2CIPA

Structure of the michaelis complex of a family 26 lichenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
273
Chain Sequence
SGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Distortion by a Lichenase Highlights the Different Conformational Itineraries Harnessed by Related Glycoside Hydrolases.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE H
total genus 110
structure length 273
sequence length 276
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cipA00
3FHAA 4P7LA 3WH5A 1RH9A 1OGBA 1JG9A 1K9TA 4FLQA 3WDPP 3VD4A 1GOWA 3IK2A 1LWHA 2W63A 4XZWA 1E6ZA 4MB1A 1TCMA 1UQYA 2PWEA 2WZIA 4CCDA 1QVBA 1JI2A 2WCAA 1V0NA 4M82A 3OLDA 5CPQA 2CNCA 2VX7A 3WQWA 2W91A 1E4LA 4F9JA 1DWHM 4JHZA 1E5JA 3BLPX 4PSRA 3L4WA 1B3XA 4WKFA 1XH2A 4HMDA 1KCLA 4AW7A 1J10A 3SCWA 5FIPA 4X0VA 2XPKA 3GH4A 2QLYA 5A6JA 1EO7A 1V02A 2ZUVA 3KWXA 3AZSA 4JCLA 3BAKA 2V3GA 1XV8A 2JIWA 3QHNA 2YA2A 4D6IA 3WD1A 4UQ9A 3UERA 1W91A 1WZMA 1TFVA 5I79A 2XUCA 5TD4A 2WWDA 1FFRA 2AOSA 3WF0A 1IT0A 1CGVA 2W92A 4Z2IA 4HOZA 4L4OA 3WIJA 3S2CA 3IAPA 3VIMA 3ZOAA 3OA5A 3WDQA 2YBUA 4DWSD 2VZOA 1M01A 2EJ1A 2WMIB 1UR1A 1XHGA 5DO8A 5BXTA 4B16A 2VVNA 4QDMA 4WIWA 2ZXAA 4YPJA 3N1AA 3K8MA 3WH8A 5JBFA 1UKTA 3VD5A 3WNNA 3TOPA 3FAWA 4LXFA 3VMNA 4OBRA 3GXFA 4W85A 3MS8A 3EDKA 2YDQA 2ZUNA 2WVUA 3VIGA 4PMXA 3D3AA 2WBGA 2YDSA 1OT1A 2D0HA 3MUIA 3PZQA 3O9NA 2XFFA 1B30A 5D4YA 4OIFA 1PEZA 3M07A 5LYRA 1GQJA 1CXLA 2Z1KA 2J25A 4RL3A 4C7FA 2A3HA 5I3DA 2BHZA 4J7RA 3BLKA 3F5LA 1CNVA 1UWUA 1NOUA 2DT2A 2DT0A 2QF8A 2F8QA 3WBEA 4MJ4A 1H49A 4HA1A 3KL0A 2IXUA 1HVXA 3AS2A 3BGAA 3S6TA 4JFSA 1GUVA 4HA3A 3ARRA 4E2OA 1FP8A 1QNSA 3BH4A 2CHNA 3TA9A 1KFWA 1Q6FA 9CGTA 5IDIA 5I78A 2WC4A 2CITA 3PZUA 4UQEA 2XYLA 4E4PA 1GORA 1OWQA 4J3UA 3GH7A 3K8KA 2PWFA 3WUGA 4UQBA 2O9OA 1AQ0A 4GKLA 3QOKA 3L2LA 3MSDA 2W5FA 1UR4A 1LQ0A 2J62A 4XV0A 4LYRA 4TOQA 1W2VA 2ZXDA 3IANA 2PBGA 3MUAA 3LMYA 1XCXA 3B9DA 2J7DA 4D6JA 3BCDA 1AMYA 3RILA 1YQ2A 5I2UA 2J77A 2ZIDA 1GHSA 3AYRA 3OLEA 2W61A 3D5HA 2OWWA 1W32A 3W53A 5E0FA 2VRQA 3RPMA 1HP5A 2EPOA 2CIPA 2F61A 1OGSA 1XYFA 5I5RA 1B3ZA 3AS3A 4AZ5A 1UWSA 1BGGA 3AIUA 1PJ9A 5A2CA 4F9DA 4H7VA 1MQRA 1JF5A 2AMGA 1NP2A 5CLTA 2OYMA 3MMDA 3TTYA 1H2JA 1BVNP 1GVYA 1KQYA 5AY7A 3SUSA 3WKZA 4AD3A 3IJ9A 4DM2A 3L4YA 5KZ6A 1QBAA 1TVPA 1NH6A 2GJRA 3AXXA 4PMNA 4AIOA 3WD3A 1E3XA 1WKYA 3MO4A 4AZ7A 3CHDA 4JCMA 2BVDA 4AD0A 3AIBA 1V0LA 3EDJA 4IPNB 3DYPA 5A2BA 4JKKA 2DGAA 4BQ5A 3N04A 2WZHA 4EK7A 2IXVA 4U31A 1DWAM 2QPUA 2CBJA 4P7NA 3UEQA 4OUEA 1HF6A 1BPLB 2OSXA 4OKDA 4Z2JA 3IJ7A 1CGXA 4MAVA 3AMGA 1PZ2A 5CSYA 5C8BB 5JBDA 3UR8A 2G3IA 1MW2A 2WMHA 1E0WA 3U7VA 1HXJA 2X0HA 2JE8A 3AYSA 1ZBKA 3WMCA 1HVQA 3O6AA 3PTMA 2FH6A 5CPSA 2DEPA 5E09A 3UG5A 1LJYA 2G3MA 5HNNA 4PN2A 1PX3A 1UR2A 4ATDA 1ZL1A 1U33A 4KH2A 2WSKA 1Q4NX 5AYBA 3W4RA 3ZMRA 1CEOA 1C8XA 2BY1A 1XH0A 3AS0A 1UWRA 3PZIA 5AYIA 1OM0A 3AMLA 2C7FA 2WCGA 2WKGA 2TAAA 4PTWA 1FFQA 1W9UA 1JIBA 3RM4A 2XVPA 1CGUA 4Z2HA 2ZX6A 2WW5A 4NRSA 3II1A 2VZVA 3CHCA 4XX6A 1JDAA 1G9HA 2W67A 1AQHA 2DH3A 1WDRA 1CDGA 1JI1A 4CN6A 5E70A 2VMFA 3ARUA 3WDIA 2IUZA 1E73M 4D6GA 2A3EA 3W38A 3AFBA 3TP4A 3VINA 2W66A 4WK9A 1EDGA 1KCKA 3WFZA 1MVYA 1I1WA 2PF0A 3L4TA 1W1TA 1BFNA 3MKKA 2ZX7A 3N17A 4S3JA 2EQDA 1G1YA 4WJXA 1DWFM 2WYSA 1GCYA 2XFRA 1QOXA 1A47A 2DIJA 3FHQA 5E6ZA 3CZJA 1U2YA 1MWOA 1E0XA 3ZM8A 3MANA 1ZBCA 2PB1A 5A6AA 4M29A 3L4ZA 2VZSA 3CZEA 2ZE0A 3ALGA 3BC9A 3NIYA 4M81A 4U3CA 1ISYA 1E6PA 3AMKA 3PTQA 4S3KA 3WD4A 4DUWA 5DT7A 5BXPA 5IXEA 2WHKA 3WH9A 1ZJAA 4HA4A 1WDQA 5FL1A 4L4PA 3A4WA 2ZUTA 1K9EA 4AD4A 3ARQA 4HPHA 2D0GA 5A94A 1US3A 3CHFA 3GTNA 3A3HA 4MDPA 2WCSA 5ECUA 1JXJA 2CCRA 3EDFA 4PMQA 1FHDA 1RD6A 2WSPA 4UQCA 2VI0A 4PTMA 1FA2A 3VKKA 3RO8A 1JZ4A 3VDCA 2J7GA 3FW6A 3WQVA 3UETA 1J18A 3E1F1 3WNOA 4UNIA 3BAJA 4UR9A 5IHSA 1BG4A 3T2QA 3VIOA 4A3HA 1CWYA 1E4NA 2J47A 3FNDA 2NSXA 2NT1A 4U3AA 3ARXA 1CGWA 2Y5EA 1K6AA 3K4AA 4LYQA 4DWSC 4KRUA 5A6MA 4CU7A 1UD6A 2OYLA 4HU8A 1K9FA 3G6MA 3BAXA 3PN8A 3I3BA 5D8WA 2GSJA 3GXMA 5M17A 3DHUA 1QI3A 1E6NA 4OBSA 4WKHA 3CIVA 1CYGA 1W3JA 2D1ZA 4PUEA 3WEZA 1TZ7A 1PX8A 1JAKA 1O6IA 5F7UA 3RJYA 3A4AA 2CESA 4B9YA 2BV9A 1JGIA 4UOJA 1LL7A 3F5KA 3K4DA 1CXFA 3OGRA 4N0RA 4H2CA 2VL4A 1UZ4A 5JBEA 3GXDA 1VIWA 3SCOA 5JUVA 4JL1A 4AD2A 1E6SM 1W9VA 1OIFA 2CERA 5DFAA 4IUGA 5FOOA 3VD3A 4P8UA 3RMEA 1ZBVA 2XM1A 3ZJ6A 2GJXB 2RGMA 1JL8A 3VPLA 2WC7A 3SEPA 4WSKA 2BVYA 1J0ZA 1W9BM 4AD5A 1CGYA 4EE9A 2VR5A 3SUUA 2X05A 3NDZA 2X2YA 1JNDA 3DYMA 4CN1A 4JKLA 1ESWA 1R7AA 3W81A 5AC4A 1KWGA 3W28A 4UQDA 4MB4A 1B9ZA 1QW9A 1UD5A 4J28A 3GNPA 2JEPA 3UESA 2WVVB 4W93A 2ZUUA 4PMYA 4MAZA 3WENA 2G8ZA 1ECEA 4Q7NA 3ZSTA 3NDYA 4EKJA 1EHNA 1IZJA 4CN4A 2GDUA 2PWHA 1KBKA 4HOXA 4W86A 3PBGA 4JFWA 1W1YA 4GO8A 5ABFB 1NWRA 1J01A 2PBOA 3TONA 1LG1A 2Y2WA 2HISA 4UZUA 1SMDA 3VTRA 4PYSA 2ZWZA 3DECA 4HZ6A 1WZLA 5FCZA 3L4XA 5DMYA 4W88A 4AZCA 2CKRA 4B9ZA 5A95A 1EQPA 1GOKA 1UR0A 2WM0A 1WAWA 1DWIM 4EANA 2PWDA 2DSVA 3KL5A 3W82A 1H3GA 2D20A 1GPFA 4NSBA 2O92A 1LL6A 5I0DA 5BCAA 1V3KA 3BXWA 4QAWA 1KXVA 1QW8A 3AHYA 3CZKA 4B3KA 1E5NA 4A3YA 1LL4A 3POHA 1DP0A 1HKJA 3T09A 1MW3A 4LYPA 1EIBA 2WMJA 4LX4A 4D1IA 3U5YA 1G5AA 2BVTA 1XYZA 1KXHA 3WDRA 4X9YA 4HU0A 2QMJA 1KXQA 2PC8A 2PI6A 1JZ6A 2UY3A 1UWTA 3I3DA 1V6VA 3W26A 3F4VA 3SCTA 1Y7VA 3CUJA 2RGLA 3NYDA 3MUY1 5C71A 5CGMA 2GDVA 3OBAA 1XGZA 2BY3A 4UOZA 2WMIA 1E1FA 1CLXA 2E9BA 1NARA 7CGTA 2EEXA 1OBAA 5A3HA 3ARVA 2EBNA 1R85A 1E55A 1WP6A 4AD1A 2ZXQA 3OB8A 3HU7A 1GQKA 5EMYA 5E0CA 3W24A 2GFTA 4U33A 3OGVA 4BF7A 1UKQA 4CCEA 4H8UA 1BSIA 2WZEA 1CZ1A 4M56A 4P7OA 1IV8A 2VX5A 8A3HA 3WSUA 2XSBA 4A4AA 1PIGA 2WWCA 1QI5A 1E6XM 3WMSA 5LA2A 2J75A 4MNKA 5LA1A 1E43A 3N11A 1C8YA 1N82A 4AZ6A 3CZLA 2B31A 1P6WA 1VFOA 3B9EA 1F4HA 1HJWA 3W29A 4CGTA 4TVUA 1FH7A 1KR1A 1TE1A 2BY0A 3BAYA 5GNYA 4ZXOA 3CBWA 5HDRA 1JFHA 1HKKA 1E9LA 1SR0A 4FLSA 2X0YA 1X6NA 3WF2A 3M46A 4ML4A 1ITXA 1HL8A 3AHXA 2E40A 1OIMA 5A6BD 1B31A 5EBAA 1ISZA 1G0CA 4RE2A 3SCNA 2YL6A 1WE5A 4D72A 4R5EA 1XH1A 1VEOA 1XCWA 5HPCA 2OWCA 3MUZ1 2G3NA 4GI9A 2J4GA 1QHOA 3QOMA 2OLHA 2VCBA 1WZKA 2GJPA 3AXIA 1D7FA 1QNPA 2D3LA 2OWXA 5JIWA 2MANA 4P7RA 2YL5A 4CU8A 3TTOA 1EH9A 2YLAA 4FK9A 4JFUA 3WNLA 1EXPA 4PMRA 4PCTA 1OT2A 1RP9A 5M03A 1HT6A 1FH8A 3J7HA 1BLIA 1W1PA 2D22A 3VILA 1AVAA 1JF6A 1QNOA 3OG2A 2OSYA 4GXPA 1JYNA 3CLWA 4GZEA 3LPPA 2GJXA 2E3ZA 4AEFA 4CD8A 1VEMA 4IPLA 5DF0A 3SUVA 3HN3A 2G3JA 3GNRA 1H0GA 1E6RA 1QNRA 3WL0A 3AXHA 1GW1A 3K8LA 2WLYA 1H41A 3I3EA 3THCA 1CXKA 4R27A 4YHGA 5BROA 2ZICA 1Q6DA 1JDCA 3NCOA 3O2LA 1JD7A 1MQQA 7A3HA 4M8UA 4XZBA 3RIKA 5KEZA 3W27A 3UG4A 1TR1A 2E9LA 1D2KA 3WDJA 1B2YA 3A47A 4ACYA 1W3HA 5D9OA 4AZCB 5FD0A 1ZS2A 1JYXA 4P8WA 2J78A 1VF8A 4KGLA 2WVTA 4KRTA 4GO9A 3CGTA 3W0KA 2BY2A 4UFHA 4JIEA 4WKAA 4GQQA 3VIIA 3AIWA 1E1EA 4PEEA 5I24A 4H8VA 4RE3A 1XSJA 1LWJA 2NW0A 1ZB5A 1GZJA 2Z1SA 3AIQA 1OB0A 2C0HA 3U57A 1FOBA 1W3KA 3IJ8A 3RJXA 1E56A 3CO4A 1W1VA 4URIA 2ESCA 4U5IA 4AZIA 4HOWA 2GUYA 4D6CA 1OGGA 5CLWA 3GDBA 5A2AA 3PZGA 3AIEA 3MV11 1MFUA 4Z2KA 1DTUA 1UR9A 3SCVA 1L8NA 1IZKA 1H4PA 1TMQA 3OZPA 4PCSA 5BYWA 1WNOA 4CVWA 1GJUA 1CXHA 4GPNA 1ZJBA 3MMUA 4BZYA 4BQ4A 3NSMA 3OLIA 1PPIA 3OZOA 1UA7A 1UR8A 1B3VA 1WO2A 3N13A 4QCEA 5GQBA 2DIEA 5BXRA 1NWUA 4ZEPA 3AROA 2E9MA 2E4TA 2VZUA 2D2OA 4BQ2A 1R8LA 2D0FA 1UD2A 2UY2A 5CSUA 1H1NA 3FXYA 2D3NA 4OZOA 3ARWA 4OOUA 1UQZA 3AMCA 1BQCA 1QNQA 4OOZA 1GOIA 3VGFA 4AIUA 4D6FA 2A3AA 1G94A 2CETA 2XGBA 2YJQA 1Q6CA 3LPOA 3N9KA 3MV01 4UCFA 3VGEA 5A69A 3DC0A 4QLJA 4CUCA 2OSWA 1OCQA 4MADA 1NQ6A 1C8QA 1W9PA 2YBTA 3BSGA 4HZ8A 1MYRA 4E8DA 1XD0A 4IISA 4CD6A 1UWIA 2FH8A 3BMVA 1C91A 3K46A 2HVMA 4NI3A 1PIFA 4HP5A 3GBDA 4Y7EA 5CPTA 5HXMA 3MMWA 1HJQA 4JZ5A 1ISWA 1B0IA 3T0DA 3PZTA 1J0YA 3B9AA 3ECQA 5GNXA 3LPGA 1BAGA 1J12A 1UG6A 4LPCA 3AJ7A 2VZTA 3CMGA 4BCEA 1WB0A 3ZT5A 4J3SA 1DWJM 1GOQA 1RPKA 3VGDA 4TTUA 2VCAA 3VD7A 8CGTA 2XTKA 4PTXA 4W8LA 2GK1B 1GQLA 3JUGA 2G4FA 2WXDM 3WUFA 1L0PA 2WK2A 3VGHA 5CG0A 1U30A 2YDRA 4EAMA 1UKSA 3W25A 1V3MA 3W6MA 1BVZA 1C7SA 1MW1A 5A8NA 1UKPA 3T08A 2WAGA 2CBVA 4ACZA 1MXDA 1JD9A 1ITCA 3PZVA 3VGBA 2VOTA 1B1YA 1H11A 1H09A 4MJ2A 2WHJA 2J74A 4DUVA 1WPCA 2XIIA 2XVNA 3AICA 2YA1A 2E8ZA 1KXTA 5A8PA 2BXYA 4FMVA 4MTVA 3AS1A 2Y4SA 1PZ3A 3WF4A 4MB5A 2J7EA 3NSNA 3KE0A 3ZSSA 3OLGA 2DPEA 1FH9A 5ABGA 2V38A 2CXGA 3VVGA 3AHZA 3GM8A 2BHYA 1C90A 1FP9A 2FGLA 1CXIA 1KR0A 3N12A 3WF1A 5A8MA 1O7AA 1KGWA 3CMJA 4W8BA 1E70M 1E0VA 4PBGA 3UR7A 1FHLA 2WHLA 3ALFA 4H04A 4W7VA 4QCFA 2O9RA 3VGGA 1JZ8A 5EB8A 4UQAA 3FN9A 1W9XA 1CIUA 1CTNA 4TX6A 4AZHA 4D6EA 5M5DA 1CBGA 5JIPA 1XSKA 4C7GA 1JZ7A 1V6YA 1VAHA 3EYPA 4BA0A 1EHAA 2D23A 3AMDA 3WQ8A 4ACZB 3NSXA 4J3VA 3GZAA 4ZXLA 4HPGA 4QLLA 4UOQA 3VMPA 4LGXA 1PX4A 3EBVA 3THDA 3WFLA 2CEQA 2YA0A 1QBBA 2EPMX 4F8XA 1KWKA 5M3WA 3CUGA 2ZUSA 5CQ1A 3VMOA 2ZXBA 3GBEA 1XC6A 3VIHA 3VM7A 2CBIA 3ARYA 2XWEA 4ZENA 1W9DM 2X8RA 2WC3A 1TVNA 1VFFA 1HKMA 1C92A 4M1RA 1JZ5A 1EDTA 1VENA 3T0AA 2VO5A 1J0IA 3MSGA 2YKKA 1V0KA 5ABFA 3WUBA 3WMBA 4Z2GA 1C7TA 1QI0A 3IAQA 4AWEA 3EDEA 4D6DA 1JYWA 4CD7A 1GQIA 1UOKA 4QP0A 3SCSA 2J8FA 1G01A 2VURA 2XVGA 2WVVA 4ATWA 1SFSA 3PZOA 1UYQA 3QHMA 3VNYA 2X1IA 5IHRA 5I77A 4NZCA 3FY1A 2JIEA 3PZ9A 1E72M 2A3CA 2UWFA 1OD0A 3WDHA 2XJ7A 3SCRA 1I75A 5ABEA 3GH5A 2J8GA 3NJ3A 2FHFA 3DHPA 3ARTA 3VO0A 4MPKA 3AISA 1EOMA 1MW0A 1F4AA 2AAAA 4DUXA 3PZNA 1VBRA 4PMVA 2FGZA 1V3LA 1UD3A 4UFLA 2VR4A 1M03A 4AMCA 4Z2LA 1X6LA 5CJ5A 1PAMA 4FLRA 4PUDA 4CU6A 2O9TA 3POCA 2DQXA 2XVLA 6CGTA 2V5DA 4U5KA 1CENA 1BG9A 4GI8A 1HJUA 4XUYA 3CZ8A 1E15A 2VJXA 4LQ1A 4W5UA 4UFMA 2YIHA 4FF5A 3K1DA 3GYCA 1QPKA 3ZIZA 5D9PA 4AXNA 1WCGA 4M80A 1PBGA 3SIMA 4PSPA 3WH6A 2WLZA 1HX0A 4ZE4A 3CUIA 2Y8KA 2EPNA 1XSIA 3AZTA 1KQZA 1HN1A 1SYTA 1NWSA 3EDDA 4BS0A 1CECA 4PTVA 2D24A 2DSUA 5FL0A 1JFXA 2X09A 4W7UA 4V2XA 5IFTA 1J0JA 3L4UA 4Q22A 3SCPA 1KGXA 4J27A 2VRKA 4C7DA 5DEZA 2QV4A 3HMCA 1ZBWA 1ISXA 1TUXA 3MU7A 3ARPA 2EPLX 3KZSA 1GJWA 1ODUA 1GOMA 5HBFA 1BYCA 4GQRA 3SUWA 3GNOA 2JF7A 3RM9A 1R86A 3WBAA 3AIVA 4K68A 1Z32X 4W5ZA 5E9AA 4DWSA 1ODZA 1JZ2A 4CD5A 2W4XA 1B3WA 4UFJA 1OINA 2DSWA 3U5UA 3VDHA 1J0HA 2VQTA 4P8XA 1V6UA 1VJSA 4UTFA 3M7SA 4IM4A 1R7OA 4CVUA 2E0PA 3VM5A 2DT3A 5I6SA 3N18A 4W8AA 2UY4A 3CUHA 1S46A 1V02E 1XD1A 2UY5A 4AIEA 1J0KA 3VU2A 2W62A 1X1NA 5D9MA 3RM8A 2ZOXA 2WANA 5A8OA 3T0BA 2DSKA 5AC5A 1BYBA 2E8YA 2Q8XA 1EO5A 2J7HA 2XG9A 1K9DA 2VVSA 2XFYA 3VX0A 4U2YA 2ZX8A 3VUPA 1R87A 2GVYA 3HJEA 5D9NA 1V08A 2CYGA 1DEDA 3WL1A 3CTTA 2XHYA 5A1AA 3UG3A 4AISA 4GI6A 5BRQA 2V3DA 2XWDA 3WQ6A 1E4IA 1TA3A 3VD9A 3WD0A 3CPUA 1B3YA 5C70A 4AEEA 1E6QM 2BS9A 2YLLA 3VDBA 1UKOA 1V3JA 1Q6EA 1UZ1A 3NUKA 2ZUWA 1VFUA 1JNEA 1WDSA 1KGUA 1CGTA 4YN5A 4KMQA 1NM9A 2V3FA 4PMUA 1YHTA 2YL9A 1OSEA 1VJZA 3WQ5A 3T2PA 7TAAA 4AY1A 2XSAA 4YHEA 1KBBA 4W84A 2OYKA 5GPRA 1EA9C 5EFDA 2EXOA 3WELA 1C3FA 3TTSA 3AZRA 2O9PA 2XGIA 1UUQA 4JKMA 3ZQ9A 1GVIA 4PRWA 3VIPA 1UHVA 1VEPA 2VT0A 2PWGA 3APGA 2EPKX 4X0NA 2FHBA 1EGZA 2XM2A 5A6BA 3SUTA 3VIFA 2VX6A 1SMAA 3M6DA 4WF7A 3CH9A 4XB3A 3WNMA 2WMGA 4J3WA 3ZR6A 5A6KA 1NWTA 2G41A 1UD8A 3T2OA 4N42A 4AZGA 2BNJA 4TTGA 6A3HA 1UA3A 3VNZA 5GNZA 3QHOA 1V3IA 1CLVA 3PZMA 2VC9A 4NRRA 1XRVA 3AIRA 3WNPA 1E4MM 1UH3A 1BGAA 1GONA 4GIAA 4HZ7A 3W6LA 4CKQA 4H41A 1B90A 2ZX5A 2WBKA 1VFMA 1W3LA 4GZJA 4UZSA 2XVKA 1JDDA 1US2A 3AHVA 1CXEA 4MDOA 3L2MA 5BRPA 4U2ZA 3ZR5A 1HJSA 4GZIA 3QR3A 1NOWA 1ISVA 1V6WA 1HL9A 4DWSB 1JZ3A 2JEQA 3WY1A 4CD4A 5CXPA 5HOSA 2ZX9A 4D71A 4PMOA 4J3TA 4JFTA 1C93A 1OD8A 3CZGA 2V5CA 2WMFA 2WVSA 6TAAA 1TG7A 4B3LA 1EQCA 1A3HA 5A6SA 4E8CA 3U7BA 1DWGM 1KB3A 4NF7A 3WQ4A 3ZJKA 1BYAA 2JF6A 2Y8VA 3BAIA 3ARSA 1W2PA 3BSHA 1MXGA 3G6LA 4ATLA 3DYOA 1MFVA 1HIZA 1D3CA 1BYDA 4DM1A 1NP0A 3RDKA 4V28A 4FLOA 1QI2A 2FDMA 4UFIA 4F66A 3TTQA 1LLOA 5DT5A 4JFVA 3BCFA 3VIJA 3ZJ7A 4CCCA 4D6HA 2J7CA 1M7XA 2WKLA 3PHAA 2VX4A 2DSZA 1JXKA 1UH2A 3EMZA 1BTCA 4HTYA 1BF2A 3WEMA 3OGSA 1QHPA 2VNCA 2VCCA 3PTKA 2WMKA 3QGVA 5ABHA 1UD4A 1QHZA 2BHUA 2WNWA 1GOOA 2VRJA 2FHCA 3WF3A 2DH2A 2WHMA 3WN6A 1EOKA 2CHOA 1AQMA 4JL2A 1UH4A 2QMKA 2GK1A 2NT0A 5A8QA 4TVDA 5E6YA 4PMDA 4AZBA 2J7FA 1BHGA 1RP8A 4PMZA 4MNLA 5CZKA 3W37A 3VDAA 4M24A 2VTFA 4W87A 4TXEA 2XIBA 1Q6GA 5BWFA 1CPUA 3SCUA 1WDPA 2V3EA 5HPOA 3AOFA 5BXSA 1GHRA 3KEHA 2QHAA 3RCNA 2ZWYA 2BFGA 1TA3B 2ZUMA 2C8NA 1E40A 1NOFA 2DDXA 3F5JA 3AHTA 4KWUA 5I23A 1HJVA 3B8SA 4TVCA 2QPSA 1LF1A 1V03A 1VRXA 1E71M 2CKSA 3LPFA 1M53A 3A6OA 1E3ZA 3CUFA 2BXZA 4JHOA 1JYVA 3BAWA 3ZO9A 4TUFA 1M04A 3AI0A 4BQ3A 1VB9A 2CBUA 4HMEA 1I1XA 4V27A 3VOCA 2Y24A 3WNKA 3BMWA 4AC1X 5FKYA 4J3XA 2JALA 4P8VA 3ZT6A 4QLKA 3CHEA 3UCQA 3ZT7A 3WUEA 3KL3A 5LA0A 2A3BA 1HJXA 2DT1A 3WEOA 4QFUA 1HP4A 1J9YA 1JAEA 1WZAA 1DHKA 2F2HA 4AYSA 2WPGA 1H0IA 1UWQA 3EMCA 1MQPA 3SCQA 1HNYA 5CGTA 1VBUA 1J11A 4JAWA 4D1JA 5A6LA 2JFEX 1ZU8A 4KGJA 4MNJA 3SURA 2VQUA 4ZE5A 4MNMA 1GNXA 2J7BA 3L4VA 4RE4A 4OJYA 1EDQA 3WD2A 5EFFA 3OIHA 4ZFMA 2EO7A 3EMQA 3ARZA 5IFPA 1LG2A 2VUYA 1V3HA 2YL8A 3A4XA 4H8HA 5D8ZA 4TX8A 3VIKA 4GINA 4F79A 4MB3A 1V0MA 4HMCA 4WSJA 4UFKA 2WB5A 2J79A 2CPUA 1V6XA 3VX1A 4WLCA 4B15A 3ZJ8A 4W7WA 1H5VA 1HKIA 3FAXA 3GXIA 4P7QA 3N15A 4W89A 3WH7A 2YOCA 3AQUA 1QI4A
chains in the Genus database with same CATH superfamily
2HJPA 3GXPA 3FHAA 3WH5A 5EPDA 4D2JA 4Y2WA 4XIMA 1PS9A 1PKNA 1EPXA 4FX6M 4XZWA 3KOFA 1W3NA 4K39A 3RYSA 3HQOA 2BBFA 1JI2A 4AH7A 4DXKA 1FWEC 5AKQA 4QDPA 2C1HA 3WBXA 3CJPA 3OLDA 2XZ7A 2CNCA 1FVPA 4F9JA 2NQHA 4JHZA 1XG4A 3BLPX 3L4WA 3O3RA 4AVOA 1K4HA 3O05A 4HMDA 1KCLA 3PJTA 4JD4A 3GO2A 1KFBA 3VOIA 3WJZA 3NQ7A 3Q67A 1V02A 6XIAA 4JX6A 2ZUVA 3KWXA 1E9IA 4J9JA 3P62A 4HYVA 4U28A 3QHNA 4JQ2A 3WD1A 3UERA 1W91A 5EA9A 3V0TA 4DZHA 5D2XA 1FRBA 3RRAA 2AOSA 4B5VA 2W92A 1HKVA 4L4OA 3TLQA 2V81A 1LROA 3WIJA 1H7OA 3S2CA 4JTCA 4I9JA 2A7RA 3WDQA 3T9PA 2OLSA 4R53A 2VZOA 4XO6A 1MUCA 3LRMA 1OCNA 2ICSA 4H6EA 4LH8A 3XIMA 1OVDA 1MSSA 4C5YA 2RDWA 4WIWA 4YPJA 3N1AA 3KW3A 1XGEA 3WH8A 3UZYA 3QPEA 4ROPA 3W87A 4AX6A 3WNNA 2B81A 1EP2A 4LXFA 1PZ1A 1EF3A 1PB0A 3PAJA 1OC6A 2ZUNA 3MI6A 3VIGA 4F2TA 3D3AA 2YDSA 3KHDA 2XFFA 2ISSA 3GVRA 1HKWA 1GQJA 4RL3A 3F5LA 1NOUA 2DT0A 1KFEA 5AC8A 2BX7A 2C1GA 3S6TA 1YYAA 3QGKC 3VCCA 4WD0A 1R2SA 1FP8A 2A6NA 1L6YA 1KFWA 4TV5A 2CITA 4RDZA 1GG0A 1GORA 2C3ZA 3MPGA 4J3UA 3GH7A 1JDFA 2O9OA 3BVJA 4FR1A 1SUXA 5T9CE 2J62A 2A85A 4GUIA 2ISDA 5HNTA 4HYRA 3RO6A 3MCMA 2PTYA 3SGGA 3M9YA 4O14A 1AMYA 2GSHA 1OFRA 1YQ2A 4L1XA 2GGIA 4RW5A 5LIUX 2Z6JA 3AYRA 4HSNA 3INPA 2VRQA 3OPSA 1R30A 1IF2A 1OGSA 3AS3A 1UWSA 9XIMA 5KZEA 5REQB 1PJ9A 4F9DA 1VC4A 5E9XA 2NLYA 3T8LA 1MNZA 3TTYA 1H2JA 2HMCA 1K8ZA 1QTWA 1GVYA 5BU9A 3I68A 4KF1A 3L4YA 4JX5A 2Z7GA 1J5TA 3GAYA 4O1DA 4N9EA 3W7MA 1W1A1 3CS2A 1LOSA 3R79A 3RX4A 3UWYA 1PL9A 1TMHA 3N19B 4G7EA 4C5ZA 4JHMA 3DESA 2WOQA 3W75A 4IPNB 4CLMA 3KX6A 5AECA 2OKTA 4U31A 1DWAM 1ME7A 4P7NA 3UEQA 1YBQB 3QZAA 4E4FA 1BPLB 2OSXA 4QX4A 3V7PA 2I16A 3VZXA 1UUMA 3UG8A 3DIPA 3W7QA 5CC6A 4RZ6A 5CSYA 4B91A 4IMDA 2NV9A 1E1CA 3LSCA 3N4EA 3PC0A 4RZ4A 2JE8A 3E2QA 3QTGA 2KZHA 4FIQA 2FH6A 1EYWA 4AY7A 1OABA 3UG5A 3OVQA 4JTDA 1UR2A 4IGHA 3BOLA 5CZSA 4WRHA 9RUBA 1XCFA 1Q4NX 3DBNA 4OECA 3UU0A 3ZMRA 4NUWA 3MWAA 3MP5A 2BY1A 3PZIA 1MO0A 1OF6A 2WCGA 3AMLA 2P88A 4PTWA 5G1YA 2Q3RA 3RM4A 1KTNA 4EVZA 4C6OA 2HEJA 2QCDA 1AQHA 5ABTA 1PKMA 3D46A 1Q4WA 5C7VA 2AL1A 2IQ0A 5E70A 4R3UA 4FAMA 2IUZA 1W5NA 3CQJA 3AFBA 3HG4A 3QY7A 4GGBA 4NX0A 1D9EA 1RCOB 1OF8A 1OYBA 4Q8QA 2EQDA 6XIMA 1G1YA 2ALRA 1QPQA 4MKSA 1Q7QA 4LRTA 3WQGA 4CEUC 3BG3A 4HK6A 5E6ZA 3T0TA 1MWOA 4ALDA 4M7SA 4Y9OA 3QQ0A 4NJGA 4DO7A 3LTYA 1ZBCA 1ZJHA 3W2MA 3CAQA 3DZ1A 4ZB2A 5CPOA 3L4ZA 5CKSA 3CZEA 3NL6A 4LEQA 3DKJA 2HBXA 4PGLA 3ALGA 3P84A 3UXLA 5F4WA 4ASTA 2VR2A 4WDXA 1DTNA 3W1RA 4C6EA 3FDKA 3WH9A 1ZJAA 4HA4A 1WDWA 5B7ZA 3FJLA 4KWWA 1XUUA 5A94A 3A3HA 4MDPA 2QDGA 3LHTA 2VGGA 4O8RA 3VKAA 4IMAA 4U4MA 4EPDC 3EDFA 2DUAA 4PR4A 1YADA 4DLMA 1RD6A 4Y9PA 3GLCA 1F3XA 3W02A 1DJHA 5CBJA 2J7GA 3DFTA 1J18A 1QRQA 3WNOA 2GJLA 3NPVA 5TQLA 2OR2A 5C9RA 4XZNX 2E67A 2C79A 3FNDA 1ZQ5A 3QFEA 1FWFC 1FCBA 1W56A 3FSTA 5A6MA 4NZ5A 1NAL1 3M0KA 5FF0A 4CU7A 2ZCGA 2C16A 4X60A 1P1MA 3PPGA 4K38A 1OEPA 3G6MA 3W7PA 4V1YA 3GW0A 1M3UA 3LCGA 4J5NA 1R3YA 4WJ8A 1W3JA 2Z26A 1TZ7A 4F40A 1PX8A 4HHMA 3ONBA 4K8EA 4EACA 2CESA 1OCBA 3EX6A 1BRLB 4UOJA 3EXSA 1XPGA 1CXFA 1QCWA 4N0RA 3DXIA 2VL4A 5JBEA 3GXDA 3SCOA 2E1WA 4AD2A 1O94A 4AYGA 1OIFA 2CERA 2HSAA 4IUGA 1IIHA 4DJDA 1OFAA 2GJXB 2VGIA 1TELA 3ZVIA 3GD6A 5A6TC 1XYMA 2PRLA 4WSKA 2BVYA 2XIMA 2HV5A 3RCYA 2VR5A 4AWUA 2X05A 3GSMA 3B3DA 1O4UA 4JBRA 3OYZA 3R25A 1R7AA 1RCQA 1KW1A 5AC4A 1FUYA 1KWGA 4Z0JA 1N8IA 4J28A 1UPMB 4B3ZA 2WVVB 4B2DA 4PMYA 3W2NA 4Q7NA 3LCFA 4RXFA 1DL3A 1TWIA 4W86A 3PBGA 4HPNA 1W1YA 5DRIA 3DG7A 2GVJA 2NQ5A 3AWNA 4QAIA 3LCWA 1J01A 1DE6A 3GC4A 2Y2WA 2HISA 3BZJA 1BRLA 4HZ6A 5XIAA 4IIBA 4LF2A 3VKJA 4HVXA 1TTIA 1WAWA 2FFIA 2GJNA 3KL5A 1H3GA 4A21A 3MZNA 3P8JA 2ZC1A 1GPFA 4NSBA 3CNYA 4KPLA 5I0DA 3DG3A 1OY0A 2UZ9A 1KXVA 1QW8A 3CZKA 1E5NA 1M6JA 3VOHA 3WZ0E 3LBOA 4C91A 4XTIA 3S42A 1HKJA 3T09A 3BURA 3U5YA 1HUVA 2BVTA 4O18A 3KXQA 2XISA 3M5VA 3EEGA 1UWTA 2PDFA 2CWNA 4CQBA 4HQVA 1VS1A 1GYNA 3CUJA 4M5PA 4Q6JA 2GDVA 4ZMGA 2BY3A 4MZ8A 3UR2A 3EA3A 1K70A 3JRKA 3ATYA 1DOSA 1CLXA 1X98A 4H01A 1XPYA 3TC3A 1NARA 1Y0EA 1HG3A 1NDYA 1YXDA 2EBNA 1WP6A 3O07A 2ZXQA 3N2CA 2AKMA 2CZVA 1YMYA 5E0CA 3PUEA 4OV4A 3H23A 4U33A 1FWIC 1MZRA 3U0HA 4H8UA 4PEKA 2WZEA 4M56A 3H6OA 1IV8A 5C2XA 4MFEA 4RX0A 2IS7A 1PIGA 1QI5A 5LA2A 2CZ5A 4RZBA 4U10A 1C8YA 4AZ6A 1HW6A 4ZQMA 2B31A 3B9EA 4B5XA 1VIZA 4NP7A 3S1XA 1KR1A 2BY0A 3BAYA 5GNYA 3WYZA 1JFHA 1HKKA 5MF5A 4GC3A 1B57A 2X0YA 3QBUA 5JH2A 1X6NA 3WF2A 4C6QA 2C14A 2E40A 3M5XA 4ORIA 4AF0A 3SCNA 4WXYA 1FWTA 3CQKA 1VEOA 1XIJA 1TTPA 3AWOA 2G3NA 3PBWA 1KFJA 5G2WA 4BI5A 2OLHA 2OU4A 3AXIA 2J88A 3T05A 2D3LA 3W1XA 1KRAC 4O8AA 4CU8A 4JIHA 2CFFA 4JFUA 3VCRA 4FNPA 5JQ9A 4POCA 4PCTA 1RP9A 5K2ZA 2DU2A 3J7HA 2D22A 5GJNA 3NA8A 3PFMA 1QNOA 4L61A 3OG2A 3QW3A 1XS2A 3GDKA 4GZEA 3LPPA 5CC3A 1DHPA 3IJQA 4CD8A 4IPLA 1TWSA 1ZAJA 4FHAA 4ZL1A 1L6WA 1LBMA 2WLYA 3GUGA 3GS6A 2XGZA 3I3EA 3THCA 4YHGA 2E7FA 3S1UA 2ZICA 1Q6DA 1M7JA 3NCOA 1RJPA 3VAVA 4LB3A 2OGYA 4EXAA 1MQQA 7A3HA 4IZGA 3RIKA 3W27A 5BMWA 1TR1A 2E9LA 1ZY9A 1XLMA 2PDGA 1ZS2A 4JQ1A 2J78A 3TR2A 2Z28A 3KCLA 4KGLA 2GVGA 3W0KA 1RCXB 3G1RA 3PG8A 1XSJA 1LWJA 2BTMA 5AHFA 4KCWA 1W3KA 3RJXA 3CO4A 4U5IA 4Q8NA 4AZIA 5D2VA 4WOQA 1DV7A 3SO7A 5CLWA 3GDBA 1DXEA 3TN6A 4KESA 1ZNNA 1DTUA 1UR9A 4XO7A 1JUBA 1TR9A 3GY1A 1FWSA 3UJFA 1CXHA 1UMYA 3MMUA 4WZHA 2PDPA 3GFZA 3LI1A 2I9UA 3OZOA 3LMZA 4LEFA 1B3VA 4IT1A 4MY8A 1U5JA 4O0KA 4UTJA 1H7WA 4AVFA 3NZPA 2DZVA 2DIEA 1XIHA 3KHJA 1H7NA 2NV2A 4O4VA 1XLJA 1ME9A 1UD2A 2UY2A 3FXYA 2D2JA 2D3NA 1PKYA 5I7GA 1D3GA 3R0DA 4WQ6A 1GOXA 1BQCA 3AMCA 1QNQA 4OOZA 4D6FA 3LI0A 1WOAA 3EZ4A 2XGBA 4UCFA 2V8ZA 1GZGA 2OSWA 3TNOA 4MADA 1RVGA 3EXTA 1FWJC 1C8QA 3SB0A 2BOGX 3GR8A 1XYLA 1MYRA 2CLFA 3H4XA 1XD0A 2QDEA 3BMVA 2AL2A 2HVMA 3N73A 2HQAA 4HU4A 3IPWA 3NQCA 2NX9A 1XIFA 3VNLA 4LNYA 1HJQA 4JZ5A 3AU6A 1AUSL 2PWVA 3QLLA 4M0XA 4RKAA 3UWEA 1UG6A 7ODCA 2QNEA 4DPQA 2BGQA 3IJDA 3C61A 4JXCA 3RF9A 1RPKA 1A5NC 5AYZA 1VCFA 2C6QA 3L21A 1Z3NA 1GQLA 3JUGA 2WXDM 1XIMA 3FK4A 3R10A 5CG0A 3S2JA 4Y6GA 3WQCA 2YDRA 2OOGA 3TJXA 2J9ZA 1V3MA 3W76A 1BVZA 5KSWA 2RFGA 1C7SA 1UKPA 1EC8A 3HV9A 4G9PA 5C9WA 2NVCA 1JD9A 1LOLA 3TOYA 2TMDA 3EOLA 4M7TA 2J74A 1YXYA 4C65A 4DI9A 1W5PA 2OQYA 1KXTA 3KVKA 1QXLA 2BXYA 3RX2A 2XU2A 3W7HA 2A4AA 2OEMA 4RV8A 3ZSSA 4C6JA 1WDDA 2DPEA 4MPQA 2V38A 3BUVA 4LY4A 1IGWA 5HQMA 3RPDA 1NQKA 2X1UA 1POJA 1CXIA 1KR0A 3N12A 1KGWA 5E1QA 3SM0A 3HM7A 4W8BA 3HQPA 3Q45A 1R2TA 2Y88A 3G1VA 4AC7C 1JZ8A 4JDBA 5EB8A 3FN9A 4MOZA 1W9XA 1CIUA 2I1OA 4OTKA 1UZDA 5D37A 5JIPA 1XSKA 4C7GA 1JZ7A 1V6YA 4GQBA 4BA0A 2D23A 4ACZB 4HPGA 3CT7A 3N2TA 4DZIA 4LGXA 3THDA 3WFLA 2CEQA 2YA0A 4NHVA 5M3WA 2ZUSA 2NQJA 5CQ1A 4XVEA 3N3TA 1XC6A 3OU8A 3GU1A 2XWEA 1YLVA 1W9DM 3E49A 3G5EA 3QY8A 1ZAIA 1KCXA 2WC3A 3QPYA 3GTFA 1VFFA 3RHGA 2PRMA 1C92A 3KBNA 3T0AA 1Q3NA 4FALA 2YKKA 1V0KA 3GHUA 1Z69A 2HE8A 5EBUA 3B4UA 3LZ3A 3WMBA 4G7EB 4GYKA 4GACA 4A22A 4TO8A 4CD7A 2YZRA 1FWGC 1FWCC 1XIBA 3HB9A 2J8FA 2FYMA 1OK4A 3FIGA 2F6XA 1GEQA 3TYBA 1SO5A 3PZOA 1UYQA 4RCXA 5I77A 2H8ZA 1PUDA 3P81A 1T99A 4B90A 4K2SA 3WDHA 3SCRA 4S3FA 3GH5A 3KBMA 4JTRA 1U5VA 4O1FA 3VA8A 2D2HA 3ARTA 3H2CA 3M44A 4MPKA 3AISA 3L65A 1KO0A 1MW0A 3HV8A 4Q4QA 2AAAA 4GUHA 3SN1A 3PZNA 4DIAA 2FGZA 1XQKA 3QV7A 3ICJA 3TQPA 1DJWA 4R9OA 4KIRA 5CC7A 4FLRA 3EEZA 2G96A 2R24A 4R7OA 1GGOA 3AO0A 3DHDA 2O9TA 4XWUA 1P7TA 5LKYA 4IIDA 1LT8A 1CENA 2ZTJA 3U9IA 1HJUA 3KOWA 4GY0A 4IPIA 4JTIA 2QZRA 3N6HA 4QG6A 1E15A 4PA8A 1XRSA 2VJXA 3WK1A 4H4IA 4W5UA 4FS9A 3M43A 3ZIZA 3P67A 3SIMA 4PSPA 3WH6A 4GVGA 5HA7A 2OT1A 2IKHA 4AB4A 2ZTKA 2WSQA 4E5TA 1KQZA 1OFEA 2QGHA 1HN1A 4IMGA 1LCOA 4PC8A 7ENLA 1KBJA 3TNBA 1YE4A 1KGXA 4C7DA 2IKGA 1DPMA 3HMCA 1ZBWA 1ISXA 1QATA 3EWXA 5AHMA 4BI7A 4QR6A 4GQRA 3NZQA 3GNOA 2JF7A 3H2OA 3WBAA 4K68A 3DCPA 4QE4A 1ODZA 2WNZA 4Y96A 7REQB 1JZ2A 5FEPA 1TIWA 2W4XA 4DQWA 1DIKA 3U5UA 3VDHA 2DSWA 1J0HA 3LG3A 1O95A 3SQMA 1V6UA 1EJWC 4XAPA 3W3OA 2INZA 4LAZA 4CVUA 1V79A 3E02A 4XISA 1D3HA 1XD1A 1J0KA 2E6FA 1X1NA 2V5KA 1TJPA 2NVAA 1KFCA 3MP4A 1ZTVA 2VDGA 5D33A 2E8YA 1PTDA 3A9IA 1K9DA 7TIMA 1K7EA 4F0LA 2ZX8A 3CEPA 2FB3A 1V08A 2XHYA 1ADOA 4M6VA 4GI6A 4LUSA 4IGSA 2V3DA 1NY1A 3WQ6A 1TE6A 5D02A 2NXGA 2WQDA 3OG3A 1E6QM 3C0LA 4YTRA 3W71A 1R38A 2A5HA 3VDBA 4QG8A 1DJZA 3STCA 1UKOA 3QMRA 1JVNA 2QCCA 3NVDA 2DZWA 3MA8A 5HQEA 1AD1A 3V0SA 9XIAA 2E68A 1A5CA 1N55A 2ZUWA 1VFUA 1Q5MA 2OXNA 7PTDA 3V18A 1X7FA 4KMQA 4PMUA 1YHTA 3LNMA 4GH1A 5I09A 2YYUA 1VJZA 2IPWA 4MWAE 3SR7A 4HHLA 3C0SA 2CLMA 4FNQA 3EOOA 5BMXA 3O15A 2EXOA 4M6UA 4CNTA 1C3FA 1V51A 3AZRA 1RPXA 2XGIA 4EF9A 3GR7A 2CLKA 1UUQA 3ZQ9A 3E38A 4C6NA 4PRWA 3IGSA 4I6VA 1VEPA 4DYKA 2GZXA 3P6LA 2DZAA 3O16A 3LTSA 3B05A 2EPKX 4OUIA 1EGZA 5JU6A 4IPJA 2PDKA 1SW0A 1OQFA 1TO3A 1GVFA 3M6DA 4JICA 4J3WA 4IIHA 4GZ7A 3T2OA 4LVDA 4N42A 2BNJA 1TWZA 4UTHA 4DWDA 3L12A 3HFYA 3QXBA 4GA8A 3T4CA 3WNPA 1IR2A 1BGAA 4XBKA 1IIGA 1ZGDA 4H41A 1JDDA 4MDOA 2FJUB 3NVTA 4BWLC 5K9CA 4U2ZA 3ZR5A 4BR1A 4GZIA 2YSWA 2JGQA 2QV5A 1NOWA 3HQNA 2JEQA 3WY1A 4CD4A 2ZX9A 4JQAA 3DHFA 1NVMA 3MYPA 4XZHA 2QUUA 4J3TA 8XIMA 2FVMA 1KRBC 2J27A 4LBUA 6TAAA 2WMFA 2XINA 4EWJA 3H2AA 4B3LA 1XLAA 2ZZ6A 5A6SA 4YIWA 1DWGM 2VHLA 1A5OC 4PB5A 1QWGA 1BYAA 3PB2A 4AXKA 5HATA 1U22A 1YW1A 3ME3A 1EB3A 1W2PA 4GFIA 4PL2A 1HIZA 4RDYA 5LHFA 4UR7A 3B9OA 4C6FA 4V28A 1EYEA 1V4YA 1B5TA 4A3RA 1QI2A 4Y9NA 4UFIA 1VBJA 2C91A 3TTQA 4XIAA 3NL3A 1LLOA 3B97A 4JFVA 4JY8A 5I3IA 2BZNA 3VIJA 2Q71A 4ZA0A 2J7CA 1SQ7A 3W1QA 3GHSA 1M7XA 1DJQA 3EKLA 1BTCA 1HGYA 3MDWA 2YCKX 1A0EA 2WMKA 3IJ6A 4HA0A 3EPMA 1EJSC 2FQIA 3A22A 3WF3A 3O63A 3WN6A 1EOKA 1AQMA 4FPSA 1UH4A 2QMKA 2YX0A 1H50A 2NT0A 4H9UA 3MBDA 2OKOA 4WVXA 1XLBA 4EAYA 2A6LA 1JGMA 4LWWA 3USBA 2VTFA 3QPZA 2L5HA 2XIBA 1Q6GA 2VD8A 4LAKA 5C9XA 4DPPA 1WDPA 4UMCA 5BXSA 5FJUA 3RCNA 2ZWYA 3LYEA 4YYFA 2AKZA 4MUPA 1E40A 4YS1A 3ZLFA 2WNQA 4GNVA 4KEZA 4TVCA 3ITGA 5FEXA 2QPSA 1LF1A 1V03A 1VRXA 2A3LA 2CKSA 3LPFA 4E2VA 1W6TA 2BXZA 3R5EA 4JHOA 3AI0A 1VB9A 4HD5A 4I7WA 4V27A 3REQB 5I3GA 3S2LA 4H6KA 1IWPA 4RLIA 3BMWA 5FKYA 4C6DA 2JALA 3ZT6A 3G0XA 1BXBA 3WUEA 3KL3A 1TV4A 1LYXA 3EB3A 2PLMA 3W7RA 1RQBA 3FS2A 4YCPA 2EPHA 3EMCA 4BK9A 1JCNA 4FO4A 4D1JA 2V5BA 3VC5A 3R12A 2VQUA 4GKTA 2PCEA 3R0KA 3BMXA 4DAIA 4AFYA 4ML9A 3GUWA 1QU4A 1OC5A 1KA9F 3BV7A 2FZNA 3ENLA 3WD2A 5EFFA 2BASA 3M7WA 2BOEX 2VUYA 1TV3A 3A4XA 5H8MA 4H8HA 2ZZ7A 1VFLA 4F79A 1BF6A 3JZUA 4AMAA 2F7FA 4WSJA 2PEVA 4HNUA 2WB5A 3H21A 1KM2A 1A5AA 3PUDA 4WLCA 2W0UA 4KCVA 3VX1A 4DY1A 2VFFA 3KFTA 1S1RA 3VNMA 2OMAA 3WLRA 1UPPA 5T9BG 1WQ5A 3M6YA 2ZFAA 5L9FA 4FLQA 3VD4A 3IK4A 3I7QA 3UJ2A 1E6ZA 4MB1A 1TCMA 3U2ZA 4ILSA 4IMEA 2I17A 4I90A 4JNMA 3QR1A 4CCDA 1QOPA 1WXYA 2WCAA 1OFQA 2PTWA 3LNPA 1V0NA 4M82A 5CPQA 1F5ZA 2X0SA 3LUTA 4MWAC 1DWHM 2XDFA 1E5JA 2OTDA 4JTUA 1I4NA 1T41A 1B3XA 4WKFA 3QJAA 4LVBA 3QZ6A 4C6KA 1MEIA 2PDBA 3DI1A 5FIPA 5HR7A 2Y61A 2AL2B 2QLYA 2ABAA 5A6JA 1KLYA 2YXOA 3AZSA 2V3GA 2JIWA 2YA2A 4UQ9A 1WZMA 1TFVA 1MUMA 5TD4A 1MZHA 2WWDA 1FFRA 4S3CA 1CGVA 1WKFA 4Z2IA 1QK2A 3CV1A 3IAPA 5D2YA 2QJMA 3MYOA 3UWWA 2BLEA 5C9ZA 2Z27A 2EJ1A 1XR2A 3T78A 1XHGA 1L9WA 4DNMA 5DO8A 3NWRA 5BXTA 1UBPC 4OWGA 3EPOA 3I6EA 4QDMA 2J66A 4G6CA 3K8MA 5I07A 3M64A 3TFCA 5JBFA 2FMNA 2QCMA 3NR0A 3PS7A 3UA4A 3OVPA 4XZMX 4OBRA 3GXFA 3ABOA 2CU0A 2WVUA 1E0UA 4FEZA 3SRDA 2DZBA 3O6CA 2D0HA 3PZQA 3O9NA 3LRKA 1T7LA 5D4YA 2NQLA 1PEZA 5LYRA 1CXLA 4DI8A 5I3DA 1CNVA 1UWUA 2QF8A 1IEQA 3EX4A 3T81A 4MJ4A 4HA1A 3KL0A 4PCNA 4HT3A 2IXUA 2FMOA 4C6PA 1F8MA 4HA3A 3W1AA 5IBXA 4E2OA 1TB3A 2HVOA 1QNSA 2CHNA 3DH7A 3T07A 1JUEA 4ZCWA 4BWLA 1YXCA 5I78A 2WC4A 3D0CA 3PZUA 4S3DA 4UQEA 4GJJA 4JTQA 2AMXA 2PWFA 3WUGA 1S5WA 2PDMA 5F2IA 4GKLA 5EMKA 4N6FA 3MSDA 3Q94A 5D32A 1ADDA 1Q6QA 4GY1A 1MMFA 1UR4A 4XV0A 4LYRA 1VZWA 3FXGA 2QDHA 1A5LC 2PDHA 3M0LA 2ZXDA 3P60A 2VEIA 3W1MA 3MUAA 1T40A 2AQWA 3C8FA 1XCXA 3B9DA 4ZVJA 2QW5A 3G18A 2VXNA 1F9CA 3G8EA 3ABXA 4LUTA 2J77A 1GHSA 4WDUA 2W61A 4H6QA 2Y8UA 4IJBA 1VBGA 1HP5A 4RDWA 3COTA 1W37A 1XYFA 4YTTA 1B3ZA 1XBVA 4DYJA 1YDNA 5A2CA 4HJFA 1MQRA 2BB0A 1JF5A 5CLTA 3B0UX 1W3IA 5AY7A 4AD3A 3OP2A 3IJ9A 5CGQA 1ITUA 1UC5A 1O60A 3GK0A 1QBAA 3PY2A 4PTNA 3W7OA 1TVPA 5G2HA 3W7LA 4R9XA 1EA0A 2E6AA 3WD3A 1WKYA 1YKWA 5HNUA 5AB3A 1SFJA 4IMCA 3CHDA 4JCMA 4AD0A 2R6OA 3CQIA 3AIBA 2YCLA 1IXPA 2GQ3A 2ANUA 2ZZ2A 3DYPA 2QEZA 3OYXA 1XLEA 3CQ0A 5D2WA 2DGAA 4IX0A 2NUWA 4C6MA 1F2JA 4ZQOA 1HF6A 4Q6XA 3E0WA 1HO1A 3APYA 3IJ7A 4MAVA 4UUIA 3TR9A 3KLLA 1PV8A 5FAGA 4GE8A 1PZ2A 5C8BB 4GY7A 2GGGA 3BDKA 3B03A 1QPNA 3U7VA 2X0HA 1EEPA 3PF3A 1HVQA 3O6AA 1RR2A 3PTMA 3R13A 2DEPA 2YW4A 1LJYA 4LUIA 5EL1A 4ZTYA 4PZVA 1Z8AA 3WCZA 2WSKA 4Z08A 2GWGA 3P14A 1DQUA 1XLGA 1V6TA 4PULA 3AS0A 2QDDA 1SM9A 1YTEA 1JULA 4ZODA 3ANYA 3APTA 1EGMA 1D8WA 2A2IA 1BSLA 4FB7A 3SJNA 5FSEC 1OFBA 1CGUA 2VGBA 2WW5A 2Y1HA 2VEPA 1JDAA 2CLPA 3RUBL 2DH3A 2FGBA 1WDRA 1JI1A 2X1TA 5CEWA 2VMFA 3WDIA 1DORA 3KBVA 4X3ZA 4D6GA 3B8DA 2W66A 1EDGA 3WFZA 1ZUAX 4HN8A 2OZ3A 3W01A 1OZMA 4S3JA 2ZX7A 1Z6KA 3MKVA 2DW6A 4CQAA 2OO0A 4UTWA 2ODOA 3G1SA 1DWFM 4GIYA 4V1XA 5HMDA 2PP0A 5FA5A 1E1CB 1OHLA 1D8CA 2DIJA 3C8NA 3CZJA 2H9AB 1E0XA 1P0KA 1XKYA 3MANA 2PB1A 4IFKB 4M29A 2VZSA 2QJHA 1TPDA 3N14A 3C3UA 3KWSA 1ISYA 1E6PA 3B06A 3H26A 3WD4A 2RHGA 5BXPA 4JQ3A 5IXEA 4K3ZA 4DJEA 1TJ0A 1AQFA 4WGHA 1LQAA 3MCOA 1YIXA 2HXTA 5CG7A 3NQGA 1US3A 3GTNA 1CX9A 1I8JA 4UNLA 3ANVA 3WX7A 1JXJA 2CCRA 1FHDA 3URAA 5GJPA 1SO6A 4PTMA 3VKKA 3RO8A 1JZ4A 3TVAA 3S4TA 4GVHA 4Z17A 3UETA 1TREA 2YR1A 1HQTA 3LBMA 3CK5A 4E3TA 3GIYA 5IHSA 3PUGA 3T2QA 3LA4A 3GG1A 4A3HA 1CWYA 1E51A 1JDEA 2NT1A 1P0DA 4U3AA 1NELA 3Q58A 3ARXA 1CGWA 5BZAA 5CJNA 3QM3A 4LYQA 3SSZA 3VUSA 1EJRC 3GW3A 4JTEA 3H22A 3BAXA 3NZ1A 5CAKA 2FTYA 3DHUA 2OOFA 1QI3A 2V6AA 1W8GA 1E6NA 4OBSA 3GAKA 4HIBA 4JOMA 1PHWA 4HNLA 3TMLA 3PAOA 4A8LA 2FVLA 2ACRA 1OYCA 1ML1A 3SIZA 2PGFA 1LL7A 1V5XA 3F5KA 3K4DA 1ONXA 3V16A 3STFA 2LLEA 1XBYA 4AEOA 1UZ4A 1AW5A 5FI8A 1W9VA 1S2VA 1KM3A 5F1UA 4LVAA 2ACQA 1EP3A 5FOOA 3CO8A 4P8UA 4YWSA 3UGVA 1SZGA 3TTEA 2WC7A 3SEPA 4PL1A 1J0ZA 3A13A 4AD5A 4EE9A 4YL2A 3SUUA 4J1OA 2X2YA 1JNDA 2HNHA 4JKLA 4KWOA 5A8GA 1IT8A 3R1ZA 4PRRA 1OC7A 3R94A 1ZENA 3W28A 1AJZA 4H2HA 4UQDA 2ZUUA 3TSMA 3EB4A 3WENA 3NDYA 1M41A 4C60A 4L5ZA 1AZ2A 4OE7A 1DQWA 1RY0A 4P61A 4HOXA 1JCYA 4HHHA 2VP8A 1N2VA 1OX4B 4WDTA 3PULA 4GO8A 2NLIA 2PBOA 4I8DA 3STEA 4FR6A 2ZYFA 1SMDA 3VTRA 3IIXA 4PYSA 3S0CA 1WZLA 4ICMA 4JN7A 5GJMA 4W88A 1E9ZB 4AZCA 3AYVA 4B9ZA 5A95A 4HTBA 3GU9A 2VFDA 2PWDA 3KRBA 4ZSUA 1VFSA 4Q4MA 4H9TA 2O92A 1LL6A 1US0A 2R91A 5DBTA 1GQNA 1QAPA 4LFYA 4QAWA 1XX1A 2VOMA 3FDGA 4A3YA 1LL4A 4Y9MA 3UR5A 2VEMA 4MM1A 3NPUA 1LLZA 1MW3A 3LCLA 4PMJA 4OU1A 1ICQA 4JIIX 3NXLA 1XYZA 3V5CA 4X9YA 4F2BA 5G4WA 2QMJA 4DJED 1KXQA 5FACA 3B40A 3PK7A 3PNUA 2PI6A 2UY3A 3I3DA 2QCNA 3HGOA 3PWAA 3NYDA 2FKPA 3ZXWA 4UOZA 1H7XA 1E1FA 2E9BA 4AD1A 4JNYA 1CI1A 3M5YA 5EMYA 3DOPA 1UBSA 2GFTA 4BF7A 1J2BA 5F2MA 3QN3A 4O12A 4CCEA 3KVJA 1CZ1A 1JPIA 1P48A 8A3HA 3WSUA 3S6DA 3WMSA 4JTSA 1K1DA 3HURA 3RPTA 4LW7A 2J75A 4MNKA 2VM8A 5LA1A 3F2BA 3ATZA 5HQLA 4QEHA 1I2PA 2QULA 1VFOA 4O50A 4Y8EA 4TVUA 1F6YA 3WK2A 3BO9A 4YVVA 1H51A 1VRDA 1E9LA 2OX1A 4DO4A 4ZOBA 4ML4A 1UW9A 4LTSA 5DMLA 4Z42C 3AHXA 1G69A 8RUCA 1KKOA 3SDOA 3LHVA 1B31A 5EBAA 2BDQA 2HVNA 3DI0A 1WE5A 3S83A 1XCWA 1VYRA 5HPCA 3MUZ1 3KCOA 3CUXA 2J4GA 3D47A 1QHOA 2QCHA 3G1YA 4LT9A 3P5ZA 3G1XA 1QPOA 4LJ3A 1QNPA 2OWXA 3V0UA 2GUBA 3LU2A 1R47A 2C0AA 1TV7A 4P7RA 5HJYA 1EXPA 5FJOA 3TUUA 1CT5A 1D7KA 1U1JA 3MCNA 3LLXA 4IX2A 1FH8A 5CH9A 2OVLA 3UWUA 5H1WA 2OSYA 3NQ8A 3R8RA 4HSHA 1YNYA 2GJXA 1RLDA 2ACSA 3R8GA 2E3ZA 4AEFA 3UA3A 3BW2A 2G3JA 3R8HA 3AXHA 3O6DA 3VDGA 3V1PA 1WV2A 4AWSA 1T5AA 1X8CA 3NQEA 2Z4GA 5BWAA 3CAWA 1JDCA 3O2LA 3UVIA 3WBYA 1W5OA 5KEZA 3A24A 5LXEA 4DVOA 1SJDA 2PPGA 3A47A 3N2XA 3WLOA 4UTWC 4DBEA 4LOCA 3LGDA 3UZWA 1XWYA 4E3VA 4GMEA 4GO9A 4MZYA 4YNGA 2BY2A 1R0MA 6REQA 5H6HA 4GQQA 1DBTA 1IEIA 3C2EA 4PEEA 5I24A 5EMJA 4RE3A 2NW0A 1ZB5A 3R58A 1OB0A 3M47A 3PTDA 3U57A 4DELA 1FOBA 2FJKA 1E56A 4K6AA 3TEVA 1PE1A 3TZFA 4HOWA 2GUYA 1P43A 1V7YA 3E96A 3PZGA 3WG6A 4DJEC 3AIEA 4LAMA 2G95A 2JBMA 2RDUA 3C4UA 2QCLA 3M16A 4Z2KA 2Z0IA 4X61A 3BLDA 1L8NA 1IZKA 1TMQA 2WKJA 1EP1A 3IEBA 3VNKA 5DMMA 1WNOA 1GJUA 4LALA 4GPNA 1RD5A 4BZYA 4BQ4A 3LY0A 4KWSA 1PPIA 1OFPA 4UTMA 1UR8A 1YTKA 3OODA 1WO2A 3N13A 4QCEA 3LCHA 5GQBA 3IIZA 3TQVA 4ROQA 3EOUA 3DFQA 3AROA 2YFOA 3CL7A 1OX5A 1R8LA 2D0FA 2PDLA 1H1NA 3ISIX 4OZOA 3ARWA 4F0HA 3VGFA 3FVMA 3JZEA 3H7VA 1O5KA 3N9KA 5A69A 3VGEA 4GVFA 5MKGB 5K9DA 3DC0A 3S1WA 1GKQA 2POZA 3V36A 1OCQA 3TYUA 2YBTA 3LB0A 2RJHA 3H4GA 4NG3A 5A5WA 5LNUA 1UWIA 1BKSA 3EAUA 3K46A 4NI3A 5B80A 1F3EA 1Q65A 2Z2UA 4CNOA 1WX0A 4N4QA 2ZA3A 4Y7EA 2Y89A 2HK0A 4H7CA 5J5RA 4A6GA 5LIKX 2NWRA 3ECQA 1UMLA 2C15A 2VZTA 3I6TA 3CMGA 1WB0A 4J3SA 3H2MA 1DWJM 3VGDA 2VCAA 5TAOA 3VD7A 2XTKA 4PTXA 4MG4A 2CZFA 4LANA 3VXGA 3EWYA 1U5HA 1ZP4A 3IRDA 4H9MA 2A21A 3W6MA 1ITQA 3JR2A 5A8NA 1KRCC 4ACZA 4JEQA 4ADUA 3UXAA 4M6PA 2VOTA 4I8YA 3LENA 4UR8A 2P0IA 3RR4A 1H1ZA 3S9YA 4XD4A 1WPCA 2XVNA 3QSRA 1TV2A 1RA0A 5A8PA 4FMVA 3WLHA 4MB5A 4XUGA 1S5VA 3NSNA 4BF9A 3REQA 4LU0A 3ANUA 2E09A 4QITA 1C90A 1FP9A 2YW3A 2FGLA 2GGHA 1RBOB 2IQDA 5A8MA 1E70M 1E0VA 4PBGA 1X39A 2R1KA 3ALFA 4H04A 5DMNA 1EZ2A 2PFHA 2O9RA 4Z1YA 1VH7A 4TX6A 1CTNA 4AZHA 4DJFC 3CQHA 4NIRA 3G8RA 1Q13A 3EYPA 3GB6A 2QPXA 1KTCA 3NSXA 4J3VA 4XTDA 3CUZA 7REQA 4UOQA 4IUOA 2EPMX 4GBUA 4F8XA 4WOZA 2X2GA 2ZZ1A 3VMOA 3VM7A 3RK8A 3ARYA 5AVHA 4GUJA 1TVNA 3NURA 5HK4A 1VENA 4KS0A 2VO5A 1J0IA 1SZFA 3QKZA 4AWEA 3F2DA 1GTHA 4D6DA 1GQIA 3IIPA 1XDLA 3QSTA 1G01A 3QQWA 4C6IA 1OK6A 2R1NA 1PZ0A 1GPWA 4AHOA 3BJFA 2JIEA 1E72M 1UJQA 2B7OA 2X41A 3TCSA 2R1LA 3DAQA 2VFHA 1OD0A 4Q4KA 4EX4A 1R3SA 5ABEA 4NAFA 1RZMA 4DEFA 5CBBA 4HSOA 1JRCA 3RCMA 3HPZA 3GHRA 2BXVA 1F4AA 2IKIA 4IG2B 3UXDA 1J5SA 1SJCA 4PMVA 3F4WA 4UFLA 1Z48A 4UMBA 1GK8A 2EG7A 1M03A 4K8HA 2P8CA 3WLMA 4AMCA 4H19A 1F07A 5CJ5A 1F6KA 4PUDA 4N4PA 5I02A 1S2TA 3POCA 4S3AA 2DQXA 3UWQA 4CNSA 4Q8OA 2Q01A 1FWRA 3CZ8A 2ZDSA 2PDYA 1O1HA 3W7NA 3L0KA 4IQLA 2YIHA 1GVOA 2DQWA 3GYCA 2PP1A 5D9PA 4AXNA 4IH3A 1KM0A 1AD4A 3W07A 4PE8A 1XSIA 4IP5A 3HA1A 1NSJA 2GPTA 1TX0A 3BLIA 3EDDA 3FCPA 3EA2A 1I2OA 2DSUA 2ZA2A 1JFXA 2X09A 5HMEA 5IFTA 1J0JA 4RXGA 4PUWA 2QJNA 1TYGA 3ZZ1A 5DCBA 3MU7A 3BLOA 1KD0A 3ARPA 2EPLX 5C6MA 4NZ4A 1GYMA 3S5OA 1CW2A 1ODUA 4QTGA 5HBFA 5HWNA 4PUJA 1M7OA 3THAA 4QE5A 3PVFA 4UTTA 3RM9A 4MVAA 4CQDA 1DE5A 4UTUA 4CD5A 5I00A 2I56A 3DX5A 1B3WA 1AJ0A 4UFJA 3K5XA 4OV9A 1B4EA 5C54A 2VQTA 3TJIA 3O1NA 2KAUC 3QFWA 1VJSA 4UTFA 3M7SA 1R7OA 3LOTA 3W86A 1HGWA 4O54A 5I6SA 1ONRA 2BGSA 4W8AA 2UY4A 3A64A 3KZPA 3OHMB 3VU2A 2W62A 5D9MA 4RDVA 5GVJA 3T0BA 1JRBA 3BGGA 5G5IA 4BEQA 2DSKA 5AC5A 4LCSA 1EO5A 2FPYA 3PSVA 1AH3A 4GJIA 1J79A 2VVSA 3UWZA 2OB3A 5CAHA 1L8PA 1R87A 5D9NA 3O0KA 3CEUA 2PP3A 3B0YA 3UG3A 3VC6A 1SPQA 3AC0A 2R82A 1E4IA 5K7JA 3CAVA 4CEXC 3CPUA 2PDNA 4AEEA 2VGFA 4AF0B 1A0CA 2HWGA 2BS9A 4WR3A 3QYSA 2NWSA 2RAGA 3R0UA 4S2BA 1BWLA 4PFMA 1Q6EA 4XAGA 1TMLA 4MHBA 1R6WA 3LGEA 1JNEA 1O5QA 1FTXA 4NL1A 3K13A 1K8CA 1R3WA 1WDSA 1CGTA 4YN5A 3M0YA 4GYPC 2DORA 3T2PA 4ZB5A 1OZQA 4AY1A 4XAFA 4B5SA 4GRSA 2HCVA 1MEHA 2XSAA 4YHEA 4DRSA 3GWQA 4IF2A 2ZZ4A 1ZP3A 5T26A 3TTSA 3N29A 4JKMA 1F76A 3GDTA 1GKPA 4JGDA 4JIPA 1UHVA 1VHCA 4NZJA 5KTLA 2VT0A 4YU1A 3APGA 3VE7A 4X0NA 2EG8A 1WBHA 1KKRA 5A6BA 4UCGA 2VX6A 5DXXA 3CH9A 4XB3A 3LX9A 3WNMA 3GTXA 1TIMA 3QY6A 4O17A 3QV9A 1IEXA 1MUWA 3QHOA 4K1GA 3G1AA 3PZMA 1C9DA 3AIRA 3LHYA 3OW1A 4AIBA 4B5TA 4CKQA 5IDZA 3VNJA 3T7VA 4X63A 1VFMA 4GZJA 4ONVA 3AHVA 4HB7A 5BRPA 3G1DA 5AHIA 4KRZA 1VCVA 1HJSA 4ZO7A 3MB9A 2YYTA 4J4KA 3SY8A 3KBSA 4G2DA 4QRNA 4G56A 2X7VA 1ISVA 1V6WA 1JZ3A 1AZ1A 5HOSA 3CL6A 4PMOA 1SR9A 4L6OA 2ZBTA 1JCLA 1GT8A 3MHGA 1RXOB 3PPHA 1KLZA 2V5CA 3M5ZA 4GD0A 1FDYA 2PDIA 3H4WA 4JTLA 1L6FA 4E8CA 3U7BA 2IPFA 1KB3A 2BVWA 1K3UA 4NF7A 4QM1A 3UY8A 4C6LA 5C2CA 3ZJKA 3B8TA 3GDMA 4RPPA 3KRZA 2Y8VA 1W54A 3BAIA 3ARSA 1XLFA 1MXGA 4DJDC 2B7NA 5AHNA 1U83A 3DYOA 1MFVA 1D3CA 1EGVA 1AH0A 4DM1A 1NP0A 4JN8A 3CLMA 1GVEA 4FLOA 2Z1XA 3CB3A 1HFBA 1ADSA 3V75A 5DT5A 1XGDA 3LERA 3PHAA 4BI6A 2DSZA 3WEMA 2IKJA 4TV6A 3ZFHA 4ZQCA 3XINA 3WLJA 1C29A 4MY9A 3PTKA 4KCUA 1VYPX 3FSUA 5ABHA 3A5VA 4M6QA 2BHUA 1R2RA 1GOOA 2WNWA 3CWOX 5CBIA 4L9ZA 3PB0A 2H8XA 2DH2A 4ORMA 1I2QA 1F05A 4S2CA 2GQ8A 3U2EA 1Q63A 3TDFA 4JL2A 1SVDA 2GK1A 4XD5A 5A8QA 1DQXA 3F7JA 2B7PA 4BJHA 1ZFJA 3WLTA 4PMZA 5CZKA 5LNWA 3W37A 3F4CA 3EGJA 1RVKA 4W87A 4PH6A 3PBYA 4AU0A 4DUOA 3SCUA 3E2SA 5HPOA 3AOFA 3T4WA 2QHAA 1PDYA 2PLCA 1XLLA 2X40A 3QMSA 2PE4A 1WXJA 4I5XA 3MY9A 1NOFA 3F5JA 3AHTA 3BL3A 1HJVA 4J35A 4MLRA 2XH7A 3F4DA 1FXPA 1CB7B 2P76A 3B04A 1E3ZA 4I5RA 3KRSA 3CUFA 1JYVA 2EGZA 3ZO9A 3NOYA 3GVQA 2CBUA 4HMEA 1I1XA 1VD6A 1LORA 4E0CA 2Y24A 3UYIA 3EX1A 5I06A 2I14A 1SO4A 4J3XA 4YTUA 4OGZA 4DO6A 4W9TA 3UCQA 5LA0A 1HJXA 2VC7A 1Q2SA 1LDCA 3CM4A 4XZLX 3WEOA 4QFUA 5TF0A 1HP4A 2F2HA 1AFSA 4OBTA 1H0IA 4O11A 1UWQA 1J96A 3W1LA 1Q2RA 2FZ8A 1HNYA 2ATSA 1UP3A 1VBUA 1J11A 2ZADA 2JFEX 1FCVA 1XLHA 4MNJA 3SURA 1DJYA 5H2ZA 4LF1A 3G0UA 3BWWA 1P0BA 3DN5A 4ZE5A 3NQ6A 1JQXA 4Z1AA 1K77A 4GCAA 3NQMA 2R1MA 2Z1VA 1EDQA 3W1PA 3UT0A 2XIOA 4ZFMA 3DC8A 2ZVIA 3EMQA 3ARZA 1K8YA 1LLWA 2VFGA 2VDIA 1LG2A 2YL8A 6PTDA 3GDLA 4HPXA 1P7TB 2BGNE 4N6EA 3KUMA 3W7EA 3UW6A 3NDOA 1T6MA 4GINA 1V0MA 5E5CA 3BZGA 4UTTC 4UMAA 2PCQA 3W9ZA 1A0DA 2XH4A 2CZEA 2OEJA 4B15A 3ZJ8A 4W7WA 1HKIA 4NNBA 3GXIA 4G1NA 5IOBA 3B0PA 1QI4A 1R9YA 3BOXA 2G50A 4P7LA 1JG9A 3E5BA 2ZRVA 1K9TA 1PYFA 4NASA 4JY9A 3H2EA 1GOWA 4HNOA 3IK2A 4R34A 2X30A 1WA3A 3QVQA 1R3VA 3IVUA 4QS6A 2WZIA 3HPXA 5FEWA 2BG5A 1QVBA 4ERGA 5C5YA 2Z25A 1IXOA 1PWLA 3WK0A 4FOKA 4AW7A 4ES4A 4FZIA 3SCWA 1S1PA 3ITXA 2XPKA 2ZRYA 3EOEA 2EJAA 4F48A 1FWBC 4IGMA 3YPIA 1K8XA 2VFIA 4JCLA 3CL8A 4YTQA 4RZ5A 1RK6A 3GYEA 4D6IA 1V93A 3W84A 2XUCA 1EEXA 1Q7ZA 2P1FA 1XINA 3SSJA 4FNTA 1N7KA 3OA5A 1LRTA 4NZ3A 1XIEA 3C52A 2YBUA 4DWSD 1EBHA 2JKEA 1TPEA 1M01A 4RW3A 2E25A 2GWNA 3GU2A 4GYPA 3TCEA 2ZKMX 3NXFA 4NILA 4B16A 2VVNA 3ITYA 1LRQA 2ZXAA 3DENA 3USZA 4IFRA 4CQ8A 5CZTA 1UKTA 3LV5A 3VD5A 1WUFA 4XZ9A 4NVTA 3TOPA 3FAWA 3VMNA 4W85A 3MS8A 2ACUA 3EDKA 4TX9A 2OFJA 3CYJA 4PMXA 5CPMA 3O06A 2WBGA 3IUDA 3MUIA 1B30A 3GVGA 3VYLA 4A8RA 4OIFA 1SSGA 3S2NA 4C7FA 2J25A 2A3HA 5F4XA 2BHZA 3BLKA 4DLFA 4KKXA 2PU0A 2DT2A 3NG3A 2FZBA 4MWAB 3GE7A 3W7CA 3WBEA 1H49A 1HVXA 3AS2A 4GC4A 3WQDA 7XIMA 1LUCB 1GUVA 3WLKX 1TV5A 2Y7DA 5C0QA 3ARRA 3GTIA 3V3WA 4B2DD 3SGZA 3R6IA 3GRIA 3TA9A 1Q6FA 9CGTA 5IDIA 1I6NA 1VP5A 2XYLA 1LOQA 1OWQA 2CLIA 1SJBA 2V2DA 3OIXA 3UNTA 2MUCA 3BW4A 3CIXA 3URNA 1XICA 3LQLA 1NJJA 1AQ0A 5CSSA 3CAKA 3QOKA 3TWBA 5DXYA 3L2LA 3ZLGA 4NI8A 3LXBA 4AQLA 2QVNA 3KDNA 5H8PA 2TODA 5K9XA 1IE7C 3C0QA 1JEZA 4FNSA 3LMYA 2J7DA 2PUZA 2HPIA 1KM4A 2DY3A 2ZIDA 2DZUA 4RJEA 1ICSA 3D5HA 2OWWA 3W53A 1GVQA 3RPMA 4GQGA 5DQPA 3TYAA 2EPOA 4UC5A 2CW6A 4H7VA 1YNPA 3ITOA 5CPNA 3BV4A 3M0HA 1KQYA 3WKZA 2Q6ZA 4MZ1A 4DM2A 4PODA 2J8TA 1NH6A 1WOBA 3TXZA 1A5MC 3EKZA 1M7PA 1BKHA 4PMNA 4AIOA 4Q33A 1E3XA 4AZ7A 4DX3A 4A2RA 4BKNA 2W79A 2HS6A 3IARA 4DBUA 3EDJA 2WPBA 2PF8A 2DVXA 2XIJA 5A2BA 4JKKA 1VFHA 4GFSA 2OJPA 4EK7A 2IXVA 1J6OA 3SQSA 2CBJA 4OUEA 4QJ1A 4E8GA 1MXSA 4OKDA 5REQA 4Z2JA 1Z41A 1CGXA 4US5D 3DERA 2D73A 3AMGA 4MY1A 4H1ZA 3IGUA 4NX5A 3CIWA 1A5SA 2X42A 3GNXA 2NX3A 5JBDA 1MW2A 2WMHA 1E0WA 1GVSA 5HINA 3LLFA 3SY1A 1ZBKA 3WMCA 1QR7A 3JW7A 4QSFA 1TCDA 2FPTA 4NT0A 5HNNA 4M3PA 4PCPA 4ATDA 1AW1A 3GC5A 4L6HA 1ZL1A 3TQ0A 5AYBA 3FJ4A 1NF7A 1CEOA 2RJGA 2GVEA 1C8XA 3QRHA 1UWRA 4X22A 5AYIA 1OM0A 4I3GA 2TAAA 1W9UA 1JIBA 2XVPA 3C2VA 1KM1A 2XH0A 1BQGA 3L5AA 4Z2HA 2ZX6A 1EJVC 2JKAA 2O4MA 3CHCA 4N7QA 3UPWA 3UNDA 3T40A 1CDGA 4CN6A 3ARUA 1QMLA 3I7RA 4CNUA 3TP4A 3VINA 1KCKA 4JQ4A 2O0TA 3TYCA 1K02A 1YDVA 1I1WA 2PF0A 2JGYA 3L4TA 3NM3A 3N17A 2G5WA 3S9IA 2DV0A 3PBMA 4ZB0A 1MDLA 4R33A 4TIMA 3W7KA 3QEZA 1U2YA 3UBPC 5HWMA 1I9CB 1YDYA 2OELA 3H2NA 4LAOA 4OHQA 4ERAA 4KBXA 4US5A 4NAFB 4M81A 3O7UA 4U3CA 2QS8A 1M68A 4O52A 3W7GA 5K3VA 4S3KA 4A8IA 4DUWA 1XLDA 5DT7A 3AUOA 4DAFA 3TW9A 3S6OA 4DBWA 1A3WA 3HPSA 1XI3A 1LZOA 1WDQA 3N6QA 5FL1A 4L4PA 3A4WA 2V82A 4FX7A 1K9EA 4AD4A 2I5IA 3L67A 3CHFA 3EPNA 3XISA 3EWUA 2WCSA 1XLCA 4PMQA 3ZWTA 2WSPA 4UQCA 2VI0A 1S5MA 4JDYA 2F6UA 3BG9A 1TWDA 2PLKA 3E1F1 5BOFA 3TE9A 4EP8C 5HJLA 4UNIA 3BAJA 2BOFX 1ONWA 1W17A 1BG4A 4NXKA 3VIOA 3KOZA 1E4NA 2J47A 2NSXA 3FA3A 3UZJA 1XDMA 2GOUA 2Y5EA 1K6AA 1NFGA 1F6PA 5AYXA 2XIQA 3LHUA 3URQA 3PN8A 5D8WA 5M17A 4N9CA 3CIVA 1CYGA 3S5YA 2YCIX 4FIRA 3WK3A 1O6IA 3W22A 3A4AA 3W23A 4B9YA 4TMBA 1I45A 4JTAA 3CASA 3QLDA 3UZXA 3VCNA 1P6BA 3PNZA 4GLEA 2FZ9A 4IFOA 4GI4A 4WGXA 3FGCA 3KOYA 5JUVA 4JL1A 3EWBX 1E6SM 3C5QA 1LBFA 1G4SA 3QV8A 3VD3A 2ZZ5A 4A2SA 1EFZA 1ZBVA 2XM1A 3ZJ6A 4CCZA 1QDSA 4DBSA 2RGMA 3WLPA 2V30A 4F0KA 2GUUA 4MGGA 3LCIA 4REQA 1AA1B 1CGYA 1XL9A 1OFDA 4O57A 3NDZA 4L1WA 5DCDA 5FF4A 1Y5XA 3DYMA 4UIOA 4JIQA 1ESWA 4LVGA 4IICA 4GUFA 2DZPA 2H6RA 5H8UA 4MB4A 1B9ZA 3GNPA 3P0WA 2JEPA 1ELSA 4W93A 1FQ0A 3CWNA 3W88A 3S47A 4PBFA 4MAZA 1W8SA 1ECEA 3ZSTA 1MRAA 4EWND 1OJXA 4EKJA 4CN4A 3LM3A 1Q6LA 2DUXA 4HCLA 1KBKA 3QTPA 2V69A 3WJSA 4HNVA 1TVLA 4JFWA 4PBEA 1SZRA 2P50A 4BF5A 1A80A 5ABFB 1XG3A 5FAJA 4UZUA 3HOJA 3KOXA 4C6BA 3HPFA 2QXWA 3DECA 1KFLA 3L4XA 5DMYA 4B5NA 2CKRA 1QWKA 4D9PA 3PUOA 1EQPA 1GOKA 1XIGA 2WM0A 2PGEA 1DWIM 4EANA 1F3WA 2DSVA 3FGCB 4RR4A 3W82A 1NDZA 2VEFA 3ORWA 4OVXA 2SFPA 5BCAA 4FI4A 1Z89A 3I4KA 1OCJA 1V3KA 1G6CA 1L6GA 3AHYA 3SZ8A 4B3KA 3GG7A 5TNVA 2ON3A 5CZJA 5I3FA 4L9XA 3SBFA 3NO1A 1G5AA 1SW3A 4QISA 3NL2A 4KCTA 4R85A 2BMBA 1UROA 3WDRA 2E5DA 3E0LA 3C86A 3JVAA 5G1MA 2YXGA 4GABA 1RBLA 2PC8A 3HFTA 1JZ6A 2Z29A 1V6VA 3GG8A 3ES8A 3NAVA 3T1GA 3Q65A 3HZ3A 2RGLA 5C71A 3MUY1 5CGMA 1SZEA 2WMIA 4XKMA 3K4WA 4DF2A 4NJIA 4R88A 7CGTA 2EEXA 1OBAA 2QJGA 3FV9A 1LM1A 1DKWA 1TPVA 3OB8A 3HU7A 3OA3A 1GQKA 4GX8A 4IJCA 1Q45A 3W24A 1FWHC 5FJTA 4XSLA 1VQTA 3BQ6A 4GWEA 6TIMA 4IJRA 3LHWA 3PM6A 2XSBA 4L1GA 4A4AA 1ZLPA 3H54A 1E6XM 4NY2A 1S3TC 3E9AA 1QUMA 3WLNA 1IR1A 5DY2A 4DZAA 3ONCA 4QE1A 3BLFA 1E43A 3VFLA 2EAWA 1N82A 1PYMA 1UJPA 3PP7A 4KQNA 1P6WA 1F4HA 3W29A 1TE1A 3AU2A 3A12A 4TMCA 4GISA 3GFYA 4QBXA 3TSDA 3WQPA 1SR0A 4PUKA 3SFWA 3M46A 1ITXA 3S1GA 2Z2AA 2KX9A 2OZ0A 1MI3A 3IVTA 4ICCX 4IIFA 1ISZA 1G0CA 5FF2A 2YL6A 3S5ZA 4XAZA 1ZJIA 3IVSA 4R5EA 5J8LA 1XH1A 2OWCA 4GI9A 1H1YA 3QOMA 1ZALA 2GJPA 4INFA 1G7UA 1PWMA 1QK0A 1EIXA 2BODX 4IHCA 2YL5A 1EH9A 3WLIA 3WNLA 4PMRA 3TX9A 1OT2A 5M03A 3QW4B 2FFCA 1AVAA 4S1FA 1JF6A 3H2FA 3GVVA 2C1IA 4GCXA 3TXVA 3LS9A 3MSYA 3HIJA 1VEMA 4IQDA 4Q8MA 3SUVA 3HN3A 2OLAA 3GNRA 1H0GA 4RNFA 2NSOA 5EYWA 1E6RA 2A79A 1SJAA 4Q8UA 2ZRZA 1XDJA 3E2RA 3K8LA 2P5NA 2E1DA 2E5CA 2RKXA 3OJGA 1H41A 4R27A 3UP8A 5BROA 1QOQA 2VC5A 4IFKA 4JTKA 1J8VA 2F2KA 1XLIA 1JD7A 2ZZ3A 3GHTA 3M0XA 5AYYA 4XZBA 2CC0A 3TAKA 2XH2A 2ZC8A 3SW6A 1D2KA 1TV8A 1HO4A 1B2YA 4ACYA 5D9OA 1UC4A 1RALA 5FD0A 5F1VA 4EOUA 1BVWA 1VF8A 4KRTA 3G3DA 4UFHA 2YCEA 4WKAA 4S3GA 3VIIA 1E1EA 2W6RA 4H8VA 2Z1SA 3AIQA 4XD3A 1TJ1A 1X96A 2BSLA 5HNRA 4URIA 2ESCA 1A53A 3IRSA 4D6CA 1OGGA 4H6RA 1O68A 2WQPA 3FYOA 5HJXA 1AMKA 1JPDX 4B4HA 3DFSA 4HCDA 1TTJA 3ZVHA 1H4PA 4PCSA 1GZ1A 1SW7A 1ZJBA 2VYOA 1M1BA 3NSMA 3OLIA 3Q2DA 3CHVA 3P80A 3SRHA 3WJXA 1YNQA 3CWHA 1R3TA 1TX2A 2REQB 3G1HA 5MHBA 1NWUA 1VPQA 1PTAA 4ZEPA 4ZTXA 5ECVA 3IACA 2E9MA 3TW7A 5BOEA 4BQ2A 4P5UA 3ZLHA 1P6CA 1AL8A 3N6JA 1F7BA 3P93A 3QMTA 1GOIA 3PWIA 4AIUA 3NM1A 4EIVA 2A3AA 2CETA 1Q6CA 2DUZA 3EWDA 4QLJA 4CUCA 3GXTA 1NQ6A 2ZDRA 5ENLA 2WSYA 3BICA 4HZ8A 3A5FA 1Q6OA 2HBVA 1Q66A 4CD6A 1H5YA 3UZZA 4NU7A 4KFPA 4GH3A 3FLUA 2WSRA 3FYPA 3ITVA 1FDJA 5CJMA 5CPTA 5HXMA 4RK8A 1ISWA 1B0IA 3T0DA 4A8NA 3PZTA 3SRKA 1J0YA 3B9AA 3RU8X 3LPGA 3UGRA 5AHLA 3AJ7A 2I9EA 1TRIA 5C9UA 3ZT5A 1GOQA