2CJMB

Mechanism of cdk inhibition by active site phosphorylation: cdk2 y15p t160p in complex with cyclin a structure
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title How Tyrosine 15 Phosphorylation Inhibits the Activity of Cyclin-Dependent Kinase 2-Cyclin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 95
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cjmB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cjmB02
3QHRB 5BNJB 4G6LB 3MY5B 1N4MA 5HBEB 1FVVB 1UNHD 1OKVB 4Y72B 2UZEB 2C5NB 2R7GA 4YC3B 4CFXB 1PKDB 4OR5B 1QMZB 3EJ1B 1D3UB 1JSUB 2WHBB 3TN8B 4BCND 2WPAB 4BCMB 4BCGB 5EFQB 1F5QB 2W96A 5CEIB 2C5XB 2CCIB 4EOSB 3DDQB 2B9RA 2IVXA 2UZDB 1H26B 3BLHB 3POMA 5IF1B 4CFWB 2PK9B 1G3NC 4CFMB 4F7JB 2BPMB 2PHGA 2F2CA 4CFVB 2V22B 1URCB 5HNBB 1AD6A 1H1QB 1JOWA 1VINA 1KXUA 4BCQB 1H24B 3BLRB 2BKZB 4EOIB 4EONB 5LMKB 2UZBB 4EORB 2WXVB 5HVYB 1OIYB 4CFNB 4KRDB 1H4LD 4BCHB 4F6SB 5L2WB 4EOLB 3G33B 1VOLA 4EC9B 1H27B 3EOCB 1OGUB 1ZP2A 4ELJA 1GUXA 1OIUB 2IW9B 2EUFA 4EOOB 4BCJB 2C6TB 3TNHB 1GH6B 3H4CA 2WMAB 3M03A 4F7LB 1JSTB 2C4GB 4F70B 2X1NB 1O9KA 4F7SB 3RGFB 3BLQB 4CXAB 4F6UB 5HBHB 1OI9B 2WEVB 2I53A 1OL1B 4ELLA 4BCNB 4BCPB 1P5EB 4YOOA 1TFBA 2WIPB 3F5XB 2WMBB 5HBJB 3BHTB 4KRCB 2G9XB 3TNIB 4RODA 2W2HA 2IW8B 2IW6B 1H1SB 1VYWB 5I5ZB 2PK2A 3QHWB 4TTHA 1H1PB 5HQ0B 2UZLB 4BCIB 2QDJA 4BCFB 4CRLB 4ROCA 4IMYB 4UN0A 1UNLD 3MIAB 5IDPB 1E9HB 3MY1B 4CFUD 4FX3B 1H28B 2I40B 2WFYB 4BCOB 4I3ZB 5ACBA 1AISB 3DOGB 2C5OB 4EOMB 3BHUB 4OGRB 4YOSA 3MI9B 1W98B 4F7NB 3O0GD 3EIDB 4F6WB 2W99A 4BCMD 1H1RB 2UUEB 5CYIB 5FGKB 4NSTB 2PMIB 1OL2B 4ROEA 4EOKB 2WIHB 1GUXB 1C9BA 4EOJB 2W9ZA 5ICPB 1XO2A 1UNGD 2CCHB 2CJMB 4YOZA 1O9KB 4EOQB 2JGZB 3DDPB 4BCQD 1OKWB 1H25B 4EOPB 4EC8B 2C5VB 5IDNB 5LQFB 1BU2A 1FINB 1JKWA 4BCKB 1GY3B 4II5B 3BHVB 4CFUB 3LQ5B 3TNWB 2W9FA 3K7AM
chains in the Genus database with same CATH superfamily
4BBSM 4HNVA 2UZEB 5EFQB 2W96A 3X24B 4EOSB 2IVXA 1H26B 5IF1B 4CFWB 2CZ7B 2F2CA 1AD6A 1VINA 1KXUA 2CZ6B 3BLRB 2BKZB 5LMKB 4EORB 1OIYB 3QYHB 3TW7A 5L2WB 3EOCB 1OGUB 4EOOB 3A8GB 4BCJB 4F7LB 3QYGB 2X1NB 4CXAB 4F6UB 2WEVB 2ZPFB 2AHJB 1TFBA 2WIPB 5HBJB 4KRCB 4RODA 2QGSA 1H1PB 2ZPHB 2UZLB 4ROCA 1UNLD 5IDPB 4HLQA 4JX6A 2I40B 2DMEA 2DPPB 3QYEA 4I3ZB 3DTOA 3HO8A 2C5OB 4EOMB 5DQWA 3BHUB 3EIDB 4AKIA 2UUEB 4MIMA 1OL2B 4ROEA 2WIHB 1C9BA 3BG9A 2ZPEB 2KR6A 4QSHA 2CJMB 3QWLA 5IHYA 4BCQD 4JX4A 4EOPB 4EC8B 2C5VB 5IDNB 1BU2A 2BS4A 1N4MA 1UNHD 1OKVB 3QZ5B 2R7GA 1QMZB 4OB2B 4JX5A 2CZ1B 3BG5A 4FM4B 2UZDB 2ZPGB 4F7JB 2BPMB 2PHGA 2V22B 1URCB 4BCQB 1JOWA 4AKGA 4EONB 4AKHA 3QZ9B 4ZGDB 1UGRB 4CFNB 4KRDB 4BCHB 2DD5B 4F6SB 1OIUB 4BY7X 2WMAB 3M03A 4F70B 2C4GB 2ZZDB 3WVDB 3A8MB 4F7SB 1OL1B 3X20B 4BCPB 4OB1B 3F5XB 2PK2A 3VKHA 4BCIB 2QDJA 4CRLB 1QLBA 4UN0A 5DQVA 4CFUD 4OB0B 4BCOB 3VYHB 4OGRB 4YOSA 3MI9B 4ZGJB 4AI6A 4EOJB 2D0QB 4YOZA 3DDPB 1H25B 3KHIA 2QQ8A 3NDQA 4LOCA 4II5B 4CFUB 3DJBA 2W9FA 3K7AM 5HBEB 3HHTB 4Y72B 1E7PA 4CFXB 1PKDB 1UGQB 4OR5B 3EJ1B 1D3UB 1JSUB 4BCND 2PJQA 2C5XB 2CCIB 2DXBB 3POMA 4OB3B 2PK9B 2G77A 4CFMB 3QXEB 4CFVB 5HNBB 2ZCFB 2UZBB 2WXVB 5HVYB 3A8OB 3VKGA 1H4LD 4BBRM 4ZGEB 3G33B 4EC9B 1ZP2A 4ELJA 2IW9B 4HL4A 2C6TB 1GH6B 1ENWA 2QF7A 3RGFB 1OI9B 4M6VA 4ELLA 4BCNB 2LW4A 1P5EB 2WMBB 3TNIB 3BHTB 2G9XB 2W2HA 2IW8B 2IW6B 1H1SB 3QHWB 4IMYB 4FX3B 2KMGA 5ACBA 1AISB 3PO3S 2CYZB 1W98B 2W99A 4BCMD 1H1RB 4NSTB 1IREB 1XO2A 3X25B 2CCHB 4EOQB 2ZPIB 3QYBA 1OKWB 4NC6A 4MFEA 5LQFB 1JKWA 3BHVB 5EJCA 2IN3A 3QHRB 5BNJB 4G6LB 3MY5B 1FVVB 2QFZA 2CZ0B 2C5NB 3HBLA 4YC3B 3X26B 1UGSB 2WHBB 3TN8B 2WPAB 4BCMB 4BCGB 5CEIB 1F5QB 3DDQB 2B9RA 3BLHB 1FKMA 4Z6YA 4HNTA 2WJ9A 1G3NC 1H1QB 4EOIB 1H24B 2ZPBB 4EOLB 1VOLA 1H27B 2DD4B 1GUXA 2EUFA 3TNHB 3H4CA 1JSTB 1O9KA 3BLQB 4MFDA 5HBHB 2I53A 3X28B 4YOOA 1TD6A 2BS3A 3DL1A 2QDYB 3TW6A 1VYWB 5I5ZB 4TTHA 5HQ0B 3WVEB 4BCFB 3BG3A 1AHJB 3MIAB 4BY1X 1E9HB 3MY1B 3VYGB 1H28B 2WFYB 3B57A 3DOGB 3HZJA 2DXCB 4F7NB 3O0GD 4F6WB 4HNUA 1UGPB 5CYIB 5FGKB 2PMIB 4EOKB 3A8HB 1GUXB 2W9ZA 5ICPB 1UNGD 1O9KB 2JGZB 3GTMS 3A8LB 2BS2A 1V29B 1FINB 3HB9A 4BXXX 4BCKB 1GY3B 3LQ5B 3TNWB
chains in the Genus database with same CATH topology
3QHRB 5BNJB 4G6LB 3MY5B 1N4MA 5HBEB 1FVVB 1UNHD 1OKVB 4Y72B 2UZEB 2C5NB 2R7GA 4YC3B 4CFXB 1PKDB 4OR5B 1QMZB 3EJ1B 1D3UB 1JSUB 2WHBB 3TN8B 4BCND 2WPAB 4BCMB 4BCGB 5EFQB 1F5QB 2W96A 5CEIB 2C5XB 2CCIB 4EOSB 3DDQB 2B9RA 2IVXA 2UZDB 1H26B 3BLHB 3POMA 5IF1B 4CFWB 2PK9B 1G3NC 4CFMB 4F7JB 2BPMB 2PHGA 2F2CA 4CFVB 2V22B 1URCB 5HNBB 1AD6A 1H1QB 1JOWA 1VINA 1KXUA 4BCQB 1H24B 3BLRB 2BKZB 4EOIB 4EONB 5LMKB 2UZBB 4EORB 2WXVB 5HVYB 1OIYB 4CFNB 4KRDB 1H4LD 4BCHB 4F6SB 5L2WB 4EOLB 3G33B 1VOLA 4EC9B 1H27B 3EOCB 1OGUB 1ZP2A 4ELJA 1GUXA 1OIUB 2IW9B 2EUFA 4EOOB 4BCJB 2C6TB 3TNHB 1GH6B 3H4CA 2WMAB 3M03A 4F7LB 1JSTB 2C4GB 4F70B 2X1NB 1O9KA 4F7SB 3RGFB 3BLQB 4CXAB 4F6UB 5HBHB 1OI9B 2WEVB 2I53A 1OL1B 4ELLA 4BCNB 4BCPB 1P5EB 4YOOA 1TFBA 2WIPB 3F5XB 2WMBB 5HBJB 3BHTB 4KRCB 2G9XB 3TNIB 4RODA 2W2HA 2IW8B 2IW6B 1H1SB 1VYWB 5I5ZB 2PK2A 3QHWB 4TTHA 1H1PB 5HQ0B 2UZLB 4BCIB 2QDJA 4BCFB 4CRLB 4ROCA 4IMYB 4UN0A 1UNLD 3MIAB 5IDPB 1E9HB 3MY1B 4CFUD 4FX3B 1H28B 2I40B 2WFYB 4BCOB 4I3ZB 5ACBA 1AISB 3DOGB 2C5OB 4EOMB 3BHUB 4OGRB 4YOSA 3MI9B 1W98B 4F7NB 3O0GD 3EIDB 4F6WB 2W99A 4BCMD 1H1RB 2UUEB 5CYIB 5FGKB 4NSTB 2PMIB 1OL2B 4ROEA 4EOKB 2WIHB 1GUXB 1C9BA 4EOJB 2W9ZA 5ICPB 1XO2A 1UNGD 2CCHB 2CJMB 4YOZA 1O9KB 4EOQB 2JGZB 3DDPB 4BCQD 1OKWB 1H25B 4EOPB 4EC8B 2C5VB 5IDNB 5LQFB 1BU2A 1FINB 1JKWA 4BCKB 1GY3B 4II5B 3BHVB 4CFUB 3LQ5B 3TNWB 2W9FA 3K7AM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHR B;  5BNJ B;  4G6L B;  3MY5 B;  1N4M A;  5HBE B;  1FVV B;  1UNH D;  1OKV B;  4Y72 B;  2UZE B;  2C5N B;  2R7G A;  4YC3 B;  4CFX B;  1PKD B;  4OR5 B;  1QMZ B;  3EJ1 B;  1D3U B;  1JSU B;  2WHB B;  3TN8 B;  4BCN D;  2WPA B;  4BCM B;  4BCG B;  5EFQ B;  1F5Q B;  2W96 A;  5CEI B;  2C5X B;  2CCI B;  4EOS B;  3DDQ B;  2B9R A;  2IVX A;  2UZD B;  1H26 B;  3BLH B;  3POM A;  5IF1 B;  4CFW B;  2PK9 B;  1G3N C;  4CFM B;  4F7J B;  2BPM B;  2PHG A;  2F2C A;  4CFV B;  2V22 B;  1URC B;  5HNB B;  1AD6 A;  1H1Q B;  1JOW A;  1VIN A;  1KXU A;  4BCQ B;  1H24 B;  3BLR B;  2BKZ B;  4EOI B;  4EON B;  5LMK B;  2UZB B;  4EOR B;  2WXV B;  5HVY B;  1OIY B;  4CFN B;  4KRD B;  1H4L D;  4BCH B;  4F6S B;  5L2W B;  4EOL B;  3G33 B;  1VOL A;  4EC9 B;  1H27 B;  3EOC B;  1OGU B;  1ZP2 A;  4ELJ A;  1GUX A;  1OIU B;  2IW9 B;  2EUF A;  4EOO B;  4BCJ B;  2C6T B;  3TNH B;  1GH6 B;  3H4C A;  2WMA B;  3M03 A;  4F7L B;  1JST B;  2C4G B;  4F70 B;  2X1N B;  1O9K A;  4F7S B;  3RGF B;  3BLQ B;  4CXA B;  4F6U B;  5HBH B;  1OI9 B;  2WEV B;  2I53 A;  1OL1 B;  4ELL A;  4BCN B;  4BCP B;  1P5E B;  4YOO A;  1TFB A;  2WIP B;  3F5X B;  2WMB B;  5HBJ B;  3BHT B;  4KRC B;  2G9X B;  3TNI B;  4ROD A;  2W2H A;  2IW8 B;  2IW6 B;  1H1S B;  1VYW B;  5I5Z B;  2PK2 A;  3QHW B;  4TTH A;  1H1P B;  5HQ0 B;  2UZL B;  4BCI B;  2QDJ A;  4BCF B;  4CRL B;  4ROC A;  4IMY B;  4UN0 A;  1UNL D;  3MIA B;  5IDP B;  1E9H B;  3MY1 B;  4CFU D;  4FX3 B;  1H28 B;  2I40 B;  2WFY B;  4BCO B;  4I3Z B;  5ACB A;  1AIS B;  3DOG B;  2C5O B;  4EOM B;  3BHU B;  4OGR B;  4YOS A;  3MI9 B;  1W98 B;  4F7N B;  3O0G D;  3EID B;  4F6W B;  2W99 A;  4BCM D;  1H1R B;  2UUE B;  5CYI B;  5FGK B;  4NST B;  2PMI B;  1OL2 B;  4ROE A;  4EOK B;  2WIH B;  1GUX B;  1C9B A;  4EOJ B;  2W9Z A;  5ICP B;  1XO2 A;  1UNG D;  2CCH B;  2CJM B;  4YOZ A;  1O9K B;  4EOQ B;  2JGZ B;  3DDP B;  4BCQ D;  1OKW B;  1H25 B;  4EOP B;  4EC8 B;  2C5V B;  5IDN B;  5LQF B;  1BU2 A;  1FIN B;  1JKW A;  4BCK B;  1GY3 B;  4II5 B;  3BHV B;  4CFU B;  3LQ5 B;  3TNW B;  2W9F A;  3K7A M; 
#chains in the Genus database with same CATH topology
 4BBS M;  4HNV A;  2UZE B;  5EFQ B;  2W96 A;  3X24 B;  4EOS B;  2IVX A;  1H26 B;  5IF1 B;  4CFW B;  2CZ7 B;  2F2C A;  1AD6 A;  1VIN A;  1KXU A;  2CZ6 B;  3BLR B;  2BKZ B;  5LMK B;  4EOR B;  1OIY B;  3QYH B;  3TW7 A;  5L2W B;  3EOC B;  1OGU B;  4EOO B;  3A8G B;  4BCJ B;  4F7L B;  3QYG B;  2X1N B;  4CXA B;  4F6U B;  2WEV B;  2ZPF B;  2AHJ B;  1TFB A;  2WIP B;  5HBJ B;  4KRC B;  4ROD A;  2QGS A;  1H1P B;  2ZPH B;  2UZL B;  4ROC A;  1UNL D;  5IDP B;  4HLQ A;  4JX6 A;  2I40 B;  2DME A;  2DPP B;  3QYE A;  4I3Z B;  3DTO A;  3HO8 A;  2C5O B;  4EOM B;  5DQW A;  3BHU B;  3EID B;  4AKI A;  2UUE B;  4MIM A;  1OL2 B;  4ROE A;  2WIH B;  1C9B A;  3BG9 A;  2ZPE B;  2KR6 A;  4QSH A;  2CJM B;  3QWL A;  5IHY A;  4BCQ D;  4JX4 A;  4EOP B;  4EC8 B;  2C5V B;  5IDN B;  1BU2 A;  2BS4 A;  1N4M A;  1UNH D;  1OKV B;  3QZ5 B;  2R7G A;  1QMZ B;  4OB2 B;  4JX5 A;  2CZ1 B;  3BG5 A;  4FM4 B;  2UZD B;  2ZPG B;  4F7J B;  2BPM B;  2PHG A;  2V22 B;  1URC B;  4BCQ B;  1JOW A;  4AKG A;  4EON B;  4AKH A;  3QZ9 B;  4ZGD B;  1UGR B;  4CFN B;  4KRD B;  4BCH B;  2DD5 B;  4F6S B;  1OIU B;  4BY7 X;  2WMA B;  3M03 A;  4F70 B;  2C4G B;  2ZZD B;  3WVD B;  3A8M B;  4F7S B;  1OL1 B;  3X20 B;  4BCP B;  4OB1 B;  3F5X B;  2PK2 A;  3VKH A;  4BCI B;  2QDJ A;  4CRL B;  1QLB A;  4UN0 A;  5DQV A;  4CFU D;  4OB0 B;  4BCO B;  3VYH B;  4OGR B;  4YOS A;  3MI9 B;  4ZGJ B;  4AI6 A;  4EOJ B;  2D0Q B;  4YOZ A;  3DDP B;  1H25 B;  3KHI A;  2QQ8 A;  3NDQ A;  4LOC A;  4II5 B;  4CFU B;  3DJB A;  2W9F A;  3K7A M;  5HBE B;  3HHT B;  4Y72 B;  1E7P A;  4CFX B;  1PKD B;  1UGQ B;  4OR5 B;  3EJ1 B;  1D3U B;  1JSU B;  4BCN D;  2PJQ A;  2C5X B;  2CCI B;  2DXB B;  3POM A;  4OB3 B;  2PK9 B;  2G77 A;  4CFM B;  3QXE B;  4CFV B;  5HNB B;  2ZCF B;  2UZB B;  2WXV B;  5HVY B;  3A8O B;  3VKG A;  1H4L D;  4BBR M;  4ZGE B;  3G33 B;  4EC9 B;  1ZP2 A;  4ELJ A;  2IW9 B;  4HL4 A;  2C6T B;  1GH6 B;  1ENW A;  2QF7 A;  3RGF B;  1OI9 B;  4M6V A;  4ELL A;  4BCN B;  2LW4 A;  1P5E B;  2WMB B;  3TNI B;  3BHT B;  2G9X B;  2W2H A;  2IW8 B;  2IW6 B;  1H1S B;  3QHW B;  4IMY B;  4FX3 B;  2KMG A;  5ACB A;  1AIS B;  3PO3 S;  2CYZ B;  1W98 B;  2W99 A;  4BCM D;  1H1R B;  4NST B;  1IRE B;  1XO2 A;  3X25 B;  2CCH B;  4EOQ B;  2ZPI B;  3QYB A;  1OKW B;  4NC6 A;  4MFE A;  5LQF B;  1JKW A;  3BHV B;  5EJC A;  2IN3 A;  3QHR B;  5BNJ B;  4G6L B;  3MY5 B;  1FVV B;  2QFZ A;  2CZ0 B;  2C5N B;  3HBL A;  4YC3 B;  3X26 B;  1UGS B;  2WHB B;  3TN8 B;  2WPA B;  4BCM B;  4BCG B;  5CEI B;  1F5Q B;  3DDQ B;  2B9R A;  3BLH B;  1FKM A;  4Z6Y A;  4HNT A;  2WJ9 A;  1G3N C;  1H1Q B;  4EOI B;  1H24 B;  2ZPB B;  4EOL B;  1VOL A;  1H27 B;  2DD4 B;  1GUX A;  2EUF A;  3TNH B;  3H4C A;  1JST B;  1O9K A;  3BLQ B;  4MFD A;  5HBH B;  2I53 A;  3X28 B;  4YOO A;  1TD6 A;  2BS3 A;  3DL1 A;  2QDY B;  3TW6 A;  1VYW B;  5I5Z B;  4TTH A;  5HQ0 B;  3WVE B;  4BCF B;  3BG3 A;  1AHJ B;  3MIA B;  4BY1 X;  1E9H B;  3MY1 B;  3VYG B;  1H28 B;  2WFY B;  3B57 A;  3DOG B;  3HZJ A;  2DXC B;  4F7N B;  3O0G D;  4F6W B;  4HNU A;  1UGP B;  5CYI B;  5FGK B;  2PMI B;  4EOK B;  3A8H B;  1GUX B;  2W9Z A;  5ICP B;  1UNG D;  1O9K B;  2JGZ B;  3GTM S;  3A8L B;  2BS2 A;  1V29 B;  1FIN B;  3HB9 A;  4BXX X;  4BCK B;  1GY3 B;  3LQ5 B;  3TNW B; 
#chains in the Genus database with same CATH homology
 3QHR B;  5BNJ B;  4G6L B;  3MY5 B;  1N4M A;  5HBE B;  1FVV B;  1UNH D;  1OKV B;  4Y72 B;  2UZE B;  2C5N B;  2R7G A;  4YC3 B;  4CFX B;  1PKD B;  4OR5 B;  1QMZ B;  3EJ1 B;  1D3U B;  1JSU B;  2WHB B;  3TN8 B;  4BCN D;  2WPA B;  4BCM B;  4BCG B;  5EFQ B;  1F5Q B;  2W96 A;  5CEI B;  2C5X B;  2CCI B;  4EOS B;  3DDQ B;  2B9R A;  2IVX A;  2UZD B;  1H26 B;  3BLH B;  3POM A;  5IF1 B;  4CFW B;  2PK9 B;  1G3N C;  4CFM B;  4F7J B;  2BPM B;  2PHG A;  2F2C A;  4CFV B;  2V22 B;  1URC B;  5HNB B;  1AD6 A;  1H1Q B;  1JOW A;  1VIN A;  1KXU A;  4BCQ B;  1H24 B;  3BLR B;  2BKZ B;  4EOI B;  4EON B;  5LMK B;  2UZB B;  4EOR B;  2WXV B;  5HVY B;  1OIY B;  4CFN B;  4KRD B;  1H4L D;  4BCH B;  4F6S B;  5L2W B;  4EOL B;  3G33 B;  1VOL A;  4EC9 B;  1H27 B;  3EOC B;  1OGU B;  1ZP2 A;  4ELJ A;  1GUX A;  1OIU B;  2IW9 B;  2EUF A;  4EOO B;  4BCJ B;  2C6T B;  3TNH B;  1GH6 B;  3H4C A;  2WMA B;  3M03 A;  4F7L B;  1JST B;  2C4G B;  4F70 B;  2X1N B;  1O9K A;  4F7S B;  3RGF B;  3BLQ B;  4CXA B;  4F6U B;  5HBH B;  1OI9 B;  2WEV B;  2I53 A;  1OL1 B;  4ELL A;  4BCN B;  4BCP B;  1P5E B;  4YOO A;  1TFB A;  2WIP B;  3F5X B;  2WMB B;  5HBJ B;  3BHT B;  4KRC B;  2G9X B;  3TNI B;  4ROD A;  2W2H A;  2IW8 B;  2IW6 B;  1H1S B;  1VYW B;  5I5Z B;  2PK2 A;  3QHW B;  4TTH A;  1H1P B;  5HQ0 B;  2UZL B;  4BCI B;  2QDJ A;  4BCF B;  4CRL B;  4ROC A;  4IMY B;  4UN0 A;  1UNL D;  3MIA B;  5IDP B;  1E9H B;  3MY1 B;  4CFU D;  4FX3 B;  1H28 B;  2I40 B;  2WFY B;  4BCO B;  4I3Z B;  5ACB A;  1AIS B;  3DOG B;  2C5O B;  4EOM B;  3BHU B;  4OGR B;  4YOS A;  3MI9 B;  1W98 B;  4F7N B;  3O0G D;  3EID B;  4F6W B;  2W99 A;  4BCM D;  1H1R B;  2UUE B;  5CYI B;  5FGK B;  4NST B;  2PMI B;  1OL2 B;  4ROE A;  4EOK B;  2WIH B;  1GUX B;  1C9B A;  4EOJ B;  2W9Z A;  5ICP B;  1XO2 A;  1UNG D;  2CCH B;  2CJM B;  4YOZ A;  1O9K B;  4EOQ B;  2JGZ B;  3DDP B;  4BCQ D;  1OKW B;  1H25 B;  4EOP B;  4EC8 B;  2C5V B;  5IDN B;  5LQF B;  1BU2 A;  1FIN B;  1JKW A;  4BCK B;  1GY3 B;  4II5 B;  3BHV B;  4CFU B;  3LQ5 B;  3TNW B;  2W9F A;  3K7A M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...