2CJ7A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.0)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
147
structure length
144
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 65
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj7A00
1RJ1A 2CJ6A 1XG2B 2CJ4A 2CJ8A 2CJ7A 1X91A 1RJ4A 2XQRB 1X90A 2CJ5A 1X8ZA
chains in the Genus database with same CATH superfamily
2Q8FA 1RP3A 1GKXA 4KTOA 1XFXA 1IS2A 1K93A 2OEXA 3M9VA 3TZ5A 1SK6A 1UDYA 2EBAA 3SCEA 1BUCA 1QDBA 2YYGA 2EBFX 3F29A 1UKWA 3KMLA 2RDZA 3GQTA 5GJVE 3CRLA 1EGCA 2R05A 5K3JA 2FP1A 2EBHX 1S26A 3D1IA 4L1FA 2VF1A 4P79A 5K3GA 1SIRA 5J6AA 5K3IA 4JIZA 3C3LA 4L3ZA 4Q17A 4FF1A 2YGWA 1GKZA 3AFEA 4MPEA 2YYJA 2HJNA 2PNRA 2IX6A 2C0UA 2VIGA 3N0RA 3B96A 3OWAA 4L38A 1RJ1A 4MPCA 2OT4A 5BRMA 5BRKA 2DDHA 1GU6A 4QICA 1XFZA 2BU7A 4H85A 3TORA 4ZYJA 4V25A 1IVHA 3P4TA 2BU6A 4HKRA 5B5WA 1XG2B 5J71A 2ZKJA 3D9DA 3TZ2A 4OO2A 2OJQA 2QR4A 2JBSA 3EONA 3FO3A 4Q4UA 3HWCA 4DZYA 2C12A 3UU9A 1XFYA 1Y8OA 3MDDA 1R2JA 1GJVA 3D6BA 2REHA 5M4NA 1XFWA 3BNGA 2VR0A 4AKHA 2UXWA 2JIFA 3C46A 2E0AA 4L3YA 3PFDA 4MP7A 3TZ4A 3X0XA 2R03A 5M4PA 3S7WA 2CJ4A 2E80A 3UBRA 4FF2A 2CJ7A 4G97A 2Q8GA 1PI1A 4ZXVA 3X0YA 5K3HA 3LG1A 3VKHA 3Q23A 3BNHA 5B6BA 4FF3A 4IV6A 4WJYA 4KSAA 4E02A 2ZO5A 3OWMA 1XFVA 4H7QA 4M9AA 3TZ0A 5B5VA 3MPIA 3GM6A 4FZ4A 4U83A 4MP2A 3II9A 3D9GA 4LQQB 2CX9A 4J1VA 2EC5A 4LQSB 1R3BA 1Y8NA 3MXLA 1XFUA 4AI6A 3OIBA 3TTBA 3BNFA 2LFWA 4JEKA 2R0NA 2RFQA 2YYIA 2CJ6A 2BU5A 2R0MA 3SXQA 4H81A 4IRNA 3SWOA 2BU8A 4NXLA 4Q1OA 1RJ4A 2BU2A 4RM7A 2Q8IA 4KSFA 4V26A 3MPJA 4W9UA 1OAHA 4FF4A 2RF7A 1RX0A 1X91A 4DOYA 2R02A 2BTZA 2AZEA 2CJ5A 4F0XA 3Q22A 2PO4A 1K8TA 2J7AA 4G5EA 2Q8HA 1SC5A 1Y8PA 2OR0A 4AKGA 3AFFA 1JQIA 2AO2A 3C2PA 3CE2A 4E00A 1X90A 3MDEA 4Q5CA 1EGEA 2JBTA 4HKSA 2IX5A 3R7KA 3VKGA 2E81A 1FS8A 2YYMA 2OEVA 3FCJA 3NF4A 1Y0VA 4MPNA 2FONA 1EGDA 2ZAFA 3MMOA 3D2RA 1SIQA 4X28A 5GJWE 1X8ZA 4L3XA 2YYLA 3GNCA 3LGQA 1K90A 1WS9A 2CJ8A 3D9EA 4HR3A 2PG0A 4P13A 4Q5BA 4AKIA 3MKHA 2GBBA 4KS9A 5M4MA 2YYKA 2ZDXA 3L1TA 1LVCA 2D29A 2FP2A 2ZDYA 2A1TA 1PK0A 3CRKA 4JIOA 3X29A 3Q24A 3SF6A 3BNJA 1FS9A 3Q0AA 5M4KA 1JM6A 3D9FA 2WBIA 4XVXA 1T9GA 3RKHA 2XS8A 1W07A 4KCFA 4Q0TA 2JBRA 2F6LA 4E01A 2DVLA 1FS7A 4X28C 2XQRB 4N5FA 2Z1QA 3VADA 1U8VA 2XS1A 3EOMA 4O5MA
chains in the Genus database with same CATH topology
1RJ1A 2CJ6A 1XG2B 2CJ4A 2CJ8A 2CJ7A 1X91A 1RJ4A 2XQRB 1X90A 2CJ5A 1X8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJ1 A;  2CJ6 A;  1XG2 B;  2CJ4 A;  2CJ8 A;  2CJ7 A;  1X91 A;  1RJ4 A;  2XQR B;  1X90 A;  2CJ5 A;  1X8Z A; 
#chains in the Genus database with same CATH topology
 2Q8F A;  1RP3 A;  1GKX A;  4KTO A;  1XFX A;  1IS2 A;  1K93 A;  2OEX A;  3M9V A;  3TZ5 A;  1SK6 A;  1UDY A;  2EBA A;  3SCE A;  1BUC A;  1QDB A;  2YYG A;  2EBF X;  3F29 A;  1UKW A;  3KML A;  2RDZ A;  3GQT A;  5GJV E;  3CRL A;  1EGC A;  2R05 A;  5K3J A;  2FP1 A;  2EBH X;  1S26 A;  3D1I A;  4L1F A;  2VF1 A;  4P79 A;  5K3G A;  1SIR A;  5J6A A;  5K3I A;  4JIZ A;  3C3L A;  4L3Z A;  4Q17 A;  4FF1 A;  2YGW A;  1GKZ A;  3AFE A;  4MPE A;  2YYJ A;  2HJN A;  2PNR A;  2IX6 A;  2C0U A;  2VIG A;  3N0R A;  3B96 A;  3OWA A;  4L38 A;  1RJ1 A;  4MPC A;  2OT4 A;  5BRM A;  5BRK A;  2DDH A;  1GU6 A;  4QIC A;  1XFZ A;  2BU7 A;  4H85 A;  3TOR A;  4ZYJ A;  4V25 A;  1IVH A;  3P4T A;  2BU6 A;  4HKR A;  5B5W A;  1XG2 B;  5J71 A;  2ZKJ A;  3D9D A;  3TZ2 A;  4OO2 A;  2OJQ A;  2QR4 A;  2JBS A;  3EON A;  3FO3 A;  4Q4U A;  3HWC A;  4DZY A;  2C12 A;  3UU9 A;  1XFY A;  1Y8O A;  3MDD A;  1R2J A;  1GJV A;  3D6B A;  2REH A;  5M4N A;  1XFW A;  3BNG A;  2VR0 A;  4AKH A;  2UXW A;  2JIF A;  3C46 A;  2E0A A;  4L3Y A;  3PFD A;  4MP7 A;  3TZ4 A;  3X0X A;  2R03 A;  5M4P A;  3S7W A;  2CJ4 A;  2E80 A;  3UBR A;  4FF2 A;  2CJ7 A;  4G97 A;  2Q8G A;  1PI1 A;  4ZXV A;  3X0Y A;  5K3H A;  3LG1 A;  3VKH A;  3Q23 A;  3BNH A;  5B6B A;  4FF3 A;  4IV6 A;  4WJY A;  4KSA A;  4E02 A;  2ZO5 A;  3OWM A;  1XFV A;  4H7Q A;  4M9A A;  3TZ0 A;  5B5V A;  3MPI A;  3GM6 A;  4FZ4 A;  4U83 A;  4MP2 A;  3II9 A;  3D9G A;  4LQQ B;  2CX9 A;  4J1V A;  2EC5 A;  4LQS B;  1R3B A;  1Y8N A;  3MXL A;  1XFU A;  4AI6 A;  3OIB A;  3TTB A;  3BNF A;  2LFW A;  4JEK A;  2R0N A;  2RFQ A;  2YYI A;  2CJ6 A;  2BU5 A;  2R0M A;  3SXQ A;  4H81 A;  4IRN A;  3SWO A;  2BU8 A;  4NXL A;  4Q1O A;  1RJ4 A;  2BU2 A;  4RM7 A;  2Q8I A;  4KSF A;  4V26 A;  3MPJ A;  4W9U A;  1OAH A;  4FF4 A;  2RF7 A;  1RX0 A;  1X91 A;  4DOY A;  2R02 A;  2BTZ A;  2AZE A;  2CJ5 A;  4F0X A;  3Q22 A;  2PO4 A;  1K8T A;  2J7A A;  4G5E A;  2Q8H A;  1SC5 A;  1Y8P A;  2OR0 A;  4AKG A;  3AFF A;  1JQI A;  2AO2 A;  3C2P A;  3CE2 A;  4E00 A;  1X90 A;  3MDE A;  4Q5C A;  1EGE A;  2JBT A;  4HKS A;  2IX5 A;  3R7K A;  3VKG A;  2E81 A;  1FS8 A;  2YYM A;  2OEV A;  3FCJ A;  3NF4 A;  1Y0V A;  4MPN A;  2FON A;  1EGD A;  2ZAF A;  3MMO A;  3D2R A;  1SIQ A;  4X28 A;  5GJW E;  1X8Z A;  4L3X A;  2YYL A;  3GNC A;  3LGQ A;  1K90 A;  1WS9 A;  2CJ8 A;  3D9E A;  4HR3 A;  2PG0 A;  4P13 A;  4Q5B A;  4AKI A;  3MKH A;  2GBB A;  4KS9 A;  5M4M A;  2YYK A;  2ZDX A;  3L1T A;  1LVC A;  2D29 A;  2FP2 A;  2ZDY A;  2A1T A;  1PK0 A;  3CRK A;  4JIO A;  3X29 A;  3Q24 A;  3SF6 A;  3BNJ A;  1FS9 A;  3Q0A A;  5M4K A;  1JM6 A;  3D9F A;  2WBI A;  4XVX A;  1T9G A;  3RKH A;  2XS8 A;  1W07 A;  4KCF A;  4Q0T A;  2JBR A;  2F6L A;  4E01 A;  2DVL A;  1FS7 A;  4X28 C;  2XQR B;  4N5F A;  2Z1Q A;  3VAD A;  1U8V A;  2XS1 A;  3EOM A;  4O5M A; 
#chains in the Genus database with same CATH homology
 1RJ1 A;  2CJ6 A;  1XG2 B;  2CJ4 A;  2CJ8 A;  2CJ7 A;  1X91 A;  1RJ4 A;  2XQR B;  1X90 A;  2CJ5 A;  1X8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...