4PRWA 1JZ2A 1M53A 1J01A 2GFTA 4CVUA 4WSKA 3VIIA 4UZUA 1Q4NX 5I79A 3TTYA 2YA2A 4DWSB 1CZ1A 1KXTA 2XFFA 3THCA 1U33A 4B9ZA 4P7NA 1LL7A 4GIAA 4P8VA 4PMQA 2WVSA 5CXPA 2E9BA 1A47A 2EPMX 1R87A 4AWEA 5AYBA 2OSXA 2XFYA 4FK9A 1G9HA 1VENA 1PIGA 6CGTA 3WDPP 4Z2IA 1M7XA 3PTQA 2OYLA 1GJUA 2CHNA 2WZEA 3KE0A 3FNDA 5BROA 4AD0A 5FOOA 3MSDA 3KL3A 4UQEA 5BRQA 1F4AA 2PBGA 3IJ9A 2EJ1A 1JNDA 5ABFB 3WD0A 1DWJM 2O9RA 3OLEA 3A3HA 4PMZA 2G3IA 1LJYA 3L2MA 1BYCA 2D0HA 2PWDA 2VL4A 4DWSA 4AXNA 3AICA 5A6KA 1J11A 5A69A 3CUGA 3ZSTA 2A3EA 4PYSA 2WKGA 1GQIA 4QDMA 5FL1A 1O7AA 5JIWA 1E56A 1ZJBA 4E8DA 2DSZA 1HJUA 3AXXA 1KQZA 1LWHA 3EDDA 1WE5A 5F7UA 1UOKA 1MQRA 1W1VA 5E09A 2WBGA 1HXJA 2W5FA 1FH8A 2G4FA 4M29A 7A3HA 1DWFM 3WMSA 2ZUUA 3SUSA 4XB3A 5LA2A 1XD0A 2QF8A 2OLHA 4D6GA 3B9DA 3W81A 2E4TA 1HL9A 5ABFA 1ISZA 1UR9A 1PAMA 3VGFA 3SCVA 2V38A 4KGJA 2VX6A 3FW6A 3VGHA 3WQWA 3ZJKA 5CG0A 5DEZA 5A2AA 2A3BA 1I75A 3HU7A 3VINA 3PN8A 3FAWA 4WF7A 2WZHA 5HOSA 2J79A 3N17A 1EHAA 1NOFA 4E4PA 5TD4A 1GOOA 2FGZA 2V3EA 3GDBA 2WCAA 7CGTA 3QGVA 4AISA 1CGUA 1ZL1A 1UQYA 3AHZA 3RJXA 2WSPA 1HF6A 2VZOA 1MW2A 4P8WA 5KZ6A 2GDUA 4URIA 1JI1A 3CBWA 3OLDA 1UKOA 1FH7A 2J7BA 3WDQA 2UY3A 4IISA 2ZXBA 2XFRA 2ESCA 2BHUA 3WQVA 3MV11 3OGRA 1BLIA 3VD9A 1CGXA 3UR8A 1OBAA 4UCFA 1R8LA 4YHEA 2GJXB 3ARQA 4D6CA 1HP4A 1JXJA 3GTNA 1W91A 3SCOA 1BAGA 5I2UA 4J3SA 3WUFA 4AZCB 3SCRA 2YKKA 3N11A 3L4VA 3WD4A 4GQQA 1DTUA 2WCSA 3WSUA 3GH5A 2FHCA
chains in the Genus database with same CATH superfamily
4IPIA 3OODA 2PC4A 5D33A 3U9IA 5M3WA 1XLKA 2PWGA 2PP0A 1GVSA 2J8GA 1VFFA 2QJIA 5D9NA 3IV8A 2PRMA 1RLCL 3IAPA 1RCQA 1TZ7A 3P62A 2G4JA 2Z24A 3AOFA 2VEGA 1KLYA 3DGBA 4ZQMA 3SQMA 2YLAA 5IBXC 4XZIA 4HPXA 4AC7C 1QNSA 5A6MA 1TG7A 5L6UA 4C7FA 4LS0A 4AZCA 2ZUSA 5EA9A 1DJXA 1OFAA 3SURA 4MNMA 1UIOA 4W7VA 4JTLA 3H2FA 1H5YA 4CU6A 1OFRA 1MMFA 2XYLA 3T2PA 3SCSA 1W3HA 4JDYA 1KA9F 1X1OA 3QW3A 4GNVA 5XINA 5LGZA 2AQVA 2WANA 5C2GA 3BDKA 3DGRA 4JHOA 4GY0A 1FHLA 5EBAA 1M65A 1B3YA 1QR7A 1BD0A 1AMKA 5IOBA 4CD6A 4F79A 1Z41A 1Y0EA 4ROPA 2BHYA 3V1HA 3SN0A 2WJZA 1XC6A 3L21A 4FO4A 3ZYZA 3RM9A 3C2VA 3CUIA 3F4NA 1OYCA 4F40A 1ZPTA 3NZGA 4GFSA 3OBAA 3WLKX 4CQCA 4P5UA 2GGEA 1V7YA 2HE5A 3OG2A 4OV4A 3R1ZA 4JTSA 3QV7A 2VX7A 5G2WA 1MDRA 1GW1A 3GLCA 4JHMA 2VR5A 2ZVRA 5TAOA 1RSCA 4Y90A 2DUZA 3BW2A 2GGHA 3EWBX 4QFUA 3RU6A 3TN4A 4GUHA 4F3HA 1UW9A 3W83A 2B7PA 4H8VA 4PL1A 1U5HA 1UP0A 1F6YA 3QC0A 3ZOAA 4Z1CA 3NO3A 2XN2A 3TYZA 3E02A 4M82A 4XQ6A 2JIWA 4W93A 4UC5A 3PG9A 3QSRA 3GNPA 3VIGA 3PC0A 1JCXA 4L61A 1W9BM 3WDHA 4M3PA 4C6KA 2R82A 4IIDA 1Q6RA 4HHHA 3BAWA 2BV9A 2Y70A 3R7MA 2WYSA 2ZA3A 3P82A 4Z0JA 5A6TC 4W84A 3TE9A 1I45A 3CL7A 4NJGA 2UY4A 3KRBA 4ENLA 3KFTA 3R8RA 4X0NA 3WD2A 1MQPA 1EQPA 5BMXA 3ARZA 4J1OA 4ES4A 2RJGA 2Y24A 1FXPA 2Y0FA 3MYPA 4O14A 3N6HA 2W0UA 3TTQA 2V5JA 4TIMA 1QFEA 5CBJA 4GGBA 4Y9NA 4E2DA 3GXDA 1EYEA 4XD3A 3LBOA 2CETA 3B8VA 2V2CA 1FWDC 3IJLA 1P43A 1EF3A 2WAGA 1EDQA 4LVFA 3U3HA 2V0TA 3NDYA 2QPXA 3LHYA 1L0PA 4Q8WA 5LNRA 3M6YA 5E0CA 4K8GA 4DWSD 1F3WA 3NQ7A 4QDPA 3CTTA 3OGVA 4PBGA 1B90A 1CXHA 3S0CA 2Y7FA 2RFGA 3GXIA 1VJSA 3TN5A 2EJAA 4BY3A 4GIRA 1DIEA 4PMDA 4N9DA 1A3HA 1UR1A 3WJXA 3MMUA 3KRUA 5CPMA 4NJHA 3TU9A 3AUOA 4AD1A 2NVDA 5U7SA 4AZ6A 4LF2A 2ASHA 1X97A 1DJQA 2ZX7A 1J10A 4H8UA 2CLOA 4EWND 3M64A 3NSMA 1TPVA 5HANA 3T09A 2JK2A 2PPGA 2VUYA 1CB2A 3W2UA 1ZP3A 1W56A 1PEZA 1ZQ5A 1JR1A 3CAKA 4GO9A 3O15A 1IZKA 1TV5A 2EPNA 1BKSA 1XQLA 4L4PA 3KXQA 1EDGA 4MAVA 4GYPC 1PB0A 4HP5A 5JUVA 5H6HA 2PS2A 2JEQA 2IQ0A 1QI2A 4M6PA 4PFMA 5GQBA 1KBJA 3NO5A 5LA1A 1KRAC 1WDQA 1ONWA 1UP3A 9CGTA 3CXOA 4HB7A 3FFSA 3BLPX 2DP3A 3SY1A 4LAKA 1LWIA 4F8XA 4LV9A 1F9CA 1BYAA 4UFKA 3BLEA 2PAJA 3L4XA 1ISYA 2INEA 3U8GA 1JGIA 1VBHA 2PTDA 4O1AA 1XIHA 1VYRA 1TJ0A 1Z89A 4Q4OA 3FJ6A 3L4WA 1JL8A 2QMKA 4IP4A 3TNOA 3WDIA 4WGXA 2WBKA 3P0XA 2XM1A 3W7QA 1BKHA 4LANA 3CMJA 3PWAA 3WLNA 4WCJA 3AYRA 4HTYA 4MTVA 2IS7A 3LRKA 2AMGA 1NWRA 1B3ZA 3MKVA 2FGLA 3M5ZA 3VTRA 3W27A 5DT7A 3W37A 1X8CA 1E3ZA 4IG2B 1AH3A 2B7OA 2OXNA 4HJWA 1EXBA 1WA3A 2ZUTA 3LTYA 7PTDA 2Q3OA 4L1XA 3M0LA 1JXKA 2DZAA 1VH7A 3ZLHA 4DUOA 4XIMA 1Z69A 1Z7AA 5LIWX 2WHJA 1J0IA 3W22A 1P0EA 3P2VA 3CPUA 4YTTA 4AD3A 5AHLA 3ZR4A 1UR0A 2X0HA 1M6JA 2YFNA 3F7JA 3TUUA 3N4AA 4CNPA 1G7UA 4YWIA 2VX5A 1IQ8A 1OINA 2ZX9A 3QR1A 4YVPA 4Q8TA 1R86A 2VFDA 3N13A 1V03A 4IG2A 1QNOA 5FD0A 1A0CA 1A53A 3T1GA 3OEXA 3P7YA 3KRZA 3O63A 4MB5A 4GZJA 1XSKA 3I6TA 3GNOA 3QOKA 1JZ7A 2EBNA 5BXRA 1NSJA 5KZEA 3USBA 1S46A 1T5AA 4TMBA 3TYEA 5IDIA 1VPQA 4XZHA 2HXTA 3WJSA 3B9OA 1OFBA 3TLLA 4Q22A 1TV7A 4IQDA 3W25A 2ZADA 5JVLA 3KTCA 2YCLB 2ZRWA 2RJHA 3TH6A 2Z00A 3CB3A 1SR9A 1TPC1 4XAZA 4C5ZA 3JZUA 1O5QA 3GDLA 3GTHA 1LBMA 4TX6A 1IWPA 2CITA 4U2ZA 1Y5VA 2F9RA 4Y7EA 1GZJA 1ISWA 1J9YA 4HSNA 5CJNA 5HPOA 2DORA 3P74A 4ZXOA 3F5LA 4PULA 2RDUA 4UTKA 4JIHA 1RALA 5HATA 4JTGA 1KM1A 1XPYA 3NPUA 2YCLA 3PUDA 5A2BA 2QJMA 2PCQA 5KEZA 4PN2A 2P0IA 3AAMA 4O8RA 1WDDA 4WD0A 1A5BA 4X2PA 4PTWA 3IARA 2B4GA 4DY1A 1TIMA 2AGTA 1N8IA 5C8BB 3KS6A 3PZGA 4A8NA 3NFUA 4E2BA 1E6RA 3KOFA 3AFBA 3W75A 5ECVA 1VIWA 3UG8A 3APTA 3DYPA 1EGVA 1TX2A 4DJED 4UMCA 1TELA 4IICA 2VX4A 3KTXA 4NSBA 4HPJA 3UGVA 3RM8A 3CTLA 2G97A 3CHCA 1XLHA 4O16A 3UWWA 1GTEA 1FCQA 3I7RA 4PMJA 5HK4A 4ZXLA 4L4OA 1I9CB 2DGAA 4PUUA 1V93A 4M0XA 4W8BA 3SCTA 3SUUA 1QK0A 2XVNA 3JVAA 1K3UA 4ASTA 4MMWA 2D20A 1FDYA 3ZXWA 4FPSA 4S3GA 1TV4A 5DFAA 1Q6OA 4PB3A 1HGYA 2YBVA 1OK4A 2FVMA 4JPGA 1FA2A 3MUIA 1JQVA 3AXHA 2CKSA 2AL1A 3A4JA 3U5YA 4A2RA 2KZHA 4AD5A 1HFBA 1H63A 3VUPA 2DQXA 3NTYA 1EP2A 1ZBKA 4MLRA 2YBUA 3JRKA 3ZVHA 1ZLPA 3GWQA 1CCWB 1NDWA 2VC6A 3F2DA 4MKNA 1LOQA 3KOYA 3PPHA 1BHGA 1K9FA 3IANA 2WMHA 3IUHA 2D3NA 3HV9A 4HN4A 2WM0A 2Q8XA 4W9TA 3SADA 3H2EA 3QY6A 1BVWA 3VNMA 5E9AA 3O6DA 3VMPA 3MO7A 2XUCA 3MANA 3FEMA 1UUMA 3HIJA 2G3MA 5EMJA 1QXLA 1OADA 2BDQA 1OCQA 4UTWC 1XJBA 2FH6A 4TR9A 4NNAA 3O6AA 4U4MA 2ISWA 3PSWA 1SJBA 3GR4A 2P0OA 3T0TA 3K8LA 3CJPA 1CXKA 5DANA 5HNUA 4HHLA 5C9ZA 3G8EA 4V1XA 4EACA 4LYQA 4QLJA 1QASA 1RVGA 3W9ZA 1HT6A 1OT2A 4O17A 1OC5A 2VURA 4IPPA 3HBLA 3W1LA 3EPOA 5IHSA 1YE6A 2QGYA 1F7BA 3TTEA 1A5CA 3CQ0A 2F38A 3SI9A 1TWZA 3S2JA 4DJEA 1QMLA 1E0TA 2JALA 2EG6A 1Y65A 4WIWA 3AS0A 3PM6A 3ATZA 4KS0A 4C6CA 3OVRA 2VDIA 1WZLA 3GK0A 3UPWA 1GQLA 4J3ZA 2YDRA 4PA8A 4AVNA 1POJA 4GI4A 3T4CA 4QX4A 5HULA 3SN1A 1K03A 1GEQA 1TREA 4K1WA 3PUOA 3QMRA 1IEVA 1QBAA 3W1QA 3ALGA 4MY1A 3TR9A 3M0HA 3WQFA 2Y5JA 3BWWA 4O53A 3C0SA 3AZRA 4CN4A 2JEPA 4M80A 4Z1BA 4CLMA 5D37A 4DEFA 5DRIA 2VI0A 4QG9A 3OLIA 2Y5SA 2D0FA 1ZUAX 4GI9A 1YRRA 3ISIX 1GNXA 3BVJA 3B8WA 3N2MA 3WKZA 5LYRA 1P1XA 1I8JA 3TZNA 3BV7A 3H2MA 3M5XA 1W8GA 3VIMA 1WDWA 1FWGC 3VZZA 3GXNA 5HNRA 1DIKA 2J77A 2Z28A 2PDXA 1MXGA 2YZ5A 4GUJA 3DYOA 3O3RA 5A8NA 1GVRA 5IDZA 4EPKA 4TX9A 1X6NA 3M5YA 1ZFJA 4J2MA 4RXFA 3QXBA 1EIXA 3FA3A 1QW8A 4FF7A 1RBAA 1VPYA 2J7CA 1UA3A 3KCOA 1UIPA 3VD3A 3SAZA 3CL8A 4J3XA 3BH4A 4DO5A 4IGHA 3ME3A 2ZRYA 4RK8A 3AIUA 1TJRA 3N9KA 1JZ4A 1YTEA 2GJLA 3RR1A 2V9DA 3T4WA 1ESWA 6ALDA 1FWTA 2DW6A 4ZMGA 1BFNA 3CO4A 4U5IA 2PDJA 1H49A 1OGGA 1W9DM 4R3UA 2QPUA 4YS1A 4GMEA 3MZNA 4JTHA 4AAJA 2JGQA 1MRAA 3C2YA 2GDQA 2NSXA 1AK5A 1PPIA 1OZQA 1QPNA 3W28A 1BSIA 1W0MA 2QV5A 3N4FA 3W29A 1FP8A 5I03A 2AKMA 2ZTKA 4C1KA 3N73A 3DFNA 2HISA 3LLFA 4BI5A 1YIXA 4DQWA 3WNMA 1ZAIA 5I0DA 3TA9A 3OZPA 1L9WA 4HNCA 3APGA 1J2BA 1VKFA 3I4KA 4IMGA 1AJ0A 3RLHA 1F73A 1KV5A 3WQPA 1QOPA 4FB7A 1TMHA 3L0KA 1TPH1 3DH7A 1JZ3A 4ZE5A 3ES8A 3G6LA 2WJDA 1MFUA 4GWEA 3PTKA 3B9AA 3S2CA 3GR7A 3WQ8A 1AQMA 3KCJA 3TZFA 4JD4A 3NSNA 4F0LA 5K9CA 4Q8MA 2ZDSA 1E73M 1IEXA 1JPKA 3FN9A 3W1RA 1DJWA 3LOTA 3S5YA 5E0KA 4MKVA 3WO8A 1EKOA 1GVIA 1WZMA 4LUIA 1LQAA 3MCNA 3N15A 3T05A 1OVDA 1XSJA 1UD8A 1E6NA 2DZBA 3W24A 4HIBA 5I07A 2Z1KA 3C0LA 3TR2A 7ENLA 2E5CA 2NQHA 2FPVA 3TFCA 4EXBA 3LNMA 2AAAA 2OR2A 9XIMA 1KM0A 1JZ5A 5AY7A 1UBPC 4JNMA 4X22A 2E8ZA 3AROA 4V28A 1V0LA 3C2OA 3PPGA 3OVPA 5CPLA 3N2TA 3NEVA 1D9EA 2X7WA 4DLFA 3CWOX 1W6TA 4M19A 1VGAA 4OUIA 4EF8A 4UOQA 5HMSA 2ONEA 2PB1A 5IFTA 1S5MA 3GY1A 3SB0A 4EX4A 4H9XA 4BF5A 3W7IA 4DHGA 1JDCA 1OX6A 5DMLA 3P67A 4ZO8A 2PP1A 1GOXA 4YL2A 4KQNA 4N9CA 4O1CA 5LIXX 3GRIA 4XUYA 2I1OA 1Q4WA 2WLYA 3DG6A 5DELA 5CEWA 2YIHA 4DWSC 3DXIA 2OYMA 5I77A 4JOMA 4GNJA 1IT7A 3HB9A 4NL1A 4E5TA 3LSBA 3S9YA 3XINA 1B57A 4Q4QA 4J3WA 5CZJA 1NF0A 5A94A 1HIZA 1EQCA 1HUVA 4JDBA 3A6OA 1GTHA 2ALRA 3UZYA 3EX1A 4GE8A 4HU0A 4ATWA 4UWMA 4Q8NA 4WXYA 2Q6ZA 4POCA 3T2OA 4C6OA 3CUFA 4QJ5B 1JEZA 3RILA 1RJPA 1S2TA 5H8UA 3VIPA 2GUBA 1FDJA 2BXYA 4P7RA 5HUOA 2L5HA 3K8KA 2V5KA 2HBXA 4L9YA 3L4TA 4YLWA 4ZL1A 2QMJA 3IIVA 1WZAA 4N02A 3WY1A 2BSLA 3ABRA 2P10A 5CZSA 4MYXA 3LPGA 1RJQA 3EA3A 1XBVA 1FFRA 3LCWA 3I68A 3L0GA 5GPRA 4LEFA 2ACSA 1E70M 1WAWA 2D0GA 2DVTA 1DWGM 4G1KA 4N6EA 3UJEA 3KAOA 4ZOCA 3H7RA 4TTGA 3EMCA 2IPGA 4XD5A 1NDVA 1VEMA 2WJEA 4FLSA 2NZLA 2R1PA 2NSOA 1IZCA 2OO6A 3U4AA 2X41A 5BU9A 2ZUNA 1HX0A 2VCCA 2IW0A 3C6CA 3VILA 3WDRA 2XPKA 3W2NA 1YYAA 1QJWA 2FZDA 3I3BA 3UR2A 4QS5A 2PU0A 3TOPA 4HPNA 1NJJA 2O55A 3KOXA 4X9SA 4UOJA 3TCSA 4AC1X 2DSUA 1XRVA 3GXMA 5EPDA 2NUXA 3ARVA 3ALFA 3LRLA 2A79A 3MMTA 5DCDA 3CUHA 3WD3A 4C6DA 3PSVA 1X39A 3N18A 5I5RA 3DG3A 3WFZA 3MT1A 1GQKA 4MJ2A 2E9LA 3R4IA 2AMXA 1CXFA 2VVNA 2H9AB 3VABA 1RPXA 3LG3A 4AD2A 3NYZA 4WDUA 1OD0A 4KWOA 1W9PA 4PSRA 4AZ7A 3W1UA 1PZ2A 4BQ3A 3VCRA 1PWLA 3SY5A 4BEUA 4ECLA 4E6MA 4YMZA 1R2RA 4C7DA 1OFDA 5EMYA 1ITQA 3PB2A 4H6EA 3EOEA 4R7OA 3QJAA 1WQ5A 5CKSA 4MSSA 4FLOA 2H9AA 1IGWA 1CIUA 4Z2GA 3QV8A 2DSKA 4YCOA 4JZ5A 2BY2A 4IMAA 1ZBVA 2WZIA 4QDWA 1HJWA 3KBWA 4FOUA 1TE1A 2RDWA 1VEPA 2V5DA 1G7VA 1XUUA 2QUTA 2P8CA 1UD4A 3LPOA 4XG1A 2WSRA 4GZ7A 3EWXA 3SM0A 2ZFAA 2CLLA 3U6WA 4WEVX 3NQAA 2DZTA 3WF1A 1M7PA 5H1WA 2P76A 1WB0A 2JIEA 5AYIA 2CKRA 2Z1XA 2DFAA 1TR9A 3PR2A 3NEHA 2C1GA 4LRTA 4ZOEA 1J96A 1FWIC 5FEPA 3EX2A 2V67A 4LUTB 1ZCCA 4LEQA 1WDRA 3DHPA 2BY1A 4QE4A 1UZ4A 3S6TA 4H3DA 3LB0A 2OZ0A 3S1GA 1Q6GA 3F4VA 2D2OA 2PEVA 2PFHA 5D8ZA 3I10A 3KOZA 3UVIA 2O4MA 4MWAD 4U33A 3KWSA 4L4MA 1G5AA 1LYXA 4I9AA 5HPCA 2YW3A 4NQ1A 4PCFA 1B3VA 1C7TA 2ATSA 4XAPA 1UH3A 4JX5A 4DJEC 4LUTA 1UH2A 2WKJA 1NFGA 2UY5A 3QMSA 4JTAA 3WQ6A 2VCBA 4LGXA 1LDCA 2VOTA 5I3IA 4MLJA 3EPNA 5K4ZA 3WL1A 1EO5A 1EZWA 4HGXA 4UTHA 4RPQA 3JUGA 4JBRA 3RN6A 4G8TA 3W7MA 1C93A 3HQ1A 4FR1A 2FZ8A 3WF3A 1AW1A 4EXAA 1KGUA 1WP6A 2Z27A 3FXYA 1MZHA 1VRXA 4GUIA 3IUDA 3GUWA 2ISSA 4LALA 4DZAA 5F4XA 3UW6A 3FHAA 3CLMA 3RYSA 1F3TA 1Q85A 3RRXA 1YNPA 3CYVA 2A3HA 4TVDA 1EA0A 1F4HA 2DZSA 3C0QA 3BG3A 1TV3A 4IP7A 5CBBA 1MUCA 3GNRA 3CQKA 4J3TA 1XV8A 3SDOA 3WQGA 4CD5A 3CASA 4JX6A 1TIWA 2FPTA 2PGWA 1E9ZB 3LI1A 1HKVA 3NXFA 1E9YB 4B4FA 3BTNA 4JS3A 4WDWA 3WLSA 2QJHA 5EL1A 4DNHA 1XLEA 3PBUA 5HWNA 3TIMA 4IH3A 1J8VA 3KBMA 1ELSA 1OCJA 1KGWA 2VC9A 3QQWA 5FJJA 2PDGA 3VOHA 4ZB0A 2GJPA 2KX9A 5AECA 3W82A 4E2VA 4IL2A 1ZJAA 3TYDA 5DMYA 1IT8A 3TQKA 4J3UA 2QKFA 4AIBA 4PRWA 1JZ2A 3LCIA 1J01A 4CVUA 3RUBL 1UROA 2PDBA 1NVMA 4IJRA 1ITUA 1Q4NX 3B0PA 5FI8A 4S1FA 3CO8A 4P7NA 4IMCA 1LL7A 3CH0A 4GIAA 4PMQA 5CXPA 4A2SA 2FFCA 2VD9A 1K8YA 4X63A 1XYBA 3NQBA 1R87A 4AWEA 1A0EA 1IIGA 5CH9A 5D2WA 1V8EA 1VENA 4D8ZA 4Z2IA 3OHMB 5XIAA 3EXTA 5D2YA 3PTQA 1PL9A 4DBWA 1GJUA 1KM5A 2YCKX 2WZEA 1NEYA 3H2OA 3FNDA 4K1GA 4LB3A 2DZXA 1YNQA 2PDQA 3TAKA 3W7CA 2EJ1A 5ABFB 3S1WA 2O9RA 3OLEA 4PMZA 2G3IA 2PWDA 2Z7KA 4QISA 5A6KA 1A50A 4WUIA 4HK5A 4QG8A 3QEZA 1NAL1 4JTTA 2WKGA 3L5MA 4ZGYA 3WJZA 3URAA 1ZJBA 4E8DA 2PCEA 2HROA 2DSZA 3NL3A 1KQZA 1SW0A 3EDDA 2AKZA 1WE5A 5F7UA 3UXDA 4XZLX 1MQRA 1NQKA 1DQXA 1HXJA 2W5FA 4M29A 3UQNA 1W37A 1DWFM 2XH4A 4GXMA 1FCBA 5GJPA 3U2CA 1O68A 3PPFA 4LY8A 4WOZA 3W88A 2QDHA 2OLHA 4D6GA 3W81A 5ABFA 1PUDA 2AAMA 4RX0A 1WX0A 1VP5A 2IMRA 2VX6A 1LLZA 2WQPA 5EBUA 3IIOA 1G6CA 3NDOA 4DYKA 3LCLA 4O50A 3QZEA 1NOFA 4E4PA 1JPIA 4Q32A 4PUJA 1GOOA 1KFJA 2V3EA 3TYBA 4Q4MA 4AISA 1UQYA 3RJXA 3VC6A 4H7ZA 3ES7A 4P8WA 3M0VA 3KBSA 2OPJA 5EU9A 3PULA 5AVNA 1D7KA 1J2WA 4URIA 3EPMA 3OLDA 3LQGA 2UY3A 3WLLA 1XIFA 1VLWA 3W7JA 2BZNA 5KZMA 1FWRA 4F0SA 2BHUA 2BGQA 5REQB 4JN7A 3WQVA 4WX2A 3DFYA 4CQAA 1TWDA 3GDRA 3VD9A 4IGSA 5HR6A 4UCFA 1R8LA 3SRDA 4D6CA 1HP4A 3SCOA 1OHLA 5G1YA 1ZRQA 3WUFA 4Y9PA 3O6YX 3CIWA 3N11A 2WCSA 3TJIA 1A5MC 2A3LA 4LAUA 3B9NA 4QM1A 2GL5A 2P8BA 2FKPA 1EH9A 4UQDA 2Y7EA 4LVGA 3ITVA 1I60A 4Y8EA 3E0VA 1HJVA 5REQA 3T81A 3JZEA 2XVKA 3A9BA 4RZ5A 1V0NA 3N9SA 3TC6A 2VELA 3NA8A 3BV4A 5AC8A 1W3LA 4DAFA 3ZZ1A 4Y2WA 1XIIA 3WUGA 4OVXA 1V0MA 3RMJA 1SZGA 4KGLA 4LAMA 3QLLA 3R8HA 3SY8A 3H54A 1V3LA 4B5NA 3MZ2A 3EA1A 3WQOA 3QHMA 3E0IA 3ENLA 1KFKA 3VIHA 1VCFA 3T0BA 5BRBA 1LBFA 3SO7A 3FCPA 2PWHA 4ZB2A 4FX8A 2YDAA 1IYXA 1KTCA 1J0HA 3M16A 3G1HA 3AWNA 4KIRA 3V0UA 2R6OA 1EJWC 3EZ4A 3CV1A 3LU2A 2G3JA 4LH8A 1YMYA 2WSKA 4GYJA 2O92A 3B4UA 3SIMA 4B9YA 1AUSL 1OG0A 2VD8A 2OX4A 2OKOA 4N9EA 3MI2A 4OU1A 1H7XA 4JFSA 1GG0A 3FDGA 3C56A 4ZZ9A 1MXDA 4GABA 3H4WA 3SN4A 1TWIA 4GX8A 2NQ9A 2Z1BA 3DENA 1NDYA 1JUEA 1BWLA 4HSOA 5JQ9A 3WBAA 3GTXA 4XO7A 2WMKA 2QNEA 4FX7A 1VFTA 3TJXA 2WXDM 1QNVA 4MDOA 2WWDA 4R85A 1JG9A 4N9BA 2PD9A 2H3DA 1HKKA 4RZ4A 3W26A 5T9CE 3BL3A 5E6ZA 4N4PA 3JS3A 4J2PA 5ABGA 3MJMA 3W74A 3PZQA 1JDDA 3RPMA 1RQEA 4Q7BA 3OA5A 1IXOA 1VBUA 5KMYA 2PDMA 4JQ2A 4JQ4A 3CYJA 3MP4A 3DERA 2E25A 3M0ZA 2EKGA 2OYKA 4S3FA 3BAXA 1Q2SA 3AJ7A 3CUZA 1KXQA 4PMOA 1OX4B 3PBMA 5L9FA 2CYGA 2XTKA 1JF6A 2NLIA 2C3ZA 3CH9A 1V79A 2IPJA 5I3FA 2DPEA 1DYSA 1SW3A 1R3TA 3PF3A 1TVPA 3PFMA 2OU4A 4NIRA 4IMFA 3QPZA 4KRTA 1ME7A 1SZRA 3WUBA 3C61A 2IQTA 2ACRA 5D05A 5ABHA 4UBPC 5AYZA 3ARWA 2HPIA 1L8PA 3STPA 3UYCA 3N25A 4LW7A 1OX4A 3S2MA 1M3UA 2XIQA 1XIDA 3TN3A 4BQ2A 2Y7GA 1EJTC 2QUMA 3G8RA 5TNVA 2P88A 3A12A 2NXGA 1X6LA 3NPWA 1R2SA 4Z2HA 1M5WA 2ATMA 2VR2A 4Q33A 3ARXA 1VYPX 3HQNA 3IJ6A 3PBWA 5CC3A 2YXXA 2J4GA 3RIKA 3CMGA 4BKNA 1NFPA 4KERA 1J0KA 5XIMA 3W7NA 3H8AA 3LLXA 4KESA 4H9YA 2V81A 3B0UX 3MPGA 1JF5A 1QHPA 2B7QA 3AIQA 3F03K 2J62A 5FJOA 4AWTA 1PZ3A 1PSCA 4G7EB 4NJKA 1V6YA 1ZU8A 1YQ2A 4QQ3A 2HV5A 4X60A 2PGFA 1OFEA 4GOAA 3F5JA 1XUZA 3AMDA 1XS2A 2WOQA 3ONBA 5D9PA 2ZX5A 1IR1A 2Y2WA 1FBAA 4W4QA 4HK6A 5LXXA 3DHFA 3SJNA 1CLXA 4EIVA 3DFPA 4ALDA 3OIXA 2PTWA 4G7EA 3T6CA 3CT7A 2Y85A 5DMMA 4F0RA 3KDNA 5EYWA 3WMCA 1G67A 4IFOA 2OQYA 1FXQA 3EDFA 1E4NA 1EJSC 1ICPA 2WC7A 2R1LA 3BMXA 2VZVA 3HPXA 4L56A 1QUMA 1FY6A 1K7XA 1E6XM 2CLFA 3RLGA 3R11A 1BQCA 4P7OA 1C8VA 4J28A 2E0PA 3H2NA 5CZTA 5D2VA 2QCEA 2OG9A 4LTSA 2D2GA 3OGSA 2A0NA 1MO0A 1O66A 1H2JA 1I4NA 2NV2A 2YOCA 3GFYA 3NL5A 2A3CA 4RLIA 4AY7A 2V69A 4QQUA 4NILA 4S3BA 3FY1A 3ZFHA 4QAWA 3BG9A 4C6IA 4LNYA 4BF7A 1Q2RA 3QFWA 1R3VA 1KM2A 3GUGA 4INFA 2ZXDA 5F2MA 1YHTA 3GBEA 3VD7A 2Z26A 5AZ0A 3NM1A 2E5DA 2WW5A 1XRSA 4J5NA 2QLYA 5A8QA 3GNNA 3FEQA 3HMCA 4FP1A 4PRTA 3WBEA 4H9UA 4M8UA 5CCZA 1W3NA 4DUXA 1DVJA 5JU6A 1SSGA 1DWHM 3EDJA 1I1XA 2GOUA 3B40A 3KBVA 2Z7GA 3MWAA 3AXKA 1W3IA 3ONCA 4C6NA 3LHVA 4JIRA 4QHRA 1E71M 2QZRA 1F3EA 1XDMA 3IVUA 1KFBA 1LUCB 3WX7A 4C6LA 4O10A 1Q7QA 3OVQA 1AA1B 5I3HA 4Q6XA 3AALA 2W9MA 2O9TA 3OIHA 4HU8A 2TAAA 4A8LA 4S39A 3LD5A 1SUXA 3FYPA 3NNTA 1Q8JA 4L7ZA 1MUMA 3ARTA 4O4WA 1BYDA 3RK8A 3BLLA 2YCJA 1KCKA 4DPQA 2CZVA 3MQTA 4KW2A 4MHBA 5KETA 2RAGA 2YPIA 1LUCA 1YNYA 2H8ZA 4PCNA 4UNIA 1EFZA 2R8WA 3U48A 3ID7A 2D69A 1E15A 3H23A 2XSBA 4D6EA 3GX9A 7REQB 3LHZA 5AHMA 1Z48A 2PWUA 1FWNA 4LQ1A 4R88A 4AEFA 3KLKA 2ADAA 3TP4A 1LCOA 1GKQA 2J8TA 3K2GA 4AWSA 2H6RA 4MZ8A 4HMCA 3CV6A 1KLZA 5AYYA 3CGTA 2G3FA 3VDAA 2BMBA 4MB1A 1WOAA 1E0VA 4PMYA 5J5DA 2OEJA 1GOWA 2I5GA 2PGEA 3G0UA 1CI1A 4F66A 4GPNA 4NXKA 1DIDA 5JIPA 4P8XA 2E67A 1F05A 3AI0A 4MWAC 3SRHA 4D6FA 2J6XA 2JKPA 4LWWA 1E6ZA 5G2HA 2J7EA 3BLFA 4M51A 4J35A 1JCNA 7REQA 4Q6JA 2JKEA 1CGVA 3SCQA 3CQIA 2XG9A 5LXEA 1XSIA 3LA4A 3DZ1A 4UNKA 2ZKMX 4Q7NA 3CL6A 4B3ZA 1JD9A 5JBFA 1X6UA 3VKJA 1WOBA 1M9HA 3GS6A 3EKGA 4UFHA 3ANYA 3GH4A 4WVXA 4FOKA 3GG0A 3PG8A 1BGAA 1R7OA 1OFOA 3CPRA 1I2PA 4KWUA 5D2XA 4PUDA 3GHSA 2NWRA 1HJXA 3GSMA 1KGXA 3SSJA 4IL0A 1LRQA 5CZ0A 3MUAA 1CXLA 4JTFA 1AVAA 4NF7A 1RP8A 4ERIA 1CXIA 3B3DA 5A95A 3TA6A 3N04A 1JYVA 2GVLA 1UR3M 1XLFA 4M6UA 4X9YA 1EJ7L 2AQWA 2VRJA 3B0YA 1S1PA 1V77A 1KBBA 1UMYA 3A9IA 3FK4A 4F9JA 1TPEA 2CBJA 5C9UA 2C1HA 1EEPA 3HGOA 3EYPA 4J40A 1H09A 5DCEA 4NNCA 1PTGA 3S2LA 1UHVA 2TYSA 2QW5A 3FS2A 3Q94A 1VF8A 1ZSXA 1IEIA 1RR2A 3NM3A 4EK7A 3A4WA 3DX5A 5CG7A 3DECA 3HN3A 1OFPA 1FWWA 2PDLA 1V6VA 5F1VA 3PJTA 1TV8A 3C8FA 2ZCGA 2BTMA 3VI2A 4O18A 4IIGA 3DDMA 1WKEA 2KAUC 1V4YA 5DBUA 1EBHA 4YPJA 2V5LA 3MYOA 5F2IA 4CD8A 4UTUA 2I56A 4LCQA 2GVGA 2X1IA 4N2YA 5BXTA 2POZA 1KC7A 4CU8A 1VQTA 4QEHA 3LERA 1DL3A 4JKMA 4XZBA 4U31A 3DAQA 5EMLA 1PXGA 2P5NA 3TCEA 1CBGA 3ELFA 2PBOA 3S4TA 2NQZA 3O05A 2DUXA 3BPWA 4L65A 1S3HA 3GDMA 4REQB 4U2YA 2HJPA 5EMKA 2YA0A 2QHAA 3WNPA 1VC4A 4AYGA 2W3ZA 2I57A 3MHFA 4PUNA 4IIHA 1E43A 3VCNA 4XZNX 3WZ0E 1R6WA 2A2IA 5AHFA 5LSMA 3N2OA 4PGLA 1OM0A 2QUNA 4GKTA 3EKZA 1PIFA 3B4YA 4J27A 3K13A 2RDTA 3BAIA 3RG6A 2X1SA 2VFEA 1Q66A 4LV4A 4TX8A 4CNTA 4DLMA 3LMZA 2CLMA 5HBFA 2PDUA 4M7SA 2JKAA 4C1LA 3FSTA 2B81A 1QBBA 2GK1B 5K4XA 4REQA 3U2EA 4R5EA 4UTMA 1F2JA 5A6SA 1AQHA 5I23A 4H8NA 3ZWTA 1W1YA 4AXKA 4B3LA 2R1NA 1L8NA 3BLIA 4PFHA 3W2JA 3UG3A 5A5WA 3MJYA 4DF1A 3LLDA 3MW7A 3C2EA 3HA1A 3QQ0A 1SFTA 1A5AA 4Q8UA 3STCA 2GVYA 1CECA 1US2A 3KVJA 1THFD 4YTUA 2JBMA 5FA5A 1S39A 1R3SA 4WXZA 1TO3A 1YDNA 5KSWA 1CENA 4HNLA 4M56A 1W9XA 2GK1A 4A8RA 1XGZA 4XVDA 3M47A 1PHWA 4MUZA 2FB3A 2ZE3A 2Y62A 5RUBA 2W92A 5BZAA 3W7RA 1DXIA 3GKAA 5TF0A 4UR7A 3WQCA 2VJXA 5BWFA 1NP0A 3SJ3A 7ODCA 5FSEC 2ZXQA 1SZNA 1XYLA 4AZBA 1YDOA 4RDZA 4FNTA 2ZE0A 1A49A 1W17A 3CUJA 2ISVA 1PX8A 5TQLA 1A80A 2C1IA 4G9PA 4HA4A 5FJTA 4C6QA 3AIEA 1WBJA 3QPYA 3DI0A 1VYSX 3B06A 3E12A 3THAA 5LA0A 4JY9A 3DYMA 4KH2A 2RGLA 1W8SA 3WK2A 2EPHA 2J7GA 3QTPA 1W9UA 3V75A 5CPNA 5A8PA 3AXIA 5A8GA 3QW4B 4B15A 3KHJA 3VFLA 1H11A 4IT1A 5D30A 9XIAA 3H6OA 3U7BA 1QW9A 3MKKA 3DFQA 5JMUA 5BW6A 2A85A 3S47A 1XL9A 4AWUA 4CNUA 1AL7A 2WV8A 2Z0IA 2P3EA 1JDAA 1O6IA 2J7HA 2DZWA 4US5D 3ARPA 4CEXC 2FTPA 3SUTA 4JTCA 4ORMA 2CERA 4J4KA 2VVSA 2PA6A 2EPOA 4UCGA 3STFA 2O56A 3UBPC 3TTOA 4FMVA 1VJIA 2ZUMA 3LXAA 1F8IA 3W87A 1CGTA 3ORWA 4LOCA 4QSHA 3EBVA 2E6AA 2VFHA 2XIIA 1XYCA 1V3KA 5AFDA 1E4LA 1XLCA 1XCFA 1BXBA 2DH2A 4NI3A 4X0VA 2H8XA 2PDYA 1BVNP 3EOUA 5LIYX 3AMKA 3LRMA 1QI0A 4NU7A 1AJ2A 2O9OA 2I7GA 1FKWA 2EPKX 4HCLA 3IIXA 2DVUA 4BI7A 3Q65A 1UC5A 3ZLFA 1R30A 4UTTC 5A6AA 1Z3NA 3WL0A 3EDKA 1I2RA 1KR0A 3R12A 2GGGA 4DXKA 3MKCA 4UFJA 5U4NA 4ERAA 3WEOA 5DO8A 4S3JA 1AW2A 1KCZA 2YXOA 1QTWA 3IV3A 3CEUA 3IK2A 4B91A 4C6JA 3KTSA 4FXRA 3KX6A 4I90A 1FWHC 1P7TB 1OWQA 3WH8A 2ZRZA 3VO0A 4CN1A 1LOLA 3WH5A 5H91A 3BQ5A 1BVZA 3WLQA 1JPDX 4QITA 3K30A 4NRRA 3RU8X 3UU0A 1TPFA 2E9MA 1UH4A 4W5UA 1TTIA 1V3MA 4O0KA 2OGJA 1UA7A 2YB1A 2I5IA 3VOCA 1XX1A 4XIAA 1TMLA 2E1WA 2QCLA 4MFEA 3GYEA 2CXGA 4QAIA 2HMCA 5E1QA 4JTJA 3GC4A 1XLIA 4NKCA 1P7TA 4AZ5A 3OYZA 2QCCA 4JIPA 4D9PA 2W4XA 4RE3A 1T41A 3KLLA 3WLIA 4MWAE 1PJ9A 1H61A 3GU9A 3AWOA 3GTIA 4R7WA 4ZQRA 1XWYA 1K70A 2ZRXA 4GYKA 4H6QA 4GK8A 2X0YA 2X1RA 2INZA 3OW1A 4XD4A 2HDJA 1UJPA 1WDPA 5C9XA 4US5A 4B5SA 1S38A 2QDDA 2QJNA 3E0WA 1GOKA 4HBKA 2D2HA 4ZQNA 2QVNA 5ECUA 4AIOA 3QR3A 4QNEA 4PTXA 4PCSA 2QJGA 3RITA 1FUYA 1I1WA 3I3EA 2X2GA 4NX5A 5DT5A 2FGBA 3UWZA 1JRCA 3SGZA 3JR2A 4EPDC 4GXWA 4S2CA 3OQ8A 4HU4A 4I7UA 4GQRA 2YL5A 4BJHA 3B9EA 4JIIX 3UVAA 3VNJA 3LV5A 2PF0A 3S8HA 4XO6A 3NQFA 2V5BA 2DVXA 5M1TA 1QI4A 4EPEC 4JTQA 3ITXA 3LZ5A 4P61A 1KRCC 4JN8A 2WPBA 4HVXA 4IFRA 3WLHA 4UMBA 4US6A 4XZMX 5DN1A 2ZX6A 3QVQA 1KB3A 3B0VC 2ABAA 5D32A 3S2NA 4KWWA 1GOIA 3PK7A 4XAFA 4NZCA 2VDHA 3FJ4A 2V6AA 1QO5A 2EAWA 1NQ6A 3WDJA 1HTIA 3FVMA 4LU0A 2C79A 1Q5MA 4MM1A 3EA2A 4FXJA 2QPSA 3GIYA 2FMOA 2PD5A 4FR6A 2JF7A 3UG4A 2C91A 2Y61A 3CEPA 4ZQPA 4O13A 5E6YA 4M81A 4NYYA 2YA1A 5DY3A 4HYRA 4IM4A 2HPMA 3BJTA 4XBJA 1YTKA 4DUWA 3F1QA 1PHQA 5A1AA 3C4UA 1HQTA 1TCMA 2GVJA 1PKYA 3LPFA 1SR0A 3GQYA 4UTWA 4EOUA 2OZ3A 2ZVIA 1GG1A 4PH6A 4DX3A 1YE4A 3K46A 2B31A 4KEZA 4EAMA 3QBUA 1C92A 3IGSA 3H21A 3SFWA 4B90A 1TKKA 2X0SA 3EGJA 3FIGA 4I5UA 3HG2A 4NG3A 2XGZA 1S2UA 2TSYA 1KM6A 4LS2A 2VZTA 3UZJA 4EPBC 3NQGA 4PE8A 3VNZA 4S3EA 1P6CA 2GSHA 3EWDA 3UA4A 3T8QA 3XIMA 2IKHA 4PBEA 1FCUA 1WUEA 4FXFA 2E6DA 3PFRA 4K7VA 4XUGA 4KEVA 3TTSA 2YDQA 3AYTA 2J13A 1SFLA 4RPPA 5D04C 1OYBA 3TVAA 2OJPA 4WLCA 3A4AA 2J9YA 2A5HA 1EX5A 1PV8A 4A8IA 2DIEA 4AB4A 5CSRA 2ZWYA 3WLTA 3WQ4A 4YN5A 2ZWZA 3AYSA 3TOYA 3IJ7A 1UR4A 2HS6A 1W5PA 3M0IA 1V3JA 3VNKA 3DEQA 3EMZA 1MQQA 1E55A 4WDXA 5BYWA 1V6XA 2OO0A 2RKXA 3EX6A 3N6JA 5SWUA 3FAXA 4L9ZA 1MW3A 2XN0A 3IRSA 4HJFA 1TRDA 1T0OA 5DY2A 1ECQA 1HKMA 1XD1A 5CLWA 4BWLC 3FA4A 2QULA 3R8GA 4V15A 5EFDA 1ZB5A 3AQUA 2VGFA 4MDPA 1N8FA 2JE8A 3VUSA 1LRTA 3QV9A 1QT1A 1RY8A 3MHGA 2XH7A 3GXPA 5FCZA 4ADSA 2XVPA 1H0GA 2CLHA 3TJLA 3AMGA 3A4XA 4J3VA 4CD4A 3QGAC 2XSAA 4HPHA 3RGTA 3ECQA 4B5VA 1V02E 3CQHA 4JTUA 2DSWA 3R6IA 4W5ZA 2PU1A 3PVFA 1NWTA 4MIMA 1JAEA 4BQ5A 4ZEPA 4WY0F 2VP8A 4TO8A 2GQ3A 2PGRA 1BG4A 2RUSA 3W4RA 5I00A 3ZIZA 4N0RA 3E5BA 1B3XA 3U0HA 1FP9A 4DJFC 3GTFA 5BXSA 3MCMA 1H7WA 2Y6ZA 1T96A 5BNKA 3N29A 4JL1A 3FXGA 5LNVA 5CJMA 3MTWA 4IIFA 4RV8A 5I3GA 2XJ7A 1YEYA 1UCWA 3OVGA 1N55A 5CGMA 3KDOA 4E8GA 5JBEA 3E2RA 1DHPA 3M4HA 4MB3A 4AZGA 5EB8A 1KM4A 2BLEA 2C19A 4GI6A 3HQOA 2E68A 3LM3A 4YCPA 3CLWA 3OG3A 1B2YA 2YCEA 4RV3A 2QR6A 5CQ1A 1PTDA 1RD6A 3LGDA 3WF2A 2OEKA 3G24A 2W62A 5GNZA 1QW7A 2BGSA 1FOBA 1I6NA 2AGKA 1UR2A 3QZ6A 3L4ZA 2C18A 1UKTA 3W7DA 2Q01A 3UERA 2HWGA 4PCPA 1H7PA 3HOJA 5HINA 3P8IA 1GJWA 4PEKA 1B9ZA 3AHVA 1DP0A 5KZDA 1MEHA 3B0XA 4K3ZA 2WVUA 3KL0A 1JPHA 4LB4A 4ZSUA 1M68A 2QDEA 3M0YA 1TFVA 3N2BA 2FIQA 4M5PA 2PZ0A 2QCHA 1DWIM 3UETA 3ARSA 4AW7A 1POKA 1UWAA 2XH0A 3BW4A 2XGBA 3VE7A 4Y6GA 3VDBA 1OZMA 1EBGA 1KCLA 1Q45A 4JFUA 2VFGA 3M46A 2OODA 5HAOA 1GQNA 2CXEA 3N34A 3LY0A 3URNA 3W2KA 3FJNA 4HMNA 1UD3A 4XVEA 4GC4A 1TWWA 3UF9A 1SO6A 2IPWA 3BW3A 5CGQA 4ZTXA 2GFTA 4WSKA 1YKWA 1EL3A 3VIIA 4UZUA 3SBFA 4DI8A 2CFFA 5I79A 4DWSB 3URBA 2HE8A 2R94A 4RW3A 4B9ZA 4HA0A 3BLOA 1PVNA 4P8VA 2WVSA 3VDGA 3HPZA 4IXXA 1RLDA 4IJBA 5AYBA 2OSXA 3OZYA 4FK9A 1G9HA 3T0CA 1W5OA 6CGTA 4M7TA 2OYLA 3KE0A 4UR8A 3BE7A 4MFDA 1YPXA 3W72A 5D09A 3PWIA 1QK2A 2EGZA 3UA3A 5FOOA 2VEPA 1JNDA 3DHDA 2I9EA 3WD0A 4ZODA 3EOSA 2BGNE 1LJYA 4DWSA 2OEMA 4OWGA 2NVAA 2PLKA 2NQ5A 2WQDA 2E77A 3ZSTA 1GQIA 2ZQ0A 4O28A 4UB9A 4NZ3A 2X30A 5JIWA 6REQB 3HPSA 2XIOA 4MG4A 3PAOA 1HJUA 1P0DA 1GT8A 1S2WA 1BTMA 1KRMA 3ABXA 3AYVA 1F76A 3Q45A 3B9DA 3UD6A 3VKAA 2NVCA 1ISZA 1NY1A 1OFQA 5BU6A 4MPQA 3LGEA 4FIQA 2PLJA 4I6VA 4NX0A 3ZJKA 3FW6A 3VGHA 3WQWA 1PKLA 5CG0A 5DEZA 4A29A 5A2AA 3HO8A 2R1MA 3TYAA 2A3BA 1I75A 3HU7A 4NXSA 2CZDA 4O1DA 2VWSA 3FAWA 4WF7A 6REQA 3LHWA 3F4CA 2WCAA 7CGTA 1A3WA 1CGUA 3MUCA 1ZL1A 1FHVA 4F2UA 3LK6A 4H9ZA 1J93A 1YLVA 1RA5A 3SQLA 2GDUA 1AZ1A 3UWYA 1ONRA 4A3QA 4I8YA 2VGIA 1MZRA 3CBWA 3QLDA 4HCDA 2J7BA 1EZ2A 4Z08A 4IISA 4RR4A 2ESCA 3R0UA 1P4CA 3V7PA 3BURA 3H53A 1G69A 1ZAJA 1BLIA 1XINA 1CGXA 4C65A 1OBAA 2YYTA 1BEUA 3UWVA 3GTNA 3R25A 1BAGA 4J3SA 4RNFA 3SCRA 2YKKA 3WD4A 3IEBA 3GH5A 2FHCA 3N4EA 4C60A 1GORA 4O12A 4OT7A 4P8UA 4XTIA 3CK5A 2TPSA 3H12A 4HCHA 5G1TA 3UP8A 1E3XA 1PDZA 1QOXA 4KMQA 3ZS4A 3NWRA 3DC8A 3HJZA 1WV2A 2CNCA 1G1YA 4XWUA 1KKOA 1VFUA 2PSNA 4HA3A 1OT1A 4XAYA 3PZUA 3VX0A 4CCCA 3A24A 3KWXA 4IUGA 3TC7A 4KRZA 3L9CA 4DRSA 5CPTA 5AC5A 4NVTA 1NFBA 3MY9A 4H04A 4K36A 5K3VA 4CNSA 1Y8BA 4JCMA 3TMLA 3VCCA 1TPWA 4IOTA 2Q8ZA 3W23A 1A5LC 2A7RA 4OBSA 3HTWA 1S5VA 2BHZA 4IQEA 4HZMA 4GIEA 1XIMA 1UWQA 4TV6A 3PZOA 5FF7A 4MNJA 3ITTA 4DM1A 3W53A 4OUEA 5FESA 1S3TC 5E93A 1QRQA 3WIJA 3ZT7A 2G8ZA 2HVOA 3ZVHB 5AZ1A 1XPGA 3NYDA 4YHGA 1NU5A 4E38A 5IFPA 3TQ0A 6A3HA 3V0TA 2DJLA 3ARRA 2PZNA 1UJQA 3VGEA 1ZTVA 2ZZ4A 1CNVA 1OB0A 1YPFA 3ITOA 3VMNA 3V16A 1OJXA 1J0ZA 3K4DA 2H90A 1GZGA 3P3BA 1PS9A 1NH6A 2WMGA 2C14A 4H7VA 3SUWA 1H1NA 3KHDA 3WMBA 1X7FA 1XCXA 2CHRA 1JDFA 2VXNA 2E3ZA 4WKFA 4UZSA 3T08A 1XLJA 3K5XA 3UNDA 1J0JA 1UOZA 3HJEA 1KXHA 2ZX8A 1JZ8A 3UWUA 2ZZ3A 4TMCA 1RH9A 3AJXA 3OTRA 4O54A 3VU2A 3B97A 5E9XA 1BGGA 1EDTA 2Y89A 5A6BD 1R2TA 4CEUC 1PWMA 3H4XA 1H51A 4O0QA 3A3WA 2HSAA 1ZALA 3M44A 4N42A 3G1VA 4YTSA 4M6QA 4V2XA 3C2RA 1EGZA 5H2ZA 3L4YA 2GWGA 3R58A 1SJCA 4ROQA 2CIPA 3H70A 4ZFMA 4W87A 1AZ2A 3TONA 1E5JA 2E8YA 1MVYA 1I0BA 1XKYA 1ODZA 3M5VA 1EC7A 3VGGA 3OO2A 3EKLA 1W3KA 4AH7A 4ZTYA 1EP1A 4PRRA 1DQUA 1P0KA 2J88A 4ZFCA 4TTUA 4NZ4A 1H0IA 1HN1A 2QCDB 2OT0A 4PUWA 4U3CA 1ADOA 4W89A 1SVDA 2ABBA 3OU8A 4MZ1A 4A22A 1YX1A 1JRBA 4ZQCA 3KL5A 3M0JA 3L7RA 1JULA 1VAHA 3E2VA 2I14A 3DG7A 3CUXA 3CAQA 1UQZA 3URQA 1PIIA 1QO2A 3UCQA 2X16A 5HUPA 3WH9A 4C91A 3W71A 2ZUWA 3OPSA 1BXNA 1BF2A 4M1RA 3TXVA 4AIEA 3W6LA 4JTIA 2QCDA 2NX1A 3T2QA 3WLJA 4E2OA 4V33A 4LVBA 1UKSA 4IWWA 4CCDA 1JGMA 3C86A 5DBTA 5CC6A 1OCBA 1SMAA 3TNBA 2QUVA 3V5FA 4L6DA 4GJIA 3RXZA 3GXFA 4AHOA 3DI1A 3ZR6A 3L65A 5J5RA 3MU7A 2PDWA 1M1BA 1BWVA 2CCRA 1G4EA 4O57A 4Z1DA 2F6UA 5LIUX 1V0KA 2PRLA 1VFSA 3DFTA 1I2QA 2EQDA 1H7RA 3UG5A 1Q3NA 2V2HA 2VEKA 3FV9A 4GVGA 5M2FX 3GHUA 1J18A 3NVDA 3ZJ8A 4FALA 4CQ9A 1IWAA 3V0SA 1M41A 5I09A 1A3XA 4MJMA 2GYIA 1M7OA 4DYJA 1EC9A 1RZMA 4QG6A 3NIYA 3S3GA 1EX1A 2GVEA 1HL2A 5EGRA 3GO2A 3XISA 4WJEA 1FWBC 1NOUA 4GX9A 2DJXA 4PTMA 4A6GA 3MUXA 3QRHA 5AYXA 1C7SA 1UWRA 3KVKA 5JBDA 3P5YA 3THQA 1JYWA 3BZJA 4LBSA 1Q6CA 4YXGA 1U5JA 2QCNA 1S5NA 4UQBA 4H9TA 3CV2A 2VYOA 1VCVA 1UD2A 4RDYA 2REQB 4A35A 3ZVIA 3N14A 3BZGA 4GQBA 1SU5A 3S5SA 1H60A 5C7VA 1H62A 3L66A 3NR0A 1HVXA 1L2UA 3VZYA 2WVVB 1JIBA 3OZMA 1KV8A 2C0AA 3SR7A 3IIPA 1WAUA 1EP3A 4PZVA 2RGMA 3STEA 4HOXA 3NG3A 4QJ1A 4XD6A 1VFHA 2WNNA 4RDWA 3O0FA 3G18A 3PZMA 4FSAA 3DHUA 4LS1A 4O8AA 5DCBA 2REQA 1Z44A 2WB5A 2W91A 5HMFA 1MYRA 1CTNA 3GU1A 3NUKA 3HGSA 3CZKA 3CHDA 4QTGA 1LORA 2DEPA 3RR4A 4W85A 3RX3A 2WVVA 2Q02A 2W67A 3NOYA 3W73A 3K1GA 3TWBA 4OECA 1UR8A 3ZQ9A 4JIQA 4MJ4A 1L6SA 2BXZA 3O7UA 2F6XA 3OBEA 2IPFA 1PE1A 5I3JA 3CWNA 3NQMA 4ILSA 4XKYB 5BCAA 2XM2A 1XG4A 4AYSA 4PMVA 3RM4A 1B30A 1XXXA 2RH9A 2VT0A 4XV0A 4C7GA 3BCFA 2C6QA 3WJWA 1AH4A 1MNSA 1WNOA 2Y8UA 2ZUVA 4MYAA 3JU2A 4GBDA 3WN6A 4AIUA 2E6FA 1SM9A 1E40A 2BS9A 1FDZA 2FHFA 4UQAA 1YTDA 5ENLA 1H50A 1HKWA 3SCWA 1QWGA 2G95A 2XH2A 3GD6A 1TMQA 3E96A 3PBYA 5HJLA 4C6EA 1WKYA 1T8QA 1XLDA 4AVFA 3BGAA 3NQ2A 8XIAA 4GD0A 2NX3A 1UD6A 1WYIA 4KCWA 4XKYA 4BS0A 2WHLA 3A22A 3EXSA 4HNUA 2PDIA 4FOJA 3GR8A 4WY0B 1W32A 3H24A 4NASA 3O0KA 4GVIA 4HZ8A 4A3UA 3T42A 3EMQA 3QHOA 4Q4SA 2BVYA 3A5FA 8A3HA 2QJJA 2Z29A 3SRFA 3COTA 3LMYA 2XWEA 3IGXA 5HNNA 4DAIA 4I9MA 3CHVA 3WH6A 4R33A 1N8WA 1L6WA 1T99A 4KWSA 2YL6A 2CLKA 1CPUA 1QPKA 1D3GA 3AUJA 3CZ8A 1CYGA 1CGYA 4IUOA 2FLIA 2C7FA 1UWUA 4WY0A 3AIRA 4GA8A 2DQWA 1QWKA 4FA3A 2Y63A 3ABZA 3AS1A 3IRDA 3PZNA 1IXPA 3A5VA 3QYQA 3KP0A 1W3JA 1BPLB 1AFSA 1AH0A 1UPPA 3DBNA 2G37A 3WQ5A 3PZTA 4YVXA 1P1MA 2X2YA 4Y9AA 2MNRA 4OE7A 4PTNA 2VOMA 5C0QA 4BF9A 5CPQA 3UR5A 4KEUA 3TJ4A 3EB4A 1UZ1A 4ZBCA 4Q4PA 1MW0A 4LY4A 2PUZA 2WZMA 3EEZA 1TPB1 1ADDA 1F6KA 2FTYA 1KM3A 2FJUB 4H2CA 4Q4RA 3WF0A 3UZXA 1B0IA 1D7FA 2QGHA 4JR5A 1EHNA 1K7EA 4AY1A 1PCKA 1GVYA 3CB8A 1H1YA 4WDTA 1O1ZA 1TPDA 2J74A 1H7OA 1DQWA 3B8SA 1GONA 1NIUA 1DE5A 1B3WA 5C71A 3IAQA 4GCXA 1MUWA 5T8GA 3WEZA 2Z2BA 4JFTA 2ZZ1A 2X42A 3GVWA 1EB3A 3AZTA 2E5BA 1E0XA 4XKMA 5F4SA 1P5BA 2OOFA 2VO5A 1LT8A 3QHNA 2GUYA 3MDUA 1DHKA 4PMUA 3RCMA 4DB7A 3W38A 8TIMA 2DU2A 3PZVA 5HMDA 4TVCA 4JICA 3DUGA 4NYUA 1D2KA 4Z2JA 1XRTA 3M0KA 5LIKX 2F84A 4JL2A 4QE5A 3VM5A 3V4BA 3M9YA 5J04A 1XHGA 4LYRA 1U1JA 2VWTA 3NJ3A 1B31A 1Y7VA 3BCDA 3RO8A 3P14A 4GINA 1C90A 3LBCA 3V5CA 1XR2A 4ACYA 2ZZ5A 6ENLA 4QRNA 1EPXA 3GDTA 4PMNA 1E0WA 4KPLA 4TV5A 5C5YA 4U5KA 3TSMA 1ME9A 1RA0A 2IKIA 4AMCA 2P50A 4AX6A 5CPOA 4PB4A 1LTDA 4HMDA 4HD5A 3F2CA 4V27A 3QR0A 3RLVA 2J7FA 4YNGA 4C1NB 3SECA 1X96A 1HJQA 3E5PA 1EXPA 4V1YA 5EY5A 1WCGA 2OQLA 4D1IA 1QPRA 1UKQA 2O9PA 2J75A 1RD5A 4BHYA 4UR9A 2OOGA 5CGTA 3UXIA 1FX6A 1W1IE 4LJ3A 1G4PA 2GDVA 1S2AA 2E40A 1MW1A 3NGJA 3KW3A 1VHNA 3WG6A 3SRKA 4MNKA 4C1NA 3V3WA 2YBTA 3MA8A 2QCFA 2CHOA 3CAVA 1A4MA 2QDGA 4P7LA 3DN5A 4AVOA 1J6OA 1XKJA 2QIWA 1MSSA 2PTYA 3VD4A 2OGYA 1KFWA 2WMJA 1XGEA 2MUCA 2Q8LA 1V3HA 3WFLA 3GNXA 5AN7A 2OT1A 1FWFC 4YYCA 1TX0A 4HKPA 3II1A 1AW5A 2DDXA 3GZAA 4IMEA 3B8IA 5FAJA 1WO2A 3GAYA 1VJZA 3T07A 5HQLA 4M1BA 1GZ1A 3I4EA 2CBUA 3IJQA 2J9ZA 4ML4A 5C9RA 1LWJA 3ZJ6A 2WVTA 4GUGA 5A6LA 4GVHA 1GYMA 2PWFA 1OG6A 1B54A 2FMNA 1YXCA 1DWAM 4NRSA 3W70A 3TC3A 3PWGA 2ZRVA 5I06A 4LX4A 2BB0A 4F2BA 1LZOA 3TSDA 1VEOA 4KWVA 4EAYA 1DJYA 1W1A1 5JXQA 3QN3A 4F48A 4X2RA 3A47A 1XGDA 3GB6A 4NP7A 3IPWA 3KOWA 4KCUA 4IP5A 3N2XA 4FIRA 3G5EA 3WLMA 2Z6JA 1IEWA 4U28A 1HO1A 4DJDD 1ZBCA 4NZ1A 1ZGDA 1Z8AA 3AIVA 4ZOBA 4QGCA 4W86A 5FEZA 2G50A 4OGZA 3S9IA 1MXSA 2QS8A 4PSPA 5D8WA 1ZCOA 4DYEA 3TW7A 4S3CA 1R7AA 1E4IA 1W31A 1UZHA 3FLUA 5DX7A 1TQJA 3MP3A 4DUVA 1JAKA 3NQ8A 2ZICA 4C6BA 1TV2A 2A7NA 6PTDA 1XIJA 2XVGA 2BVWA 1GPWA 1J6PA 2HNHA 4UUIA 1H1ZA 2XIBA 1FWAC 4HA1A 5FF3A 3BOFA 5AHIA 2W66A 4GNKB 4IZGA 3G1FA 4DO7A 4MB4A 1KKRA 4HZ7A 2GQAA 1E72M 3MVIA 3D3FA 3FOKA 4S3DA 1MNZA 2IXUA 3UPMA 3O06A 4C5YA 4RE2A 5H8PA 1ITCA 1OF6A 4GVFA 5LZLA 2ISFA 1R85A 3BGGA 1AQ0A 2YB4A 3BICA 5DRCA 2GGIA 2NLYA 4AEOA 4PODA 1K6AA 4KF1A 1SJAA 2V5CA 3UZZA 4DI9A 1GVOA 3G0SA 4TUFA 3WK1A 4DF2A 4OJYA 1T8XA 1R47A 1SZEA 2HTMA 3NQDA 1T6MA 5GJNA 4IHCA 4MWAB 1SMDA 1O5RA 3O6CA 1QI3A