2CJ7A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.0)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
147
structure length
144
Chain Sequence
b'NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKSPFSALNIAVHELSDVGRAIVRNLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 65
structure length 144
sequence length 147
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj7A00
2CJ4A 1RJ4A 2CJ8A 2XQRB 1X91A 1X8ZA 2CJ6A 1XG2B 1X90A 2CJ7A 2CJ5A 1RJ1A
chains in the Genus database with same CATH superfamily
2ZKJA 4Q0TA 1PK0A 4E01A 5BRKA 1S26A 4LQSB 3SXQA 4O5MA 1JM6A 2RF7A 1Y8OA 3D9DA 3Q0AA 2OR0A 2C12A 4RM7A 1K8TA 2JBRA 1IVHA 1BUCA 2YYIA 4XVXA 1GKXA 3TZ0A 2VR0A 3BNGA 4H81A 5K3HA 2AZEA 3MMOA 4L3XA 4KS9A 3D9FA 2UXWA 3GNCA 3SCEA 4E00A 5J6AA 2E0AA 2FONA 4HKSA 2DDHA 3Q24A 2F6LA 3UBRA 3MXLA 4Q17A 1RJ4A 3M9VA 2BU7A 4FF3A 4AI6A 3N0RA 2RFQA 3C2PA 3AFFA 3PFDA 4WJYA 4W9UA 1OAHA 3MKHA 4H85A 3UU9A 2E81A 4L1FA 4U83A 1RP3A 3MDDA 2ZDYA 4KCFA 3CRLA 4MPEA 1EGDA 5BRMA 3TZ4A 2EBFX 4FF1A 4P13A 2Q8HA 3RKHA 2R0NA 1XFZA 1R3BA 1JQIA 2RDZA 2PO4A 3OWAA 4Q5BA 3VADA 1K90A 3Q23A 1IS2A 2IX6A 2OJQA 5J71A 3VKHA 3X29A 2CJ6A 4MP2A 1X90A 4NXLA 2CJ5A 2XS1A 3FCJA 2YYMA 2PG0A 2C0UA 2IX5A 1FS9A 2OEXA 4DZYA 1X91A 5K3IA 5M4PA 2JBSA 2BU6A 2E80A 4N5FA 1XFYA 1UKWA 3D9GA 2VF1A 2JBTA 1U8VA 3HWCA 2OT4A 5B6BA 3X0XA 3TTBA 2REHA 2J7AA 3F29A 3OIBA 4JIOA 4MP7A 2HJNA 3TORA 4L3ZA 3CRKA 2R02A 4KSAA 1UDYA 1R2JA 3C3LA 3SWOA 2CJ4A 2VIGA 1Y8PA 5M4KA 1Y8NA 3KMLA 2Q8FA 1X8ZA 3NF4A 3R7KA 2BU2A 2ZAFA 4X28C 3D2RA 4JIZA 4P79A 4Q5CA 3TZ5A 2WBIA 2R03A 2GBBA 4FZ4A 1LVCA 2D29A 2LFWA 4Q4UA 2YYKA 4L38A 3S7WA 5M4NA 2FP1A 2DVLA 1EGEA 2CJ7A 2PNRA 1RJ1A 4M9AA 5M4MA 4V26A 1SK6A 3LGQA 1EGCA 2BU8A 3SF6A 1T9GA 2EBHX 4G5EA 2R0MA 4MPNA 3LG1A 1FS8A 4L3YA 1RX0A 2A1TA 3MDEA 1SIRA 3BNFA 5GJWE 2FP2A 4HKRA 4HR3A 3BNJA 1XFWA 2YYGA 2Z1QA 3EONA 1SIQA 4IRNA 1XFVA 3VKGA 4E02A 2CX9A 3FO3A 5B5WA 3D1IA 3X0YA 2Q8GA 5K3GA 1W07A 4H7QA 5GJVE 1SC5A 1PI1A 1GJVA 1XFUA 2OEVA 2ZDXA 3AFEA 3BNHA 3GM6A 4KSFA 3EOMA 5K3JA 2EC5A 1GU6A 2Q8IA 2YGWA 1Y0VA 1QDBA 3MPIA 3P4TA 2XS8A 4ZYJA 3L1TA 4Q1OA 1XFXA 5B5VA 1GKZA 4X28A 4AKHA 4JEKA 3TZ2A 3D9EA 2BU5A 2CJ8A 4G97A 4AKIA 3MPJA 4IV6A 2AO2A 3OWMA 1XG2B 2R05A 2EBAA 4KTOA 4F0XA 1WS9A 4FF4A 2ZO5A 2JIFA 4AKGA 3GQTA 1FS7A 4OO2A 3C46A 2XQRB 2YYJA 3CE2A 2QR4A 3II9A 4QICA 1K93A 2BTZA 3B96A 4MPCA 3Q22A 4FF2A 4ZXVA 4LQQB 4V25A 4J1VA 2YYLA 4DOYA 3D6BA
chains in the Genus database with same CATH topology
2CJ4A 1RJ4A 2CJ8A 2XQRB 1X91A 1X8ZA 2CJ6A 1XG2B 1X90A 2CJ7A 2CJ5A 1RJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ4 A;  1RJ4 A;  2CJ8 A;  2XQR B;  1X91 A;  1X8Z A;  2CJ6 A;  1XG2 B;  1X90 A;  2CJ7 A;  2CJ5 A;  1RJ1 A; 
#chains in the Genus database with same CATH topology
 2ZKJ A;  4Q0T A;  1PK0 A;  4E01 A;  5BRK A;  1S26 A;  4LQS B;  3SXQ A;  4O5M A;  1JM6 A;  2RF7 A;  1Y8O A;  3D9D A;  3Q0A A;  2OR0 A;  2C12 A;  4RM7 A;  1K8T A;  2JBR A;  1IVH A;  1BUC A;  2YYI A;  4XVX A;  1GKX A;  3TZ0 A;  2VR0 A;  3BNG A;  4H81 A;  5K3H A;  2AZE A;  3MMO A;  4L3X A;  4KS9 A;  3D9F A;  2UXW A;  3GNC A;  3SCE A;  4E00 A;  5J6A A;  2E0A A;  2FON A;  4HKS A;  2DDH A;  3Q24 A;  2F6L A;  3UBR A;  3MXL A;  4Q17 A;  1RJ4 A;  3M9V A;  2BU7 A;  4FF3 A;  4AI6 A;  3N0R A;  2RFQ A;  3C2P A;  3AFF A;  3PFD A;  4WJY A;  4W9U A;  1OAH A;  3MKH A;  4H85 A;  3UU9 A;  2E81 A;  4L1F A;  4U83 A;  1RP3 A;  3MDD A;  2ZDY A;  4KCF A;  3CRL A;  4MPE A;  1EGD A;  5BRM A;  3TZ4 A;  2EBF X;  4FF1 A;  4P13 A;  2Q8H A;  3RKH A;  2R0N A;  1XFZ A;  1R3B A;  1JQI A;  2RDZ A;  2PO4 A;  3OWA A;  4Q5B A;  3VAD A;  1K90 A;  3Q23 A;  1IS2 A;  2IX6 A;  2OJQ A;  5J71 A;  3VKH A;  3X29 A;  2CJ6 A;  4MP2 A;  1X90 A;  4NXL A;  2CJ5 A;  2XS1 A;  3FCJ A;  2YYM A;  2PG0 A;  2C0U A;  2IX5 A;  1FS9 A;  2OEX A;  4DZY A;  1X91 A;  5K3I A;  5M4P A;  2JBS A;  2BU6 A;  2E80 A;  4N5F A;  1XFY A;  1UKW A;  3D9G A;  2VF1 A;  2JBT A;  1U8V A;  3HWC A;  2OT4 A;  5B6B A;  3X0X A;  3TTB A;  2REH A;  2J7A A;  3F29 A;  3OIB A;  4JIO A;  4MP7 A;  2HJN A;  3TOR A;  4L3Z A;  3CRK A;  2R02 A;  4KSA A;  1UDY A;  1R2J A;  3C3L A;  3SWO A;  2CJ4 A;  2VIG A;  1Y8P A;  5M4K A;  1Y8N A;  3KML A;  2Q8F A;  1X8Z A;  3NF4 A;  3R7K A;  2BU2 A;  2ZAF A;  4X28 C;  3D2R A;  4JIZ A;  4P79 A;  4Q5C A;  3TZ5 A;  2WBI A;  2R03 A;  2GBB A;  4FZ4 A;  1LVC A;  2D29 A;  2LFW A;  4Q4U A;  2YYK A;  4L38 A;  3S7W A;  5M4N A;  2FP1 A;  2DVL A;  1EGE A;  2CJ7 A;  2PNR A;  1RJ1 A;  4M9A A;  5M4M A;  4V26 A;  1SK6 A;  3LGQ A;  1EGC A;  2BU8 A;  3SF6 A;  1T9G A;  2EBH X;  4G5E A;  2R0M A;  4MPN A;  3LG1 A;  1FS8 A;  4L3Y A;  1RX0 A;  2A1T A;  3MDE A;  1SIR A;  3BNF A;  5GJW E;  2FP2 A;  4HKR A;  4HR3 A;  3BNJ A;  1XFW A;  2YYG A;  2Z1Q A;  3EON A;  1SIQ A;  4IRN A;  1XFV A;  3VKG A;  4E02 A;  2CX9 A;  3FO3 A;  5B5W A;  3D1I A;  3X0Y A;  2Q8G A;  5K3G A;  1W07 A;  4H7Q A;  5GJV E;  1SC5 A;  1PI1 A;  1GJV A;  1XFU A;  2OEV A;  2ZDX A;  3AFE A;  3BNH A;  3GM6 A;  4KSF A;  3EOM A;  5K3J A;  2EC5 A;  1GU6 A;  2Q8I A;  2YGW A;  1Y0V A;  1QDB A;  3MPI A;  3P4T A;  2XS8 A;  4ZYJ A;  3L1T A;  4Q1O A;  1XFX A;  5B5V A;  1GKZ A;  4X28 A;  4AKH A;  4JEK A;  3TZ2 A;  3D9E A;  2BU5 A;  2CJ8 A;  4G97 A;  4AKI A;  3MPJ A;  4IV6 A;  2AO2 A;  3OWM A;  1XG2 B;  2R05 A;  2EBA A;  4KTO A;  4F0X A;  1WS9 A;  4FF4 A;  2ZO5 A;  2JIF A;  4AKG A;  3GQT A;  1FS7 A;  4OO2 A;  3C46 A;  2XQR B;  2YYJ A;  3CE2 A;  2QR4 A;  3II9 A;  4QIC A;  1K93 A;  2BTZ A;  3B96 A;  4MPC A;  3Q22 A;  4FF2 A;  4ZXV A;  4LQQ B;  4V25 A;  4J1V A;  2YYL A;  4DOY A;  3D6B A; 
#chains in the Genus database with same CATH homology
 2CJ4 A;  1RJ4 A;  2CJ8 A;  2XQR B;  1X91 A;  1X8Z A;  2CJ6 A;  1XG2 B;  1X90 A;  2CJ7 A;  2CJ5 A;  1RJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...