2CIPA

Structure of the michaelis complex of a family 26 lichenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
273
Chain Sequence
SGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE H
publication title Substrate Distortion by a Lichenase Highlights the Different Conformational Itineraries Harnessed by Related Glycoside Hydrolases.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 110
structure length 273
sequence length 276
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2cipA00
3UESA 3L4TA 1ISYA 1CGXA 3K46A 3TA9A 1C92A 1KXHA 2J74A 1GOQA 3CZGA 2J78A 2WVSA 4ML4A 1ZJAA 1BYCA 1H4PA 1K9FA 3N15A 2D0FA 1K6AA 3VNYA 3L4XA 2D0HA 1V0LA 4UFKA 3CGTA 4GPNA 2WC7A 3IK2A 2E8YA 4E8DA 5CPSA 2ZXQA 2D1ZA 2QMKA 1H2JA 2Y8VA 3WH8A 1E3XA 4HA1A 7TAAA 1E6NA 1UHVA 1KGXA 3PBGA 1J0JA 1JD7A 2WMIB 3CZLA 1M53A 4FLRA 3VKKA 3UEQA 1E15A 3OZPA 4WSKA 4MB3A 4PSRA 4BCEA 4LYRA 2DT1A 3MSGA 1ISWA 1OIFA 5LA1A 5DFAA 5EFFA 4MJ4A 3NDYA 1UD3A 1UQZA 2V3GA 4CKQA 4AIUA 3POHA 4TVUA 1E0VA 4S3KA 3WL1A 1WB0A 4UOQA 1QNPA 1W3KA 5A2CA 1NWTA 1LL4A 5EMYA 3VGEA 4Z2IA 5AY7A 2WK2A 1LF1A 2XVNA 3ARPA 1FHLA 5CGTA 2WMJA 1JYWA 1UD4A 1V0MA 1Q6CA 4CU8A 3CH9A 2J7CA 4M82A 3M46A 2J7BA 4MNJA 2MANA 2XGBA 4EANA 1UR8A 1BAGA 4YN5A 4KWUA 4AZ6A 2A3EA 2VCAA 1HJWA 3ZR5A 1WZAA 4WKHA 4J3SA 5HBFA 4B16A 4JKLA 2VRKA 1MWOA 4XV0A 4CD8A 1ISVA 3AHXA 5BROA 2PF0A 1JYXA 4DWSC 1QNQA 3VM5A 3S2CA 4XZWA 2BY1A 4UQDA 1B0IA 2DSZA 4PCSA 2JF6A 2OSXA 3MKKA 4GINA 1H09A 3GXDA 3WEZA 3OA5A 4AZIA 4NZCA 1NP0A 5A8NA 3THCA 1E72M 2W63A 4J3UA 4P7QA 1HT6A 5FIPA 3W81A 1KBKA 1E70M 4W8BA 2A3AA 1J0KA 5CG0A 3NIYA 4MNLA 3WMCA 3U7BA 2FHFA 5BRPA 1TZ7A 3WD0A 3VD5A 4GZJA 4MAZA 2F61A 4H8UA 2HVMA 2BHUA 1E6XM 2QMJA 3K8KA 5A6JA 2JALA 2E0PA 5A2BA 2EPMX 4PBGA 1B3ZA 4CCDA 1JZ4A 1M04A 1VEPA 3A4XA 3K4AA 3BAIA 1VAHA 3ARTA 1XH2A 1MW1A 1HKJA 1V02E 3TTYA 3CUIA 5ABFA 2PWGA 5A6AA 3B9DA 3SCOA 5JUVA 1OGGA 4ZXLA 2DSWA 3OLGA 3FAWA 3TONA 4PMZA 3CZJA 3VIJA 7CGTA 1UWSA 2D3NA 5FCZA 3WUEA 2E9MA 4WKAA 2J62A 1QHPA 4BQ2A 1GJWA 2VJXA 2Y24A 3RM9A 2X0YA 2YJQA 3AROA 1V3LA 4W86A 3W53A 2XHYA 1LWHA 4M81A 3ZT7A 3D3AA 2RGLA 3APGA 1JDAA 4LYPA 1JF5A 3T0BA 3ARXA 3WNOA 4EAMA 2EPNA 1ECEA 1JG9A 1V08A 2XTKA 5ABGA 1VIWA 1MQQA 3AMKA 3AZRA 5A95A 2PWEA 4HA4A 2EXOA 4QFUA 3AICA 1CEOA 4GI9A 4M8UA 1BQCA 5ABFB 4JFSA 1HP5A 1CXHA 1UOKA 2CKRA 1ITCA 2HISA 3G6MA 2VR4A 2CBJA 3QGVA 3VDAA 2WYSA 1C90A 4HU0A 4XUYA 4J27A 2QPSA 2BY2A 5E09A 4OZOA 1FH9A 1OGSA 5GNYA 2VT0A 2OWXA 4V2XA 2VO5A 3GH5A 3UETA 1E4IA 2WW5A 4PMUA 1JXKA 4GI6A 1EH9A 1UQYA 2GDUA 3ALFA 4CCCA 2VZVA 2PBOA 3B9EA 1GJUA 2ZXBA 2A3BA 7A3HA 4ACYA 3AIWA 4J28A 4PMYA 4QLLA 1OB0A 1C8QA 3PZUA 2Y8KA 1EQPA 1FH8A 2WHMA 4AMCA 3T08A 3AS3A 2WHJA 1OGBA 2TAAA 4AZHA 3WBEA 2Y2WA 4MB1A 1CZ1A 2J8FA 4HZ6A 3WNNA 2E8ZA 3ZSSA 2EPKX 1BPLB 4CN4A 2XWDA 2WHLA 3W37A 3VGBA 4CCEA 3MMDA 4AXNA 1QOXA 1EDQA 4LXFA 3ARUA 1V6XA 5CLWA 1ZB5A 2C0HA 4PTWA 1EA9C 1KB3A 4X9YA 5C70A 3UG5A 3PHAA 2PC8A 1M7XA 2YL9A 3RDKA 4D71A 4ZXOA 2WC4A 3SCVA 4ZE5A 3AI0A 1BF2A 4PMQA 1J10A 2X05A 2VI0A 3CMJA 2WAGA 2V3DA 1BVNP 1C8YA 1E6RA 3GNRA 1CECA 1QVBA 1UWIA 3TTOA 1RH9A 4LX4A 2YLLA 5I5RA 2W92A 2EEXA 2J7DA 2D0GA 3VDCA 2G3MA 3DECA 1X6LA 2QPUA 5D8WA 2XUCA 3WDPP 3PZMA 3PZOA 1PX8A 1UD8A 4URIA 5GNXA 1OD8A 3OB8A 5FL1A 1UA7A 5D9OA 3T2PA 1B31A 3AHTA 4HU8A 3WY1A 1W9UA 3GXMA 4UFHA 4TOQA 3AXHA 3F5LA 2QV4A 3FW6A 2DH3A 1JAKA 5A1AA 2VNCA 3AS2A 1KXQA 3NJ3A 4P8VA 1HKKA 1US2A 2WMFA 1ISXA 3UCQA 3CUGA 5TD4A 4YHGA 1H1NA 4W87A 2DQXA 1CIUA 4CN6A 4RE2A 3T2QA 1B3VA 5JBEA 1WP6A 3AMGA 2XVLA 4HA3A 4F9DA 1UR1A 3CBWA 3W0KA 1XGZA 2DIJA 4AD1A 2WXDM 3BXWA 2GFTA 4YHEA 4E2OA 2XVGA 2J47A 1BHGA 3VM7A 4V27A 3IAQA 3OGRA 1J12A 4JKKA 2Y4SA 1TMQA 3N12A 4AZCA 1R87A 1X6NA 1QI3A 4D1IA 4CD6A 1WNOA 4UOZA 4W93A 3HN3A 5C71A 1QNRA 3CHFA 5EFDA 1G5AA 1JL8A 4U2ZA 1J01A 2G3IA 4XB3A 4U3AA 3WNPA 1NM9A 3T09A 3WNMA 1OM0A 2G3NA 4QCEA 2VVSA 1H3GA 3WF4A 4PRWA 2FHBA 2D23A 2QLYA 2XVPA 1QHOA 1VF8A 2ZE0A 2XGIA 4BQ5A 4E4PA 2BXYA 1GQIA 4R5EA 5BWFA 1PIGA 2ESCA 3HU7A 2YBUA 2VX7A 2WKGA 1GOMA 1GZJA 3AIUA 4KRTA 4JKMA 1JI2A 5BXRA 3AIVA 4GQQA 2UY2A 5I3DA 1CGTA 3VD3A 2QHAA 2YBTA 1PX3A 1IZKA 1GNXA 3TP4A 1ODUA 1TVPA 1JFXA 1W1TA 3WQ8A 1E6QM 4AD3A 2WLYA 4HP5A 2O92A 3DC0A 3MO4A 1UH3A 1LWJA 1LG2A 4UCFA 3I3DA 3WL0A 3W4RA 3DYPA 2X2YA 1Q6EA 2YDQA 2D24A 1E4LA 4IM4A 3QHNA 4HMEA 1ZBWA 2EJ1A 3T0DA 3AXXA 2D2OA 3VOCA 1M01A 2V3FA 4J7RA 5EBAA 3MU7A 2QF8A 3ARZA 1UD5A 1VJZA 4MADA 3EDDA 1QW9A 4P7RA 1C7TA 1DWAM 1XYFA 1XSKA 4B9YA 3WMBA 2DDXA 2XIIA 3CMGA 4DWSD 4Z2GA 4LPCA 3TOPA 3VIMA 3WEOA 2IXUA 1MQRA 3F4VA 1QI2A 2V3EA 2ZX7A 1B30A 3WKZA 1EDGA 1VJSA 1WZLA 3CIVA 3IAPA 1QBBA 1VFMA 1FFRA 4DUVA 1V02A 4ATWA 1L8NA 2ZXAA 3AMCA 2NT1A 1VBUA 3K8MA 3VDBA 4QDMA 1PX4A 5A8MA 3NSMA 3VMOA 2CHOA 1DWJM 4W5UA 2VQUA 4PEEA 3RILA 3ZMRA 1QNOA 1DWGM 4PMVA 1W9PA 2BXZA 1HNYA 2BFGA 1DP0A 4JCMA 2V5DA 1BVZA 3RIKA 3M6DA 4UNIA 3SCWA 1EIBA 3IJ8A 3AZSA 3ARYA 2PB1A 2G8ZA 1W3HA 3WN6A 4W84A 1AVAA 3EMZA 1UR4A 4U5IA 1HL9A 3GXFA 1YHTA 2DSKA 3ARWA 5A6LA 1FFQA 2YDRA 2FH8A 5IHRA 3WDJA 1N82A 3KL3A 1TR1A 3CHEA 3J7HA 3BCDA 3N13A 3IANA 2J7EA 1MFVA 1TVNA 3AOFA 1B2YA 4PCTA 3RMEA 3MUY1 3CZ8A 2O9TA 3O2LA 4B9ZA 2WMKA 1TUXA 2YLAA 1UKTA 3MUAA 1XSJA 3A3HA 4X0VA 1EHNA 3WUBA 2BHYA 2DPEA 1MVYA 4L4PA 1DTUA 5ABEA 4OJYA 3AISA 3VDHA 2NW0A 3QR3A 4U5KA 2XM1A 1L0PA 3TTQA 3W29A 1V3HA 3GM8A 3NDZA 4KH2A 2AOSA 4MNMA 1S46A 4GZIA 3PZGA 5C8BB 4C7FA 4AISA 2D3LA 1RPKA 4J3XA 5AC5A 3VIHA 2AAAA 2W62A 1IT0A 4OOUA 4HZ7A 2FHCA 3VIIA 1VB9A 4OKDA 4CD5A 2CNCA 2WWDA 5F7UA 3O6AA 4HOWA 1HJUA 3PZ9A 2J7GA 3WD4A 1OIMA 1ZU8A 4OBSA 1GHRA 1XH1A 4U31A 4WK9A 4F66A 4FK9A 4MB5A 1B9ZA 1J0HA 1MQPA 2ZUNA 3PN8A 3WF2A 3UERA 1ESWA 2ZUUA 3CPUA 1E55A 2VC9A 3WF3A 3M07A 2X0HA 2GVYA 1KQYA 4D6DA 4E8CA 2J7HA 1E1EA 3VUPA 1ZBKA 5LA2A 2YA0A 2ZXDA 1LG1A 5GPRA 2WC3A 3AFBA 3BAYA 4JL1A 2ZUTA 2VUYA 3DYMA 1WZKA 2EO7A 2YL6A 2DEPA 3AQUA 1GORA 3W27A 5D8ZA 1EGZA 4PMXA 5GNZA 1XRVA 1V3IA 3FAXA 5DT7A 2DT0A 1NWSA 4CVWA 2RGMA 1HF6A 2CXGA 4CU7A 3VD9A 5M5DA 3RJYA 1FA2A 1BTCA 3PTMA 4W8LA 4Q22A 4GO9A 3K8LA 5FD0A 3W28A 3AIRA 1WAWA 3MMWA 4CD7A 3VMNA 3UR7A 2NSXA 5M03A 3OGVA 1JDDA 5IXEA 1JZ2A 1W2PA 1FP9A 1CYGA 3L2MA 2D22A 4HTYA 4AY1A 3WSUA 5LA0A 3ZR6A 1U2YA 1LLOA 1OT1A 4K68A 4WJXA 3VD7A 1JZ8A 2OYKA 2VQTA 1E73M 2EQDA 3ZT6A 6CGTA 3CUFA 3TTSA 3F5JA 4D6EA 1QI0A 2WB5A 3WF0A 1D3CA 2VOTA 3CUJA 1B3WA 5I0DA 1OSEA 5A69A 1J0YA 5A6MA 2VRQA 2VX4A 1JFHA 3U57A 2F8QA 2BS9A 3EDKA 2J4GA 1JI1A 2J79A 3MANA 3N17A 3ARSA 4CVUA 4AEFA 5M17A 4CGTA 1E1FA 2CPUA 1F4HA 2ZICA 5A8OA 4B15A 1WDSA 5JIPA 3BAWA 4M24A 1C91A 1NP2A 1HKIA 4QCFA 4AIOA 1E43A 1UH2A 3ZOAA 4XZBA 3SUSA 2JEQA 4JFTA 1H0GA 1BYDA 3BGAA 2WVUA 4A3HA 2GUYA 2X8RA 1D7FA 4BQ3A 4B3KA 4F9JA 5BXSA 3WQ4A 3MMUA 1V3KA 1W2VA 4QP0A 5IDIA 4DM2A 4PMRA 1W91A 1P6WA 3WH7A 2YOCA 3CLWA 1LL7A 4LYQA 3NSNA 2YA1A 2PI6A 1VFFA 3BAJA 3WD2A 1BSIA 5CZKA 3WUGA 3VILA 5JIWA 1GOKA 3T2OA 4RE3A 1H0IA 1Q6FA 4QAWA 1FOBA 6A3HA 1G9HA 3SCPA 4HMCA 2WLZA 3WFLA 2DSUA 2XFFA 1PJ9A 3OZOA 1UUQA 1JZ3A 1U33A 1WE5A 2WMHA 4PTMA 1BGAA 3W24A 2OLHA 3WH9A 3WF1A 2DIEA 2DSVA 3EDJA 1BGGA 1R86A 1TFVA 2NT0A 1E0XA 3UR8A 1H11A 3KZSA 3RJXA 2EPOA 1WPCA 4CU6A 1A3HA 1G94A 5HPOA 4XX6A 5A94A 3QHMA 1V0NA 2C8NA 3LMYA 1XCWA 5DO8A 5IHSA 4NRRA 1OD0A 4IPNB 2BVDA 4V28A 2GJRA 4H8HA 4ZFMA 3VX1A 3B8SA 2OWWA 9CGTA 1CDGA 1V6UA 5BYWA 1FH7A 1QI5A 1FHDA 1CXIA 4RE4A 1UH4A 3ZIZA 1GQLA 2ZWYA 2WMGA 5CJ5A 4Q7NA 3N18A 5IFTA 1XSIA 3ZJ8A 2WCGA 2JE8A 2PWHA 1SFSA 2J25A 4DWSA 3EMQA 1CXKA 3MUZ1 3I3EA 4PMDA 4ZE4A 4BQ4A 1UKOA 1XYZA 4U33A 1QNSA 4D6HA 2F2HA 1VEOA 5E0FA 1CNVA 4W8AA 4WSJA 4MB4A 2XSAA 1MXGA 1JZ6A 1JF6A 1J11A 5LYRA 4IISA 2YA2A 3FXYA 3VINA 3WQVA 1E3ZA 2XG9A 1CXEA 1D2KA 3AHYA 2WWCA 2UY3A 4H2CA 5I23A 2BV9A 4NF7A 1MYRA 5EB8A 3WELA 1UZ4A 3BCFA 3WH6A 5CQ1A 3VX0A 1HX0A 4W88A 2EPLX 4D1JA 1HVQA 1XH0A 4UQCA 3OLEA 2VURA 3AIEA 3RCNA 4DWSB 1CGYA 3BSGA 1ZL1A 1KXVA 4TVCA 4HOXA 1E71M 4OBRA 3WNLA 3KWXA 2CKSA 5JBFA 4JIEA 2WBKA 4J3WA 4QLJA 3DYOA 2W67A 4H04A 3L4WA 1ODZA 4P8UA 3L2LA 4X0NA 4EE9A 2WVVA 5D9MA 2YL8A 1W32A 1MFUA 1HJSA 4C7GA 2XPKA 1WO2A 2XFRA 2ZX8A 2A3CA 4AZCB 1VENA 1OWQA 2XJ7A 5I24A 1SMDA 3LPFA 2OWCA 3AIQA 3WD3A 3AMLA 1XD1A 1OT2A 5IFPA 4W89A 3WBAA 1C3FA 4GKLA 1HVXA 4U2YA 3IJ9A 1GVYA 1UR2A 2O9OA 2G3JA 3GBEA 3L4UA 3POCA 4Z2KA 2FGZA 1JXJA 1HXJA 4P7LA 4AW7A 5AYBA 4JFUA 2CIPA 4TX8A 2WHKA 3LPGA 2VCCA 2VZUA 4N42A 2O9PA 1E6ZA 3CTTA 4AD2A 4J3TA 1W3LA 2V5CA 1J0ZA 3GDBA 2E40A 1XD0A 1CXLA 2WVVB 3A47A 1R85A 3SIMA 1G0CA 4WLCA 4ACZA 4B3LA 1UZ1A 3WNKA 1JZ7A 5DF0A 1DWIM 1WDQA 2GJPA 5A6BD 2WM0A 2WCSA 4HOZA 2CCRA 1TE1A 3A4WA 5ECUA 2GDVA 2YIHA 2VMFA 2CBVA 3SCUA 1KFWA 2CEQA 2DH2A 2E3ZA 1UR9A 1RD6A 1E6SM 4TX6A 4OOZA 1HJQA 1AQ0A 1JYNA 3AYSA 3BH4A 2B31A 4W7VA 4Z2LA 3WDHA 1CGWA 4TTUA 2G41A 4HPGA 3BSHA 3SCQA 2CBIA 4M80A 4CUCA 1GUVA 2C7FA 4D6GA 2OSYA 1PZ3A 3ZM8A 3A6OA 3JUGA 5I2UA 4A3YA 2XSBA 2VZTA 1NQ6A 3OLIA 3GYCA 5I79A 2WVTA 3VIKA 4FMVA 1VFUA 4J3VA 5BCAA 3GZAA 4WF7A 4GXPA 3GH4A 5A8PA 2O9RA 2XM2A 2J75A 4U3CA 4MDOA 5HNNA 1QW8A 4ACZB 4Z2HA 1GVIA 1RP8A 4P7NA 5I6SA 1W9BM 2J8GA 3QOMA 3FNDA 5A2AA 3ZSTA 4L4OA 1BLIA 2VCBA 1CLVA 4IUGA 3CZEA 3N11A 1A47A 2V38A 3BLKA 1VBRA 4PN2A 4PUEA 4RL3A 3LPPA 3N9KA 3CHCA 4EKJA 2Q8XA 1EOKA 2OSWA 1LJYA 3OGSA 1W1PA 1UKSA 4AZBA 2CHNA 2W4XA 3BMVA 4TVDA 3CHDA 4JHOA 2VL4A 3UG3A 4AZ5A 1XHGA 4FLQA 1QHZA 4M56A 1E9LA 3MV01 4AC1X 1UA3A 3AS0A 3RM8A 4GI8A 2ZX6A 4JAWA 3GH7A 1KR0A 1CWYA 4W5ZA 1SMAA 3VIPA 3VIOA 1V6YA 3AZTA 3THDA 4IPLA 5D4YA 2CESA 3ZQ9A 3F5KA 2IXVA 3ARQA 4PUDA 1E4MM 2XIBA 1CLXA 1W1VA 5CSYA 5A3HA 1Q6DA 2X09A 2PWDA 1AQMA 1G01A 3ALGA 1WDPA 3WQWA 3K4DA 3VGDA 4HPHA 1GOWA 3DHPA 4UZSA 1ZS2A 1PAMA 3HJEA 3AJ7A 4LGXA 1TG7A 4MTVA 1FP8A 4W7WA 4KMQA 3ZO9A 3SURA 2ZWZA 1JD9A 3S6TA 3EDEA 2A3HA 3PTKA 1RP9A 1E0WA 3VIGA 5DEZA 3RO8A 3UG4A 1H5VA 3WFZA 1NWUA 3VU2A 1X1NA 2W5FA 4NRSA 3PZQA 2YKKA 1QBAA 2ZUVA 1Q4NX 2E9LA 2W61A 3L4VA 3N1AA 4UTFA 1NOUA 2JFEX 1HKMA 4D72A 1BG9A 5HDRA 3EMCA 4Y7EA 4R27A 3NUKA 3BLPX 1NH6A 2XWEA 1G1YA 1EO5A 3HMCA 2WSKA 4N0RA 3QOKA 4M29A 4W7UA 1NARA 1B1YA 1CXFA 3W82A 1V3MA 2E9BA 2FDMA 4M1RA 1XC6A 2VR5A 3SCTA 4NI3A 4FLSA 4UFMA 1B3YA 3N04A 1VEMA 4TUFA 1UKPA 4UQ9A 3RPMA 4HZ8A 2ZUMA 5ABHA 1LL6A 1C7SA 1GQJA 1GOIA 3VGGA 5HXMA 3CUHA 3W6MA 1J18A 3O9NA 3VTRA 5CXPA 4BF7A 1H41A 3SCRA 5AC4A 4JCLA 1BYAA 2IUZA 5HPCA 2XFYA 4PMNA 2VX6A 1UKQA 1GCYA 2WZIA 2VZSA 3K1DA 2VZOA 1E56A 3QHOA 1SYTA 3VGFA 5GQBA 3AYRA 3FN9A 3VIFA 1HJVA 2ZUSA 2CERA 3D5HA 2WPGA 2ZIDA 1KCLA 1MW3A 4JZ5A 1C8XA 1JNEA 1V6VA 1V3JA 2JF7A 3I3BA 4KGJA 8A3HA 1E4NA 3SUVA 1UWTA 2WNWA 3ECQA 5KZ6A 5M3WA 2JEPA 3PZVA 1Y7VA 5CPQA 3U5YA 1OBAA 4HMDA 5A6KA 3NSXA 4DUWA 1QPKA 1KWGA 2EBNA 1PEZA 4PTXA 1OINA 4PSPA 1US3A 1KBBA 3LPOA 4ATLA 1KCKA 3MSDA 1LQ0A 3AS1A 3ZJ7A 5BXTA 2CYGA 4UFLA 4LQ1A 5D9NA 4P8WA 3VPLA 3OG2A 2G4FA 5DT5A 1MW2A 4OIFA 1CTNA 4D6FA 3KL5A 3SUWA 2GSJA 4UQBA 3G6LA 1SR0A 1C93A 2CBUA 1F4AA 1TCMA 4BA0A 4AEEA 4EK7A 2BY3A 3RM4A 2BNJA 4AWEA 3AMDA 4KGLA 3SUTA 2D20A 5AYIA 2YDSA 3BC9A 4H41A 3OLDA 2FGLA 4AD0A 5DMYA 4UFIA 5E6ZA 4D6IA 4AD5A 4PTVA 1XV8A 1PBGA 2AMGA 1J9YA 1GHSA 1GOOA 3EDFA 1V6WA 3GXIA 4F8XA 1K9TA 1UYQA 1ZJBA 2CETA 2XVKA 1EHAA 2VX5A 1BFNA 4JHZA 1HN1A 1NOFA 5FL0A 4JFVA 3GNOA 3L4ZA 3BAXA 4PYSA 1KWKA 1R7AA 3MV11 4AYSA 1E5NA 3OBAA 1CBGA 2VTFA 3VD4A 4GZEA 2ZX9A 4F79A 1MXDA 1UR0A 2UY4A 4ATDA 1AQHA 5E70A 4UQAA 1E6PA 2WZHA 4BS0A 1NWRA 1NOWA 4BZYA 1BG4A 4MAVA 2GK1A 1DEDA 4JFWA 1EQCA 2WZEA 3AHZA 2UY5A 5CLTA 4UR9A 3WDIA 4MJ2A 1KGUA 1V03A 3W38A 5A6BA 1W3JA 4KRUA 2J77A 3NCOA 4FLOA 1JYVA 1PPIA 3U7VA 1JAEA 3MUIA 5CPTA 1UWRA 3B9AA 3VGHA 4TTGA 1HP4A 3M7SA 2CITA 1Z32X 1GONA 3VMPA 4UQEA 4D6JA 1PIFA 3GBDA 2WANA 3SUUA 3SEPA 1KQZA 2ZOXA 3WH5A 3L4YA 2OYMA 5BRQA 3GNPA 4W85A 1I1WA 5BXPA 3KEHA 3PZTA 4AZGA 3PZIA 2J7FA 4CD4A 2GK1B 4D6CA 1IV8A 2WCAA 3WEMA 2YL5A 4NSBA 3AIBA 3KE0A 1CGVA 2BVYA 2BY0A 5FKYA 2BVTA 3FY1A 2JIWA 5E6YA 3WQ6A 4H7VA 1JZ5A 1UWUA 1QI4A 3NYDA 4UFJA 4OUEA 1EO7A 2E4TA 2WBGA 4WKFA 3BMWA 1ITXA 2WSPA 3W6LA 3PTQA 3II1A 1HL8A 3ARRA 4MDPA 3WUFA 1ZBCA 2GJXA 4UOJA 1U30A 3OIHA 5CSUA 1W9DM 1GPFA 2Y5EA 4H8VA 4Z2JA 4GQRA 1ISZA 1GW1A 1I75A 1HJXA 1B3XA 1J0IA 4TXEA 2Z1SA 2DT3A 3VO0A 3WDQA 3GTNA 1B90A 4S3JA 2DT2A 3WDRA 3VVGA 1UD2A 4A4AA 1VRXA 3EYPA 5I77A 1JDCA 2VRJA 1Q6GA 1E40A 4JL2A 1IZJA 4DUXA 1W9XA 3FHQA 2DGAA 5CGMA 3WQ5A 1TA3A 4CN1A 1O7AA 1AMYA 1UG6A 2Z1KA 3ZT5A 2WKLA 4QLKA 3W25A 1JGIA 1KXTA 2W91A 4GO8A 4PMOA 1EXPA 3WD1A 1EOMA 5A6SA 1WCGA 2GJXB 3EBVA 1KR1A 4GIAA 3T0AA 1ZBVA 3PZNA 1JIBA 1DWHM 3WENA 3U5UA 4AD4A 1HIZA 1E5JA 5E0CA 3DHUA 3FHAA 1MW0A 1BYBA 1W1YA 1R7OA 2PBGA 2BHZA 1V0KA 5JBDA 1VFOA 2OYLA 1EDTA 2UWFA 1DWFM 4P7OA 4AIEA 5D9PA 2FH6A 1W9VA 5HOSA 3IJ7A 5I78A 3CO4A 3VNZA 3E1F1 1WDRA 4MPKA 1WKYA 3SCNA 1O6IA 2PWFA 5A8QA 8CGTA 1XCXA 3W26A 3WIJA 1GQKA 1CGUA 1TA3B 2VVNA 1K9DA 4ZEPA 1UD6A 4C7DA 3ZJKA 5FOOA 3ARVA 3AHVA 3A4AA 1H49A 1R8LA 1CENA 1WZMA 4P8XA 1JNDA 3SCSA 4AZ7A 4DM1A 2WMIA 2XYLA 1UWQA 1I1XA 4WIWA 2X1IA 4FF5A 6TAAA 4ZENA 3CZKA 1DHKA 1YQ2A 1OCQA 1CPUA 2W66A 3ZJ6A 2ZX5A 4MNKA 2ZUWA 2JIEA 3KL0A 3MS8A 3BAKA 1M03A 1KGWA 1K9EA 5KEZA 1PZ2A 4UZUA 5E9AA 3WMSA 3AXIA 4YPJA
chains in the Genus database with same CATH superfamily
2J74A 1GOQA 2GZXA 2OEMA 1Q4WA 4GJIA 2WVSA 5AHLA 3VNYA 2ALRA 4GACA 2YDAA 2D0HA 1OC5A 4GQGA 4GPNA 3ZWTA 1MNSA 4R53A 2OQHA 4E8DA 2RDUA 1B4EA 4I7VA 2PE4A 2Y8VA 4LUIA 2LLEA 3F03K 3RG6A 4WGXA 1E15A 3A9IA 3MSYA 4WSKA 1QK0A 4D8LA 4I9TA 4YTRA 3MSGA 4DZIA 2B7PA 1TZ9A 5LA1A 4OV9A 4YCPA 2NUXA 3DGBA 4H9XA 1UUMA 1GQNA 4Y9PA 1E9ZB 6REQA 1U5HA 4UTHA 1JPDX 5BOFA 3WL1A 3EWCA 3O05A 1QNPA 1LOSA 2G96A 4Z2IA 5AY7A 2WK2A 1DYSA 1RSCA 3QLLA 4WCJA 5HMSA 4B5WA 4F2UA 4HGXA 4Y8EA 4CU8A 4GJJA 1S2VA 1H7RA 3M46A 3R94A 2NUYA 3C86A 2MANA 3ABQA 3NQEA 5M1TA 4EANA 1PTAA 4GHRA 3PWAA 4KWUA 2A3EA 2VCAA 2QYGA 5C54A 1WZAA 3QKZA 5HBFA 3BO9A 1ZQ5A 3NNTA 1A0EA 1MWOA 3GFXA 2Z7GA 5HULA 3IUIA 2QULA 3LCIA 1JYXA 3S2NA 3S2CA 3MYOA 4XZWA 4UQDA 3OOQA 4U28A 2J88A 1WXYA 2EGZA 2PFHA 3KLKA 3GXDA 1VLIA 3WEZA 3OA5A 2GOUA 1Q7MA 1P6CA 4O0KA 2NVDA 4RZ4A 1NP0A 5KZEA 2W63A 4JOMA 4P7QA 4ZQPA 2IQTA 4H9VA 4IX2A 1J0KA 5CG0A 3LCWA 4D2JA 4KIEA 2FHFA 4JQ4A 2NQHA 2IKHA 3VD5A 4GZJA 3ITYA 4MAZA 2F6XA 2F61A 4MG4A 1OF8A 5LIYX 3E5BA 2JALA 2E0PA 4CQAA 4A3UA 1E9IA 4PBGA 1B3ZA 1KM5A 5MKGA 1P0NA 3K4AA 3TSBA 1VAHA 3ARTA 4NJIA 1MW1A 2GQ8A 1HKJA 3N9SA 3H53A 4MJMA 5A6AA 3SCOA 1OGGA 2PDJA 3KCOA 4NZJA 3QF0A 3OLGA 3TONA 4S3GA 5GJMA 5C9UA 2Y1HA 5FJRA 2D3NA 3BL3A 4UTKA 2QCEA 3G1AA 4WKAA 3OA3A 1NQKA 4BQ2A 3RM9A 1K70A 3AROA 1BXBA 1V3LA 2P8CA 3L0NA 3W53A 1IF2A 2HVOA 1LWHA 3ANYA 1ME8A 4RUBA 4HCLA 4C1LA 4S3CA 3WQOA 2QPXA 3MUXA 3UYCA 2ZZ1A 3TLLA 4Q8UA 3S4TA 1OG6A 3LTPA 3ARXA 3GR7A 5HWMA 3BW3A 4L9ZA 3RX2A 1LQ2A 1ZCOA 1O1ZA 2PWEA 3VKDA 5ABFB 4JFSA 5HJYA 2CKRA 1ITCA 1NIUA 3EPMA 4J27A 4OZOA 4DAFA 3SN0A 4K7VA 4DJDD 4QRNA 1OGSA 2PDCA 2VT0A 3W7IA 1TV4A 4LTSA 2OWXA 4ADUA 2J27A 3FIGA 3GH5A 1E4IA 4FR6A 2DORA 4LOCA 5CKSA 3WK3A 1JXKA 1W8GA 3VKBA 3M0KA 4GI6A 1UQYA 2PTYA 3ALFA 2D69A 1IXNA 3NAVA 7A3HA 2ISWA 3LMZA 4K38A 4HNTA 2X1RA 1FH8A 1YYAA 3PP7A 1FWCC 4GH1A 3SY5A 5GJNA 3T8LA 3T08A 3K5XA 3AS3A 1OGBA 3P3BA 1LBLA 2IS7A 1CZ1A 1MZRA 2J8FA 2QR6A 2E8ZA 5TF0A 2ZA3A 1BPLB 2XWDA 4BF9A 2ISDA 4CCEA 4AXNA 1NF0A 1ADSA 1RALA 1JCXA 4GFIA 5FACA 1EA9C 2J24A 1KB3A 1M7XA 5AB3A 3IVUA 2YL9A 5CJMA 1W3IA 3RDKA 4ZXOA 2B81A 3E0IA 1NFPA 2OG9A 1BF2A 1R0MA 2X05A 4DUOA 2WAGA 2V3DA 5TBOA 2PDGA 3CB3A 1C8YA 5EMMA 3GNRA 5FJTA 3TTOA 4DY1A 3WQCA 4AWTA 2EEXA 3R0KA 4C6FA 1P0KA 3URAA 1QWGA 3VDCA 3DECA 4P5UA 1G4PA 2QPUA 3IWPA 5F2GA 3W1RA 3PZMA 1EC7A 1PX8A 2ZA1A 1OD8A 3KUMA 2POTA 1B31A 3E5PA 3DCPA 3P93A 3QTPA 3DC8A 4HU8A 1QPNA 3LQGA 3WY1A 3MJMA 4LH8A 5A1AA 3BLFA 2VNCA 3CAVA 1A50A 1HKKA 1ITQA 3AU6A 3V1HA 5TD4A 4YHGA 4B5NA 2Y70A 2NXGA 4PEKA 2QAPA 3T2QA 4DN1A 2OPJA 5JBEA 4D9PA 3PBVA 2X40A 4HA3A 4IIGA 1UR1A 1XGZA 5HQEA 4K7YA 1LOQA 4AD1A 2WXDM 1XPGA 2XVGA 3DGRA 1BHGA 3VM7A 2HMCA 3BLEA 2GDQA 1ZP3A 3EOOA 1QOQA 1KBLA 3AJXA 5DY2A 4W93A 1UMLA 1KRAC 4NL1A 4GGBA 1JCTA 4FNPA 3SN4A 2E5DA 3R79A 5EFDA 3VOJA 4C6MA 3LRLA 4XB3A 5BOOA 1U1JA 3EX1A 3T09A 2IPGA 3V5FA 3ZYZA 1JULA 4RX0A 1H3GA 3GKFA 2D23A 4WY0A 2VUNA 1P7TA 4Z1YA 2P53A 4E4PA 1GQIA 4ROQA 1DXIA 3MVTA 1W3NA 4C6EA 3WLQA 3WJZA 4UR7A 2DU2A 4WDWA 3UP8A 1GG1A 5EMUA 1PTGA 4RXFA 5I3DA 1A5LC 1JCMP 3W7PA 5TAOA 2ZYFA 1R5YA 4LY4A 4XSMA 2BZNA 1N8IA 9RUBA 1GNXA 5ABTA 1TV2A 3A5FA 4GISA 3TE9A 2NV9A 3TJLA 1XP3A 1W1TA 3OHIA 3WQ8A 4G9PA 1NDZA 3MO4A 5C7VA 3H7UA 1TTIA 1UH3A 5C9RA 1DQXA 1EP1A 3DYPA 2X2YA 4R34A 4IP4A 2D24A 4IM4A 4ZA0A 2EJ1A 3H21A 1M01A 2V3FA 2QF8A 3E0FA 4I8DA 1OZMA 2Y88A 3SECA 1A53A 2QDHA 2GLKA 4MIMA 1C7TA 1QO2A 3CU2A 4EXBA 2PDIA 4H6EA 4Z2GA 4LPCA 3VIMA 3F4VA 1B30A 4E8GA 1EDGA 1K7EA 2BDQA 2PWVA 3IAPA 1TZZA 5I3IA 1XDJA 2YXGA 4HYWA 5CC6A 2ZXAA 4HPJA 3HV8A 2NT1A 3DOPA 4US5A 3VDBA 3L5AA 1GW9A 1DWJM 2BOEX 1ZSXA 3NZQA 3W3OA 3SO7A 1DWGM 1GYMA 1JCYA 4MY1A 1W9PA 3E2SA 4GLEA 3B0UX 2VDIA 1FWSA 4LANA 3SCWA 2RHGA 5G4WA 3H2OA 2D2GA 3ONBA 4S3AA 2B0MA 4L1GA 2YGYA 2Z29A 4XD5A 4MWAB 1RY0A 2OO0A 1P0BA 3M7WA 5CG7A 3THQA 1HFBA 5U7SA 1HL9A 5A6LA 1FFQA 2YDRA 5F1UA 4KF1A 4HHPA 2QCHA 4IIFA 4MVAA 4UCGA 4N2YA 1F07A 4C6LA 3KLLA 3N13A 4XVEA 5CEWA 3AOFA 1QU4A 1D3GA 1GTEA 2O9TA 2OT1A 2WMKA 2XZ9A 2YLAA 1VZWA 2H90A 4HK5A 4X0VA 1IR1A 4RJEA 2H8ZA 2VEGA 5ABEA 3VDHA 2NW0A 3QR3A 1Q13A 4U5KA 2IPFA 3REQB 2XM1A 1L0PA 3XINA 2PF8A 3GM8A 2AOSA 2Y89A 1TQXA 4NAEB 4GZIA 3QV8A 4M6VA 4AY8A 5C8BB 2V68A 4QE4A 4J3XA 1XGEA 1E0TA 2AAAA 2W62A 1IT0A 1GZ1A 2PLMA 3QXBA 4ML9A 4OOUA 4OKDA 4AY7A 1VD6A 4N4PA 1VJIA 1ZU8A 1GHRA 4WK9A 3C0JA 2BBFA 2G95A 1SW7A 4IL2A 1GKRA 2HQAA 4MLJA 1DIEA 1TIWA 1I2PA 2AKMA 3WF3A 1E0UA 3TWAA 3HMJG 1V79A 1L9WA 1ZBKA 2YA0A 2YCEA 5GPRA 2V63A 4LNYA 5IBXA 3QYQA 2WC3A 2NLYA 2OLSA 1L6SA 1PHQA 3B8DA 1XIFA 3GTXA 3GUGA 2OR2A 3CT2A 2DEPA 3CUZA 1J6OA 5LNRA 3NDOA 1TV3A 5D8ZA 1EGZA 4PMXA 3JU2A 3TC7A 1NWSA 2VFDA 2VEIA 4H3DA 2OKTA 4P61A 5D2XA 2CXGA 1AK5A 2FFIA 1BTCA 4L80A 4W8LA 4Q22A 4GO9A 3W28A 3MY9A 3MDUA 1JZ2A 4MYXA 3HQNA 2PURA 1I4NA 4AY1A 1U2YA 2NX9A 1YXDA 4WJXA 1Q63A 1Q6LA 4R85A 3IEBA 3ZT6A 1OFPA 4PC8A 3TTSA 3KRSA 3GC4A 3WF0A 2GGJA 3CUJA 1X39A 1XG3A 1OSEA 5A69A 3PY2A 1J0YA 4QE1A 4J5NA 3C8FA 3P7YA 1XIDA 3U57A 3HZ3A 2F8QA 4JTUA 4B5VA 8RUCA 2J79A 3KFTA 1Q66A 3BARA 5JIPA 4JN6A 4M24A 4XD4A 3R25A 3OO2A 1RUSA 4JX6A 1M7PA 1UH2A 4JDYA 1HO1A 3E0WA 1F8MA 4ZODA 2VGGA 4INFA 4A3HA 2X8RA 1JUBA 4CNTA 3WFAA 4BQ3A 3R89A 1V3KA 1PKMA 5CSSA 3U8GA 3PB2A 4PMRA 3NR0A 3W1AA 1JPHA 1P6WA 1TPDA 3WH7A 1BWVA 4AEOA 1LL7A 3NSNA 3CT7A 4PA8A 4FF7A 4LUSB 2ZQ0A 3MA8A 4M51A 1EJRC 4NNAA 4GVHA 4Z1BA 3SCPA 3W7EA 2ZDRA 3A64A 3Q94A 1TJ2A 3WFLA 5I00A 3QSRA 1YXCA 3Q58A 1UUQA 3LHWA 1U33A 4NJJA 5M2FX 1BGAA 2FFCA 1M3UA 4KRZA 3W24A 3EDJA 1BGGA 2P0IA 4Y9AA 2BX7A 1O94A 3S1GA 4FHAA 4CU6A 5CZSA 4Q4MA 3M5VA 4Q7IA 2CLEA 3N6HA 1PXGA 1TWSA 4G6CA 5DO8A 3AU2A 4HTBA 3Q67A 2W3ZA 3W86A 2BVDA 1CDGA 1FH7A 1QI5A 1FHDA 1CXIA 1E51A 1GQLA 2ZWYA 1DIDA 5IFTA 1XQKA 1XSIA 4LVBA 5DCBA 3F2BA 3RXZA 3M1ZA 3O16A 2W79A 2WJZA 5FF0A 2V5JA 5FJIA 1JF6A 3UWVA 4NJHA 4J9JA 4IISA 4RW3A 2Y7GA 1E3ZA 3B97A 3AHYA 2I16A 3I6RA 2VFIA 2WWCA 1PDYA 1Z7AA 2BV9A 3PF3A 4CEUC 4GUIA 2GYIA 1OX6A 5EB8A 1NJJA 5D33A 4C1NA 2EJAA 1A3XA 3O63A 4W88A 3H6OA 1XH0A 4UQCA 4FOJA 1MZHA 4FR1A 4G7EA 3DX5A 3BSGA 1T41A 2YZ5A 1ZL1A 1R3VA 5IOBA 2E5BA 3E2RA 2P3EA 2CKSA 3P6LA 3DG7A 2W67A 1RV8A 3V0SA 4NHVA 1X7IA 2Z00A 2WVVA 4NZ5A 1W5OA 1H63A 1XF0A 3ZVIA 4Q8TA 4JIHA 1YADA 1TWWA 2PDLA 5EPDA 3MWCA 4AZCB 1VENA 1OWQA 3EKZA 4EPKA 5I24A 1OT2A 1VIZA 2POZA 4H9ZA 7REQA 1BXNA 3CAWA 1TMLA 3JZEA 4Z2KA 2O9OA 3QLDA 1OCJA 1JXJA 4AW7A 3N2TA 3FDKA 1XISA 2YBVA 4O18A 5D2YA 2P3ZA 2CLHA 3LD5A 2QJIA 2VZUA 3W88A 1AZ2A 1M41A 1E6ZA 1J8VA 4QNEA 2DIKA 3LGDA 4J3TA 4DB7A 3W7MA 4OTKA 3W9ZA 1XGDA 3DFQA 3AC0A 3AUJA 3SIMA 5H8MA 4WLCA 1TR9A 4NU7A 4JYDA 4BJHA 1UZ1A 3CQHA 1YW1A 1DWIM 3B0YA 4HOZA 3TW6A 1TE1A 1POKA 3A4WA 3EX6A 1DKWA 1XBVA 2PDXA 1AW2A 1KFWA 3UZJA 1VS1A 4TX6A 1HJQA 4Z2LA 1XINA 2G41A 4A3QA 3BSHA 2NX3A 3BW4A 1GPWA 5H1WA 2C3ZA 4D6GA 3A6OA 3S0CA 3UJSA 4FXFA 4IICA 4MZ8A 3HGSA 3MBDA 3GZAA 3T4CA 2O4QA 5A8PA 3CK5A 3WK0A 4U3CA 1I6NA 4Z2HA 5JXQA 3NZ1A 4EACA 2QCGA 1RBOB 2Z4GA 2J8GA 4B5UA 5LSMA 4OBTA 5CPNA 5FEPA 4Z17A 2I57A 3M64A 3N11A 3I68A 2V38A 2B4GA 3LPPA 2GPTA 1MSSA 2WZTA 4IMGA 2OSWA 1W1PA 3QZEA 3WK1A 1UKSA 1YIXA 4JTKA 1B54A 5I06A 3IJDA 3N2OA 2GUBA 1KA9F 3UG3A 3BJFA 4QNWA 1FWDC 4M56A 2Z0IA 3O15A 1UA3A 1DJWA 2XU2A 1RJPA 3KOWA 1A80A 1V93A 5FEWA 2A2IA 4YVXA 5A8GA 1Y5VA 3VIOA 4Y90A 1V6YA 1HW6A 3RRXA 5D4YA 4RK8A 3O6DA 2IXVA 3ARQA 4PUDA 3KVLA 2NQLA 1VYPX 3BOFA 4QISA 4O52A 1EJWC 3C5QA 1DJXA 1OFQA 1AQMA 1G01A 4A8NA 1WDPA 4NP7A 1A5BA 4IFKB 3K4DA 5I09A 1OX4A 3VGDA 1ZS2A 4DVOA 1O68A 3AJ7A 4LGXA 1TG7A 1FP8A 3BLIA 4JIQA 3WLJA 1K6WA 1KBIA 2R24A 3UR2A 1JD9A 2ODOA 4H2HA 3OBKA 4BHYA 3IK4A 3VIGA 3G18A 4XQ6A 3WFZA 3OVRA 1X1NA 3A4JA 3LBOA 2YKKA 1QBAA 2ZUVA 1Q4NX 1XBYA 1RJQA 2DW6A 4C91A 4UTFA 3CIXA 4QIUA 4XUGA 4IFOA 5K9CA 4F0MA 3QQ0A 1EO5A 2A6LA 4X22A 3QOKA 4M29A 3N6JA 2XSXA 1CXFA 2E9BA 1GYNA 4M1RA 4QS5A 1AZ1A 3W75A 3LCHA 2HE8A 1XICA 3FGCA 3P81A 4FLSA 4UFMA 3IIZA 1BWKA 4TUFA 2PU0A 2JQXA 4HZ8A 6ALDA 1GOIA 1PCKA 3D6NA 3W6MA 3GTFA 3LI1A 2OU4A 1DIKA 3R10A 2Z24A 3H4GA 4PFMA 4JCLA 1PWMA 2WSRA 2Y7EA 2ZZ5A 2AL2A 1WA3A 4C6NA 3K1DA 1RVGA 3UYIA 3QHOA 6TIMA 2ZUSA 2CERA 3RCYA 1KCLA 2Z2UA 3E38A 2X1SA 2WJDA 2FVLA 3OW1A 1KCZA 4IT1A 4XD3A 4HB7A 1W54A 8XIMA 1QXLA 1YDVA 1OVDA 3AAMA 4UNLA 1K8CA 3G22A 3I7QA 5A6KA 3NSXA 4XWUA 1QASA 1KWGA 2QEZA 1US3A 3CPGA 4B4HA 3LPOA 1KCKA 3AS1A 2CYGA 5D9NA 3TUUA 3OG2A 4FXJA 2NX1A 4H7CA 1BEUA 3PBMA 1CTNA 1J79A 2ATSA 2GSJA 1XBXA 4H9TA 5CC5A 1J5TA 4EIVA 4L6OA 2CBUA 3W2MA 1F4AA 1K1DA 4TMCA 4BA0A 1SFLA 3IRSA 3GG0A 3W7OA 1P1XA 3IGXA 3T78A 1BKSA 3WQPA 1YTKA 2YDSA 3PFRA 3GHRA 4Z0JA 4A22A 3BQ5A 5DMYA 2QVNA 1P6BA 5E6ZA 2IPWA 4FX8A 3MWAA 4PTVA 3O0FA 1UMYA 2E25A 2AMGA 3EDFA 3URNA 1UYQA 1ZJBA 2CETA 1EKOA 1RD5A 2QGYA 2XVKA 2FPVA 4IXXA 3CL7A 3W00A 2E6FA 4JFVA 1REQB 2C13A 2WV8A 3L4ZA 3BAXA 3B0XA 4NXKA 1M6JA 4GZEA 3GD6A 3L0KA 3DENA 2A4AA 1XWYA 3M0LA 4F79A 1DBTA 4IIEA 3KXQA 4RW5A 4ERAA 1NOWA 1E1CB 4MAVA 3W7LA 2WZEA 1HGWA 4GC4A 3MPGA 4GI4A 2XZ7A 2FVKA 2ABAA 2CLMA 1KGUA 4A2RA 3P61A 2H9AA 3HGRA 3C2YA 1A4LA 3MQTA 1LOLA 4CNNA 3UZYA 2YPIA 1NFGA 4XAZA 5BOEA 3WX7A 3U2OA 4TTGA 1I2RA 3QQ1A 3AO0A 2RDWA 2YCLA 3ZZ1A 2CITA 1Z32X 6PTDA 1JGMA 1FWAC 1JPKA 3UXAA 2X1TA 3QZ6A 1PIIA 1Z8AA 3GNPA 1TPB1 1HGYA 3KEHA 4AZGA 3PZIA 5K3VA 4N9EA 3MYPA 3P8JA 1KKRA 4AWSA 2EKCA 5LIXX 1CGVA 2BY0A 2QIWA 3L67A 3UVIA 1KCXA 2JIWA 3GC5A 4FEZA 5E6YA 3TTEA 1OC6A 3NYDA 3BMWA 1ITXA 4GE8A 1RR2A 4FX6M 3II1A 3PTQA 4MDPA 1P5BA 4GWEA 4UOJA 1TPUA 1U30A 1J2BA 1KTBA 2PRLA 3IARA 2Y5EA 1XLHA 3OBEA 1GW1A 2TODA 4ZOEA 3N6QA 3VZZA 3WDQA 3GTNA 1IYXA 4S3JA 4ALDA 1OC7A 3WDRA 4X2RA 4AXKA 3KOYA 1LRQA 3EYPA 2CWNA 5I77A 2BG5A 4DAIA 1E40A 4DUXA 2DGAA 5CGMA 1T99A 3WQ5A 1IGSA 3KWSA 3QY6A 1O7AA 4N6FA 3ZT5A 1X8FA 1OFAA 4X60A 1SFJA 4DI8A 4GO8A 1ELSA 1EXPA 4XG1A 1WCGA 2GJXB 4DXKA 4DJED 3AUOA 1VGAA 1KR1A 5PTDA 3PSWA 3ITVA 1M65A 2PDMA 3IJIA 2I7GA 4O53A 1E5JA 1J4EA 2VEMA 1MW0A 1W1YA 3W84A 1MRQA 3E12A 1EDTA 2AL1A 4LW7A 2FH6A 4KWSA 3WK2A 3K30A 3F4WA 5I78A 1VBGA 3E1F1 2OX1A 3NXLA 1WKYA 2PWFA 4HNNA 3W26A 4LBRA 2QDDA 1OFDA 1F5ZA 2VVNA 4C7DA 5FOOA 3ARVA 4RPQA 4ZOAA 1W1ZA 1LCOA 4S38A 4XIMA 2A5HA 4FO4A 3DAQA 1CENA 4E2BA 3CJPA 3NPUA 4B2DD 4UNKA 1GG0A 3FYPA 6TAAA 2OZTA 4J4KA 2FZBA 1CPUA 1YLVA 2UZ9A 2W66A 1R2RA 2ZX5A 3EXRA 2ZUWA 2JIEA 2DZBA 4FS9A 2OODA 5H2ZA 3KL0A 3MS8A 4U10A 3H54A 3Q37A 1KGWA 3F4NA 5TIMA 4UZUA 5E9AA 5AC5A 4ADSA 2MUCA 4ZB2A 4L65A 2FJUB 1ISYA 1CGXA 3K46A 8TIMA 4RXGA 3TA9A 1C92A 1KXHA 1XRSA 3CZGA 2J78A 3DG3A 1BYCA 1K6AA 2ZE3A 3L4XA 4DHGA 3CGTA 4XAFA 5G4EA 1J93A 3IK2A 3M44A 5DLCA 4ECLA 3GNNA 3VC6A 3QY7A 4S3BA 1E3XA 1KGXA 4ZSTA 1O4UA 3PBGA 5AYZA 1J0JA 2VFFA 1AA1B 1V7AA 3S5SA 3VOFA 3OZPA 2OT0A 4PSRA 4BCEA 4DYJA 4GX8A 5H8PA 1LRTA 1UC5A 5DFAA 5EFFA 5LIKX 1O5XA 3VC5A 1UD3A 1A5MC 4AIUA 1G6CA 3LA4A 4UUIA 4TVUA 5C6MA 4NIRA 2ZRYA 4UOQA 2P88A 3PPCA 3BZGA 3N14A 2WMJA 1V0MA 1Q6CA 1FWFC 1NELA 2XGBA 3PUEA 1YEYA 1VPYA 4JQ3A 3TKFA 4AZ6A 5EYWA 4JTCA 3WBYA 1HJWA 2ZBTA 3ZR5A 3QM3A 4WKHA 5HA7A 4BF5A 4E6MA 4CD8A 1ISVA 3G1VA 2PF0A 3P8IA 3EKLA 1W56A 1FDYA 4M1BA 3ATZA 1KM3A 4PCSA 2OSXA 4GINA 1H09A 4JTFA 4L9XA 3FJ6A 4LAZA 2D73A 1FHUA 3WBWA 1R9ZA 5A8NA 1H7OA 3THCA 2VR2A 2PGEA 4NT0A 2O55A 3TN5A 4Q8OA 1F2JA 1N8FA 3NIYA 1PKLA 2NWRA 3WMCA 4ZGYA 5BRPA 1K03A 3E96A 3ITGA 5HWJA 3T07A 3GY1A 3RLHA 4MWAD 2YB4A 4BI5A 5DX7A 3OZMA 4IQEA 4H8UA 1PB0A 2HVMA 3QV9A 1E6XM 2QMJA 4KBXA 5GVJA 5A6JA 5FF4A 5LHEA 3QYSA 4GYJA 5A2BA 2EPMX 2REQB 3B8WA 3MKVA 2QCNA 4WOZA 3M0YA 2R91A 4MYAA 3S42A 3CUIA 5ABFA 2PWGA 3S5YA 4ZXLA 1UIPA 3UWZA 1BWLA 2J8TA 4LFYA 3FAWA 1AH3A 2OMAA 3VIJA 5G2IA 1UWSA 3WUEA 2AGKA 2J62A 2AQVA 3RR4A 1QHPA 3BPWA 1GJWA 2VJXA 2X0YA 3PTDA 3M9YA 1VQTA 1OFRA 4M81A 3CV2A 4F48A 2Y62A 4ZL1A 3D3AA 5C0QA 1G4TA 3M4HA 1JDAA 1C29A 1TV7A 1JF5A 2GVGA 2XH0A 1FCBA 4EAMA 2EPNA 4K8GA 1V08A 2H3DA 1MQQA 1ENUA 3AZRA 2D2HA 2Y85A 5A95A 3ABOA 2EXOA 1CEOA 3LXBA 3SQLA 4M8UA 1BQCA 1X97A 1CXHA 2QCLA 2HISA 1OFOA 2VM8A 2CBJA 3QGVA 1YDNA 1C90A 2BY2A 3GHTA 1FWWA 3T4WA 1FH9A 3EB4A 2OFJA 3W74A 4BK9A 4PUKA 2QUNA 2VO5A 3MT1A 5HINA 2EF9A 4AF0B 2PCEA 4LUJA 4Z1AA 3BLLA 5EA9A 5C9WA 3LNMA 2VWTA 2Z1VA 2ACUA 2GDUA 3V0TA 3CS2A 4ZQNA 2VZVA 3H2CA 4ACYA 3B4YA 4Q6JA 5FJPA 4QLLA 2Y8KA 1EQPA 3UNTA 1EZ2A 4U4MA 1S2TA 4QAIA 4AMCA 3GC2A 3BW2A 3RF9A 4DIAA 2TAAA 3ONCA 3SFKA 2Q01A 3OVGA 2Y2WA 2VC5A 1SSGA 3H26A 2PDHA 3ZSSA 4CN4A 2ZRZA 2WHLA 4E3TA 3H22A 3MMDA 3KOXA 1EDQA 1V6XA 2ICSA 1ZB5A 5T9BG 4S3DA 2PDUA 3M0VA 3BURA 4LT9A 2C1HA 1YTDA 2YSWA 4YTSA 1L2UA 3F1QA 3TU9A 3SQMA 2YCJA 3SCVA 2WC4A 4ZE5A 2SFPA 5D03A 3G0SA 1BVNP 4V1YA 3IJQA 5DRCA 1E6RA 4DBEA 1QVBA 1UWIA 2XGZA 2E6YA 4LX4A 2WJFA 2W92A 5I5RA 4NVTA 1VYSX 3VCNA 2J7DA 4FOUA 2QDEA 3VZXA 1W3TA 1X6LA 5C7HA 2XUCA 3WDPP 4WDXA 4LUTB 1D8WA 3OB8A 3AHTA 2G50A 1UIOA 5FA5A 5CC7A 3EWWA 3TQVA 3FVDA 4O1EA 4IJCA 5K7JA 4ROPA 3HPAA 4E3VA 4TOQA 3AXHA 2OELA 2DH3A 3VUSA 4B2DA 1KXQA 3KRZA 1YPFA 2E67A 1H1NA 2VFGA 4JIIX 4RE2A 1XLDA 2ZRXA 2EPHA 3SGGA 4XSLA 4ERGA 3L68A 2EKGA 2CWXA 4F9DA 3M5YA 1EA0A 5BW6A 4GY0A 3FA3A 2DIJA 1QATA 4DJFD 3WBXA 4YHEA 4H9MA 2J47A 3IS4A 1J12A 4JKKA 4M6PA 1MI3A 4EXQA 3IPWA 1R87A 2PRHA 3CL8A 4D1IA 4A8IA 1TWDA 5C71A 1Q8AA 2DZWA 1QNRA 3CHFA 5D32A 1G5AA 4PODA 4U2ZA 4XBSA 1DJYA 2G3IA 1CB7B 4U3AA 1NM9A 3TW9A 1PL9A 3WNMA 3S9YA 9XIMA 1HKWA 1WBJA 2CZFA 2FZ9A 3GTHA 2GUUA 1EIXA 1XUZA 3W2JA 2ZE0A 2XGIA 3USBA 3W7GA 1VCFA 3EB3A 4AQLA 5BWFA 3I7SA 2OJPA 3FYOA 2HEJA 3CAKA 4HN8A 3O3RA 2VX7A 1A49A 1GOMA 4RDZA 1K77A 5DXYA 5BXRA 3HQPA 4N6EA 1ECQA 4Q32A 4L7ZA 1KBJA 3EEGA 3DIPA 2QHAA 1LBMA 3EXTA 1TVPA 1JFXA 2BODX 4DZAA 4F3HA 2WLYA 2GSEA 4XBJA 2QJNA 4JGDA 4RCXA 1Y65A 1LWJA 4UTWC 1OK4A 4UCFA 3WL0A 3W4RA 1XLCA 1ZAHA 1H61A 3HG4A 3APYA 2ZTJA 3S2JA 4HMEA 2A7RA 3T0DA 3HG3A 1LUCB 3AXXA 2D2OA 3VOCA 9XIAA 2TMDA 3LY0A 3UZ5A 3PULA 3NVTA 1VJZA 1ME9A 1QWKA 4GUJA 1QW9A 3S3GA 3BICA 5FF7A 1IXPA 2DDXA 1IWAA 3CMGA 3TOPA 1M7JA 4C5YA 4MWAA 4BKNA 1QI2A 4XZHA 2ZX7A 4YLWA 3PB0A 1QDSA 2C1IA 2RH9A 1QBBA 4LVAA 2ATMA 1FFRA 2OKOA 1OFEA 2VC6A 1I0DA 3UXLA 3N34A 1V02A 4ATWA 3WQDA 3TNBA 1L8NA 3P14A 1T40A 2YCKX 3K8MA 3GLCA 4V15A 2QJHA 3COTA 4W5UA 5C9ZA 3RILA 1R3TA 2DY3A 3G5EA 1BVWA 5DANA 2BXZA 1HNYA 2NQ9A 2V5DA 1XL9A 4K8EA 4M7SA 1BVZA 2Y6ZA 4JN8A 2ABBA 4IH3A 2J9XA 3VOGA 2INFA 1N2VA 3ARYA 5HNRA 3DFTA 2G8ZA 5D2TA 1W3HA 3R12A 1YBQB 1I0BA 3GDLA 1PZ0A 3REQA 1V8EA 4NAEA 5C5YA 1HTIA 2VENA 2X30A 3GXFA 3O6YX 5BNKA 5FF2A 1YNYA 3ARWA 4WX2A 4GUGA 1UASA 4F40A 2FH8A 5IHRA 4ES4A 2J6VA 3N2BA 3GG1A 3T44A 1IGWA 4KPLA 3BCDA 4BY3A 4RR4A 2FZNA 3IANA 2J7EA 1OG0A 5GJPA 1XUUA 4EAYA 3N29A 3ZLGA 3TYZA 1W0MA 3GX9A 4B9ZA 1TUXA 3QEZA 1UKTA 1XSJA 4DO6A 3LSBA 1EC9A 2OVLA 2BHYA 4LWWA 3P0XA 1DTUA 3IVTA 1VP5A 3CUXA 3A24A 5MF5A 3NL6A 3WLTA 1PHWA 1S46A 5DCDA 4GFSA 4HBKA 4C7FA 2DFAA 4JTIA 1R6WA 3KW3A 4HZ7A 2FHCA 3LEPA 1HJUA 3PZ9A 4L6DA 2PMQA 1XH1A 2OZ3A 3LXCA 3B05A 1B9ZA 1MQPA 4N9CA 2ZUNA 2RJGA 3UERA 1AJZA 5KZMA 1DXFA 4YMZA 2QT3A 1E55A 3CPUA 4DELA 3OVQA 3GS6A 2C1GA 2G4JA 1E1EA 1RQBA 2CLPA 5LA2A 1QNVA 4CNOA 1XIBA 3TFCA 3B9OA 4FNTA 5DRIA 1V6TA 1VCGA 3BAYA 4JL1A 3F2DA 3NQFA 2VUYA 5HATA 3I65A 2RJHA 1VPQA 2YZRA 4H9UA 4UTLA 5J5DA 2FB3A 4W9TA 3MP5A 3EB2A 3LV6A 3TLQA 5B80A 1RCOB 5DXXA 4D8ZA 5KTLA 1TTQA 1SZNA 1WAWA 4DNHA 4CD7A 2NSXA 4GZ7A 3OGVA 1JDDA 1TYGA 5IXEA 1W2PA 1GOXA 3WSUA 4ZZ9A 5LA0A 3ZR6A 1G7VA 3CH0A 1EPXA 1QK2A 1OT1A 3OYXA 4YTUA 5F4WA 3H2EA 1JZ8A 2EQDA 4UIOA 1VHCA 1FWTA 1R3WA 1WOBA 4IMDA 4Y9MA 1PS9A 4LUSA 1KM2A 3CEUA 4A29A 1V51A 4RDYA 2Y7FA 3VOHA 4CEXC 4AC7C 3VNIA 3EDKA 2J4GA 4ORIA 2R9RA 3MANA 4CGTA 4CVUA 4AEFA 3C0LA 2CPUA 4HHHA 1F4HA 2ZICA 3KP1A 4B15A 2ZZ3A 5A8OA 3BAWA 1GJPA 1NP2A 4OECA 4YCOA 3DXIA 5DMLA 1OQFA 8XIAA 4XZBA 3UPWA 3A22A 1SW0A 1W5NA 2GUYA 4J3ZA 4TV6A 2W27A 4QP0A 4DM2A 1UBPC 3L5MA 3W2UA 4ZO6A 1PE1A 2BLEA 2YA1A 2Z7KA 5CZKA 2DZSA 5JIWA 1GOKA 3H23A 3KBWA 3ITTA 3ORWA 1H7PA 2WQPA 3SM0A 3UPMA 4L4MA 1W17A 2WMHA 4GA8A 3WF1A 3WH9A 2FZ8A 2DSVA 1R86A 1RQHA 3PAJA 1MDRA 4PH6A 1H11A 4XZLX 1XC4A 2XN2A 2ZZ7A 2NVCA 1Z41A 2C6QA 5HPOA 4W4QA 4PBEA 4XX6A 4UTIA 5A94A 3QHMA 1V0NA 3G1FA 1HKVA 1XCWA 5IHSA 2BB0A 2ZDSA 2L5HA 3LOTA 1SO5A 4NRRA 4QGCA 4QSFA 1OD0A 4HU3A 1XIHA 2GJRA 1JR1A 3VX1A 3B8SA 1EBGA 3RMJA 1XYMA 4DBWA 1G7UA 1W5PA 4RE4A 4NNBA 4NZ4A 4DF0A 3EPOA 1X8CA 1UH4A 3T9PA 5CJ5A 4JR5A 2WMGA 3LX9A 3A9BA 1ZHAA 4OT7A 3ZJ8A 1WUEA 2Q09A 4LC8A 4XK2A 2J25A 1V4YA 3UJEA 3EMQA 3MUZ1 3I3EA 4ZE4A 1XYZA 4DPQA 4O54A 3CV6A 4XIAA 1QNSA 4D6HA 3WO8A 2F2HA 1VEOA 5E0FA 5T26A 1CNVA 4EVZA 5L6UA 2XSAA 1J11A 3H7RA 3NQDA 5LYRA 3PFMA 1KFLA 3FXYA 3WQVA 1CXEA 1PTDA 1TJ0A 2YFNA 3WJYA 5I23A 4NF7A 4NILA 3VYLA 1XCFA 1E9YB 3WH6A 1KRBC 1JQXA 5FAJA 3TJIA 1HX0A 2A3LA 2EPLX 3UA4A 3OEXA 3UGRA 3RCNA 4I8YA 3UA3A 2GGHA 4K1WA 3TQ0A 1F3TA 1E71M 5HMEA 3H70A 4ZO8A 3KWXA 3TYEA 1GTHA 4JHMA 3RHGA 1Z48A 3RRAA 4QLJA 3DYOA 4H04A 1ODZA 5FJOA 3NO5A 1JRBA 4JXCA 4OU1A 3V5OA 3FA5A 4EE9A 4CNUA 5D9MA 1H60A 2YL8A 1GKPA 2PD9A 4LYKA 3FKRA 4ILSA 2FDSA 1KFEA 3R13A 1RA5A 4RNHA 5LHFA 1GYLA 2XJ7A 3LPFA 3LB0A 3AMLA 3P67A 5IFPA 4RNJA 3WBAA 1HVXA 4U2YA 3PK7A 1SUXA 3L4UA 5TNVA 1H7WA 3PC0A 3TK7A 1W31A 2WHKA 3LPGA 2H3BA 4WXYA 3SRHA 1UPMB 4GQ0A 5E93A 3GNDA 4AD2A 1J0ZA 2DUZA 3BLDA 2D2JA 4QE5A 4Z42C 2XINA 3FEQA 1R85A 3INPA 4I7WA 4M6UA 3ZS4A 2YW4A 1IXQA 3W7JA 3UNDA 2Y61A 2GJPA 1QCWA 1TO3A 4ZO9A 1IIHA 2GDVA 4TR9A 4QROA 2YIHA 3SCUA 3U0HA 4HU4A 3URQA 2NVAA 3EOLA 3AYSA 5HNTA 4L1WA 2B31A 4W7VA 3WDHA 3PR2A 4TTUA 4HPGA 1WYIA 3SCQA 3KBVA 2C7FA 2X16A 3EOUA 5BU6A 3ZM8A 5BMXA 3O0KA 5I2UA 3R8RA 3UQNA 4C90A 1NQ6A 3U4FA 2WVTA 4AVFA 3VIKA 4PL2A 4XBKA 3STGA 5HQLA 1VFUA 5BCAA 3TW7A 1AH0A 2J75A 4MDOA 5HNNA 1L6WA 3TAKA 4ZBCA 4ACZB 4K39A 4P7NA 4PUUA 3SJNA 1OY0A 1BRLB 3IIVA 3QOMA 3EA1A 2HV5A 5A2AA 4X63A 3W7RA 4YNGA 2QKFA 1CLVA 2GQ9A 3CZEA 2V81A 1IEQA 2P50A 4PN2A 1IT7A 1TB3A 4RL3A 3N9KA 4JY9A 4C6KA 1HL2A 2J9YA 4IFKA 3D47A 3JS3A 4AZBA 1Z9AA 1ZFJA 4WHBA 5EY5A 2W4XA 1LQAA 3BMVA 1XPYA 4FZIA 4EPDC 1XHGA 1E9LA 1FHVA 1VFSA 1PV8A 1NTHA 4HPXA 1CWYA 4W5ZA 3S6DA 2HDJA 1SMAA 1VKFA 3LK6A 3AZTA 2F84A 1JEZA 3NM1A 4Z1DA 3F5KA 5AECA 3UWYA 4R3UA 5AC8A 3P5ZA 1GEQA 4HHMA 5A3HA 2FMNA 3MSRA 3GU9A 2FPTA 2X09A 4M0XA 4PR4A 3WQWA 1TPEA 4IHCA 3S9ZA 4JY8A 3DHPA 1GVOA 4UZSA 1DIOA 1ITUA 1I60A 4NX5A 1NAL1 1LT8A 4AIBA 3SURA 2ZWZA 4US6A 3VAVA 4LJ3A 3PJTA 3S6TA 3V75A 3V1PA 3VKCA 1E0WA 5LGZA 1MEWA 3QBUA 3RO8A 3VU2A 4LEQA 2W5FA 1KM4A 4ZO7A 4EP8C 4NRSA 1XLGA 1U5JA 1VH7A 3L4VA 3N1AA 1JUKA 3R43A 1HKMA 4D72A 3EMCA 4Y7EA 4L9YA 1NH6A 2DZXA 2XWEA 3WQEA 3G1RA 3QGKC 3HMCA 2WZMA 3MC5A 2A21A 1NARA 2GSHA 4O1BA 1VC4A 1V3MA 3TQPA 2FDMA 1XC6A 1EJTC 3SCTA 1DV7A 4NI3A 1B3YA 1IE7C 1XR2A 4JX4A 3N04A 1VEMA 3RPMA 4E2VA 5AZ0A 5HXMA 2Q3RA 4GX9A 5CXPA 4LCQA 2GGEA 1BYAA 1LT7A 4RZ6A 3VE9A 4I9MA 3R2GA 1AG1O 3TX9A 1P43A 1OZQA 3NURA 3RN6A 3SGZA 2AMXA 3C61A 5LXEA 1ONRA 2OB3A 1T96A 3W1LA 1IHIA 3D5HA 3UY7A 2UV8G 4C6QA 4C60A 2NV2A 4JZ5A 1C8XA 1V6VA 3U2EA 4KGJA 3N73A 4HHLA 4EWJA 3QR0A 2VP8A 1Y7VA 4R7WA 1EPVA 1VPXA 5CPQA 3U5YA 4DF1A 1OBAA 4PBFA 1K4GA 4DUWA 4JTTA 1QPKA 5D02A 1X1ZA 4HT3A 1EB3A 2EBNA 3O6CA 4PTXA 1OINA 4PSPA 5CPMA 5T9CE 1KBBA 1LQ0A 3M0IA 2HPMA 4LQ1A 4YVVA 4K36A 4O50A 1RBAA 2DUXA 2FZMA 4GIYA 4O4WA 3UWWA 4OIFA 2ZRVA 5CPOA 5I3JA 1XFCA 2V5BA 3IV3A 1DJZA 1REQA 3W83A 4H6RA 3WLRA 3GDRA 2OZ8A 2DZTA 3UG8A 3B03A 3RM4A 3MP3A 4AWEA 2GVEA 3C2VA 3P84A 3FFSA 2I1OA 1Z42A 1Z3NA 4GMEA 3W85A 1I8JA 4Q8MA 1VRDA 3ENLA 4O19A 4Q4QA 2HK1A 4UFIA 5DBUA 3CEPA 3QPZA 1W1IE 4I5UA 1GVFA 1WOAA 3BOXA 3FX4A 2WPBA 2Q8LA 4EWND 1GOOA 4F8XA 3LQLA 4OV4A 2VX5A 4J35A 1NOFA 4XD6A 4E38A 2E5CA 4G8TA 4DQWA 3EAUA 3CQKA 1R7AA 3OBAA 1CBGA 4HCHA 3VD4A 3RPDA 2FTYA 3HGOA 4L56A 4PCNA 4B91A 2ZX9A 1UR0A 3OODA 4ATDA 5E70A 1E6PA 2WZHA 5K4XA 1Y8BA 3AHZA 2UY5A 2V6AA 4NYYA 1TQJA 3WDIA 4MJ2A 1V03A 3MHGA 3WZ0E 3W38A 4L64A 4PRRA 1W3JA 3M0ZA 3MCMA 2J77A 2FZDA 1PPIA 3EX2A 1M5WA 5F4SA 1UWRA 4WSHA 3HTWA 3W1TA 1R9YA 3W1XA 4KT2A 2VGIA 1FXQA 4UQEA 4D6JA 1PIFA 4G5DA 5KMYA 3SUUA 2NQ5A 5XIAA 1ZP4A 2PODA 1F7BA 2ZOXA 3WH5A 3L12A 3TFXA 5BRQA 3AYTA 1ONWA 1CT5A 3LRMA 1UPPA 4CD4A 1YTEA 4D6CA 4ZB0A 4GYFA 2WCAA 3AIBA 3TZFA 1QPRA 2QXWA 5FKYA 4UWMA 3QSTA 4DXVA 4A3RA 1QI4A 4G1KA 3UZWA 4LS1A 2WBGA 4WKFA 2YXOA 1S5VA 3QC3A 4XO7A 3KOFA 3WUFA 4PUJA 2FVMA 2GJXA 3OIHA 2V2DA 2E77A 4AVNA 5CSUA 1ZJIA 3W7KA 3Q65A 4P2VA 4GYPC 6XIAA 1W9DM 3AWNA 4H8VA 4J2MA 4GQRA 1LLZA 1I75A 2QJJA 1B3XA 1T8XA 1HUVA 3LCXA 3IIPA 2Z1SA 3PSVA 2F2KA 1F61A 2IKGA 4FSAA 4Q6XA 2DT3A 1O66A 1B90A 4HNOA 2PDYA 3KS6A 1RK6A 3HF3A 1UD2A 1VRXA 3UWUA 1UZHA 1JDCA 4H83A 1W9XA 3FHQA 2IMRA 4IGSA 3OQ8A 3SRKA 4C1NB 5CAHA 3T0TA 4QLKA 1UROA 2EAWA 3HM7A 4FPSA 4J1OA 2W91A 4PMOA 1OADA 4JIPA 4XAPA 1FWJC 3KCLA 3GKAA 3R6IA 5LNWA 4JTLA 4GIAA 3T0AA 1ZBVA 3B4UA 3WENA 1NVMA 2INZA 3KHDA 4AD4A 3DHUA 3C2EA 1VBHA 3OQEA 4Z1CA 1V0KA 1VFOA 2OYLA 4ZSUA 1TE6A 4P7OA 4AIEA 3NGFA 4DYEA 3L66A 2E1DA 1K4HA 3UPBA 1QOPA 1ADDA 5HOSA 4GNKB 1KO0A 3FVMA 2IPJA 5LXXA 1AJ0A 1O6IA 3W73A 5JVLA 2GL5A 1EF2A 1TA3B 4ZEPA 4UBPC 4DBDA 2PD5A 4QITA 4QEHA 1A5UA 1H49A 2Y8UA 7TIMA 4AZ7A 4HSNA 2XYLA 1UWQA 3QR1A 4FF5A 4ZENA 3CZKA 1DHKA 1OCQA 3ZWSA 3TXZA 3ZJ6A 1TIMA 5HR7A 1PZ2A 5HAOA 4FNSA 2PUZA 3UESA 3IUDA 1S3TC 1TCDA 4QS6A 4F2BA 4FXSA 4LV4A 2P76A 3MI3A 1ZJAA 1H4PA 1K9FA 1P48A 3CQIA 3N15A 2D0FA 3W7DA 1EFZA 1H1YA 3SQSA 1V0LA 4UFKA 2WC7A 4XKYB 4HKPA 3EA3A 2P5NA 2ZXQA 4GH3A 4LB3A 1KLYA 4HN4A 1E6NA 2HRWA 1JD7A 1QW7A 1R3YA 1S39A 2WMIB 4UC5A 4RKAA 4IJBA 3VKKA 4F0KA 4IX0A 4NYUA 2ISSA 3P0WA 1G67A 1KRMA 4G7FA 2RFGA 4MB3A 1K02A 3TYUA 2C91A 3GVQA 1ISWA 3CPRA 3QMTA 1TKKA 1EX1A 4MJ4A 3YPIA 4Q4SA 3NDYA 2VGBA 5CGQA 2V3GA 4CKQA 4YXGA 3POHA 1AH4A 4IPPA 4JN7A 1E0VA 4S3KA 1WB0A 2ZZ4A 3TC3A 1W3KA 1NWTA 3NWRA 1LL4A 3VGEA 4AU0A 1LF1A 3ARPA 1FHLA 5CGTA 3LENA 3CH9A 2J7CA 4L1XA 2J7BA 3N19B 3V18A 5HJXA 1N7KA 3NQCA 1UR8A 1BAGA 4YN5A 4C65A 4DJDA 3NPWA 2Q6ZA 4J3SA 4B16A 3V7PA 2VRKA 3BVJA 4XV0A 3GHUA 1S5WA 4DWSC 1QNQA 2REQA 1QPQA 2BY1A 3VNLA 3N9RA 1B0IA 5D04C 5AZ1A 2JF6A 3H2MA 3MKKA 3C4UA 4JYFA 4B5SA 2PP3A 3DG6A 4AZIA 2QW5A 4H1ZA 3EOEA 3RLUA 4IIDA 5D2WA 3BCJA 1UW9A 4IG2B 4J3UA 5CPLA 1HT6A 5FIPA 2Q02A 3W81A 3TZNA 4IPJA 2A3AA 4AH7A 3N4EA 5AHEA 2OXNA 5DN1A 4MNLA 1YE6A 3LYEA 4ZMGA 5EMLA 3U7BA 4MM1A 1XLIA 3WD0A 1UC4A 1AUSL 4BI7A 3TMLA 5K9XA 1OJXA 1X98A 4K2SA 1AODA 4CCDA 1JZ4A 3A4XA 2CC0A 1XH2A 1UOZA 5EKYA 3VNMA 1V02E 1XXXA 1RHCA 5JUVA 1FTXA 3G1DA 1MMFA 5J5RA 2GQAA 4DO5A 3MTWA 1WUFA 3MJYA 3CZJA 7CGTA 1ZUAX 4EX4A 4F0HA 2YJQA 1R38A 4AF0A 1K8XA 2C18A 2INEA 3KX6A 2ZVRA 4EF8A 1F76A 1IR2A 3ZLFA 2QCDB 4PB4A 3ZT7A 4H4IA 1TJRA 2RGLA 4AHQA 4LYPA 3G8EA 4GQBA 4A6GA 3VKAA 3DEQA 3H2AA 4F0LA 3CASA 2XTKA 5ABGA 1DJNA 4QXIA 1VIWA 3AMKA 4ICCX 4LB4A 3URBA 7XIMA 4JICA 2DJXA 2AKZA 3B8TA 4HA4A 3AICA 6ENLA 1M9HA 1HZYA 3TDFA 1TPVA 2VR4A 3M43A 4HU0A 2C15A 4ZQOA 2OQLA 3OJGA 5GNYA 4QX4A 3DI0A 3UXKA 1OF6A 3HJZA 3KZPA 3LM3A 3P2VA 4KWWA 3P80A 2WW5A 4WDUA 2PLJA 2Z1WA 1XM3A 3NQ8A 2F6KA 3I4KA 1EH9A 3C2OA 4CCCA 2PBOA 3B9EA 1GJUA 1I2QA 3SRFA 2ZXBA 1FKXA 2X7WA 3UR5A 3V3WA 4AX7A 3O1NA 4WRHA 3PZUA 4DWDA 3LHTA 2WHMA 1SJAA 1OX5A 2GJLA 1Q45A 1EEXA 5D09A 4LUTA 2OZ0A 3GU1A 5REQB 3W22A 2V30A 3W76A 3W37A 3AYVA 3I4EA 1QOXA 2A6NA 3ARUA 4S39A 5D38A 1Z6KA 3V0UA 3FLUA 3ZXWA 2PU1A 5C70A 3UG5A 3PHAA 2PC8A 4CQDA 3NFUA 4CNPA 3QN3A 3A3XA 1SR9A 4ZOCA 4D71A 3NA8A 3AI0A 2GWGA 4PMQA 4IP5A 1W1A1 2VI0A 1YXYA 3E02A 3PNUA 1H62A 4NZ3A 1CECA 1OABA 1NDYA 2PA6A 5D37A 4J40A 2YLLA 3HPFA 4LALA 1TUFA 4MUZA 2D0GA 1KRCC 2G3MA 5D8WA 5FJJA 3PZOA 4OQVA 5HMDA 1I45A 1UD8A 4URIA 3T2PA 3QKEA 4RNFA 3LHUA 3HQOA 3IGHX 1W9UA 3GXMA 4UFHA 4WY0F 4WXZA 3F5LA 2QV4A 4K37A 2R1NA 3AS2A 4P8VA 2WMFA 1ISXA 3UCQA 3QPYA 2DQXA 3LZ3A 1CIUA 5BMWA 2DZVA 4O15A 2YB1A 1ZJHA 4KW2A 1WP6A 3HB9A 3AMGA 2XVLA 3T6CA 3OPSA 2CZEA 2DZPA 1X96A 3W0KA 2H9AB 4NX0A 3NZPA 1DJHA 3R1ZA 2BTMA 3BXWA 1O5QA 3VFLA 3QW3A 3S2MA 5LNUA 1YDOA 2P8BA 4RZBA 5CBJA 3IAQA 3OGRA 2XIQA 1WXJA 4JNZA 3N12A 3OU8A 1UJPA 1N8WA 4WJ8A 1WNOA 1XYBA 3KVJA 2HXUA 3THAA 1JL8A 4GUFA 1UP2A 3G1HA 4QDPA 1B9BA 1TTPA 2A7PA 4I5RA 2NSOA 4JDBA 4XZNX 2G3NA 1MO0A 2B7NA 4FXRA 3WF4A 2FHBA 2QLYA 1XS2A 2XVPA 1O5RA 1VF8A 1EP3A 4WDTA 1SZGA 3F2CA 2WSQA 1LUCA 4R5EA 4B92A 3F7JA 4ICNA 1JCLA 2ESCA 1IEVA 3HU7A 2YBUA 4E2DA 2Z1XA 4KRTA 3AIUA 1JI2A 3M0XA 1LDCA 3CLMA 2I5IA 1KFKA 3WJSA 2EG6A 4ONVA 1EYEA 2YBTA 1IZKA 3CQ0A 3TMQA 1ODUA 5CZTA 1XIMA 3C6CA 2P10A 3VABA 4AD3A 1F9CA 3KBSA 3PUOA 3DC0A 3WLNA 2VDHA 3I3DA 4JIRA 3DBPA 1Q6EA 2E6AA 1F6PA 4LF2A 5IDZA 1YE4A 1C9DA 4J7RA 5EBAA 3MU7A 3C3UA 3ARZA 3E0LA 3I6TA 4GOAA 2V5KA 2HROA 1D3HA 4YS1A 3U6WA 3PJWA 4NG3A 4P7RA 4FI4A 1K7FA 1XYFA 1XSKA 1SZEA 2P1FA 3WMBA 4C6CA 1XIGA 2TPSA 4ZTXA 3FKKA 2IXUA 1MQRA 3BMXA 3H4WA 3WKZA 4JBRA 1WZLA 4KEZA 1WKFA 3BTNA 4HNCA 3K4WA 4S1FA 3SZ8A 1VFMA 2VEKA 3STFA 1QMLA 3NGJA 3U9IA 4YTQA 3BG9A 5C55A 1PX4A 5A8MA 3NSMA 3HPSA 3VMOA 1OFBA 4PEEA 3RPTA 3ZMRA 2QUUA 1QNOA 1Z44A 1F3EA 2ZZ2A 2BFGA 4POCA 1NDWA 4JCMA 3APTA 4Q4KA 3LSCA 3RIKA 4HSHA 1S2CA 3M6DA 4UNIA 1EIBA 3A23A 3M5ZA 3UZZA 4ZR8A 3WN6A 4W84A 3EMZA 3TYBA 2RDTA 1ADOA 4ZFCA 1MEHA 1UR4A 3QJAA 4U5IA 2PDBA 4S3FA 1YHTA 4IP7A 3M0MA 3NG3A 4X2PA 4DO4A 3E0VA 2CLIA 3NEVA 1RLDA 3PWGA 1CI1A 2E28A 1V5XA 3J7HA 5ENLA 3IGSA 3O8AA 1KC7A 4DF2A 2XN1A 1IWBA 4IZGA 3V4BA 3ABXA 1MFVA 1TVNA 1B2YA 3RMEA 1QPOA 3RCMA 5U4NA 3MUY1 3BJSA 3PVFA 2YXXA 2AQOA 1IEXA 4TMBA 4C6DA 3WUBA 2DPEA 1MVYA 4L4PA 4OJYA 3AISA 4LAUA 4EPBC 5LNVA 5FSDC 3W01A 3TTQA 3W29A 1V3HA 5AOUA 4KH2A 4HK6A 4TX9A 3KDOA 2NV1A 3PZGA 2QNEA 2C19A 4S23A 4AMAA 3VIHA 1VB9A 2I9UA 4CD5A 5FSEC 1M1BA 1S38A 2V69A 3N4AA 1FWHC 3O6AA 4HOWA 5HJLA 4JTAA 2J7GA 3WD4A 1Q8JA 4U31A 4YL2A 3S5ZA 4FK9A 1TPC1 4PTNA 1J0HA 4QBXA 1Q2SA 3PN8A 3WF2A 3DUGA 1O12A 1ESWA 1KW1A 3BOLA 4UTMA 5AVNA 3MKCA 2Z2BA 4AVOA 3T1GA 3M07A 1KFCA 1KQYA 1GZGA 3GW3A 2J7HA 1FWRA 2BASA 2ZXDA 1AW1A 3PS7A 1W5QA 2VELA 2DJLA 1KM6A 1LZOA 3AFBA 1R3RA 4FX7A 1H7NA 1TPFA 3QQWA 4US5D 3BJTA 3EWXA 3DYMA 5AHIA 3CM4A 4KETA 2J66A 3CWNA 1S5TA 2TRSA 2YL6A 3C56A 3KTXA 4IUOA 1F6YA 3W27A 1EF3A 1XRVA 1V3IA 4GRSA 3FAXA 5DT7A 1YX1A 3R8GA 2FTPA 2RGMA 4K1GA 1HF6A 4CQCA 1TTJA 4CU7A 3DFOA 3VD9A 3RJYA 1FA2A 3DHDA 4H19A 5G2HA 3DN5A 2ACRA 3K8LA 1LP6A 3NEHA 4QQUA 3AIRA 2BWGA 3MMWA 3KRUA 3ZVHB 1CYGA 2Z1BA 4JEQA 3L2MA 2D22A 3SGUA 3NQ2A 3D3FA 1VHNA 4NASA 1DL3A 4Q3MA 3SSZA 4PFHA 4KCVA 2VQTA 2GGGA 1E73M 3ELFA 1AFSA 1XQLA 4ZCWA 1H51A 3CUFA 3W23A 3F5JA 4R7JA 3TC6A 1QI0A 3E6EA 3RU8X 2WB5A 2Y7DA 3LRKA 3EEZA 3UBPC 5T91A 1DJGA 4NAFB 1ZZMA 4CNSA 2VX4A 1JFHA 2A0NA 4WD0A 2BS9A 4LY8A 3N2CA 3R0DA 1JI1A 3N17A 2PWUA 1NEYA 5KSWA 4OGZA 1MXSA 1WDSA 4ORMA 5CH9A 4MF4A 1C91A 4C6IA 1RCXB 1HKIA 4QCFA 5DCEA 1E43A 4AIOA 1IT8A 3SUSA 2W0UA 1Q3NA 1PYMA 4FNQA 2V5LA 1ZTVA 1XX1A 4PL1A 4B3KA 3NOEA 5BXSA 2HS8A 3CXOA 1A4MA 4N9BA 4C1KA 2YOCA 3CLWA 1JCNA 4LYQA 3MCOA 2PI6A 1SZFA 4X9SA 1BSIA 1TELA 4UMAA 3ZR4A 3VILA 1LLWA 4N02A 4RE3A 2WJEA 4QR6A 4QAWA 1FOBA 3WLHA 4QEEA 3RLGA 2A1YA 1EWDA 4JTEA 2QUTA 3IRDA 2WLZA 3GB6A 4DRSA 2XFFA 3ITOA 1GEHA 2QV5A 1JZ3A 3ES8A 1AD1A 5K4ZA 3H12A 2NT0A 1E0XA 4JNYA 3RJXA 3W7NA 5LIUX 2EPOA 1F3XA 2C8NA 5IM51 3B8UA 4ZVJA 2HXTA 1K3UA 3HG5A 3LTSA 4IPNB 3QFWA 4ZFMA 5F4XA 1V6UA 3I6EA 2PGWA 4DLFA 2BOGX 4O17A 4C5ZA 3ZIZA 4JS3A 4Q7NA 3N18A 3NO1A 3W72A 2WCGA 2JE8A 1SFSA 5F2IA 3M16A 3S5NA 1V7YA 1CXKA 4PMDA 1OEPA 1OHLA 3TV8A 1MNZA 4NJKA 4YWSA 3RNDA 4CQ8A 4CQBA 2PEVA 1T5AA 4MB4A 3GG8A 2Y5SA 3CIWA 1R9XA 1OK6A 4NZ1A 2PGRA 3DH7A 4GK8A 4MZ1A 4F0SA 4MKVA 3NPVA 3N3MA 2A79A 1D2KA 3LCGA 4XO6A 3U3HA 2GVJA 3SAZA 4YYFA 1RCQA 4H2CA 3NZRA 3FJ4A 3G1YA 1MYRA 2OEJA 3BSMA 2DV0A 1L6GA 2VWSA 5DMNA 2QUVA 5FF3A 5CQ1A 3VX0A 1C8VA 3W7CA 4D1JA 1HVQA 2G97A 3G3DA 2VURA 4DWSB 4QJ5B 2Q8ZA 3K1GA 1AMKA 1CGYA 1RY8A 1XLKA 4YIWA 1KXVA 2DW7A 4TVCA 4HOXA 3BE7A 4AUBA 5JBFA 3PBUA