2CIPA

Structure of the michaelis complex of a family 26 lichenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
273
Chain Sequence
SGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Distortion by a Lichenase Highlights the Different Conformational Itineraries Harnessed by Related Glycoside Hydrolases.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE H
total genus 110
structure length 273
sequence length 276
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cipA00
1D3CA 3VIKA 4AZBA 2Y24A 3ALGA 3AHZA 4NZCA 5A6KA 4UFLA 5E09A 4CU6A 2ZUWA 4RE3A 2GK1B 3ZMRA 3CIVA 1E56A 2X8RA 1G1YA 1GOOA 3POHA 4V2XA 1E9LA 3VIHA 5A95A 5BCAA 4D6FA 2MANA 2VRJA 4AZGA 2XYLA 3CUHA 1UD3A 4HZ6A 3BMWA 4HP5A 4WK9A 4X9YA 1TVPA 2JEQA 4QLKA 2WMIB 1UH3A 2D20A 5BXTA 1UHVA 4CVWA 3PTMA 5ABEA 2XFYA 1FHDA 4LXFA 1UR1A 2OSWA 3VKKA 1HP5A 3O6AA 2YL8A 2WLZA 4AD5A 5EFFA 2VMFA 4UTFA 5LYRA 1GOWA 3VX0A 4ACZB 1KGWA 1J0HA 2WVSA 2ZXAA 3QOMA 2E40A 4N0RA 3FHQA 2YA0A 4EE9A 4H2CA 3KE0A 2BY0A 3ZOAA 3N1AA 3WMSA 3ZO9A 3WUEA 1B3YA 4H04A 2PB1A 3ARYA 1V0LA 1UWTA 3HU7A 3CZ8A 2D3NA 1K9DA 4UR9A 3SUSA 5LA1A 3WBAA 4JFWA 1WB0A 5AYIA 3WY1A 1FH8A 3IANA 3ARTA 4HZ8A 2ZICA 4F8XA 1CLVA 1RD6A 1JDCA 2A3EA 1C8YA 2QPUA 4MDOA 1VRXA 3S2CA 3U5UA 1GUVA 3VIGA 2VX4A 4UFHA 4XV0A 1E5NA 3PZOA 2EBNA 5A6SA 4GO9A 3CTTA 1MXGA 1Q6EA 4OOZA 1GJWA 1U33A 2RGLA 5BWFA 2DSUA 4W87A 3OLGA 2AOSA 2DT2A 4WKFA 1ZJBA 1BF2A 4AZ5A 3CHCA 2W63A 3K4AA 3W27A 4Z2IA 1V6YA 2G4FA 4UQ9A 5GPRA 3WUGA 4PTVA 3BXWA 1GNXA 4CD5A 3MSDA 4HA4A 5HXMA 3RM8A 1DWHM 3UETA 1BG9A 2ZUVA 4TXEA 5CGMA 1BSIA 1J0KA 4D6EA 3MUIA 4KGJA 2YL5A 3D5HA 3G6LA 3MKKA 4CUCA 5A6MA 4W7UA 3I3EA 2YA1A 1W9BM 1BAGA 2WZHA 2CEQA 4ACYA 2XVPA 4QCEA 1BYCA 1VENA 1L8NA 1UD6A 2J8FA 3NUKA 4OJYA 4BS0A 4GKLA 3EDDA 3TP4A 3VIIA 1KR0A 1LWJA 5DFAA 1W91A 2WMFA 1NWTA 1Q4NX 2EPLX 1X6NA 4JHOA 5I2UA 1EO7A 3LPOA 4Z2KA 5FL0A 3PZVA 3N9KA 2BS9A 1B3WA 1PPIA 5CPTA 4WJXA 1UWQA 2BVDA 1PZ3A 3SCPA 1XHGA 1ZBVA 3K4DA 4U33A 1J01A 3WQ4A 4AEFA 2HISA 1QW9A 3PZQA 1UQZA 1ZL1A 3SUTA 1WDQA 4JHZA 1QHPA 4ZE4A 5CSUA 3WD4A 1W9DM 2GFTA 2JE8A 4R5EA 1LF1A 5ECUA 2XWDA 2EPKX 4AZCA 3GYCA 2YKKA 2CXGA 2YBUA 2DEPA 1ISVA 5C8BB 1DWJM 1OCQA 3W25A 4A4AA 2V5CA 3FHAA 4WIWA 3VDCA 3ARRA 1E43A 1K9EA 3VILA 1V0KA 4PRWA 1UZ1A 2HVMA 2XFFA 3TONA 3VGGA 5C70A 3SUVA 1V6WA 2X2YA 3S6TA 1MW1A 1E4MM 2W67A 2WCGA 1US3A 4MB3A 1U2YA 2Y2WA 1TUXA 4H8UA 2WCSA 5D9OA 1WP6A 5HNNA 1CYGA 1W3JA 3WEZA 3W38A 5I77A 2VZSA 5A6LA 1XH1A 5A8QA 3AIWA 4DUXA 1GQLA 1SYTA 1UD2A 3O2LA 4OIFA 2O9PA 1W3HA 1GQJA 1UKOA 4KRTA 1JXKA 4U31A 1KXQA 1W32A 4HPGA 4AD4A 1ZBWA 5F7UA 1TVNA 2YDQA 4DWSA 2G41A 1SMDA 2BY3A 1WNOA 4PMZA 1O7AA 2WXDM 2Z1SA 2DSWA 1V0NA 3AYSA 1CXHA 1JYWA 2WCAA 3OLIA 1E6ZA 3T2QA 3GNOA 2XTKA 2E8ZA 3M46A 3NYDA 2EPNA 2ZUNA 3W29A 1E71M 2ZXDA 1M04A 4LPCA 2YDSA 1A3HA 1QNOA 3AYRA 1JAEA 5E70A 3LPPA 3EYPA 3ZJ6A 4P7QA 3T2PA 1E6NA 4E4PA 4D1IA 1C8XA 3RO8A 2VVNA 1Q6CA 4U3CA 1XYFA 4OOUA 5D9NA 4W5ZA 3CZJA 2O9RA 4XX6A 1TE1A 2EPOA 3AXIA 3NCOA 4OZOA 3WUBA 3PZTA 3WD2A 2AMGA 3AI0A 2QPSA 2E4TA 4LYPA 1XD1A 4WLCA 4JZ5A 1V3IA 3WENA 2ZUTA 3K8KA 4D1JA 4DUVA 2XSBA 2BY1A 2WM0A 1M03A 4W89A 1NH6A 4XZBA 2X05A 1UR9A 3RMEA 1H09A 4TTUA 1BPLB 1E55A 1BYBA 3SIMA 3POCA 3MMWA 3WUFA 2PWGA 3MV01 4B9YA 5FD0A 2BNJA 4UQEA 1JF6A 5GNYA 2DGAA 1TA3A 4CN1A 1HJUA 3CMGA 1VF8A 4B9ZA 4LYQA 4JCLA 3OBAA 1H1NA 1B30A 1B3VA 2EEXA 2VJXA 7CGTA 5AY7A 3AS2A 3ZT7A 4EK7A 1BLIA 1UYQA 4PMRA 2WVVA 4K68A 3U7BA 4KWUA 1MQQA 1TG7A 3WEMA 4FLOA 2NT0A 1I1XA 1GVYA 2WANA 2XIIA 2DT1A 2ZIDA 3RIKA 3II1A 2ZUMA 2J79A 2DIJA 1JZ2A 5IFTA 4Q7NA 2X0YA 1WDSA 5JBEA 4AMCA 4CN4A 4LQ1A 1BFNA 1GOQA 3PZNA 4DWSC 1OT1A 3ZM8A 4HZ7A 4AIOA 1B1YA 4XB3A 1A47A 3BGAA 2XIBA 3OLEA 3BAXA 1R7AA 3FNDA 1O6IA 4PCTA 1JZ7A 4PCSA 4OKDA 3F5KA 3TOPA 4P7RA 2A3AA 2CKSA 3VO0A 5LA2A 4CU7A 4FLRA 1WO2A 2ZXBA 3MANA 4GINA 4R27A 4D6JA 5A8MA 2CESA 3MU7A 1C3FA 5AYBA 1XV8A 3RJXA 2NSXA 3AHTA 4M82A 1W9UA 1GHSA 3I3BA 4GI6A 3QGVA 2VOTA 1V3HA 2D22A 4QDMA 1VJSA 2WVVB 4PMUA 1C8QA 1NWSA 1XSJA 1MQRA 1R87A 5LA0A 5HOSA 1EA9C 2X0HA 5A6BD 4NI3A 3SEPA 3WH8A 3EDFA 4GZJA 2C7FA 2PF0A 1OT2A 1GORA 3CGTA 1E5JA 4S3JA 3VIFA 4ZE5A 4L4PA 4AC1X 4RE2A 4WSKA 1HF6A 4HTYA 1ZBCA 1KWGA 1JZ6A 3BCFA 2CBVA 4W93A 4HOWA 4JCMA 4KMQA 4P8VA 2VC9A 5D8ZA 4ZXOA 2PWHA 1HNYA 1HIZA 2CHOA 5ABFA 4GQRA 4J7RA 3WF3A 1JZ5A 4CGTA 4H7VA 1EHAA 3VTRA 1KWKA 1B3XA 4KGLA 1CZ1A 1CXIA 4U3AA 2WYSA 1V03A 2DIEA 2DT0A 1ZJAA 5CG0A 3VPLA 3VDHA 2ZWZA 4JKLA 3VNZA 5I5RA 4AXNA 3AXHA 3VIJA 1DEDA 1JAKA 1V02E 2ZUSA 3BSGA 4PMXA 2V3DA 3ARUA 3EDEA 2TAAA 1G5AA 2BFGA 1W3KA 2XGBA 8A3HA 1DWAM 3ZR5A 3GH5A 2WMKA 3WF2A 3AOFA 1ZB5A 5FCZA 1AVAA 4UQDA 4JKMA 2D2OA 3SCWA 4AD1A 4ZENA 1V0MA 1H41A 5E9AA 1B3ZA 2CHNA 1IV8A 1D7FA 2CNCA 2JF6A 1JG9A 1JD7A 4UFKA 3U7VA 3K8LA 2WNWA 3AXXA 4D71A 1WZKA 4X0VA 4W86A 4DWSD 1HX0A 1B90A 4E8DA 4MJ2A 2DSVA 4UOQA 4UFMA 2Y8KA 4EANA 3LPFA 2ZX9A 1EXPA 3AJ7A 3CUFA 1QI5A 1UWIA 2F8QA 3DECA 5CLWA 1MWOA 1UKPA 5BXRA 1B0IA 2VX5A 5CPSA 4E2OA 4PTXA 1E4LA 3GH7A 3KL0A 4AZIA 1J11A 1JYVA 1W2PA 4AEEA 5JBFA 1V08A 1ODZA 4PUEA 4CD6A 4ML4A 1W1VA 4JIEA 1DWIM 3K8MA 1N82A 4PMYA 5AC5A 3GTNA 4ATDA 1ITCA 2OYKA 2PWFA 1V3LA 3EMCA 2AAAA 2W5FA 5D4YA 2DT3A 4GIAA 1FFRA 4XZWA 1UOKA 3NSMA 1UKSA 5IDIA 2WMGA 3SCRA 3AS3A 3SCTA 4AIEA 4JL2A 2W4XA 1RP8A 1W1TA 2Q8XA 1MFVA 4N42A 3PTKA 1F4HA 4S3KA 2YIHA 3OA5A 2EO7A 1NOUA 4KRUA 4GZIA 3VD3A 5E6ZA 5HBFA 4JFSA 3RPMA 3RM9A 5M5DA 3VUPA 1W9XA 5I6SA 1JI2A 5BXPA 3SUWA 2UY4A 4P7OA 3AIEA 2DH2A 3AIVA 1KCLA 1QBAA 4CN6A 1CXFA 1HL8A 1S46A 3ARWA 1Y7VA 1XSIA 4ZEPA 3ZIZA 3M7SA 3W82A 3ARSA 1FH9A 1H0GA 5HPCA 3BAYA 3MMUA 3FY1A 4BZYA 1QI2A 2V3EA 2W62A 1HKIA 3UR8A 8CGTA 2IUZA 5CSYA 3RDKA 5CQ1A 2CYGA 1WPCA 4GXPA 1HVXA 5A6AA 1QBBA 4TOQA 4EAMA 2BHZA 4AIUA 6CGTA 2W91A 1EO5A 4ZXLA 1OGSA 1OIFA 1OM0A 4F9JA 3UEQA 1GOMA 3OLDA 4M24A 1KGUA 2J75A 1E4IA 4D6DA 2WMJA 1KCKA 4C7GA 1PJ9A 3SCVA 5M03A 3ZT5A 4AISA 1NP0A 2OWWA 1LG1A 4Q22A 3EMQA 3WSUA 3GXDA 1XCXA 2WZIA 3U57A 2DQXA 4CVUA 1EDGA 1H3GA 1CIUA 5DT5A 4HMEA 2G3JA 1Q6DA 4P8WA 3UERA 7TAAA 3VVGA 2WMIA 9CGTA 1E3ZA 3O9NA 2BV9A 4MNKA 1CXKA 4BQ4A 4MB5A 3KWXA 1ZU8A 2ZX8A 2D0HA 1VIWA 1JL8A 1EDTA 4J3UA 4J3SA 1HKKA 1H2JA 1HN1A 1VAHA 1KBBA 2CKRA 4IPLA 3WFZA 1GQKA 3THDA 2QHAA 3BAJA 1PX8A 3A3HA 4PTMA 2E9LA 1WKYA 1VEOA 2WC4A 5IXEA 2BY2A 3BAKA 2C0HA 2GDUA 1XYZA 1DTUA 3WDIA 1G9HA 3QHMA 1UQYA 2ZOXA 3WNMA 5GNXA 3WH9A 2QLYA 1H0IA 1EQPA 2VCAA 1J0ZA 3VM5A 2CBJA 1CTNA 1JF5A 3ECQA 1JZ3A 1KBKA 4HU8A 2WHJA 1XH0A 3CHEA 3L4XA 2GJPA 3HMCA 3WDJA 1JNEA 2VZOA 3VINA 1PX3A 2J7BA 3IAPA 4AD3A 4JFTA 3GZAA 3AHXA 4P8XA 5IFPA 3OZPA 5E0CA 4PUDA 1NQ6A 1VFMA 4AYSA 1IZJA 1JFHA 3RJYA 1QVBA 1US2A 2WWCA 3M07A 4FF5A 1NP2A 2F2HA 3WKZA 3N15A 1ISYA 1V6UA 1BHGA 2D24A 4J3TA 1X6LA 4FLQA 4W8AA 2ZX5A 2XVKA 2VL4A 4YPJA 1CGWA 2A3CA 2CBIA 4V27A 1GONA 2D0GA 1XCWA 1FFQA 2XM1A 1ISZA 3WMBA 2WKLA 5A94A 2FDMA 2PWDA 2XPKA 1VEMA 2X09A 3U5YA 4UNIA 1CBGA 3CZLA 3OB8A 1UH2A 4D6HA 2WZEA 2PBOA 4OUEA 1LQ0A 2ZWYA 1L0PA 3ZSTA 3DHPA 5EFDA 3WDQA 4BQ5A 1C7TA 2GJXB 3GXIA 1BG4A 3OGSA 3MS8A 4BQ3A 2J7HA 3APGA 1QOXA 1NOWA 3CBWA 1ZBKA 3QOKA 1SFSA 7A3HA 4XUYA 1SMAA 2J7CA 3BLPX 1HT6A 1LLOA 3T0DA 1GW1A 2WLYA 3UG5A 1JNDA 4M8UA 3WL0A 2X1IA 4W7WA 1U30A 1JGIA 2V38A 1SR0A 2Y8VA 1C91A 2BXZA 4YHEA 1JYNA 4B15A 5FKYA 5BYWA 1UWSA 5EB8A 1WZAA 3MSGA 3VD7A 4HU0A 1JZ4A 1WDPA 2NT1A 2ZXQA 4MTVA 1E70M 1UD5A 2GJRA 4J28A 3WQ6A 3F5LA 3LPGA 5DF0A 3VNYA 3VMOA 2WHLA 4GPNA 2OSYA 1TR1A 2DPEA 1HJXA 1AQMA 2VUYA 1PX4A 2CBUA 4HA1A 4QP0A 1LL6A 3W53A 1EH9A 2OLHA 3NDZA 4TVUA 4AZ7A 1XRVA 4B3LA 3RCNA 4JFVA 5DT7A 5A8PA 4D72A 4YN5A 3PHAA 3VD4A 4QCFA 5KZ6A 1UKQA 2QV4A 4UOJA 3DHUA 4PBGA 4LGXA 3CO4A 4JFUA 2VO5A 3UG4A 4QLJA 2CIPA 3FXYA 3ARXA 4NSBA 3NDYA 3CUGA 3M6DA 2XUCA 1IZKA 4CU8A 3CHDA 5I3DA 4AY1A 1TZ7A 1G01A 4D6IA 3AZTA 3L4YA 2GSJA 4GI9A 3KEHA 1JYXA 1CGVA 5JUVA 1CEOA 1MW3A 3WBEA 3NSXA 4V28A 2Y5EA 1GQIA 3AZRA 3T0AA 5BROA 3ZJKA 3A4WA 3SCNA 3VM7A 1BGGA 1DWFM 2VRQA 5A1AA 4ATWA 3GBDA 1KQZA 3BLKA 3WQVA 3VIMA 1TMQA 1GOIA 2VURA 2DDXA 4U2YA 3K1DA 3GM8A 1KB3A 1NM9A 5BRQA 1MW0A 1NARA 2G3NA 3WDPP 4H8VA 2J7DA 3WD3A 1PBGA 3ARQA 5CXPA 1PZ2A 1R7OA 3L2LA 2ZX6A 3UESA 3CLWA 1HJWA 4M80A 3OG2A 4URIA 5JIPA 4Z2LA 1EOKA 1J10A 3CH9A 2VX7A 3AROA 2JALA 2B31A 3WF1A 3PZIA 3SCQA 2J77A 5CPQA 3W37A 3BCDA 1QHOA 1CXLA 2FHCA 1OIMA 1QNPA 4UQAA 1ODUA 1PAMA 2GVYA 2VT0A 2YL6A 1HL9A 4F79A 3VD5A 1TA3B 1E40A 2JF7A 2YLAA 3MUY1 2Z1KA 3W26A 2D23A 4P7NA 4ATLA 1C92A 2DSZA 1Q6FA 2WVTA 2UWFA 2XHYA 3L4ZA 1E73M 5A2AA 3VU2A 3AS0A 3CZEA 4W8BA 1NWRA 4CKQA 4UFJA 4LX4A 2ZX7A 1NOFA 1H4PA 4FK9A 2J74A 4CCDA 1I75A 3ZQ9A 3WH7A 4JAWA 5BXSA 3VD9A 1J0YA 3WNNA 4BF7A 3VOCA 4D6CA 3VGBA 2BVTA 5KEZA 4GZEA 1XC6A 3NJ3A 1UD8A 2XVLA 3VDBA 4UOZA 3TTQA 2BHYA 1E1EA 3WF0A 1E0XA 2YL9A 1EOMA 1JIBA 2W66A 4W5UA 3FN9A 2W92A 4HMDA 1AQHA 1E15A 2EQDA 3WDRA 5TD4A 6TAAA 1V3KA 4H41A 4W84A 3T0BA 3TTSA 4DWSB 2YA2A 4Z2JA 2ESCA 5I78A 4WKHA 5GQBA 4AWEA 3AISA 2WAGA 4QLLA 3VMNA 3KZSA 2UY3A 2WMHA 5JBDA 4C7DA 5D9PA 2A3BA 2VVSA 4JL1A 1PEZA 2GDVA 3IJ7A 4F9DA 4AZ6A 2YJQA 4BCEA 2ZUUA 4L4OA 3CZKA 1QHZA 3E1F1 1M01A 4MNMA 4QAWA 1E3XA 4IM4A 1X1NA 3VIPA 5AC4A 3DYPA 4M56A 3SCSA 3VGEA 2VCBA 2V5DA 3BAIA 3W28A 4J3XA 5GNZA 1QI3A 2OYLA 3N04A 4PTWA 2Y4SA 1V3JA 2D0FA 1HKJA 4PSPA 2J25A 3QHNA 5M3WA 2PBGA 1E4NA 3MO4A 3TA9A 3CUIA 2VRKA 3WH5A 4Z2GA 3W24A 3N17A 3ZSSA 2GK1A 3ARZA 3TTYA 3W6LA 1E6XM 3G6MA 4DUWA 1OD0A 5FOOA 4MB4A 3MUZ1 4BQ2A 1YQ2A 2PC8A 1ISWA 3EDKA 2YDRA 4WKAA 1WAWA 1J0JA 5EMYA 5ABHA 1LWHA 1E6PA 1UWUA 2IXUA 2WSPA 1V6XA 5D8WA 3B9AA 1FOBA 2WC3A 1UWRA 3CHFA 1BTCA 4HOXA 1UUQA 1E72M 1JZ8A 2XFRA 3KL3A 4GO8A 5A6BA 2CETA 2EXOA 1WZLA 2O9OA 4M1RA 3CPUA 2OSXA 1B9ZA 4AD0A 4UZUA 1F4AA 2DH3A 4ACZA 2J7GA 1VBUA 3T09A 3WQ8A 3L2MA 3ZT6A 5CJ5A 4JKKA 1J9YA 3BC9A 1HVQA 3T2OA 1K6AA 1ECEA 3SUUA 3WNPA 4F66A 2CPUA 2E3ZA 2VZUA 1E1FA 1JI1A 1D2KA 1GPFA 2VQTA 3NSNA 1LJYA 5I0DA 1ESWA 2FH8A 1FH7A 4GQQA 4HOZA 2A3HA 3FAWA 1BYDA 3OZOA 2DSKA 2C8NA 1B2YA 4Z2HA 2QMJA 4EKJA 1P6WA 3PN8A 1V3MA 1QNSA 3FAXA 4HPHA 2XSAA 1CPUA 4UQBA 4PN2A 4D6GA 1CGYA 1JXJA 2FHBA 1J0IA 3RILA 5HPOA 2WC7A 2OWCA 4MDPA 1GZJA 3ALFA 3W81A 2E8YA 5I79A 3IK2A 4GI8A 3AQUA 3SURA 4PEEA 1GCYA 4MB1A 2OWXA 1ISXA 2E9BA 4AZCB 5A8NA 3CUJA 1EHNA 1V6VA 3J7HA 3UG3A 1TCMA 3AHYA 2CCRA 1XSKA 4FMVA 4P8UA 2J4GA 5I24A 2WHKA 1CXEA 1LL4A 3N12A 3AHVA 3OGVA 1GJUA 3VGDA 2J7FA 3AZSA 4H8HA 4MAVA 4PSRA 4UFIA 1VFUA 2IXVA 1HJSA 5DEZA 5HDRA 2G8ZA 3HN3A 1W9VA 5A3HA 3B9EA 3QR3A 4ZFMA 3EMZA 4YHGA 1PIGA 2J47A 3GH4A 1UR8A 4HA3A 4RL3A 3WN6A 3WFLA 1BQCA 2XVNA 1PIFA 1CECA 2BVYA 4A3YA 4NRSA 1H49A 3D3AA 3K46A 4OBSA 1XD0A 3VX1A 2YLLA 3A47A 3IJ8A 4W85A 2VI0A 1FHLA 2FGLA 2F61A 2VZVA 4TUFA 1OWQA 1BVZA 2WW5A 3OIHA 1EQCA 1HXJA 1HJVA 1OGGA 2XJ7A 3AIBA 3A4AA 1RH9A 2JIWA 2V3FA 1VBRA 1UA3A 4IPNB 2ZE0A 1RP9A 1H11A 3PZUA 3DYMA 4MNLA 3GXFA 3AMLA 2EPMX 3AIQA 3UCQA 5JIWA 4MPKA 5IHSA 2D3LA 1YHTA 3AIUA 1BGAA 1H5VA 4Y7EA 5DMYA 3KL5A 1QPKA 2G3MA 4TTGA 1KQYA 3PBGA 2RGMA 1MYRA 4A3HA 4DM2A 3NIYA 4TX6A 2FGZA 1MXDA 3GBEA 1UR4A 3CZGA 2WSKA 2CERA 3W6MA 3DC0A 1CGUA 3AMCA 4MADA 5ABFB 1CGTA 2GUYA 3BAWA 5ABGA 1GHRA 5BRPA 2E0PA 3AMDA 3ZJ7A 4AD2A 1E6SM 1JD9A 1VJZA 4M29A 4UZSA 4PYSA 1JDAA 1WDRA 3IAQA 4PMDA 5A6JA 3F4VA 5FL1A 2J62A 3EDJA 1DWGM 1OINA 4AW7A 2BXYA 1KGXA 1C90A 3VIOA 5EBAA 4OBRA 4W7VA 3EBVA 4QFUA 5CZKA 2WBGA 1DP0A 2XWEA 3AS1A 2VTFA 5A8OA 4TVDA 1RPKA 1CNVA 3VGFA 1MW2A 4WSJA 4DM1A 1CDGA 3LMYA 1QNQA 1VEPA 3B8SA 1IT0A 4U2ZA 1WZMA 1KFWA 4C7FA 3JUGA 4RE4A 4X0NA 3AIRA 1ITXA 2J8GA 4U5IA 1NWUA 4J3WA 2QMKA 3GXMA 2WK2A 3WD1A 1UR0A 2W61A 3QHOA 1CLXA 6A3HA 1OSEA 1QNRA 1V02A 3VGHA 1CENA 5IHRA 1BYAA 1UZ4A 5D9MA 2BHUA 3N13A 3VDAA 2WKGA 4UQCA 3W4RA 3WDHA 1VFFA 2JFEX 4CCCA 4CD7A 4U5KA 2J7EA 4PMNA 2XVGA 1R86A 1UD4A 2XG9A 2XGIA 1UA7A 2FH6A 1KXVA 3WD0A 4UCFA 2WB5A 5A69A 1AMYA 5A2BA 3L4VA 1LG2A 3GNPA 3MUAA 2O9TA 1EDQA 1VB9A 1VFOA 3PZGA 3ZR6A 4TVCA 1HP4A 2GJXA 5E0FA 2UY5A 3AFBA 2WVUA 1XH2A 4PMVA 3WMCA 1W3LA 4B16A 1CWYA 2J78A 1KXTA 3PZMA 3ARPA 2PWEA 3GDBA 5CGTA 2EJ1A 2E9MA 2VZTA 1I1WA 1QI4A 3DYOA 1K9TA 3AMGA 2JIEA 3WL1A 3BSHA 4PMOA 3WNOA 4AZHA 1MVYA 3OGRA 2WBKA 3RM4A 1LL7A 1Z32X 1CGXA 3PTQA 3L4TA 4NF7A 2WHMA 2NW0A 1QW8A 3UR7A 2WWDA 4BA0A 1XGZA 2FHFA 2YOCA 3N11A 3WQWA 1FP8A 4IISA 1E0VA 3MV11 1K9FA 1B31A 1J18A 1WE5A 3IJ9A 3N18A 3BMVA 2PI6A 2VR4A 4MNJA 1JFXA 3L4UA 4J27A 2VCCA 3HJEA 1W1YA 3W0KA 1C7SA 1E6QM 1KXHA 1M53A 1M7XA 3GNRA 4W8LA 1G0CA 3L4WA 4KH2A 2O92A 2QF8A 2WPGA 3T08A 4NRRA 3WELA 3AICA 3WF4A 1EGZA 5A2CA 3WNKA 3THCA 3A6OA 3AMKA 4WF7A 1MQPA 5M17A 2VX6A 4MJ4A 5E6YA 4HMCA 2CITA 3WIJA 2VNCA 1OGBA 2YBTA 1R8LA 1W1PA 3BH4A 4LYRA 2UY2A 4M81A 1UR2A 3WEOA 1OB0A 4B3KA 3CMJA 4FLSA 1MFUA 3I3DA 3B9DA 4W88A 4CD4A 3WQ5A 4E8CA 4MAZA 5I23A 3A4XA 1FA2A 1E6RA 4IUGA 4PMQA 1OD8A 1W9PA 3SCOA 1BVNP 1W2VA 2OYMA 1HJQA 1DHKA 4P7LA 3F5JA 1KR1A 3MMDA 5DO8A 3VMPA 3WNLA 1WCGA 1R85A 2VR5A 2D1ZA 2XM2A 1JDDA 1TFVA 3ZJ8A 1ZS2A 5FIPA 1UH4A 1UKTA 1GVIA 1HKMA 1OBAA 2V3GA 1Q6GA 3TTOA 3FW6A 4CCEA 1J12A 4CD8A 1G94A 5CLTA 1GOKA 4J3VA 1FP9A 3ARVA 1AQ0A 1UG6A 5C71A 3PZ9A 1E0WA 2JEPA 1C93A 1QI0A 2VQUA 1EIBA 3SCUA 4TX8A 2G3IA 3WH6A
chains in the Genus database with same CATH superfamily
3RLHA 3VIKA 1MRAA 1NSJA 1MRQA 2QUTA 2I17A 5J8LA 2VDIA 5A6KA 1SW3A 2Y7FA 4ZZ9A 1A5UA 1US0A 4IIEA 3CIVA 1E56A 1XYAA 3VIHA 1YXDA 4M7TA 5BCAA 1GQNA 1FCVA 3LZ3A 4BR1A 4DF1A 2XYLA 1FY6A 1X38A 3E6EA 3BMWA 1RQHA 3IRSA 3GRIA 2H3DA 2JEQA 4QLKA 1E0TA 3IJLA 1A5BA 4OV9A 1A5MC 4ILSA 3HOJA 2IKGA 5CPLA 1QK0A 1UR1A 3EWZA 1IE7C 4QG9A 1FXPA 1B57A 2YL8A 2VC7A 2ISVA 5EFFA 2VMFA 3FOKA 1GOWA 2C19A 3DGBA 3BOLA 5K2ZA 1J0HA 3M0JA 4NAEA 5A5WA 4QEHA 3KE0A 2BY0A 3IIVA 1TQJA 1CW2A 5HNUA 3HMJG 3LBCA 1WQ5A 4H04A 1TPH1 2PB1A 2VP8A 4K7VA 3GU1A 1OY0A 5ABTA 2BDQA 4K8GA 1V0LA 4C6BA 1K9DA 1F6PA 4UR9A 3SUSA 2V2CA 3GYEA 4Q8VA 1WB0A 5AYIA 1YADA 1FH8A 3ARTA 4DBUA 4F8XA 2Q8LA 3OOQA 1VBJA 5DCDA 2QPUA 1R30A 1Y65A 4UR7A 3U5UA 5G2WA 2A5HA 3FKRA 2PLJA 5A6SA 4C5ZA 4GO9A 1G67A 3URNA 4E2DA 1RY0A 4JXCA 2RGLA 4KEVA 2QCFA 1Y5WA 2PTZA 4DO4A 4W87A 2AOSA 5AKQA 2DT2A 4QG6A 5LNWA 3EWBX 2PGWA 3KAOA 4I8YA 3KM8A 4AZ5A 1TQXA 2W63A 4RZ4A 3W27A 1DJIA 3E02A 5SWUA 2VGBA 2G4FA 1JCJA 3ME3A 1XLLA 3PVFA 3HM7A 4HN4A 5HXMA 1DWHM 3LRMA 3UETA 3B4YA 1T8QA 2BX7A 3FEQA 4Q8OA 2I5QA 3D5HA 2Z1XA 3G6LA 2YDAA 2DZVA 3QVQA 4NJJA 3I3EA 2CZ5A 1BAGA 1IIGA 4O57A 2CEQA 5GVJA 4UB9A 3WLIA 1XDLA 2FPVA 2J8FA 4PCFA 3PTDA 2MNRA 2QGYA 3EDDA 1UMLA 5DFAA 1W5MA 3ZR4A 1QWGA 2WMFA 1NWTA 3BG5A 1HW6A 4JHOA 5I2UA 1EO7A 4JTAA 4JTDA 2DZSA 3UA3A 2DW7A 3HPSA 2BVDA 4MMWA 3CMFA 5KZMA 1XHGA 3WQ4A 4ZFCA 2HISA 3BUVA 1ZL1A 3PZQA 1LLZA 4INFA 5CC7A 1OG0A 2Z2AA 3WK3A 3ES7A 1L6WA 1FWRA 5ECUA 2XWDA 2EPKX 4AZCA 2YKKA 1QCWA 2ASHA 2ATSA 1EJXC 5DRIA 3MVIA 3W25A 1PWMA 3VDCA 3UWZA 2IMRA 1I2QA 4GC4A 3S6TA 1RHCA 3GQYA 2UV8G 1PB0A 3HF3A 4TMBA 4DNHA 2A2IA 1U2YA 1XI3A 5HNNA 3TK7A 5I77A 3I10A 1XH1A 3U3HA 4IMEA 4ORMA 1K8ZA 4CQ8A 3TNOA 5REQA 5A6TC 4JN7A 1MO0A 1UKOA 1KD0A 1JXKA 4L4MA 3E0LA 3UA4A 2RDWA 1KXQA 1W32A 3MI3A 3RO6A 4DQWA 2YDQA 3GXPA 5C55A 4IWWA 4DXKA 2QDEA 2B7QA 2VEPA 1O7AA 4UWMA 2E28A 2WCAA 1VPYA 3OLIA 1SM9A 4QS5A 1KM5A 4XZLX 3BGJA 2XTKA 2EPNA 1E71M 4XAPA 3W2JA 1LLWA 2I9EA 3TMLA 5E70A 3YPIA 4ZCWA 4P7QA 1XRSA 3PBMA 1P1MA 4EPDC 3E0IA 1X39A 2DW6A 4NAEB 3WK2A 1JRCA 3V7PA 3KTSA 1BF6A 4AWTA 3CZJA 1VCFA 1F05A 1R2TA 1TYGA 3KWSA 4GJIA 3NCOA 4OZOA 4PCPA 3HGOA 4LVAA 3RAOA 4LYPA 2QJJA 1DQUA 2ZYFA 4JZ5A 2DZAA 1V3IA 4C6IA 1A4MA 3K8KA 3W7CA 2V68A 4D1JA 2BY1A 1LRNA 3PM6A 1UW9A 1L9WA 3RMEA 2VR2A 4TTUA 4G56A 1BPLB 3S83A 1E55A 4AX6A 1G7VA 2A6NA 3W7QA 5C7HA 3GHUA 3WUFA 3MV01 4QIUA 3W02A 3EEZA 3CMGA 3QZAA 4LYQA 3R7MA 3OBAA 1H1NA 3NPXA 1IXQA 4XD6A 2EEXA 1LBFA 4KFNA 1VIZA 4PMRA 3SIZA 2WVVA 4K68A 3U7BA 2HJPA 4KWUA 5CZTA 1MQQA 3W2UA 2WANA 2ICSA 2EKGA 1KRCC 1YMYA 5IFTA 3UNTA 3LXBA 4CN4A 1XCFA 4DWSC 4LAZA 3P61A 4ADUA 1RR2A 4AIOA 1A47A 1VFLA 3FLUA 4PCTA 1JZ7A 1P5BA 3TOPA 4P7RA 5FJPA 1W17A 2A3AA 2CKSA 4HPJA 4CU7A 3HPZA 1WO2A 3MANA 1A0DA 1KBIA 4NZ4A 4H19A 3Q2DA 2IS7A 4YTTA 1RK5A 3AHTA 1W9UA 4BK9A 4EX4A 4GI6A 4I3GA 1RK6A 3WLKX 3FJ6A 1EA0A 2NLYA 4MIMA 4B5UA 3BJSA 3NNTA 1VJSA 2WVVB 4PMUA 5HWMA 1NWSA 1XSJA 4UC5A 1QR7A 4BKNA 1FCUA 2NQZA 3I6EA 4B5SA 4M6VA 1EA9C 2YXGA 3WH8A 1Z3NA 7REQA 2FVKA 3W7KA 2PF0A 1OT2A 3GG1A 1W5NA 4CQAA 4L4PA 3WJXA 3M0HA 4RE2A 1HF6A 1KA9F 3ABXA 5LXEA 1ZBCA 3CASA 3PBUA 3T8LA 2ZVRA 4KRZA 3S5OA 4ZQOA 3BO9A 3W1XA 1SJDA 4KMQA 4UBPC 5C9XA 4ZXOA 4Z1CA 4EPBC 4HGXA 1TO3A 4J7RA 3UY7A 4LNCA 5AHFA 3G0UA 1KWKA 4KGLA 3O0KA 1F3XA 2WYSA 2YCJA 3VNIA 3OHMB 2CU0A 3SW6A 5LXXA 2DT0A 3P93A 5CG0A 3VPLA 4WDWA 2TYSA 1Z41A 4AXNA 1TZZA 4WVXA 3RFAA 2V2DA 2UBPC 3C86A 3WBWA 1W1IE 3NDOA 3ANVA 4FA3A 3ARUA 3RLVA 1G5AA 4K7YA 2XGBA 4FXSA 1XXXA 3H2AA 3GH5A 2WMKA 1LYXA 4HPXA 4UQDA 2GQ9A 3NQFA 4AD1A 1X98A 1B3ZA 2CHNA 2J6VA 2ZVIA 4GACA 1XL9A 1D7FA 3G8RA 4UFKA 3GUGA 2QIWA 4GGHA 2WNWA 3AXXA 3C2YA 1WZKA 1HX0A 4E8DA 5E5CA 4HNVA 2IQDA 4UOQA 1RPXA 4EANA 4IIFA 2ZX9A 1EXPA 4PR4A 2NQJA 1QI5A 5GJMA 1ZPTA 1HGYA 3DECA 4X3ZA 4EF8A 1UROA 3M9YA 5FF3A 3E0FA 4PTNA 1DJNA 5CPSA 1OX5A 4AZIA 1JYVA 5G4HC 1M65A 4AEEA 4MY9A 2PDWA 3EGJA 1ODZA 3MBFA 2E5BA 4E3TA 1W1VA 3RPTA 3OBKA 4XISA 5HMSA 3K8MA 2GVJA 4LS0A 4FX6M 5XIMA 5AC5A 1O4UA 2HRWA 3ABZA 4AF0B 3A5FA 2PWFA 3OHIA 3EMCA 3M4HA 3SY8A 2DT3A 1ONEA 4GIAA 4OE7A 3QSTA 2ONEA 4H9UA 2HE8A 1VFHA 2JQXA 3CO8A 2DP3A 1Z44A 1B4EA 1TV4A 1RP8A 4P5UA 1A0EA 3UXIA 1MFVA 3PTKA 1WDDA 1F4HA 5E1QA 4IP5A 1PYFA 5BU6A 3EB4A 3KVKA 4JFSA 5FAGA 4DVOA 3VUPA 1R0MA 3SUWA 1WUFA 1QBAA 4CN6A 1IWBA 3OQ8A 1LOSA 3E96A 3EX3A 2JKEA 2QAFA 3ARSA 1FH9A 3KCOA 3NQVA 4LAKA 3BAYA 3FY1A 4A3UA 4NU7A 1OX4B 2PDCA 8CGTA 1VD6A 4WJ8A 4FNQA 4HNLA 2YGYA 1Z48A 3HQPA 2VD9A 2HK1A 1QBBA 1I0BA 2BHZA 3H8AA 6CGTA 1EO5A 3BDKA 1PIIA 1JUKA 1VC4A 2PAJA 3N2OA 4QS6A 1GOMA 2Z7KA 4JQ3A 4M24A 1KGUA 1JCYA 3S2NA 4B3ZA 2WMJA 4C7GA 3MDUA 5M03A 4IGNA 4AISA 4M19A 3BK0A 2NV9A 2V67A 3BCJA 4Q22A 3VOJA 4UIOA 2ISSA 3TZNA 1EDGA 1H3GA 4HK7A 4JTSA 3SRFA 5DT5A 4F40A 1TWWA 7TAAA 3HGRA 3RU8X 1ZU8A 2ZX8A 3IGUA 5CSRA 1EDTA 4J3UA 2HV5A 3TQPA 4I5XA 1HKKA 2TPSA 3CAQA 4OTKA 3OZMA 3WFZA 4L56A 3RRAA 2QHAA 2BG5A 3G77A 1S3HA 3BLIA 4PTMA 1MEWA 1U5VA 3D46A 3IVTA 2BY2A 4OQVA 4Y9NA 1BQGA 3GR4A 1EC9A 2FPYA 3WH9A 4J40A 2J88A 4JHMA 3VM5A 1CTNA 3G1SA 3P3BA 1KBKA 5HR7A 4QISA 2WHJA 2WNNA 3HMCA 2DZXA 2PDFA 3H24A 1JNEA 3BG3A 2XH4A 1C9WA 5I03A 3GZAA 3TR9A 4Q3MA 3OZPA 3SQSA 5IFPA 4PUDA 1NQ6A 1I0DA 1VFMA 4PGLA 1IZJA 2IQTA 1LUCB 1QVBA 3QQWA 4XD4A 2WWCA 3DBNA 1BHGA 4FXJA 4ZA0A 3A4JA 3ICJA 1SO3A 3KRUA 4FLQA 2HS8A 4YPJA 2VHLA 2A3CA 2CBIA 2D0GA 4DNMA 3EX4A 2YYUA 5A94A 2FDMA 1XBYA 2PWDA 4MGGA 1VEMA 4O52A 1B5TA 1J2WA 5T91A 4GIRA 3P8JA 2WZEA 3NXLA 5TF0A 4AH7A 3DHPA 1LQ2A 3WDQA 4AY8A 3KX6A 8XIAA 4D2JA 3PC0A 3OGSA 3QF0A 2Y89A 2ACSA 4GBDA 1JDFA 1ZLPA 4WDTA 1Q6LA 1ZBKA 4A05A 3QOKA 3ID7A 3Q67A 1XIMA 7A3HA 1SMAA 1YBQA 2FIQA 1GYNA 1Q8AA 3N2MA 2QCDB 1H7NA 2Y8VA 3V75A 1ME7A 3SJNA 4B15A 5BYWA 3FGCA 1WDPA 4NNBA 4J28A 3QC3A 4M6PA 1S1RA 3VMOA 2WHLA 2HPIA 1DL3A 4GPNA 1EP1A 1F3EA 3TAOA 3PJTA 2DPEA 4C1NA 1VS1A 1AQMA 2CBUA 2FB3A 2P76A 4OVXA 4QHRA 2YZ5A 2V5KA 2CW6A 4HHMA 4C6NA 1R9ZA 1SZGA 4TV6A 2BGQA 4RV8A 5A8PA 4YN5A 3PHAA 3IK4A 1AH3A 5HK4A 2OZ0A 1UKQA 5DCEA 3NPWA 4UOJA 1P7TB 4Y2WA 3NQ8A 2VO5A 3VUSA 5BU9A 2C16A 5FF4A 3M6DA 3C0LA 1GTHA 4R33A 4R7OA 1SW7A 4AY1A 1TZ7A 2PUZA 4D6IA 3AZTA 3R8HA 2X30A 1DIKA 2PDLA 2GSJA 5DANA 2VXNA 5DCBA 2QR6A 4NX0A 1PHWA 3W70A 3NFUA 3WFAA 3EOLA 3NSXA 5BOEA 3CK5A 3T0AA 5BROA 3ZJKA 4C6MA 1BGGA 4LBSA 4LS2A 1E9IA 3WQPA 3BLKA 1Q85A 4US5A 7PTDA 3WQVA 1QPQA 3VIMA 2F2KA 2VURA 2VFDA 3E49A 4U2YA 1DJZA 2GOUA 1K8XA 1KB3A 1TKKA 3B9OA 2Z25A 3WDPP 5I3GA 4C6CA 3WD3A 2J7DA 1I4NA 4NT0A 4N6FA 4Q32A 4FAMA 2ZX6A 5LZLA 1KM2A 4URIA 3HPAA 3C2EA 3BOFA 1TWIA 4N9EA 1OC7A 1M3UA 2X42A 3AROA 3REQA 3LRLA 3WF1A 4NAFB 3OVGA 3W37A 2XU2A 3KBJA 1LQAA 3BCDA 4LY4A 4I90A 1KLYA 2FHCA 4TR9A 1QNPA 4O16A 2XH0A 5AECA 1N2VA 4ZO9A 1JPIA 3W26A 1EP3A 4CNNA 2QDHA 1MUWA 4P7NA 4C6KA 1NFPA 2WVTA 2XHYA 1E73M 2E67A 1RJPA 3AS0A 3CZEA 4W8BA 4PUMA 4JR5A 1TPEA 2ZX7A 2HBXA 2GWGA 2J74A 3DOPA 5C6MA 4IPPA 2PLMA 5I02A 3GSMA 3HGSA 4MKNA 4O1BA 1F3WA 3V5OA 3ITGA 4JAWA 5HAOA 2PODA 1XLBA 3GD6A 2PTXA 2AL1A 4BF7A 3VOCA 4D6CA 2BVTA 4GZEA 1Q6QA 3GC4A 4BI6A 3T78A 3M5VA 3UG8A 1E1EA 1E0XA 4O12A 3PFMA 1EOMA 5HJYA 3EPMA 3FN9A 1SW0A 2W92A 4G8TA 5FAJA 4S38A 2G37A 1E15A 3LLFA 3H7UA 3PPGA 5TD4A 1SO5A 4W84A 1V3KA 4H41A 4QRNA 1CB7B 3MZNA 2A7NA 5F1UA 5GQBA 3C5QA 3E0VA 4QLLA 5C5YA 2WMHA 3RU6A 5JBDA 1RCQA 1UP2A 2FZNA 4JL1A 3IJ7A 3IUHA 4O1AA 4BCEA 2ZUUA 3TN5A 3CZKA 3ZFHA 4UTTA 3T9PA 3U2OA 4DX3A 1E3XA 4XIAA 4GVGA 1IQ8A 1X1NA 3MW7A 3QGKC 2I9UA 3LCWA 2V5DA 4M5PA 3W28A 5GNZA 2CLLA 1EIXA 3NL5A 4Z0SA 1A3WA 4XZIA 2HXUA 2J25A 3KOFA 1WXJA 2EG6A 3LCHA 3VK5A 3TA9A 3CUIA 2VRKA 3NL2A 3WH5A 5I06A 4CNPA 1V77A 3URAA 3ARZA 1EUAA 3BQ5A 3G6MA 4DUWA 3M0MA 2P8BA 4K36A 1V7AA 3MUZ1 1YQ2A 5T9CE 3B3DA 1ISWA 4DZ5A 1TMHA 2XSXA 5EMYA 1V4YA 4KS0A 1E6PA 2IXUA 3UZZA 4RPQA 4EXQA 3WLNA 1FOBA 4ERGA 2EPHA 1UWRA 1XR2A 2QQ6A 1EJWC 4WXZA 4XBSA 2POTA 3VOHA 1B9ZA 1XKJA 4ACZA 2J7GA 1XG4A 1FQ0A 3GXNA 1UPMB 3R0DA 3GG7A 4ZOEA 2WQPA 5JU6A 2P0OA 3DC8A 3QW3A 5LGXA 1ECEA 2DUZA 4ZQMA 5FACA 2J13A 1ESWA 2RAGA 3FSUA 1TJPA 2O55A 4QE5A 3KS6A 1TV5A 1IEQA 1XUUA 1CGYA 2VEGA 1J0IA 4MZYA 1FWBC 5HPOA 2OWCA 4MDPA 4ZBCA 3Q94A 4GNVA 3FGCB 2WO5A 3HFTA 4GI8A 1XPYA 3W1RA 3SURA 3TYDA 4HB7A 1GCYA 2QV5A 3F2DA 2QZRA 5CC5A 3LX9A 3UW6A 4GNKB 3CT7A 5I24A 2B7NA 4L1XA 3GTHA 1LL4A 4MM1A 5D30A 1K70A 4U28A 4FIQA 3OGVA 4ORIA 3M0XA 3B05A 3VGDA 1XLCA 2J7FA 1LZOA 4XKMA 2IXVA 3M5XA 1HJSA 4QJ5B 5A3HA 2ABAA 3QR3A 4ZFMA 3DHFA 1P43A 4YHGA 3OTRA 3L65A 2J47A 4HA3A 4RL3A 3NVTA 1HG3A 1ITUA 3WFLA 4E4UA 3W74A 2BVYA 1D8CA 3D3AA 3EPNA 5AHNA 2ZZ7A 4W85A 2BLEA 4E6MA 2FGLA 2CLMA 1XIFA 1KRBC 4TUFA 4LUSA 4IMFA 3RCYA 1BVZA 3EWCA 1HJVA 3AIBA 4IXXA 3PAOA 4AC7C 1IYXA 1DJXA 4RV3A 3RR1A 1HO1A 1RP9A 3DYMA 4PCNA 1FWNA 4JTHA 1FWDC 2D3LA 3H2OA 3KL5A 1KLZA 4GYPC 4KPLA 4HNCA 3PBGA 1P6CA 4OWGA 4LF1A 1MXDA 4B5NA 3EX1A 3C61A 3W6MA 1SGJA 3SI9A 5HMEA 1NFBA 3NURA 5ABFB 5F2GA 3LCFA 5BRPA 2E0PA 3V5CA 3ZJ7A 2R14A 4HNUA 1PTGA 5HWJA 5FJIA 5DMLA 3KVLA 2BSLA 4G6CA 3SQLA 4XZNX 2PF8A 3TCEA 1DWGM 2BXYA 1QO5A 1C90A 1ZQ5A 5CEWA 4QFUA 1BVWA 3KOYA 2ACRA 4UTHA 1TCDA 1ZUAX 2VTFA 3UZXA 4TVDA 1RPKA 1CNVA 4LCRA 1MW2A 3GE7A 4HJFA 1QNQA 2YFOA 1IT0A 4U2ZA 3NPUA 2XN0A 2OELA 4OV4A 4S3AA 4C7FA 4ICNA 1EJ7L 1M7OA 4IQDA 3GIQA 2OB3A 4U5IA 3GXMA 1UR0A 1PZ0A 1UWAA 2ZDRA 3GY1A 4L5ZA 3CB8A 4RNHA 2GGEA 1CENA 4DJDC 3N13A 3VDAA 3VCCA 2I14A 3WDHA 1VFFA 4CCCA 4LH8A 4CD7A 1H60A 4Z0JA 1DE6A 2V6AA 3FKKA 4PMNA 3N9RA 2FB2A 5ENLA 3E2SA 2B0MA 1OG6A 4ADSA 3KDOA 3LXAA 3ELFA 1VFSA 2WB5A 5A69A 1AMYA 2OZ3A 3NXFA 3GNPA 3MUAA 1JUBA 2O9TA 3NZ1A 3HQOA 2PP0A 4F0SA 1VFOA 1P4CA 2D2GA 3IV3A 1OFEA 2GJXA 2ZZ5A 1FWEC 2WVUA 3RX4A 4MOZA 2OOGA 2J78A 3M0ZA 3S6DA 3EA2A 5CGTA 1FWWA 1A5NC 2ON3A 2JIEA 3W9ZA 3WL1A 4PMOA 4JX6A 3GFYA 4GXWA 4AZHA 3OGRA 3RM4A 2E09A 4V1XA 1KW1A 3GFXA 3L4TA 2WHMA 1SSGA 2FQIA 4KT2A 5C54A 3UR7A 2E25A 2FHFA 2A4AA 4MUPA 4HHLA 1TIMA 5FA5A 3M0VA 4S3EA 3N18A 3BMVA 2PI6A 3MUXA 1KTNA 4NJGA 4J27A 4QROA 3I7QA 1W1YA 4DELA 3OVRA 3S0CA 4C6PA 1E51A 1E6QM 1M7XA 3GNRA 4KH2A 2QF8A 2QJHA 3WF4A 3G1VA 3KCLA 2PZ0A 1XPGA 2PU0A 4Y6GA 1YXCA 4WF7A 5M17A 2HNHA 2CZFA 4KCVA 3WIJA 5HQMA 1UOZA 1DOSA 1W1PA 1SO6A 2UY2A 2PRLA 3B8IA 3DFYA 1KM0A 1UR2A 3WEOA 3RITA 3O0FA 1MFUA 3B9DA 3B97A 3CIXA 3A4XA 3L0NA 1FA2A 5AZ1A 1NEYA 1E6RA 1YBQB 1W9PA 1BVNP 1W2VA 2OYMA 3F5JA 2PTDA 4GOAA 5DO8A 4S3DA 3V18A 1WCGA 4C90A 4S23A 1S2UA 3H21A 4HD5A 1ZS2A 3W7NA 5FIPA 1JULA 4GE8A 4DRSA 4US5D 3PBYA 2V3GA 4O10A 4X2PA 4FP1A 4DJEA 5DXXA 5I09A 3MYOA 1WYIA 2JEPA 4M3PA 1QI0A 3MPGA 3GWQA 1KC7A 1EIBA 4IOTA 3WH6A 2YPIA 1Z9AA 4N9DA 2WZMA 1FWHC 1EGMA 4Y9PA 2AGKA 3AHZA 4NZCA 4RKAA 4DO7A 2ZUWA 3OVPA 1JCNA 1S2TA 3SGZA 1LUCA 4OGZA 3WK1A 1G1YA 1GOOA 3POHA 4V2XA 2MANA 3HIJA 3GLCA 4XIMA 4G7FA 2GVGA 4JTKA 5F2LA 4TMCA 1A5SA 1EX5A 2R82A 1UH3A 4UXDA 3F4DA 1REQA 1TVLA 1J5TA 3TYAA 3VKKA 1GVFA 1TTJA 2R6OA 3TE9A 3C0SA 5LYRA 2X40A 3QTPA 1UP3A 3T8QA 1KGWA 2GZXA 3ZVHB 2YA0A 1AUSL 1XYCA 3ZO9A 4DF0A 4JD4A 3R8RA 2PDMA 4Y8FA 1DORA 3OQEA 5BOFA 3HU7A 3CZ8A 3CH0A 3U2EA 1P0EA 3WBAA 1I2PA 4GBUA 4GKTA 2WNQA 4CQ9A 2ZICA 4NAFA 1CLVA 1JDCA 3P7YA 5LIWX 3S2CA 2VX4A 4UFHA 4GYFA 5LKYA 4AU0A 2VDHA 3WK0A 1Q6EA 4H9YA 1GPWA 4NKCA 4OOZA 4JNMA 2Y0FA 3VDGA 1ZJBA 1E1CA 3B04A 5IM51 4R7JA 4Z2IA 4UQ9A 3TJ4A 1TV3A 4JDYA 4PTVA 3BXWA 3C3UA 1GNXA 2QVNA 4CD5A 1D7KA 1RV8A 3MSDA 4PULA 3CWHA 1BG9A 1YW1A 2ZUVA 1BSIA 4KGJA 2B4GA 1O95A 1AG1O 3MKKA 4CUCA 3W88A 5A6MA 2NXGA 4W7UA 3W7PA 3DFSA 3IIPA 2WZHA 3KVMA 4GY0A 2XVPA 4QCEA 1VENA 3UXLA 3NUKA 3G24A 4E0CA 3MJMA 3VIIA 1LWJA 4PRRA 4QNWA 2OR2A 3FYPA 1X6NA 3LPOA 3HBLA 4NNAA 5FL0A 5DN1A 2O56A 1PPIA 3PULA 1Z89A 4WJXA 2CZEA 3MA8A 1QASA 1ZBVA 3L5MA 3L66A 1TREA 5LNUA 3S1VA 3CPRA 1ZRQA 2GFTA 4GVHA 1NF7A 3TWBA 3H55A 1JGMA 2CXGA 2DEPA 1ISVA 1DWJM 1GTEA 3FHAA 4WIWA 1E43A 2W6RA 1UZ1A 3A9BA 3VGGA 3GAYA 5C70A 3SUVA 1XUZA 3DFOA 4XBJA 3QLDA 4PC8A 4Z17A 5CC3A 1AQFA 1QAPA 1F73A 2Y2WA 1TUXA 3ISIX 5D9OA 1W3JA 3G5EA 5EPDA 3AIWA 3BMXA 4DUXA 1UD2A 1UP0A 2NSOA 4OIFA 1GW9A 1W3HA 7ENLA 1GQJA 4O50A 3TYZA 2WZTA 1A3XA 4HPGA 2VUNA 1TVNA 4DJFC 5FJOA 1EX1A 3R94A 1SMDA 2BY3A 1AA1B 1XYBA 1ZCOA 1WNOA 4PMZA 2WXDM 2DSWA 3AYSA 4XAFA 1IEVA 1JYWA 1XISA 3T2QA 3GNOA 2E8ZA 3M46A 3W1LA 1F9CA 1K1DA 3TC3A 2ZXDA 4LPCA 1XDMA 2YDSA 2DUAA 4HNNA 2C3ZA 1PTDA 3LTPA 4LB3A 1JAEA 1PS9A 4Q7BA 3EYPA 3KTXA 5CAHA 4D1IA 1O12A 4H7ZA 4O18A 1C8XA 1Q6CA 4U3CA 5D9NA 4GH1A 1TRIA 4XX6A 2X1TA 3INPA 4Q7IA 2EPOA 4DPPA 4UR8A 4HCLA 4KCUA 2DZWA 3WUBA 1Q4WA 1XM3A 1NDYA 3TYCA 1IT7A 1M9HA 1XLMA 3AAMA 1Q7QA 2E4TA 3MHGA 4LF2A 1KFEA 2ZUTA 3M0LA 1ZAHA 2XSBA 2WM0A 3UYIA 3LQGA 2V69A 4W89A 1NH6A 4XZBA 1T0OA 5EKYA 2X05A 3TC6A 1FWFC 4JTGA 4ZSTA 1Q7MA 4HHPA 3PY2A 3SIMA 3NZRA 1FXQA 3W2KA 3LLDA 1JF6A 2DGAA 4Z1YA 1TJ1A 3N25A 3E2RA 1VF8A 3QMTA 2NVCA 4HK6A 2C0AA 1SSDA 2DFAA 7CGTA 4DB7A 1WUEA 3AS2A 4ZGYA 4O0QA 4LANA 1BLIA 1UYQA 1KNWA 2VELA 7ODCA 1I1XA 1GVYA 3BICA 2XIIA 3RIKA 1A5OC 1VP5A 3QH2A 2J79A 5TNVA 2DIJA 2O7SA 4Q7NA 3W1TA 4O1FA 1WDSA 3E5BA 3O05A 5JBEA 1BFNA 1GOQA 2O4MA 3QPEA 1OT1A 3NQDA 3L5AA 1UZHA 5I7GA 3EWYA 2J9YA 3LNPA 3STCA 2GQAA 2RDXA 4GYKA 5D02A 2FJKA 2Q71A 1QPNA 3VO0A 5DXYA 3HGJA 2ZXBA 4R27A 4D6JA 3T4WA 3EXRA 5DY2A 5KMYA 4MFEA 3MU7A 5EMKA 8XIMA 2J27A 2BGNE 3QR0A 4HYWA 2C6QA 2NSXA 3I3BA 3MSRA 3A21A 2QT3A 3L0GA 3QGVA 2ABBA 3W7MA 2PDXA 3CIWA 2UZ9A 4UTLA 2PLKA 2AL2B 1M1BA 3H4XA 3L9CA 3AWOA 4YTQA 5LA0A 5CJMA 1HFBA 1W1A1 3UD6A 3SEPA 1CX9A 4MKVA 3P14A 3EDFA 3GHTA 4WCJA 4AC1X 4OBTA 3AXKA 3B8VA 1YTDA 3U2CA 3WBYA 1K6WA 3TYEA 1KWGA 3P60A 2AMXA 3EKGA 5HATA 1O60A 1A5AA 2OX4A 3R89A 2ZC8A 3S3GA 1WOAA 6ENLA 5JXQA 2GLKA 4PB3A 4F0MA 3KBSA 1JZ5A 4IL2A 1EHAA 4IMDA 3NZQA 1UUMA 3AALA 3IUDA 5FJJA 3S2LA 4NZ3A 1CXIA 1CB2A 1V03A 1YEYA 2DIEA 5CBIA 1PDYA 5HUOA 4XTIA 1DE5A 2XN1A 4JKLA 3DFNA 3CU2A 1GKRA 2INZA 3P5ZA 5T26A 3WLTA 1TJ2A 3BSGA 3E0WA 2TAAA 1ADDA 2YW4A 1AW2A 1W3KA 4MLRA 6TIMA 3PJXA 8A3HA 4F2UA 3M47A 4MWAB 3H26A 2H90A 3LHZA 4XSMA 2CLOA 1XYMA 1AVAA 1UCWA 3BLDA 3CEUA 2D2OA 4JKMA 5G1YA 3SCWA 2FPTA 3GDMA 3MKCA 1TRDA 1V7YA 1JPKA 1JG9A 1VR6A 4GX9A 1TUFA 1THFD 3GU9A 3K8LA 4X0VA 1O5QA 3URQA 1GOXA 3VKCA 3IUIA 1KFKA 1B90A 4MJ2A 2W3ZA 2Y5SA 2HPMA 3M43A 3PJUA 5AHLA 3LPFA 1T99A 3GHRA 3QY6A 2PDNA 3AJ7A 1UWIA 1O66A 1MWOA 4PTDA 4E2OA 4NG3A 4HVXA 2Y88A 3FYYA 5KTLA 1NDWA 5JBFA 1V08A 1U1JA 4CD6A 4ML4A 1U5JA 2QJGA 1BEUA 3TN4A 1NDZA 1N82A 4DN1A 5AOUA 3LCXA 1F3TA 4XBKA 1B3OA 5IDIA 2WMGA 3R25A 3AS3A 3UVAA 4NY2A 4MWAE 3TFCA 2V81A 4JL2A 5CGQA 5H2ZA 4GZ7A 4XZHA 4H00A 3O16A 4YWIA 3OA5A 3G1YA 1IXPA 3VD3A 5E6ZA 5HBFA 3NM1A 3RM9A 5M5DA 1Q5MA 2WM1A 2UY4A 4IIDA 3KHJA 4P7OA 1AH0A 2DH2A 1KCLA 2OO0A 1BRLB 1S46A 1J5SA 1POJA 4KW2A 4FR1A 1Y7VA 4ZVJA 4YIWA 2IPGA 3TYBA 3DFTA 1H0GA 3MMUA 4BZYA 4DXXA 4XKYB 4NP7A 3VCRA 2W62A 3NOEA 1HKIA 1KBJA 3R2GA 3RDKA 1ENUA 2HWGA 2CYGA 2AKZA 1WPCA 4H9VA 5T8GA 4GXPA 1RALA 1HVXA 3KOXA 1N8FA 3NGJA 3H2CA 3U9IA 1WAUA 1SZFA 5EU9A 3K4WA 4ZQCA 3V5FA 1OGSA 1OIFA 3W7EA 5L9FA 2A7RA 3FIGA 3NQBA 4LUYA 3TXVA 2PDYA 3CUXA 4WX2A 2XZ7A 2J75A 1PJ9A 3GS6A 4B90A 1NP0A 1P6BA 1OCNA 1O1HA 3SQMA 2Z4GA 3EMQA 2D69A 3GXDA 3U4AA 4IHCA 4O1CA 3H22A 4F0HA 4FX7A 2WZIA 4CVUA 4HMEA 4IQEA 1Q6DA 3TW6A 3ORWA 4IFKB 1R3SA 4FPSA 2FTYA 1E3ZA 1RQEA 1H62A 2QJMA 4Q8UA 3KOZA 3ONBA 4UCGA 4LRTA 2D0HA 2V0TA 1I60A 1YPXA 2RHGA 1M6JA 3O07A 5H91A 1I8JA 3NL6A 1HN1A 1VAHA 4IPLA 1VCGA 3FDKA 3THDA 4CQBA 1MZHA 3A3HA 2E9LA 1O94A 3SFWA 5IXEA 4DJED 3BAKA 1XYZA 3WDIA 3WQFA 2NUXA 3A3WA 1XBZA 3QHMA 3A22A 1L2QA 1TB3A 2VCAA 3VNMA 2VENA 1BXNA 4S2CA 3SO7A 1JF5A 1TV8A 3EX2A 5CSSA 4IXHA 5G4EA 3O8AA 4ES4A 3GKFA 2PDPA 2CLKA 3IAPA 5CC6A 3GW3A 4AD3A 2JBMA 1NY1A 2VEKA 5DELA 5E0CA 4AYSA 1JFHA 3BV4A 3RJYA 4S3FA 3UZ5A 4B91A 3WKZA 2VFIA 1ISYA 3N4FA 3I7RA 3W1AA 4J3TA 3W73A 1XLJA 4S3CA 3S2MA 2NUWA 1F5ZA 3UCCA 1Q13A 2XVKA 2GDQA 5D04C 2VL4A 2WNZA 1W1B1 4LV4A 4FXFA 1ELSA 5F4WA 4ASTA 1UC4A 1JCTA 3GVQA 1K8YA 1NJJA 1KFJA 4AHPA 2XPKA 3ITOA 1OCJA 2R24A 1CBGA 1LBMA 3CZLA 3ANYA 4EXAA 1OABA 3VCNA 4OUEA 3W3OA 2ZWYA 3SAZA 4IJBA 3TVAA 1OQFA 2NUYA 5AB3A 2DZUA 5K3VA 4YMZA 3GXIA 5FJTA 5G1MA 3MS8A 1QOXA 3CNYA 3CBWA 3L7RA 3K5XA 3S5YA 3EPOA 4C91A 2EF9A 4IJRA 4EWJA 4Y9AA 4CQDA 1LT7A 3CEPA 3LENA 3VZZA 3BLPX 3CS2A 2YCLA 4FXRA 1LLOA 3CJPA 4R7WA 3UG5A 1JNDA 3ONCA 3WL0A 2X1IA 4W7WA 1U30A 2QS8A 4KFOA 3W7DA 4CNSA 4JIHA 1JYNA 5FKYA 1UWSA 4O19A 3VD7A 4HU0A 1JZ4A 2ODOA 1OK4A 3QZ6A 4MPQA 2ZXQA 1E70M 5I3FA 2GJLA 1SJCA 1XLIA 2GJRA 2Z26A 3PAJA 1EZ2A 2HNEA 3ZS4A 2NX9A 5DF0A 4R3UA 3LG3A 4QQ3A 1E1CB 4RW3A 4YYCA 5FEXA 2GGJA 1Q6RA 1PX4A 4Q8QA 4X22A 4ZQRA 2DJXA 2Y62A 3B03A 3MJYA 1LL6A 1YIXA 3W53A 1EH9A 2OLHA 1F7BA 2NVDA 1XLFA 3T81A 1IZCA 3N3TA 1U5HA 3DU0A 4KEZA 1QK2A 3VD4A 3H4WA 2X1SA 2GVLA 2QV4A 4IMGA 4WXYA 3CO4A 3UG4A 4QLJA 2CIPA 4ERIA 3SGUA 4GVIA 1EJUC 4YS1A 3CHDA 2V2HA 4C60A 3ZVIA 3NGFA 1BRLA 1RJRA 1HGWA 2JKAA 4XUGA 3XISA 1AODA 3M16A 1K4HA 1P0DA 4V28A 1GQIA 1MEHA 3RG6A 4ZOAA 3AZRA 3JS3A 3RYSA 3KTCA 3CWOX 1J8VA 3NEHA 4ZR8A 1OYCA 4IIHA 3QKZA 5A1AA 4XO6A 3FYOA 1T8XA 2PLCA 3BZGA 5FF7A 4V33A 7REQB 3IGHX 1KQZA 3W75A 3NEVA 1PKYA 2RKXA 3LSCA 4YXGA 3NQ6A 1NARA 3PG8A 9XIMA 3LHUA 4E5TA 1Y5VA 3C8NA 3WBXA 3CLWA 2A1YA 3OO2A 1UIOA 1EOKA 1OFDA 3LRKA 1SZRA 1J10A 4G2DA 1NVMA 4RUBA 2VFEA 1BXBA 2B31A 1EXBA 4WDXA 1RCXB 3SCQA 2PCEA 1Q2RA 1QATA 2F6KA 1QHOA 1OIMA 2GVYA 1PCKA 4F79A 1HL9A 1E40A 2YLAA 3MUY1 4A3RA 2Z1KA 5GJPA 2G4JA 3CAKA 1IGWA 2DSZA 2UWFA 4D8AA 4HN8A 1V79A 3VU2A 2X41A 1EJVC 4FNSA 4GRSA 1NOFA 4LAMA 1TJ0A 2QEZA 4JOMA 4GHRA 2Z6JA 2J24A 3KZPA 1TSIA 3WH7A 5BXSA 3VD9A 4RX0A 3S2JA 3DIPA 2AQVA 3A12A 2I16A 1RD5A 4S39A 3VGBA 5KEZA 1UD8A 3CB3A 4GCAA 2R1KA 3NQEA 2E6FA 2PP1A 1EC7A 4HNTA 3TTQA 2QYGA 2BHYA 2V9DA 3FVDA 1QXLA 1ZCCA 2W66A 4CNUA 4C6JA 3VI2A 1ME8A 1Z42A 4Q4QA 4E2VA 1XLAA 6TAAA 2I5IA 3TTSA 2V63A 4QSFA 2Z2BA 4AWEA 2WAGA 1RXOB 3P0WA 3SN1A 5D9PA 1SZEA 3LB0A 2VVSA 4JY8A 2GDVA 1H7PA 4F9DA 4AZ6A 4PH6A 4L4OA 1T6MA 1VLIA 4S3BA 3U6WA 4L1WA 3C2OA 4POCA 2VDGA 3W00A 3HA1A 3DYPA 4AQLA 3WLRA 5JMUA 1QI3A 3IV8A 5K4XA 3QRHA 4WQ6A 3FA5A 4PSPA 3QHNA 3H2MA 4O4WA 3MO4A 4DBSA 1PL9A 3N17A 4NJHA 4E8GA 3SB0A 3TTYA 4FSAA 1GEHA 1XLKA 3UPMA 1OD0A 1UMYA 3PBVA 3QM3A 4BQ2A 2PC8A 3EDKA 2RDUA 2YDRA 2AL2A 1ZENA 5TQLA 4LU0A 3NZPA 2WSPA 4JYEA 3B9AA 3UQNA 1NTHA 3Q65A 2WC3A 4X9SA 1QO2A 2ZTKA 3CHFA 3LCGA 4HOXA 2WKJA 1EF2A 4RDYA 3F7JA 2EXOA 1R38A 3KBVA 3M0KA 3UP8A 2NVAA 2O9OA 3RUBL 3WLPA 2R94A 1XIGA 2OSXA 2ADAA 4X61A 1OFBA 4AD0A 1FKXA 1F4AA 1JPHA 3WQ8A 3ZT6A 3ITLA 1J9YA 2P5NA 2FGBA 1IEIA 2ISDA 3DI1A 2CPUA 2VZUA 2C18A 1E1FA 1E9YB 2YX0A 1JI1A 2VQTA 3NSNA 2H3BA 1UJQA 4L9XA 4HOZA 2A3HA 3OZOA 4YL2A 2ZRVA 2QMJA 4EKJA 1XIJA 3PN8A 3FAXA 4HPHA 4MVAA 4CNOA 2PWVA 3L2IA 4UQBA 4D6GA 3S47A 2FDSA 1XX1A 4LW7A 3CQIA 2ZCGA 2NLIA 1PDZA 2X7VA 2IKHA 2VC5A 3F4NA 3ALFA 3W81A 1XJBA 1H7RA 2E8YA 4K8HA 3N2XA 4DYEA 4GK8A 3AQUA 3V1PA 4HHHA 1XFBA 4JQ1A 1UBPC 4MB1A 1ISXA 2LLEA 4NASA 3CUJA 2VOMA 4HU4A 4QX4A 1DVJA 3WCZA 1XKYA 2O7QA 1XSKA 4FMVA 1GJPA 3UYCA 3WJYA 4K8EA 2MUCA 3K2GA 1CXEA 3HURA 3P6LA 3DUGA 1MMFA 4IQLA 3QV7A 3KHDA 2I5GA 1RAKA 4Q4RA 1SO4A 4MY1A 3MY9A 1VHCA 2X16A 3PF3A 3HV8A 3NA8A 4H8HA 4MAVA 3W72A 3DKLA 3A9IA 4UFIA 3IPWA 3XINA 4JQ2A 3KLKA 2G8ZA 4GUHA 1Q2SA 3V1HA 1YPFA 3TTEA 1PIGA 3GH4A 3WN6A 1F6YA 4IH3A 3N34A 2XVNA 4A3YA 2FTWA 3TOYA 3K46A 3E9AA 1XD0A 4GXMA 2VGFA 1D9EA 1I9CB 5G2IA 1FHLA 1RY8A 2ZRUA 2OT0A 4HNOA 3EXSA 4OT7A 3V0UA 1TPVA 1EQCA 3P0XA 2ZA3A 1OGGA 5HMDA 1DQWA 4LSBA 3A4AA 2XISA 1E0UA 1DBTA 3THQA 2V3FA 5AC6A 1OFRA 3TN3A 4MNLA 3GXFA 1R9XA 1PO9A 3UCQA 5JIWA 4MPKA 2E6AA 1YHTA 1BGAA 2ZRXA 4Y7EA 3QW4B 4ROPA 3THUA 4B5XA 2G3MA 1EJSC 2NQ9A 2RGMA 4R34A 2YB4A 4NJIA 5G1TA 3AO0A 2YXXA 4DM2A 2VFHA 3H2EA 3IS4A 2DZTA 3M6YA 4EP8C 5KZDA 5HQLA 2FGZA 2ZZ3A 3DG6A 2R8WA 3GBEA 1UR4A 4UTMA 1Z8AA 1LTDA 1TX0A 4GYJA 4MADA 1CGTA 3DENA 3BAWA 1GHRA 1K7FA 4YVVA 1TV7A 4GH3A 4H6KA 3IAQA 3AXMA 3WMLA 3WQCA 3ZYZA 2J62A 4EOUA 1OINA 4AW7A 2VGGA 1J2BA 1KGXA 5EBAA 4OBRA 3MHFA 2R91A 4C6OA 1R3TA 2P10A 2EKCA 1IHIA 1RCOB 1IXOA 3AS1A 4MWAA 1XIEA 1QTWA 3CYJA 3URBA 4JTRA 3EWWA 3ABQA 2F84A 3LI1A 3LHVA 2ZZ4A 1LM1A 2R1PA 1KBLA 4XAGA 5F2IA 1ZNNA 4X0NA 4DHGA 1UB3A 4MWAC 1XWYA 2QUNA 3BLFA 3UR2A 4IGHA 1HKWA 1TMLA 1CLXA 4PBEA 2QCNA 4NXKA 1OSEA 6A3HA 4DBDA 3LHTA 1V02A 1JEZA 3VGHA 3CQJA 5IHRA 4I7VA 3OYZA 2WKGA 4WJEA 5CZJA 4E4FA 4U5KA 4CQCA 2J7EA 2XVGA 3DAQA 6ALDA 3GTXA 3PS7A 2B7OA 1YTEA 3CHVA 3S1XA 4UMAA 3W2MA 1EDQA 2JGQA 2JK2A 3PZGA 1AW5A 2Y7GA 4BWLC 4LEQA 4QNEA 2PP3A 2BOGX 2UY5A 1TWSA 1XH2A 4Y9MA 3GNNA 3GXTA 1VYRA 3GDBA 3W22A 1I1WA 5MHBA 1K9TA 2A6LA 2NZLA 2R1NA 2GSEA 4NZFA 5AC7A 1W1ZA 1Z32X 3IJ6A 3PSWA 4EVZA 4DO6A 1EBGA 2NW0A 3RR4A 1QUMA 1QW8A 4JDBA 2WWDA 1XGZA 3KS5A 2YOCA 3STGA 3QN3A 5H1WA 4N2YA 1E0VA 4NYUA 4RK8A 4MNJA 1S1PA 2Q02A 3PUOA 5DMMA 1O5RA 2W0UA 3RLUA 3LS9A 2XGZA 4O14A 3L4WA 3N4EA 2O92A 1WBHA 3T08A 4WDUA 3AICA 3WNKA 1V5XA 3THCA 4NZ5A 3A6OA 3COTA 4M51A 1XIBA 2F7FA 3AMKA 1MQPA 4I9TA 5TAOA 2HTMA 2VX6A 1BXCA 2C1IA 2YBTA 3IJDA 3C3NA 4LYRA 3GVVA 5BNKA 1O68A 4MSSA 4M81A 2HVNA 1OB0A 5K9CA 1GG1A 3HB9A 3LHYA 2FFCA 1EC8A 4MAZA 3R43A 3E2VA 1ONXA 1WOBA 2OU4A 1W37A 2DUXA 1REQB 4H4IA 4LUIA 1XGEA 3MMDA 3P80A 4ZTYA 1NELA 3XIMA 3WJZA 1TZ9A 4LUJA 3S46A 3NO5A 1G4TA 3ZJ8A 4X60A 2QCCA 1GVIA 4H2HA 3TTOA 4Z1AA 1J12A 4JNZA 5CLTA 2ZZ1A 2OO6A 1ML1A 3R12A 3ARVA 4RDWA 1NU5A 5KETA 1C93A 4FOUA 4IIBA 1NFGA 4WY0A 4XQ6A 1TR9A 3SCUA 2G3IA 2PDHA 2ALDA 1BSLA 4JX4A 1VJIA 3REQB 2EAWA 3BLOA 4UNKA 4UFLA 4MZ8A 4CU6A 3GAKA 5EBUA 1ICPA 3ZMRA 3FEMA 1BKHA 3I4EA 2XN2A 5EMUA 2TODA 4HJWA 4QE1A 4LYKA 2VRJA 4AZGA 2OZTA 3CUHA 4I6KA 4WK9A 2E1DA 1TVPA 4A8RA 3H70A 1ZTVA 3CQ0A 3DN5A 4CVWA 4MY8A 3P5YA 3PTMA 5ABEA 2PD5A 2XFYA 5HNTA 4GWEA 5HWNA 5F4XA 3TJXA 2OSWA 4GQ0A 3FJLA 3CC1A 4Q8WA 2WLZA 4AD5A 4Y90A 1K7XA 4UTFA 5HQEA 1JUEA 2WJFA 3VX0A 4PUKA 4ACZB 2WVSA 4JY9A 2ZXAA 3QOMA 2E40A 2H6RA 4N0RA 3S8HA 2G96A 3HPXA 3ZOAA 3N1AA 3WMSA 3WUEA 1BKSA 4RR4A 1UWTA 2A0NA 2BOFX 4DZIA 5LA1A 4ZO8A 4JFWA 4K38A 1VBHA 4QJ4B 4HZ8A 2DVXA 4LWWA 4K1WA 3TJIA 1RD6A 4GMEA 2A3EA 1C8YA 1AJ0A 4XV0A 4REQA 3PZOA 4FB7A 3I4KA 1SFLA 3CTTA 1MXGA 1WKFA 5IDZA 1U33A 3M5ZA 5IRPA 1MDLA 3MHUA 4JTQA 3BGGA 4WKFA 4AVFA 3S9IA 1BF2A 4LCSA 3UXDA 1BWVA 3CHCA 3QSRA 1JVNA 3K4AA 4RE0A 4C6QA 5HANA 2EHHA 1V6YA 1E9ZB 1AZ1A 1LROA 3GR7A 5GPRA 3IGXA 1GEQA 2BTMA 2QCHA 2X0SA 3PPFA 4HA4A 3RM8A 1TTIA 4J2MA 2YL5A 3N3MA 3UT0A 2Y70A 2YA1A 2WSQA 2OKOA 1S5TA 1UC5A 2P0IA 1W56A 2GJNA 2YSWA 3EA1A 2FYMA 1L8NA 1UD6A 2DZPA 4BS0A 4DJFD 3TP4A 2OGYA 1KR0A 1XIIA 1W91A 1Q4NX 2EPLX 4JYFA 3CWNA 4DUOA 4S2BA 5BRBA 4Z2KA 1W8SA 2XFWA 1FWTA 3PZVA 3N9KA 2BS9A 5CPTA 3CV7A 3W1UA 1UWQA 4BF5A 3D0CA 3SY1A 4EAYA 5KITA 3ABRA 5XINA 3TC7A 2ZRZA 3K4DA 4U33A 1J01A 4NJKA 4AEFA 4DAFA 1EF3A 3VNLA 4UTIA 4K6AA 1UQZA 1C8VA 3SUTA 1QNVA 1WDQA 4GUJA 3E5PA 4Z08A 1GVQA 3WD4A 3G1HA 4RZ6A 1W9DM 4WHBA 2JE8A 4R5EA 1LF1A 1ZP3A 2J9XA 4FNUA 4Z42C 4IGMA 2YBUA 4RNIA 3ARRA 1K9EA 1GVSA 4PRWA 2HVMA 3TONA 4I9MA 2ZRWA 2X2YA 1E4MM 2W67A 2WCGA 1US3A 4Q4OA 4MB3A 4ENLA 1CYGA 1ZZMA 3NL3A 2VZSA 5A8QA 1GQLA 3NYZA 2BMBA 2O9PA 1YX1A 4PL1A 4KRTA 4U31A 4QEEA 5FEWA 3UU0A 4DWSA 2ZA2A 4NNCA 3DHDA 3RRXA 3MYPA 3PB2A 1I6NA 5FI8A 1PV8A 2Z1SA 1V0NA 5CAKA 2C15A 1RBOB 3SZ8A 3LGEA 1WX0A 2ZUNA 3W29A 1B9BA 3T1GA 3I6RA 4M0XA 3CQKA 3G0SA 3CM4A 1A3HA 1XF0A 3AYRA 3PUDA 3LPPA 1F8IA 4PUNA 2J66A 4E4PA 3F03K 1ZY9A 2VVNA 1PCWA 4OOUA 1H61A 4W5ZA 2W79A 3B0PA 2O9RA 4O8AA 3OEXA 4RNJA 1SFTA 3GDTA 3AXIA 5J04A 4PRTA 4DBEA 1YLVA 5LGZA 3WD2A 1K4GA 3C2VA 1KO0A 4LUTB 3AI0A 2QPSA 3ITXA 4KWWA 4NHVA 1IWAA 1QOPA 1XD1A 1QPOA 4AEOA 3K13A 5CKSA 3D3FA 4Q8NA 4DUVA 3KCJA 1GKPA 3TSMA 1UR9A 3TIMA 1JRBA 3RGTA 3HTWA 2KX9A 3NQCA 4AUBA 4ZTXA 5LIKX 1YXYA 3POCA 2PWGA 4B9YA 5FD0A 4LTSA 3H4GA 3G3DA 4CN1A 1TA3A 1OC6A 1VRDA 1HJUA 4JCLA 2OEMA 1QMLA 5LIYX 1B30A 2G95A 3B8WA 5AY7A 3ZT7A 3S1GA 4EK7A 3BLLA 3WLHA 4FALA 1FWSA 4FLOA 2NT0A 1ADOA 2D2JA 3WEMA 4JIQA 3II1A 3KBMA 2ZUMA 2R1MA 2I1OA 1JZ2A 3QLLA 2X0YA 4AMCA 3PWGA 4G1KA 1I45A 4XB3A 3KLLA 3EKLA 4KERA 3BAXA 1R7AA 1GZGA 3ABSA 3STPA 5C2XA 2WJEA 2WPBA 2OEJA 4MUZA 4JIIX 1K03A 5D32A 5LA2A 4D8LA 3CXOA 6REQA 3VE7A 4FLRA 2BOEX 4JX5A 4GINA 1MUMA 5LNVA 1BWLA 5A8MA 1C3FA 5FJUA 5C9ZA 2GL5A 4WOZA 1X1ZA 1GHSA 1HQTA 2GQ3A 1V3HA 4KWSA 3I6TA 4HSHA 2DORA 4R9XA 1FHVA 4QDMA 3LV6A 1C8QA 4E3VA 1MQRA 1R87A 3A24A 3MI6A 2X0HA 3ZWSA 4IZGA 5A6BD 4NI3A 4Q8MA 3MUCA 4US6A 1S5MA 4EPKA 1P1XA 2IW0A 2C7FA 5IBXC 2EG7A 3LTYA 1E5JA 4S3JA 3VIFA 4BHYA 4WSKA 1ZJHA 3OIXA 1KRAC 4KCWA 4U4MA 1LORA 3QYSA 5E93A 1A5KC 3GW0A 1M7JA 4RNFA 3BCFA 2CBVA 4W93A 4HOWA 3FXGA 4WR3A 1OHLA 4P8VA 5D8ZA 3M41A 1HNYA 2C71A 5C0QA 3BARA 1HIZA 5ABFA 5HR6A 4WZHA 3WF3A 4ZB2A 4CGTA 4ICMA 4H7VA 2ZKMX 1CZ1A 1ZALA 2SFPA 1ZJAA 3STFA 1N8IA 3VNZA 1NDVA 3R8GA 3VIJA 1G69A 2OQLA 1JAKA 4GFIA 4XD5A 3THAA 5CCZA 1UASA 2ZUSA 4PMXA 2V3DA 3EDEA 4G7EA 4GGBA 1DJQA 4GUGA 1DWAM 3ZR5A 1KTBA 1WKDA 2XIJA 3KRZA 3QKEA 4RDZA 3EWUA 1TPUA 4ZENA 1H41A 4JEJA 5E9AA 1EWDA 2CNCA 2JF6A 3B9NA 3U7VA 3KBNA 4N7QA 2QUUA 4QTGA 2HMCA 2Z2UA 4GVFA 3CPGA 4PBFA 3VA8A 3TQKA 2A3LA 3B40A 3GUWA 2DSVA 2EJAA 2FVLA 1DV7A 4UFMA 2Y8KA 3A5VA 3CUFA 2F8QA 1G4EA 5CLWA 1A80A 3G8EA 1B0IA 1PXGA 3USZA 2OLAA 4PTXA 3GH7A 1X1OA 3KL0A 1F2JA 5D03A 3T0CA 1W2PA 1KRMA 4DLFA 2YW3A 2ZADA 3RK8A 3DCPA 2IQ0A 3WLOA 2PEVA 5C9RA 2OTDA 4ATDA 1W3NA 2OYKA 4WGXA 2AAAA 3P67A 4ZSUA 1UOKA 3NSMA 1UKSA 4FHAA 3CV6A 4AIEA 4C1KA 4N42A 3UGVA 5C9UA 2HCVA 2YIHA 2EO7A 2CWNA 3WLSA 4GA8A 4KRUA 4N9CA 2OQYA 1W9XA 5I6SA 1XP3A 1JI2A 5BXPA 4XAYA 2X1RA 4HCHA 3KUMA 3AIEA 3AIVA 5LNSA 4HQVA 2PS2A 3LGGA 4QGCA 4KQNA 1CXFA 4XK2A 3LMZA 3ARWA 1G4PA 3UWQA 1JQXA 1XSIA 4ZEPA 3M7SA 3ABOA 3QQ0A 3W82A 4EACA 2A85A 5B7YA 1J93A 1QI2A 1H1YA 1K3UA 4LNYA 3F2CA 4B2DA 3UR8A 5CSYA 1ZGDA 1A49A 4DJDA 2OG9A 2QVHA 4TOQA 4EAMA 3W7RA 1AK5A 2W91A 4NYYA 4J5NA 1OM0A 4F4RA 3UEQA 1TPDA 1VKFA 1SJBA 4PUUA 4S1FA 3W1QA 2OX1A 1E4IA 1YE4A 3E12A 2Q3OA 3ZT5A 1A50A 1XICA 3ZZ1A 1H7XA 1TPB1 1X96A 4YTUA 3GZ3A 3WSUA 3LBMA 3UVIA 3U57A 3DI0A 2JKPA 1CIUA 3PBWA 4HBKA 4FOKA 3GC5A 5AVNA 4I5UA 2WMIA 9CGTA 4QR6A 3H2NA 4MNKA 2BV9A 3KWXA 5AZ0A 4AWSA 1JL8A 3M0YA 4J3SA 5I3IA 3L0KA 4GIYA 4LUTA 3GG8A 3BAJA 2XIMA 5J5DA 1XLGA 4XVEA 3OZYA 2WC4A 3VZYA 4KF1A 3RX3A 2GDUA 3OA3A 1G9HA 2Z0IA 2QCMA 4JQ4A 1XQLA 2ZOXA 3WNMA 1R3RA 5GNXA 4DYJA 2QLYA 4XG1A 3ENLA 1J0ZA 3TW9A 3N2TA 3MC5A 1H1ZA 3B8UA 3ECQA 1F6KA 2OT1A 3IWPA 3ZWTA 4HU8A 2YCLB 4LUSB 3CHEA 1XH0A 3L4XA 4MG4A 2GJPA 1EP2A 3WDJA 4UTTC 5CJNA 2VZOA 4F0KA 2J7BA 4NQ1A 3WG6A 4JFTA 4QAIA 3MZ2A 2IPJA 4Q6JA 1J96A 3DH7A 1US2A 1NP2A 4FF5A 2C91A 1V6UA 1QOQA 2Z7GA 5EL1A 4JN8A 3UXAA 5CG7A 1LT8A 4W8AA 3UJSA 3CL7A 3G2GA 2YXOA 3RF9A 3UJ2A 1CGWA 3S1WA 1GONA 3UFYA 2XM1A 1WXZA 1ISZA 5TIMA 2BGSA 3W86A 3DESA 2E77A 3U5YA 1RBLA 3OB8A 1YDVA 3HO8A 4MHBA 1UH2A 4H3DA 5HMFA 1LQ0A 1L0PA 5EFDA 4HMNA 4BQ5A 1MXSA 3QV6A 3QFEA 2GJXB 3TEVA 1BG4A 4Q4MA 4BQ3A 2NV2A 1FWIC 3MO7A 3MVTA 1NOWA 3F4WA 1DTNA 1W3TA 2AQOA 3IVUA 1HZYA 4OUIA 1SFSA 1VCVA 4UUIA 5D2XA 2OPJA 4L65A 2PTYA 1HT6A 4JIRA 1GW1A 3G0XA 5FEPA 3TFXA 3KP1A 3APYA 1IWPA 4L6HA 2V38A 2QPXA 2F38A 1LCOA 4YHEA 3T4CA 5EB8A 2GVEA 3VOIA 1WZAA 3LSBA 2FMNA 2NT1A 1P48A 3F5LA 4JGDA 4LJ3A 1FWCC 3SN4A 1ALDA 3H7VA 1HJXA 4HA1A 3B8DA 4FX8A 5D2WA 4Q8PA 3NDZA 4TVUA 4AZ7A 1XRVA 3RCNA 4KIEA 3CT2A 4JFVA 5DT7A 1VGAA 3NM3A 3W1PA 2YB1A 1Y5XA 3ITVA 1TV2A 5KZ6A 4I7WA 4LGXA 3M0IA 4A8LA 4NSBA 3NDYA 1SJAA 4LBUA 1R5YA 2XUCA 1IZKA 1Q3NA 5I3DA 4ONVA 4B92A 1G01A 1XLEA 3L4YA 4GC3A 3CTLA 4GI9A 4DPQA 5K4ZA 1JYXA 1V93A 5JUVA 1CEOA 1R3QA 2PTWA 2GSHA 4HKPA 1W5PA 3PWAA 3NG3A 4IFKA 1MW3A 3WBEA 1OADA 4MZ1A 2QDGA 5I3JA 3MCOA 1LRTA 3A4WA 5CPMA 4GI4A 1MDRA 4LAOA 4UTKA 4J1OA 3FJ4A 1OJXA 2HQAA 4ATWA 3WLMA 3GBDA 3TWAA 2HS6A 3KFTA 1A5LC 1Y0EA 3K1DA 1R47A 3GM8A 1MW0A 3SECA 4BWLA 4JNYA 2G3NA 2WV8A 3A64A