2CJXA

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-Ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cjxA00
5LUBA 4EHLA 5IAKA 4N5DA 5I9BA 3V6MA 4AW9A 2FP3A 3GJTA 1IBCA 2H4YA 4M9RA 3UOAB 2H5JA 2HBRA 3R5KA 4EHDA 4NOKA 3R7SA 1RWWA 5IAJA 3V4LA 1I3OA 2C2MA 3D6HA 4ZVPA 4JQYA 3DEHA 4FDLA 4QU8A 5IBPA 2WDPA 4QUEA 4QUBA 5IAGA 3S70A 4DCJA 5IC4A 4QTYA 1JXQA 3EDQA 4EHFA 3R7BA 1NW9B 1RHKA 3H11B 2QL7A 4QUJA 3GJRA 3IBFA 4FXOA 4IYRA 4D3YA 1RHQA 2AR9A 2H48A 2QLBA 3DEIA 4NOLA 2QLJA 4AWBA 4EHNA 1SC3A 5IASA 1NMSA 4NOJA 3RJMA 4JJ8A 4QU9A 2HBYA 4ZVQA 2XYHA 1F9EA 4QUIA 1CVRA 3P4UA 1SHJA 4I1RA 3SIRA 4DCPA 4JQZA 4NBKA 2CNLA 2QLFA 2Y0BA 4QTXA 3H11A 4EJFA 1PYOA 3PCXA 4HVAA 5IBCA 3KJFA 4JR2A 1GQFA 1RHRA 2P2CA 1I4EB 2HBZA 4JB8A 4ZVTA 2QL5A 2J31A 4PRZA 4PRYA 3IBCA 1RHUA 1RWPA 2H65A 4NOMA 1RHMA 2NN3C 1NMQA 1RWMA 4EHKA 4JR0A 2CNKA 4QU0A 1QX3A 4HQ0A 2DKOA 4AWAA 3V4OA 1RE1A 3GJSA 4FEAA 1BMQA 4IEFB 3H13A 4JJEA 3DEKA 2FQQA 5IABA 4N6NA 1M72A 1PAUA 3P45A 1SHLA 1ICEA 2H51A 3GJQA 4HQRA 4N6GA 3SIPA 3UO8B 4FGUA 4EHAA 4N7JA 2H4WA 3R6LA 4PS0A 4QUHA 5IAEA 4DCOA 5LUAA 2CNNA 5H0IA 4EHHA 5LU9A 2FUNB 2XZTA 4NBLA 2H54A 1RWKA 1RWOA 2C2KA 2J30A 3E4CA 2CJYA 3V6LA 2CJXA 2XZDA 4PS1A 2HBQA 1I4OA 3PD1A 4QUDA 3NS7A 1KMCA 4QU5A 1RHJA 4D3XA 4LSZA 1K88A 4JR1A 3ITNA 2XYPA 4JJ7A 3K7EA 2XYGA 2Y1LA 4ZVRA 3NKFA 1CP3A 3V3KA 5IARA 5K20A 2CDRA 1RWXA 3R7NA 1SC4A 1F1JA 1K86A 3D6MA 3PD0A 3QNWA 5I9TA 4I1PA 4ZVSA 2J32A 1I51A 2H5IA 3KJNA 3V55A 3BIJA 3EDRA 2C1EA 1QTNA 1SC1A 2QL9A 2J33A 4NBNA 4N6OA 5JFTA 2C2ZA 2CNOA 4D3ZA 5IANA 3R6GA 1RWVA 4QUAA 3DEJA 4ZVOA 5LU8A 3H1PA 3OD5A 5IC6A 1RWNA 3S8EA 2C2OA 2K7ZA 4ZVUA 3H0EA 3KJQA 1QDUA 3R5JA 4N7MA 4QULA 1NMEA 1GFWA 3D6FA 5IBRA 4QUGA 3NR2A
chains in the Genus database with same CATH superfamily
2A1TS 1I4TD 1VPLA 2RONA 4H1TA 4NATA 1I10A 1QGYA 2ZI7A 1UXGA 4L5JA 2G83A 4QDTA 1EFKA 3FYCA 2QZ9A 3BWMA 2HYIC 1S0UA 2AK2A 2JFUA 3IUQA 4X3OA 5DNWA 3LDFA 5FADA 4CR7A 1B2RA 1E5DA 1ZD1A 1M34B 2PKWA 1QZ3A 2A7QA 3D59A 3T3IA 4U8GA 3ZZUA 2AOVA 4AMGA 1GAEO 1PEDA 1UKBA 4G4SO 1VJGA 3VVLA 4DMFA 4MGZR 1G4AE 1HZZA 5FTJA 1IL0A 3HB7A 3SZLA 3IUYA 3ZU5A 2VF7A 4IDFA 1DAPA 3OE7D 2QJWA 4UM8B 4R8LA 3E15A 3IESA 5CIQA 3CLRC 1X92A 2P3SA 1OD6A 3W5JA 3IULA 4FZ3A 4ND5A 5B7PA 4TVSA 3URKA 1DCFA 3PCRB 1L7PA 3KSUA 3JQCA 3TL6A 3HUFA 1DT3A 4KWHA 1HE8B 1IEQA 5GGXA 3GR6A 4MWCA 5I7RA 1R0LA 1AKVA 2OGWA 5DHTA 4QBGB 4RF2A 3UAZA 1TTTA 3TZQA 2I9KA 4KQEA 3W6NA 1A8HA 1C3JA 1UC4B 3EZNA 4BTVA 3USES 3LW8A 1M5RA 2QUIA 3UPTA 2CHUA 5EOVA 3ICEA 2EFJA 4HGOA 5JW6A 4PYJA 4KDRA 4OJNA 2IOFK 5HG0A 3QF7A 2NMVA 1PQ4A 3IIMA 3A3YA 5AW7A 1W4ZA 1FDWA 4PICA 4RTSA 3EVBA 1V96A 3GJSA 3MYRA 1I94B 1M2EA 1NVWQ 3UUEA 1X38A 4D4HA 5J59A 2NU6A 2CWWA 1RXWA 1I30A 3I8SA 2K2QB 4L0CA 4JITA 1Y8RB 4A2QA 3ILVA 4HG2A 1P1CA 2YHIB 3GUCA 4XVHA 3SD7A 5KNDA 3CJRA 1GGHA 5IK2A 4L1KA 3KQNA 1NE7A 3BFKA 3HADA 1XD2A 1LW7A 3BRSA 2GAFA 2VHVA 2F9FA 2AUMA 3SXPA 1EQAA 3V6LA 1O2DA 3LY9A 4AB1A 4D97A 1EP3B 1HTTA 3OTQA 4LXIA 3ZU2A 1U63A 3HNRA 4GQBA 4GGMX 5BUQA 2QB5A 3HDVA 2OFXA 4GYYA 1PI3A 1Q0SA 2K87A 5K0FA 4TLBA 4F3RA 1KWKA 3F8WA 3GLTA 1XP8A 5IJ0B 1PJAA 4JEUA 5A62A 2FEWB 4TQ9A 3AEUB 3ONNA 4I6EA 3O9VA 1XNRB 1BHSA 2QG9A 4LHXA 1KI4A 4OHCA 1VJCA 3CWQA 4QVGA 2ETVA 3MMNA 4HVCA 4F56A 2ORYA 3IKTA 4J0DA 4LY0A 3PWKA 4ZIRB 2QMUA 4NAUA 3NYIA 2QG4A 4GR5A 4LECA 5P21A 1XLVA 1RRFA 3OMWA 4AU1A 4D9FA 3BBPA 2KWIA 4IRUB 3H9UA 3UG6A 1W88B 2WF6A 3QEOA 3CUSA 4TLCA 3NH9A 1ADJA 1YU9A 2XGOA 4PSVA 1JR3D 4CKBA 3CPSA 4NE9A 1R74A 4OQMA 3PWSA 3TB6A 1Z4KA 3WBJA 1EH5A 3GPDG 1RR6A 2DYKA 2IF0A 2JJMA 3GA7A 1HQKA 1H2YA 4ZDKA 1Q7TA 5LQCA 1NFQA 1UAYA 2VIIA 3HR7A 4IDNA 1PV2A 4K9RA 4DCGA 4JBIA 2IPOA 3OICA 1ZK3A 4OU5A 2VNSA 4R1NA 1R8YA 3BCHA 1IBCA 4OXYA 4S0XA 1BEEA 5B1DA 3L4KA 3KZXA 3URMA 3L0OA 3OUUA 3EF0A 5ELLA 4MVJF 5DSXA 1CEYA 3MHPA 1W85A 1E5QA 4IH1A 2GMWA 5G40A 5IBPA 3RARA 2FFHA 3VU9A 5NLLA 2LD4A 3N53A 1LV7A 3WYNA 4ZV7A 3NU1A 4G3XA 4LVUA 2X1HA 3NVKI 3KNZA 1CCWA 1G63A 5DGDA 3E1GA 2A35A 3OVMA 3U44B 5LZ7A 2AD5A 3JSXA 2JCSA 4OJQA 4DNQA 1BZYA 3N8IA 4ZQBA 3STUA 5TIIA 2J07A 1EGVB 4JT9A 1XLWA 4B6RA 4DTIA 1II0A 3JQFC 3RSCA 1TVEA 1ECGA 2A9JA 3LECA 3LVRE 3QI2A 2IDJA 4F86A 3U44A 1YD7A 1U7WA 2QV7A 3E22B 4HFMA 4QTXA 5BYAA 7AT1A 1JAYA 3W6PA 5L7YA 1A0OA 5FWXA 1JA1A 1RMQA 2FEPA 3VYRB 3F5FA 3ONDA 4V0QA 1V9CA 3OOEA 5E6SA 3PQ4A 3CPEA 3U4AA 4WK0B 3RR2A 3UC5A 2COKA 3HQ4O 1KSGA 1HMPA 1ZCAA 3RUIA 2Y66A 4RGBA 3MWEA 4EGCB 2QIOA 4C5CA 1PS9A 4I6JA 1O5TA 1VHTA 4HXFB 4D9NA 1KRWA 4WKBA 3VH3A 3FZGA 2Z1DA 3PNLA 2X0EA 2DKNA 1EWYA 1KI1A 1XHLA 1RYNA 4LV6A 4PIMA 4LVCA 5AOBA 3D54D 3W7VA 3GUYA 2DH6A 3ZHSA 1HEIA 1M1UA 4L27A 5FBWB 3EGOA 1ZVQA 2X4GA 1PWYE 1ISJA 1Y1PA 2VBIA 3IBSA 4LHZA 4KRFA 4DG9A 3OWOA 2C31A 3X2SA 1XTUA 4IFTA 4N3CA 2HNKA 4CDNA 4EEZA 1IY2A 1Q6ZA 4JJGA 3LX8A 4GSLA 2O8CB 3NHSA 4NAVA 2RD2A 1Q1ZA 2C58A 2POCA 2XYQA 4F1KA 1G5RA 4L8YA 4AICA 1KMCA 1A9XB 1AZWA 2VWPA 3D0KA 3UKOA 2VS1A 3RFCA 1TKAA 1Y9DA 4D9IA 1GA1A 1YQDA 1WW3A 2VAVA 4ZD6A 4ZYYA 7GPBA 3T95A 1HF3A 2FSHA 3T3DA 4EAAA 1O9BA 2FEAA 4TUYA 4G89A 3GELA 1EG7A 1WDLA 4CLXA 4BATA 4C22A 4IF4A 1HYGA 4MEAA 3H8SA 2RGXA 3HS3A 1NWHA 2WMNB 3CH6A 1FDTA 4OQEA 4B31A 4BZQA 1TMYA 3GJ7A 3WIOA 4HWSA 1KXZA 1T8PA 4NENB 3DKRA 4ZOBA 3UTCA 3D2AA 1ELOA 1E3QA 3HO8A 1YQGA 2YWDA 4KO1S 1IH8A 3NHRA 1R3DA 4I4TA 3ISTA 5KTYA 1H9BA 3FSRA 4B32A 1E9FA 2J6BA 1QWOA 3UZUA 1X1QA 3ZW8A 5K0TA 1SC9A 3NGMA 5G0UA 3RU3A 3ICWA 4A8TA 1KQOA 2F8TA 2W6NA 2P9JA 4BLVA 1HR0B 1MQAA 4J75A 3EDCA 5DIFA 3PCTA 5DBFA 5LB2A 1QVWA 2OCAA 3ABRB 4QG7A 1N5LA 5FWDA 3OQPA 4HNGA 3NBYC 1R15A 2AX4A 4M9RA 5LQJA 4QDOA 2VBGA 3FBTA 4XGNA 5LQRA 2FPUA 1MN6A 5ITVA 3KYIB 1L7NA 3ZYZA 1VYHA 3LI2A 3BIFA 3OT1B 3MTJA 4RADA 2QMYA 2Q5FA 3AMVA 2GN6A 1MU0A 2WK1A 4M6WA 4DQXA 4HGRA 4Q5IA 3ZV3A 5JNSA 1C2YA 2HD4A 3UPUA 4YC7A 5EQFA 3AEQB 3AK4A 3C8MA 4K9LA 4ZJZA 1F7VA 3C3PA 4TM7A 5IF9A 4Q7LA 2JFGA 1JVSA 4JI3B 3AUAA 3T6KA 1K7SN 1NXWA 4B8ZA 4KXQA 4BPRA 4W7SA 5HOEA 1BGVA 3GAMA 4CUJA 4TXMA 4MXDA 3CJTA 3E3AA 4YB8A 2RJOA 2H2HA 4M9SA 3IB6A 4RY2A 1QIGA 4KL8S 2Q0QA 4L0QA 3OM1A 4MV1A 5AICA 3CZRA 5DK6A 1OFHA 5M3BA 2B5VA 3L8ZA 3AVYA 2GVNA 4LC0A 2J9FA 1TAUA 4EUEA 2VBFA 2C92A 4L85A 4ERXA 2FF7A 1XEXB 1NW4A 1TCVA 2IIVA 2FG5A 5KDOA 2NUPA 1O0SA 1S2LA 2HXYA 3FF1A 5C1DA 5JSFA 5F7OA 4ZT2A 2QQEA 2V7VA 3AJRA 1N2CB 4I14A 3MT8A 3TR5A 3OE4A 5I9IA 1H1TA 5CVEA 2OY0A 4C2TA 4PU0A 2GGSA 3C48A 3FBWA 3T7RA 1V25A 2JFHA 5KU7A 3TECE 2B2XA 3SYKA 1N0UA 5DNDA 4Q39A 4H4DA 1G21E 3CEJA 4GM1A 5FEMA 4EPYA 5K8JB 4B6FA 4CM3A 4LYEA 4KQKA 1NVMB 2PD6A 3N0TA 3UT6A 1G3MA 3S8YA 3CIOA 3WGIA 3W5BA 1O94C 4F91B 3AJAA 1ML4A 5FT9A 2QP4A 1MNAA 1T15A 3ZGVA 5EJ9A 2ACKA 3CO0S 1Q0TA 3IKVA 1M73E 4AMVA 5HKKD 2GPJA 1QMGA 3A9RA 4JNCA 3WK9A 4LE1A 5LP6B 2CHVA 3BGVA 3AOGA 5JNLA 5DV9A 3ZW9A 4YJKA 4IAOA 4GKBA 1E1CA 5FNVA 3BC1A 5CYFA 2ZJBA 4H16A 4KQFA 3ZNQA 4BGDA 2LV8A 1FXUA 1L7OA 4G37A 2IYVA 3DP7A 2FQXA 4URXR 1P2BA 3O4IA 4JBYA 1EHCA 2E3JA 2ZZKA 4L22A 1L5VA 3MT9A 4IYJA 3UCEA 3QNWA 4U7DA 1T9ZA 3A2KA 1WXGA 2XJ9A 3HY6A 2XRFA 2WWXA 4M9CA 5ER6A 3KXLA 2HDOA 4FZJA 4NZZA 4A5SA 2ONCA 4B5LA 2FJPA 3OKFA 4GP6A 4IG9A 1E0SA 2JCGA 2BFFB 2WD7B 1JZTA 2JD1A 2AFHB 3CSUA 3F6RA 4X63A 1ODIA 3E9EA 5WRFA 2H2WA 3RAJA 4JEMA 3VVCA 1Z5VA 4C07A 5CCEA 4NK4A 5AKYA 1T4MA 4EZBA 1QTRA 4UM9B 1O58A 2IYZA 1E9BA 2RH8A 5KOHA 1IXYA 1XVVA 3AF0A 3IAM6 1TQ6A 3KJGA 3K5IA 4MR7B 4RD6A 5IJ9A 1LNSA 1GU1A 3JQEA 4XUDA 3VSEA 1X0XA 3DWEX 2O8NA 2BTOA 1PYDA 1MG5A 3LLCA 1LGYA 4RU1A 1H23A 3EFEA 1IHXA 2JVIA 1G2QA 4LNUB 3CHYA 1YK1A 3PWTA 1QVRA 5HDQA 3R75A 4JXZA 3FGOA 2IE8A 3DFMA 5FIUA 2BWJA 4DLTA 1FLAA 4H3SA 2VTBB 5LBUA 4DMGA 2HT1A 3AQIA 1MC1A 1T1GA 2PZGA 3H11B 3HWRA 4G97A 4BXOA 1IOVA 2GD2A 1FSGA 1Y7LA 1D07A 2H48A 3DDWA 5E3JA 2B7CA 1LDGA 2JCBA 1EGHA 5E2AA 3MBKA 3RUFA 4ZICA 3AOEA 1GP2A 3PD7A 4BMNA 1CT9A 1H5NA 1EM8B 4EECA 9LDTA 5J4VA 4IOJA 3ZXXA 4E15A 3E8MA 1X7WB 1T5DX 2BBOA 2GZAA 1W4RA 2O0JA 2OC4A 2P3LA 2O8DB 1OTHA 1II9A 3BRCA 2ID4A 3O4FA 5HK9A 5KTMA 1OAKA 4DSAA 1Q2UA 4EKIA 3ENZA 2VHYA 5DWVA 5M5BA 5ALFA 3OPNA 1RDFA 5C8VA 4E2XA 1L5MA 2H17A 4QT0A 2YWFA 4FE4A 5J5AA 4AZWA 1EBUA 4CM5A 3FMPB 3U5TA 3S68A 2EZ4A 3H19A 1H22A 3WIDA 1D03A 2VJBA 3WJ1A 4TTAA 3TIFA 1GL6A 3COVA 4KR6A 1DOHA 2Q6LA 2EP8A 3FUTA 4HOYA 3T94A 3Q8KA 4YBRA 5LKRA 2YOFA 3QBEA 5LQDA 3FETA 2A0UA 1H2BA 3FWPA 3DMHA 3TCKA 1V16A 1QP8A 4QECA 3K09C 3OOHA 3VTKA 1M1YE 1ZHFA 2G36A 4EHHA 3DS8A 1EB9A 1GTSA 8AT1A 3KAJA 1JI0A 1YV9A 2CY0A 3CF2A 1Q95A 1OYVA 2BUAA 2GYUA 3OIUA 1XIVA 2PM8A 1G9XA 1QHGA 4D96A 4BFYA 1U3GA 5LQAA 5D3QA 3C6ZA 3I1YA 2NTJA 5JZVA 2IPMA 5FWAA 3G8DA 4LZAA 4UUPA 4AF8A 3IO5A 4IHJB 2P6OA 3NIDB 1PWEA 2DBVO 3IPRA 1K88A 4Y2XA 5DM4A 5F9MA 5TR9A 5A3VA 1GL3A 2FK7A 2C3PA 4EQZA 5EKXA 3ADDA 3ZE2B 1CY1A 1SY7A 3TUIC 5A5FA 5JDIC 5IYZB 5DTRA 3NGLA 1AK9A 4MWEA 4Z3OA 3OT4A 5FTMA 3HMQA 3I5MA 4BNUA 4DAOA 4RTMA 1NZJA 1WY5A 2BMVA 2AWNA 3IUEA 4Z2YA 3JPYA 4RX1A 3JZIA 4DT1B 1ST2A 5LOVB 4ESHA 4ZP1A 3JARA 4TV8B 1IOLA 5KUTA 1P2VA 4ZAYA 2QM0A 3QMPA 4CKCB 5K4AA 1KDZA 1U7PA 4ZAWA 3S1SA 2VL7A 1QOPB 2X7HA 2C2OA 3H65A 1KMHB 5BQ5A 5FAKA 1RBYA 1TMOA 3L46A 3FYUC 2E5WA 1CZHA 1N9ZA 2WWYA 1EP2B 3EVFA 4PVDA 1AQJA 3IPAA 4F2DA 1Z0JA 1NBAA 1SK8A 4FQ7A 2YS7A 4D0RA 2CLCX 5IH3A 2JATA 3NTLA 1JXMA 4KPFC 4DCTA 5EG5A 2QRMA 2VWHA 3H9QA 1A2BA 4UU8A 1J4AA 2QMZA 2YWJA 2FSUA 1NLMA 1TYEB 4JU9A 5ALSA 2IOYA 2WDPA 1BNCA 2O2ZA 3F74A 1UBJS 1W85B 4UHKA 5IKEA 4ZXFA 5IH7A 1AB5A 1P19A 1R0BA 3VKUA 3IEKA 3HVRA 4KPUA 4XM2A 4U2GA 4B7XA 4IIUA 5BUCA 1OV4A 5KU1A 4U3JA 2ZIXB 5ALOA 5SYMA 5FO0A 4FIZA 3S2ZA 3P8ZA 2A86A 2DR3A 3PVZA 4TSFA 3IE2A 3LYLA 3VHQA 4G4SP 4JBXA 3N7UA 1F2DA 2FZLA 2WYUA 3CH4B 4WKCA 5TS3A 3ZV5A 1DVRA 1FP4A 3A1CA 3KZNA 3PX3A 4OG2A 4QGAA 4YN3A 3UAGA 5U4QA 5ARBA 2P4UA 2BGMA 1JKJB 4ZVTA 3J7AC 1MABA 5EXSA 5BOSB 5T64A 4D25A 1X74A 1Z17A 3GVHA 2B92A 3NDBB 3FHJA 2PH1A 3TBFA 4N49A 3IDOA 3QEAZ 1KVRA 2O7SA 3NJ4A 1DO0A 4MO2A 3HTXA 3K9FC 1H2RS 1SEPA 3CF6R 2WM8A 2D0DA 2X19A 3HKCB 4G5OA 4W8HA 5C9ZA 2RHWA 4XYBA 3V1NA 2QTZA 4AXXA 5I7EA 2H52A 2SKDA 3I9V1 4FEAA 3AGQA 4HWTA 2AC4A 1QIMA 4XJSA 1WXDA 4EF4A 3MTGA 2DFVA 3BFJA 1P0IA 1QQ6A 3T5GA 5BQ3A 2W8BA 1E60A 4U2DA 1E4YA 3AY0A 4BKPA 5HIJA 5IAEA 4UHFA 2X8AA 3WYAA 4DLVA 4ER3A 5CYGA 4FN5A 1S7CA 2PZLA 3HDHA 3BWDD 3KVOA 3MOGA 3WLQA 1QWSA 3ZI4A 4EATA 3N2KB 3ZS8A 4P5PA 1YZNA 2VJMA 5JZSA 3K1AA 3M7IA 1XCPA 1YRAA 3VR3A 4UDOA 5GJCA 5E1BA 3WGLA 4D45A 4MV3A 1JW9B 1PD1A 1FPMA 2OCKA 3BTSA 4QG3A 1B3BA 2F9MA 13PKA 1CW2B 2FDXA 1A4IA 1D0SA 1Y3FE 3FPKA 4RSHA 1XB2A 3SP1A 1GQSA 1RAFA 1FTYA 3N2GB 2Z1MA 3PEUA 1GR0A 5CEJA 3KQUA 1C0LA 3AWDA 2WILA 1FSPA 2JH8A 1PKEA 4GT1A 4A8JB 4YXFA 3K6KA 4H7HA 2O3TA 4JVOA 1IN1A 4UUQA 1NL3A 2V4ZA 3V8MA 4W5TA 1DJMA 5D7NA 3GGGA 3KSDO 2YS6A 4G84A 2CZQA 4MV7A 2B83A 1ETUA 2X7JA 4RTOA 1MXHA 2ZWVA 1XJWA 4JSTA 3ROXA 4PGHA 1RM0A 1AMNA 2JKZA 3A28A 1TRHA 3FMFA 2OESA 3IQXA 3UV3A 1MFPA 2DWQA 2PUGA 3OESA 1JAIA 3LUPA 3BUSA 4RVUA 5D84A 4CMKA 3DGFC 3W7AA 1TX4B 3MJRA 3ZHYA 4Q02A 2DZDA 4MW5A 3RKUA 4RE6A 2OCGA 1UXHA 2HZBA 4QGGA 1XK7A 3K30A 2BFCA 1N2ZA 4UARA 1DBRA 1NBMD 1ZNYA 4I7EA 2K4MA 4ZQGA 3SPXA 2AV6A 2QWXA 2YMPA 4B83A 3I12A 3KTAB 4ZT4A 4PHCA 2PS0A 1N25A 2OSVA 2BZ0A 1E4EB 1CXZA 2H9AA 3OEED 1DX9A 2GPWA 4GR4A 1KJJA 4I4CA 5LCXA 5REQA 3WLTA 2CYBA 4K0KB 3QWAA 1LQUA 1JWLA 2W2QA 4BZZA 1CRQA 4KXVA 2P40A 1PQYA 4CM4B 3GZNA 4MQEA 3IDQA 2F4NA 2VYND 1QTIA 1UWCA 2H11A 4U8HA 4YNBA 4A8PA 4POOA 2D5BA 5HKBA 1EG2A 1NVTA 3DMNA 4WNYA 2I4LA 3L6CA 3LUFA 3R8FA 1SGWA 3LX4A 5FUYA 1QE0A 2FDCA 3E4DA 4CEJA 1EWKA 3KZ1E 5F2KA 5B30A 1VKHA 3DEAA 1V5IA 1T9AA 3ABZA 4QIHA 4G1FA 1AGRA 3OU7A 5CT9A 5BYBA 3HPRA 1TAQA 1ZXXA 3P9PA 3QUCA 4O02B 1U94A 1O96A 2UYOA 3BF8A 2JGRA 3GCZA 3L7BA 3LWZA 5GAJA 3T1YB 1G3UA 1V95A 2P35A 1VXOA 2VUTA 5COBA 3CW8X 4PE5B 1SZCA 4N5HX 4BFTA 4B84A 1DKRA 3LC7O 1A97A 4PRYA 4DV6B 2ATEA 3IBCA 3ZIAD 2JLQA 1FNCA 2DT8A 1QIJA 2NN3C 3T1QA 3FPEA 3ACBA 4JLKA 3AR6A 4JVNA 4YRSA 1JUDA 2ZQYA 1LBQA 3O9ZA 1XAJA 1ONOA 4IJVA 4N5IX 1RLJA 3HWWA 3TEJA 4EQ6A 2WHRA 2H3EA 3FD8A 4ONEA 2HJSA 3H13A 4W9NA 4QTZA 5A0TA 2D5IA 1EXNA 1PS8A 4L95C 4TXJA 5D6NA 4D0SA 1N78A 3OFSA 4UZSA 1WMFA 3MWDA 1W2GA 3N2LA 1B7GO 4RFVA 5DTEA 3SIPA 1LJUA 3D8TA 1K4MA 1YZGA 3EUFA 3L40A 4CIVA 4OBBA 1VLVA 3J81k 2VCYA 4CQMD 2XGSA 1Y8QA 4MPPA 1Z5UA 4KR2A 2TS1A 2PUHA 3CTPA 3G3EA 5E2IA 5E6UA 4PPQA 3TQFA 3S0JA 3DE4X 3ESZA 1Q0UA 4LQ4A 3TJZA 4NAHA 3UMSA 3L8EA 5CDHA 2OCPA 3AJDA 1QUFA 1AVTA 3O2NA 4H7DA 3SEAA 4FHFA 5HNKA 3GP3A 1IM2A 2ZSIA 1AGNA 3JQGA 4BU1A 3EEYA 3RH0A 5CFZA 3RVNA 4DUPA 2QZZA 5A02A 5EA2A 2V4UA 3GBSA 4YV1A 2DFPA 5KTRA 4RFLA 1UEJA 1A7JA 4XB1A 1LA2A 1WZIA 1BW9B 4OQDA 4RJJA 3OTHA 2BEKA 4CTJA 2WIGA 3EVZA 2RE8A 4LRUA 1DEXA 2IPAB 3EG9A 4OKSA 3K9NA 1TYDE 4TKUB 4UTZA 4O4HB 3TJRA 3D8RA 4F97A 3CVXA 2WTAA 2RGNA 3I0MA 3SFTA 1A2KC 3OPQA 2J33A 3OTIA 3NVAA 4LMAA 5AP9A 1CV2A 5DW3A 1Y1RA 1QB7A 4RNCA 1GTZA 4EYKA 2ATVA 2JFBA 4EJMA 1LBHA 2VH5R 4LC9A 1U2PA 2FP4A 4CIWA 1JH9A 3PT9A 2I4TA 3KETA 1KVSA 2IELA 3L7NA 4HUTA 3JAMA 2JKVA 4L3OA 4YQZA 5K1ZA 3VDMA 1QDUA 3M4XA 4WHMA 2PL9A 4DW8A 1S5PA 2IP2A 1WZCA 3AESA 3IQEA 1N8KA 2OBFA 2P77A 1G5PA 4WCFC 3B3GA 1IOZA 5JJLA 1D1SA 1GTMA 4DLZA 2JGMA 4PVCA 4BMYA 3Q3CA 1BA3A 2KJQA 4CCSA 2YXBA 3UJCA 3KC2A 3KQPA 2X5OA 4X1YB 3TPCA 4D74A 5C5EA 2NZVG 2AG0A 3SFZA 4ZI7B 1KBQA 1XRQA 3C6YA 4D9HA 3H6GA 4WXRA 1KEZA 1H9AA 5C51B 3LF2A 5EWJB 1RHKA 2RH5A 4MS3B 5AM1A 1GZ3A 4JELA 4DM7A 3MERA 5KJ6A 3GLIA 2QLTA 3VJLA 4IINA 1D1QA 1UBRS 1TZMA 1EWRA 3DTYA 3ASUA 1EINA 1QOQB 1T0HB 2Z9CA 3LE8A 4Y2QA 4WAUA 1OXUA 1Z2CA 1YACA 1I7LA 4W9NC 3GQVA 2DBZA 2RHBA 1XTZA 5L51A 1RVV1 3DAYA 2G63A 1E79A 2PH3A 4FNAA 3PQCA 3QFSA 1W5SA 3E2PA 4WXEA 5KKCA 3AR3A 1IBKB 5CYOA 1ABEA 1CDOA 3BE6A 1ECCA 1GFZA 3KYDB 4NQZA 4NZNA 2Z6VA 2ZUFA 3Q88A 3V4SA 5JAIA 4KO8A 2BN4A 1HE1C 2XGMA 3WWDA 3HB9A 1EUYA 3HU1A 3GNLA 4OP3A 2FA9A 5EIWA 2BKUA 2BY4A 2XNDD 1IFXA 4G5GA 2R7AA 3H6KA 4JT8A 1JKFA 2IU3A 2ZVQX 1E79D 4G65A 4LQLA 5EQTA 2WZCA 1O57A 1PG0A 5D7BA 3SLGA 4BJ5A 4Z8XA 1QPBA 4H18A 2VQ6A 3FGPA 3FI0A 1LI4A 3W2TA 5E6RA 4CTOA 4RTPA 1U3UA 1BXGA 1M1YA 1XQXA 4IGEA 4IRMA 1YO6A 2QD3A 4N6NA 4XJXA 1LPNA 3KLMX 3MCTA 4I50B 5F7ZA 3RRNA 2Y0PA 3HBFA 1N5OX 3BXEA 5IMBA 4B9AA 1WM1A 5E3HA 5FHRA 5CLIA 1T6ZA 1G8GA 3DE5X 4YVFA 5LU9A 2GAIA 2HWYA 2HEIA 3G6WA 1RWOA 3I9NA 1QDEA 3IRVA 3WYEA 2W4MA 3Q6MA 2CVFA 3GEIA 1ONBA 2BD0A 4RSGA 4ZTBA 1JG7A 3EVNA 3O38A 1QJ4A 1H6DA 2PXHA 2ZBGA 3LPNA 4W1RA 4BV8A 2DKFA 5AI8A 1XNQB 5PNTA 4BFCA 5A9SA 3AIIA 2ADMA 3HN6A 2CB0A 1VXRA 2HIAA 4NFLA 2VDMB 4YJ3B 3WNVA 3Q7PA 2LKCA 1JG2A 4BIMA 4N48A 3E8XA 3I0ZA 5CPFA 1QHHB 1YGYA 3W9YA 3PNMA 4D8WA 3OMLA 4PF1A 4XYMA 3UMGA 1C3LA 1OJLA 5F1PA 2AE1A 3R3HA 1DG9A 5BV0A 1P72A 3OEHD 4Y2YA 4N6OA 4WLFA 4CEJB 1F0NA 4CTKA 2UVDA 4YR9A 4RSMA 2NNLD 1XRMA 1GUYA 3R77A 4MYHA 4HKTA 2I1VB 5EMNA 3IPCA 5DI3B 5IKOA 3RU9A 5H3HA 4D81A 1HFKA 1A04A 3LYHA 4FR2A 1Z12A 3B3QA 4MVJA 1EVZA 5H83A 1N7JA 1QC5B 1ZM9A 2E1RA 3KJQA 5BXQC 5I7FA 5JNVA 2F43B 2N0SA 4BC0A 1XVLA 3LPMA 3EC1A 1RCFA 3JQ7A 1OXTA 1U9ZA 1WXIA 3B8EA 1P74A 3QLVA 4DMCA 5HZGA 4N40A 1FYWA 1Y7TA 1QNLA 1VRVA 1W25A 1FNDA 1QH1B 4B5KA 1BYUA 3GDWA 5CCBA 2ZJ1A 1QO0A 1YS1X 2XZPA 3V8QA 3WGQA 1PZXA 3E35A 3WS7A 1C9JA 1QG2A 4IVRA 3S3TA 4DS3A 2PGNA 4PGAA 3CNBA 2Q3HA 3KZCA 2XB4A 1MIHA 2GI4A 4NYJQ 1Y5LA 3O83A 2HGZA 5EKTA 3KPVA 2IUEA 1C9DB 2WAOA 1WO8A 3GJRA 4RYDA 3DAPA 4D3YA 1L4KA 3HE3A 3ESQA 4U9HS 2W2PA 1SC3A 1YBAA 1H93A 4QDKA 1GPUA 3EN0A 4LJ6A 4XLTA 1ZL0A 2YMMA 4IIJB 3UENA 5K6AC 1CVRA 1E7QA 1UPCA 3IOCA 4G5QA 3T7KA 5KWIA 3B20A 1MC5A 1DV2A 1OZ0A 2R6DA 3A36A 1JAZA 1Q19A 3ZWQA 5HZKA 2G4VA 1LDNA 3ONVA 5CBKA 1QX4A 3SZRA 4YP5A 3PIRA 2IQIA 3G2JA 2PIDA 5IFLA 1M1NB 1NASA 3FYHA 2FK8A 1P2TA 2ILVA 4DT1A 1KDOA 4FKMA 2YC4C 4CL0A 1IRIA 1RWPA 2QP3A 4GICA 3PV0A 1HT1E 1QNFA 3PXCX 4HMQA 1DQZA 4JR0A 1X8LA 4R3NA 1YL6A 1YTUA 1QYWA 3UA4A 2COEA 3ILSA 1B73A 1UT6A 1TTQB 4F38A 2V0CA 2GEKA 5ICCA 2TMDA 3BERA 5KYNA 1JU4A 3DD1A 4IQGA 3RQIA 1LSSA 1PAUA 3NTUA 5DI3A 5DNEA 3EOAI 2VYVD 4UM5A 3O90A 1KH1A 2JI7A 3NEYA 2CVPA 4IZ6A 2J09A 3IELA 2ECQA 4YRPA 1EFRD 1SUBA 2XODA 3FGNA 3D4LA 4FJ0A 2JAHA 4Q47A 1EFRA 1ODTC 1QR6A 3QLUC 3EWNA 5GP1A 3S2EA 1V47A 2WUWE 3LRTA 1KK1A 4TMTA 3WKBA 3NASA 3H2BA 1KAQA 2X8BA 4FUTA 4OMCA 4QHYA 5EJ8A 1KIMA 2VP5A 4BRSA 1O6CA 4TUYF 1J06A 1I4OA 1VG1A 3RUHA 3A4IA 1T4CA 5TVKA 2C2GA 2PLAA 3ED1A 3CF4A 1E3WA 3FRJA 4RVOA 1POWA 2CMFA 3DAHA 1ZHOA 2XYGA 4PSAA 3OX1A 4OMUA 1FPQA 5BOSA 3QYPA 5I3CA 5KMGB 4NYJR 2WKQA 3QU7A 3RSFA 1FP2A 1UMCA 1H5QA 3M89A 3PR3A 4GXTA 2HV9A 3HCWA 1GNVA 4JLVA 3HFJA 3VH1A 1Z0ZA 3FI9A 4A0FA 1ZD5A 1QOZA 2CFCA 4MW6A 4NBUA 4FDTA 4RPGA 1XJQA 3E9DA 1INLA 2XWJI 2WZBA 1DIRA 1UCFA 1BDMA 3AJEA 1QORA 3WIBA 5F76A 3WL5A 2PWYA 3P9SA 1GGEA 1WA5A 4O08A 4DE5A 1L1RA 1QH0A 4ZEXA 2RGYA 3AY7A 5T3UA 3JD1A 3TFOA 4L78A 1EE9A 4V2IA 4W82A 5DTJA 3RT1A 4D98A 4AAYA 3OURA 3TL3A 4LIPD 2CLIB 1JX6A 1DTSA 2WUVA 1EPUA 4EHBA 4YRMA 1Y3HA 5ADVA 4E5VA 5AVVA 3E3MA 4JI7B 4FZ5A 1LSJA 4HL6A 1PUXA 1W5EA 5K0ZA 2VSYA 3GEEA 3RAEC 5KWSA 2WSIA 1AKTA 2ZRQA 2DERA 1N8SA 1W52X 3Q9NA 1T8UA 3CX4A 1QO0D 4HSEA 3RANA 5ICGA 2P75A 3G2LA 2Q27A 3LCRA 2BJVA 5DX1A 5JC8A 3ZWDA 3K1ZA 4WKPA 1OX5A 4JXJA 1JH8A 4KXLA 4A9AA 5ICMA 2B8JA 1S3GA 3W3AH 3SSNA 2X15A 3MAAC 1AMUA 2ATIA 3ZZMA 2R2AA 3CEMA 3H1AA 2R5WA 5JYBA 1YJ5A 2XDWA 4D9KA 3K09A 1U3VA 2AGVA 3FIUA 2UZAA 4MVJD 1YMVA 2H1VA 4WSOA 1C9EA 3T3PB 1VFPA 4CGYA 3HYSA 5JYEA 1LLQA 4QHTA 5D3ZA 1P2DA 4CKCA 2MYTA 4KK4A 3HJCA 4S1OA 5E1MA 3K9CA 4HQLA 2VRCA 4BQOA 4D42A 2P3QA 2YWHA 2ID7A 4D99A 1U0NA 3GUZA 4MJXA 1VE7A 4CEHA 4MS3A 3ASYA 2VQDA 3GGJA 1NFRA 2QHXA 5CLQA 3S2IA 4IJKA 4CE6A 4F04A 5CA1A 5AVWA 2J46A 3PLAE 2P1RA 4EGQA 3AUYA 3CKMA 1A77A 2GF9A 2JFYA 3JQFA 1T43A 3CLSD 3N8KA 3GOQA 4I3HA 4BNNA 2PS9A 4WOKA 4LHEA 4ZFNA 3OA2A 1ISMA 1UWVA 2I4RA 1KP3A 4D8YA 4AFNA 1RC0A 4MPDA 2DFLA 1RHMA 5LM3A 1H3FA 3OF5A 4BV9A 3HYLA 3F6PA 2Z5VA 3T4EA 1P60A 1PVVA 2WHYA 4HNVA 3UGKA 3QXJA 4UUMA 3T61A 3ZCRA 4GGOA 1T9BA 2I6FA 3HA7A 4ND2A 4Z4GA 1P1FA 1ZG3A 4UZFA 2FE4A 3LBHA 2EQ5A 2HI0A 4YT5A 4DLSA 3A1NA 1NA5A 4BMZA 1N0VC 1X13A 2P27A 1M0EA 3TOXA 3LOUA 3MCAA 1REQA 5TT0A 1T3TA 3DLCA 1AQ6A 4R6XA 2ZAMA 5U4XA 1JFFA 4MH0R 5AW5A 1XZDA 4NPHA 3U31A 3CLSC 4YLGA 2WLSA 4K28A 4DUGA 2SKEA 4ALLA 5ALLA 3O94A 2DJIA 2FRDA 1KSFX 1C1DB 1VL1A 3LG2A 4L3VA 4RK4A 3OG9A 1GCAA 1FX0A 5AI5A 3KVRA 2P9FA 4JEIA 1L5HA 1ND6A 5ALVA 4ND8A 2GVZC 3LP5A 3K70B 4QPPA 3A7EA 3HYNA 1JR4A 5T7BA 2QN6A 2TECE 2CLOB 4DDVA 1IOWA 3ETGA 3NKFA 5FORA 4Q6BA 5GZ6A 1IVNA 3HV2A 1Y37A 4OGFA 1KS2A 3EASA 3GJ8A 3C4JA 2IF2A 2KLBA 4B3BA 4CV2A 4XFJA 4ZC8A 1G2PA 2OGZA 2QX4A 3DTTA 3L4BA 4HNHA 1C7IA 1UKVY 1S2MA 4HNQA 4PG7A 4UAGA 1IVSA 4BO4A 3B7PA 2OO3A 1MW9X 2E2WA 3RVQA 4RWZA 2HMWA 4QWWA 1GCGA 3K3PA 4EKGA 3WAKA 3IVXA 1JHZA 3QVXA 4BUJA 3DT6A 3OLWA 3SN6A 4U7PB 4PTYA 3GFGA 4MVWA 5FDFA 1Z6ZA 3RS8A 4K81B 1N2XA 2QT1A 3MBOA 2AI3A 4QXMA 4U00A 5CVDA 2HQ1A 1R6TA 3WGMA 4W5RA 1WCWA 1XZCA 3IH5A 1B8PA 4JYPA 4Q3BA 2QNBA 5DNUA 1FU4A 4R0MA 5KAPA 4P3KA 2EKBA 1XA0A 2HPVA 3L8MA 4H08A 4HNSA 4J90A 5KWEA 1RRPA 3ANXA 1NVBA 3GOHA 3PX7A 2J3HA 3WWZA 2LCIA 3A37A 1UDAA 1IPHA 3Q2OA 1X2EA 4ID9A 1T8WA 3LHFA 1GHTA 1N2GA 4LQCA 1MD9A 1UODA 2JRCA 3ZV4A 3VX4A 3WJ2A 1JDBC 3S7TA 1PV4A 4GOKA 3OECA 4I81A 2G6TA 4Z7NB 1GTL1 1G20E 1I7NA 1RPAA 1VCOA 2FPIA 2WD8A 4H7FA 4UEOA 4DLLA 5IDVA 3U3MA 3LHDA 3KIPA 1EFAA 4M89A 2XZLA 4PY2A 3SJBA 1IZYA 3HRKA 3IMEA 1X7DA 1ZAKA 1U7XA 2PUTA 4GKVA 4LA4A 4NE7A 4NEGA 5AM0A 3TIVA 2YN2A 1Q1GA 3UM9A 1C9YA 2EJBA 1E5VA 2WP0A 1XDBA 4GX2A 1RC8A 3UHOA 3KKKA 4G1BA 3G8CA 3N6XA 1XZAA 4C87A 2IYSA 2VF4X 5KX5F 1I2CA 4DJAA 4ENRA 3RC3A 2BKEA 4IUBS 2E4VA 3GCWA 2R00C 2VAXA 3MILA 4Q3NA 3IX7A 1CDDA 3SX0A 1WB9A 1JLSA 5I48A 3ADBA 5A5DA 1NMQA 2GR9A 3A6KA 3DJFA 1JHMA 3PQDA 4PQGA 2WIDA 3I4FA 4Q3OA 4ENSA 4M21A 4IXMA 4OUDA 2PQ6A 4KX3A 3N07A 5DISB 3E5MA 2JJQA 3EIXA 5IAAA 1GUDA 2VNHA 5B58C 5CJPA 4NXNB 1T91A 1U0LA 2WJJA 2AJLI 1XCBA 2X2PA 2AFIE 2ZI6A 3ND7A 5BWBA 1M72A 4X6UA 5JZ9A 5D2CA 3RNOA 2GAOA 3AP1A 4BAGA 16PKA 4CMAA 4H60A 2VJCA 5EJ7A 3WRWA 2V3VA 2RB4A 1H8HA 3GRCA 2ZGVA 4ANFA 3UT5B 3U7IA 4E2ZA 2HHLA 3EXG1 2OV1A 3QSYA 3ZK7A 4OXQA 1AXEA 1OCEA 1RRCA 3VV3A 2W6CX 1EZZA 4RIGA 3QENA 1HDIA 3IPYA 4FZRA 3R7AA 2ZUCA 3MZ0A 1I13A 1QE5A 1RHJA 1V8DA 2HMAA 4EPXA 2YIDA 1U0OC 4EPVA 2ZAGA 3G2QA 3ZVMA 1DV1A 5JYCA 2XMDA 2ZWPA 4MJ3A 3W34A 3HEAA 1NVVR 4K1XA 4RZ2A 2QL6A 2YINC 4XTCS 5GZ3A 2MSDB 4PPGA 2G06A 2Z57A 5K3SA 1EQUA 1UEXC 2AFIA 3HLKA 1PHRA 3CWCA 5SZHB 1FP4B 3AJ8A 2VJMB 3KT0A 3B1FA 1DAIA 4LCEA 2H0RA 4PZLA 4MUMA 4XH9B 4PC2A 1ORHA 1RI4A 3BOSA 4FUQA 4GRDA 1DCKA 1E2HA 4FOSA 3R24A 5FOUA 4XWGA 2EW8A 2WIAA 1KYYA 4Y9DA 2OEPA 9ABPA 3L1JA 4G0PA 4KNVA 3ESCA 3KB6A 3NZEA 1PGNA 4X71A 2M6KA 4EBBA 3ENKA 3OTGA 5F73A 1XG5A 5IK2D 2GCEA 2EL9A 2N46A 3H0EA 4YV2A 4D6XA 4DZTA 2ZE7A 5F3DA 1MQSA 2NQTA 3KK0A 1JI3A 2D0OB 1L5RA 2Q6KA 3MM4A 5EWLB 4CNQA 4QGHA 2CB9A 3Q85A 3C5EA 2HAEA 4EY3A 2P69A 3B48A 4AF6A 1M2VA 2D8AA 2I2FA 5CEFA 1IHUA 3MS4A 4TPKA 4OHRA 4TV8A 3TKLA 1NFFA 4I1YA 3AUXA 3IVGA 1KEVA 4FFPA 4FYWA 1G98A 3N6VA 4QHSA 3RWMB 2ZU0C 1P7VA 3U60B 1D2CA 4O4JF 1K08A 5BMVA 1P4AA 1KY4A 4Q4HB 4DWWA 5KMGA 5KBYA 2FNAA 3ZDCA 5KCMA 4NJOA 2ZIXA 2PN1A 3EWSA 2JBAA 2XXAB 2HO4A 1EB8A 4GDMA 3DZCA 4DN6A 5JRJA 2CKMA 1Y7PA 4GMXA 1Z13A 1KDTA 1PYOA 5HFJA 3K8YA 4PPNA 3BGWA 3Q41A 2L19A 3VPCA 5F2NA 2FMIA 3ZX5A 1XZPA 2ZTUA 4WCFA 1TT5A 5LD2B 3N86A 4UXIA 1IY1A 4KQHA 4G23A 1JGTA 4U5XA 1Z75A 2EBUA 4HADA 3AGPA 4YRTA 4Z1MA 5T41A 4BCBA 2WQ7A 5I5EA 2ZM6B 4KXFB 6LDHA 3B2QA 1AN9A 3Q5EA 1OC2A 5C1OA 3GVCA 4BWFB 5K8LA 4MWGA 2PGJA 3K92A 4MS1A 2J7PD 3D3KA 3OBBA 2DFNA 5DVZA 3DWFA 1A50B 3CPJB 4FNGA 5KSPA 3TBKA 3RJZA 2RHLA 1MCZA 5EINA 4I8IA 2NOAA 1B6SA 2QVYX 2WKRA 3CLHA 4HQRA 3CZQA 5HTKA 3K73O 5KHLB 5LQKA 2JJYA 5ISMA 3L7JA 2OZKA 2R4UA 3O2QB 3TWOA 4YS6A 5KVCA 4QYIA 2CK3A 3DTVD 2VP6A 3U2QA 2B5OA 4B4OA 2NZWA 1FNNA 3AW9A 3T12A 3OJOA 4TWZA 2WA1A 3HH8A 3VR2D 2G5TA 1G19A 2Q3DA 3WWCA 4ETIA 1G20B 2Z4SA 4ZYWA 1NLYA 2AJBA 3D7NA 1ZD2P 5EAIA 3FZYA 1AT1A 3IXQA 2JHCA 4GMKA 2EX4A 3RKRA 5BRJA 2YY5A 4LRTB 2WZDA 4X84A 4ARUA 5IYZA 4S2UA 2JAUA 1G42A 4ZCMA 3U5ZB 4LF7B 4GI5A 2NU6B 4Q9NA 3WWPA 3ANNA 1ZGBA 3U9TA 3R40A 1U8AA 2GXSA 3TTYA 4D5GA 1EP9A 1KP2A 3RROA 1TU3A 4DNXA 4IIJA 4Z7QB 3DCNA 1U2EA 4NV3A 1ZNWA 1U9IA 2M98A 5FI0B 1LNQA 3UB2A 1AO3A 2OR3A 3L18A 5MGBA 5G4KB 1VFNA 3KR1A 3OSZA 2ZZNA 3MXTA 4HK4A 2IVFA 2ZIGA 2XD4A 4N03A 2C4VA 1FX1A 1VYUA 2BBWA 4JJ4A 4OHMA 2WEKA 4GPBA 2H16A 4NCKA 3FMIA 3LDAA 5JQGB 3TXAA 4E30A 3ZGZA 1W94A 1KL7A 4CDRA 3OI7A 3LBYA 5JAQA 4RTJA 4LSMA 2PYIA 3JQRA 4B3HA 4XASA 4C3ZA 5KI6A 3B1VA 2A14A 3EXIB 3V34A 3BL5A 5H9WA 1GCOA 1G8KA 2ATCA 2J0UB 4NDNE 2IYPA 2WU3A 4X0EA 2JDIA 2ZUUA 1R0WA 3HI6A 1JEQB 2C4NA 2OHGA 3HJUA 1C0KA 4RW0A 3W06A 3MQ2A 2NSLA 3P9ZA 5GM2A 5KOHB 4IIYA 5L3QA 1SXPA 5HR5A 1R27A 3N5KA 3I8XA 4TRRA 4KPEC 3QEMA 4BC1A 1NYRA 2HA4A 3WQRA 2AFHA 1EKXA 2OWEA 2VTDA 1L7AA 4KYVA 1Z16A 1LTQA 4OHXA 4RFSA 4WBSA 5HQTA 5B55A 4L0MA 1VLZA 3O3CA 4GMDA 2VDKB 3VZPA 1JTEA 3HY4A 1IEWA 2A1UA 2QM3A 4ZZ3A 4DLWA 1VOTA 1LBIA 4QM6A 4UU7A 3L02A 2CL0X 1E5LA 1XQVA 3QG1A 5AK3A 2D06A 3A9CA 1GG8A 4CKBB 2W83A 4JBNA 1AGYA 1YZFA 2B1IA 3K4QA 1JJFA 1JSRA 2J41A 1AQUA 2VZ8A 2VJLA 2A3NA 3EXHB 1IN7A 1DARA 1B0UA 5JSYA 1W5AA 2CCJA 3W8RA 3IR5A 5I6DA 2CL6X 2VPQA 3LPLA 3BZBA 3ZIUA 2VJKA 1Y4AE 3QQ5A 5LXTB 2CMHA 4RTRA 3H11A 4DR6B 3KQMA 1I3NA 4CG1A 3EODA 4K2HA 3HDQA 2JGDB 4IWNA 4L51A 5I45A 5DTIA 5IXJA 1WPXA 2RGGA 1CIVA 1GTRA 2B37A 4MQMA 5IX8A 1MDFA 1XD9A 3GVIA 3IDAA 1OXKB 3F9RA 1AU9A 4R2MA 3LH5A 4XRRA 3UGTA 3K5HA 3DFIA 3GGCA 3OF2A 5JIBA 1JWAB 1WCIA 4HDRA 3AT1A 4MEJA 1W1IA 1XMPA 1D6NA 1OW3B 3C1TA 4YDHB 3LBAA 1LCIA 3IJPA 2ONZA 3BMNA 3M34A 4RVDA 1QSGA 4CG0A 2O52A 4L08A 4XSVA 2GFQA 1WV0A 4UUAA 4RD1A 2NPFA 3KV3O 2L17A 3K5WA 4C2BA 1GKYA 3LKVA 1NVUQ 1WQ4A 3E1SA 2IZ1A 1KE1A 5KNBA 4GYWA 3I9KA 2CNNA 2YJZA 4KZKA 1FP6A 2HK9A 2AN9A 2IEAA 3EZ2A 4AZ3A 4KIGA 4UBNA 2PLWA 3C8HA 4I8XA 2FPMA 4BVBA 1RQGA 1X6VA 4IDAA 5JLJA 5KJ1A 4X66B 3LT1A 2D5CA 1GTJ1 3VNSA 4CUKA 2D6FA 4YV0A 2WUGA 4P0PB 3TLKA 2BSQA 2G25A 1ZVJA 4AP9A 2AZDA 3DVAB 3I34X 5LMNB 2NUPB 4G1VA 3W4IA 3CMMA 1W5FA 4OXKA 3ACDA 2BFDA 4B09A 4WKOA 1C3VA 1B1AA 2I67A 3AF6A 1MPTA 1DE0A 4RE5A 4R0NA 3BMCB 5BT8A 2G4LA 2IYWA 3AEYA 3SNHA 3LUGA 4LV5B 5SYAA 2DT5A 3BAFA 3PD0A 2F1KA 2VTVA 1LZKA 3QVTA 2ZVDA 1D3AA 4H7IA 5K8TA 2N42A 3FNIA 5HZMA 1RPZA 2YQ5A 4UU1A 5H70A 3SXUB 4H17A 4MMZB 4OLBA 2FZEA 4TLMB 2FEMA 3BHJA 4Z4IA 2ZVPX 4A16A 2CNOA 3VJRA 3KOXA 1D2RA 4M83A 3MJCA 4F4IA 3DKPA 1M2NA 1XU4A 4O4LF 1Y48E 3SYMA 2Q50A 3PR1A 3G9ZA 1ZM2A 4U2CA 3PE4A 3DFFA 3GRRA 1E59A 4FMDB 5I8WA 2BBTA 1U2SA 3DLIA 3BBLA 1SVUA 2BEUB 2VCHA 1WY7A 4OLJA 3R5KA 3B6KA 1QM5A 4L4RA 4RVSA 2ID9A 2H1WA 3LJKA 4EG3A 1RWQA 4NZMA 4C0SA 3ORYA 4BECA 1O8BA 2XADA 1M5UA 3DDNA 3EA4A 2UXDB 1PLKA 7ADHA 3M1YA 4P4NA 4YCNA 1BFKA 3OEWA 4B82A 1NR1A 2B6NA 2JS7A 3DMGA 3MB5A 3KT8A 4INAA 1PFGA 3LHKA 4KE8A 4TRMA 5I9MA 2NVUA 2O2XA 1C30A 4IYRA 1WSAA 4UXJA 4A10A 4JQCA 3RIXA 2FJ0A 2LDBA 3B1XA 1F2TB 2QLJA 2V55B 1BW9A 3AR2A 4HMOA 1IBRA 1F8GA 2JJ2A 3UMJA 3E7XA 2G5PA 2X8WA 3ADOA 4QPJC 3H1EA 4R1LA 3U4CA 3VSCA 5A4MS 5K3EA 4ZO7A 3OPMA 4ZAXA 2AN1A 3QUAA 4F4CA 2O1EA 3RBZA 4B1FA 4WUVA 5AI0A 3T5MA 5IC5A 1A9SA 3KR9A 4YMGA 4PXAA 1A9XA 3QEMB 1RP7A 4NECA 4Y3UA 1D2HA 1O8CA 1QONA 2DG2A 2V9PA 4FZVA 4M6WB 3QXHA 2G3YA 5KTTA 1YUNA 1K5PA 5LBIA 2KLHA 4LRWA 3LDUA 5AQ1A 1JE0A 2XD9A 4CLRB 3OEYA 2GM5A 4B6OA 2BM9A 1UBUS 3L1IA 1JRLA 1SQ6A 3V97A 2O8FA 2QR2A 4ME6A 2V45A 3TAUA 2OHOA 2QORA 1RJ9A 1LEHA 2NO5A 4R0VA 5FQOA 5FXMA 3SZGA 4OEHA 4G5RA 4BPBA 3RYHB 3MD0A 2Q4EA 4HLNA 1ZNQO 3MWDB 1EHYA 1FTQA 1JR3E 3NHLA 1IUOA 3HM2A 1ZL2A 4J7AA 4V38A 5FUXA 5HKKA 1MHTA 3MRXA 2FWAA 1DWQA 4GO1A 3CV3A 5LLTA 1ZH4A 4I4TB 5DXAA 3VPXA 4BE4A 4PTZA 1G5FA 4ZMSA 1VG9B 1EJ6A 1M6VA 3GZTB 3KHTA 3B7WA 2IPNA 5HXAA 1YE5A 3VR4A 8GPBA 1Z0FA 1PFVA 3KHKA 2CL7X 5ALNA 4KXNA 5TMBA 3HY3A 2C2KA 2XAAA 4A2CA 2CHEA 3BK2A 1KAMA 3TYXA 5BSWA 4Y0VA 4XQGA 5FWYA 3EGIA 3MJHA 5G1OA 3G79A 3NIFB 2A4KA 2FMUA 3OJWA 2TMYA 1DPFA 4TUYB 1THGA 1ZOPA 1WOYA 1RI2A 1V3QE 2RK4A 5DWQA 5EXXA 3VUFA 4XYLA 1KU0A 1ZR4A 1ISRA 4MTLA 3BWXA 4ZVRA 1N2JA 1V48A 5BSRA 4DARA 1JMKC 3D5TA 2LPMA 3ECCA 3FYTA 3ODGA 4I66A 3WKEA 3ML1A 2B25A 4HGQA 5E7MA 1VCIA 3FOFC 8ABPA 2FX3A 2XVYA 3IOMA 1YNSA 4MV8A 3JATB 2PTHA 4H59A 1ZUWA 4KXMA 4QICA 1PR6A 4OH1A 4ZYZA 3BHIA 2GETA 2PAFA 1SBNE 1I24A 1QG4A 2RGCA 4GWGA 4BCCA 5EXDA 4DA0A 2ZBFA 4EYSA 5J47A 1LB1B 1K2WA 1S4QA 3FFAA 4EI7A 5JSHA 2JLXA 2VXBA 1PQWA 3JR7A 4OQPA 3KTOA 3WLHA 5DYIA 1NI5A 1K5GA 4ZOEA 5EP4A 2W98A 1CUHA 4KQ1A 4PGGA 4UATA 4Y9UA 5AJHA 3ROFA 3V1LA 4FN4A 5FI3A 2WWGA 2NTEA 3HBMA 5FHQA 1LJ8A 3DV0A 3T7CA 2PRJA 4R8RA 1VMKA 3PIDA 1ZK0A 3AHHA 4NCAA 1TEXA 3EXFB 4XEHA 4XWOA 3TMYA 1TIBA 5JD4A 2YJ6A 3DA8A 5IBRA 4RL4A 2R1VA 1KYIA 2J48A 5I9BA 2XGJA 1QG6A 4MCHA 4WJKB 1J1IA 2MU1A 5ESDA 2RARA 2J4CA 4V02A 3TEMA 1K8ZB 2LRHA 3BPSA 4XYEA 1TL7C 3PGJA 5KZMB 2LCFA 2AYZA 4IGFA 3IVRA 2VQEB 4BNDB 4MW4A 4R41A 1JKIA 1MJNA 3BG5A 3NTXA 2NP6A 1QDLB 1V3UA 3COPA 4MR8A 5J2UF 3TE6A 3DAFA 1BOOA 4DSUA 1HDYA 4G5XA 4HDMA 4EG5A 1GPBA 2ZAIA 2IZZA 3GXBA 4HDOB 2VSQA 4FR5A 4Q4JB 5LOVF 1R88A 1DC4A 2JFPA 2NU7B 3TH5A 1O0CA 4E4TA 5J63A 4ZGGA 3C4VA 1K4KA 2BAGA 3HCNA 4HUJA 5JRZA 1JG6A 4ZJYA 1T2UA 2J5BA 4I99A 2ILTA 5HA5A 4XCQA 3CB2A 1H0KA 1H4VB 2AXNA 4LZOA 2ZRDA 3A2LA 3W05A 2EFGA 4DWJA 2HREA 2HRDA 3CKYA 4K6HA 1WRBA 4JB3A 1QRTA 5B2FA 4QPDA 2PYDA 3DDZX 5GONA 4RF4A 4QVIA 1NUTA 2YUIA 1TE2A 4R7GA 2O7RA 2ZPAA 4LQDA 3CRW1 4DZRA 3MG9A 4TYYA 1J00A 4WNIA 2GYYA 3D81A 2YHIA 1G8JA 3DB1A 3RYFA 5C3UA 2F2TA 3FG9A 1HSZA 3M4ZA 4Q9DA 3AC0A 4AWAA 4QBHA 4DV5B 4MVJG 5JCZA 1NW5A 2OQRA 3NHKA 5K3FB 4ALNA 1T9GR 2R66A 2FOLA 1QTQA 3AY6A 4WERA 3Q0TA 4FXPA 3TRJA 1DAMA 2CLEB 2B4QA 1K6IA 4WVFA 4PO8A 2EIHA 3ZZTA 1UJNA 3RS2A 4URVR 4EJ0A 4FFRA 1I80A 2WMOB 1GPH1 3OX4A 1G0NA 3BD9A 2JCXA 3P2JA 3MUOA 4V0MA 4XI9A 3UJDA 4EFKA 1ZOLA 1J0CA 4RZSA 5HCNA 2PV0A 3A9TA 4F5ZA 4O4JA 2LW7A 3U3XA 4DQLA 4BEWA 1WB6A 2PBRA 5LYJF 4JJIA 1CQJA 4LDZA 2K6GA 3C0KA 1VSUA 3EG5A 3R6DA 4LJYA 2ZJ8A 4M37A 3OHPA 5AM3A 2CCKA 3ASZA 4PO3X 4QLOA 2CVQA 2EGGA 2P9TA 2YV2A 1VI5A 2PVSA 1D5CA 1OC4A 3AEUA 3NFYA 1K7EB 4IIHA 3TVYA 1CU1A 4XLZA 2C3OA 1I6LA 2GZRA 5E0OA 4FYIA 4TZ6A 3OO0A 4OUDB 5FD8A 3M6MD 2J0VA 2PSEA 1VIMA 1DDIA 1Q1EA 4WX2B 4Q7QA 1OWLA 4Q3EA 1C5KA 3LCCA 3CEAA 3CU5A 5CDGA 4X45A 3RIHA 3R2JA 3AIMA 4HNAB 4R2LA 4FIDA 3SMVA 1XNGA 1VIDA 3ADKA 1KS9A 1PGJA 4ZT5A 3A1SA 2I62A 3KOUA 1ATZA 2DHQA 2GN2A 1LI7A 1XU7A 2OLKA 3RKSA 3I58A 4F9EA 1AKYA 3EGWA 2PFKA 4E7OA 1RRMA 2DPGA 2P11A 2ET6A 5CH8A 1JQKA 2EG5A 5L3SB 4IDPA 3WA6A 2KBEA 2ZJ2A 1P4JA 5GINE 1U2RA 4HEHA 3WLFA 2AC7A 3VU0A 1HFEL 4UM7A 4RJLA 3HA2A 3GJTA 1XPOA 5IKPA 4G25A 3V8EA 3KDPA 1WHSA 1F4VA 2H5JA 1FB5A 4US1R 2YBEA 1GADO 1UM9B 4NOKA 1VJDA 3WYDA 1UMDB 3VZBA 2JI8A 2I7XA 1ZIOA 3WBFA 3PQEA 4QPNA 2YY6A 2VUIB 3I6ZA 2W5UA 2KB0A 1GV0A 4KIUA 3DCYA 4CCYB 1RACA 2NXJA 4FOLA 1R9JA 4DC1A 1MZVA 1U6KA 1UFOA 3PEFA 3QOFA 3WDSA 3ZLBA 3OZEA 2PKXA 2REOA 1HC7A 4OSOA 2ZANA 1N6OA 5SYNA 1ONNA 5ERXA 4MWBA 2Q5QA 3QBJA 1DBQA 3IAUA 3NHWA 3UOGA 3U4QA 4ZRNA 2ZJ0A 1MAUA 3TW4A 1IZZA 4B75A 1PO7A 2IZOA 4OI1A 1FIUA 2J08A 2H1RA 5T6MA 1E1YA 2KSQA 3IP8A 4IO0A 4N5LA 2HHCA 3JVUA 2RAUA 1NVGA 3R6TA 4Q9AA 1ZGZA 4CMIB 5MF6A 1C3OA 3DB2A 4HZIA 4O1IA 2FAXA 4YRIA 4GP7A 2AQHA 1UWLA 3K32A 4BFVA 5EUBA 5AKJA 4GKAA 4CJXA 2QQ5A 2Z2XA 3VSBA 1NRXA 1P80A 5JAZA 4YASA 3DZIA 4C21A 5F98A 1RQ2A 1MEJA 4RMGA 4IHAA 2VDRB 4NYIR 2JIZA 3H2YA 1GV1A 1TOAA 4RZQA 3UFBA 1NW7A 3O92A 2QRVA 4L57A 4AJKA 4NCBA 1W0JD 5B1SA 5K0CA 1K2VN 4IDOA 4JLAA 4OKNA 3ZHVA 2H06A 3S55A 1FMCA 3U81A 3UUWA 4CTNA 3AL0C 2WT8A 5IBQA 4KN8A 2QSZA 3QHQA 4FINA 2TMGA 5EJIA 3DDHA 4D5EA 2H54A 1NQUA 3FCAA 4G0WA 4RK1A 5JWRA 3TZ6A 2AQIA 3GRZA 3S7ZA 4QOFA 4COOA 1PJBA 3JQ8A 5HFNA 4ENQA 3QTLA 5MN5A 3F3YA 2Y1KA 3I73A 4YJ2F 4EA6A 3FTPA 2R7LA 1DMSA 2PEYA 2CBGA 3GUUA 3LIPA 3EVEA 4MQBA 5H81A 5DEOA 3QMVA 3JV7A 3JWEA 3RLFA 4DLNA 4TOIA 3U6BA 3GZ4A 3ABOB 3LC2O 3B5EA 3ORQA 5M04A 4RESA 4QOJA 2VZ0A 2PTGA 1YJAA 2VPIA 3DDOA 3D4IA 1SVLA 3DMTC 2ONYA 3KS9A 1WPRA 1XZHA 3UA3A 1DAKA 4ZAFA 3I72A 4AC9A 2PBZA 3QLJA 3GLQA 5JAPA 2HO5A 2I34A 5KYKA 4Z0NA 2GDJA 3V2UA 5LXTA 5AVYA 3HSSA 2VK1A 2WTXA 3JYQA 5DBEX 3LLVA 3ETEA 3VPHA 1XK6A 2AL7A 4F6RA 2QUKA 3DSRA 3RVBA 3JASA 4ODIA 1RNLA 5FX2A 1KJQA 1TXGA 2AYYA 2C5LA 2OO5C 3IV6A 3NHFA 3NIBA 4RHFA 3VKVA 5KSZA 3ZVKA 3TW8A 2AKYA 3TXYA 5EY5B 1W49A 2VI5A 5EFZA 3TW6A 3LCVB 4MS4B 5EESA 1LC3A 4BCDA 1EEHA 4U2KA 1HURA 5C8ZA 5BMVF 1XQYA 2ZW9A 3PFFA 4N76A 1CQXA 1P45A 2EARA 5E4TA 3CT6A 1OB2A 3B6EA 2OXFA 5KCZA 1N2BA 1XEWY 2AOXA 3E3NA 5IS2A 2XXJA 2O5EA 1EBBA 2ZSJA 1VYTA 2ZT7A 2A1IA 4J1NA 1PUJA 1I0ZA 2NWQA 2J3JA 1SVMA 2REQA 3GA0A 3IR6A 4BKMA 4HLQB 4DJFC 1EDEA 4EPWA 3CCCA 2DBRA 1RRGA 2GCPA 1JQDA 3D6VA 3IAS1 1YFLA 3RRFA 4C3UA 3QG5A 2ZSBA 1BROA 2FQ1A 1XALA 4TLLB 1WVMA 2ORVA 3DEIA 4BMDA 1XAGA 2B20A 4J3FA 5JRDS 3RJMA 4JLBA 4OM8A 4WOBA 1QUEA 3MWJA 3GEGA 2IHBA 3QJ5A 1TC2A 3G59A 4Q16A 2NYAA 2R8RA 4ITVA 1VECA 4MQ5A 5GTDA 3KDSE 3KAQA 1JECA 2BJHA 3VC7A 4AO8A 4ZHSA 1UJBA 5MN6A 1X1DA 1FCJA 1YIAA 3RVJA 1KEPA 2JFFA 2GCOA 5IULC 3QOYA 4YREA 2QM8A 3IT3A 1W75A 2N9UA 3BXGA 1VSQA 4LHSA 5H3CA 2BR3A 2GASA 1BVYF 2DFTA 1XSEA 4QAJA 5C35A 4QYMA 1ZY2A 3VGJA 3HLYA 3LL7A 4B45A 4V03A 2EQBA 3NBUA 4YT8A 3UH0A 5KVAA 2NNWB 1WXWA 4KQCA 3FYSA 2P68A 3O8OA 4DB2A 2YHBA 1V8PA 2GPAA 4YWHA 1UXIA 3TRIA 4UVHA 3D5EA 3NONA 3ZJ5A 1VKNA 2PMKA 3ET4A 4KJXA 2JGJA 4V39A 5DM0A 2CLFB 3C1UA 4ZV4A 2PRSA 2Q1XA 4CM7A 1PFKA 4JYMA 2Z8XA 1X7GA 3ITDA 1GILA 2Q1TA 1LDBA 2WTBA 2OMEA 4AQYB 5KNDH 4UTVA 3IOEA 2P9BA 4B7AA 4CRWB 2NP7A 5BOVA 2A0XA 3PFNA 2IYTA 5HCUA 3CVYA 3HXKA 4ML3A 1ZUIA 2JLZA 5E4YA 1DTWA 1BE8A 1OTYA 5GADl 1CRZA 2QZPA 4YRBA 2PRYA 1XDWA 4EGAA 2QAGA 2G67A 1CUUA 1GLVA 1MQ9A 2H1SA 2O23A 3HG7A 3K5PA 3PKIA 1U3TA 2XTJA 3IPLA 4OGKA 1Z8HA 1LV8A 1AXRA 2HJRA 2X6QA 4MS1B 1KO4A 1HBJA 5CMLA 2WWWA 4B6QA 4AJIA 4JI0B 3F90A 1DJQA 2ZBUA 4B3SB 4J4TA 3FMGA 5B5SA 3IDZA 3O8LA 2PMBA 2DGDA 2R79A 1P4RA 2I6GA 1TMGE 3EXG2 3TAXA 2HA0A 3TQSA 1QQBA 3MUFA 5A6SB 1UBTS 4Q12A 2ZE8A 4R2HA 3MS2A 1HH4A 1C4XA 1CBUA 4PO9A 4DWVA 1GAQA 2M1ZA 2RGAA 3FKSD 3NDRA 4CMGA 1KOGA 1BJKA 3A10A 2H5EA 5IT4A 4FMBB 2FVYA 1JEAA 1BAPA 4MR9A 3JD0A 2HU7A 5FA6A 5A5EA 3KCQA 4EF5A 1H69A 2PA0A 1TM7E 2C57A 3LLMA 1UBEA 3QXXA 3C70A 1G291 4I1SA 3PFHA 2FPLA 2BEVA 2PWPA 4J91A 4UTPA 1H85A 1BXRA 4EHJA 4BTLA 1OZAA 4FC7A 1GZDA 1UJ4A 2BM1A 2CLSA 1J09A 2AOUA 2OQVA 4F3YA 4L2IA 2A9OA 2CGEA 1LBSA 4PANA 4NG5A 1ODSA 1TCBA 2QY9A 3AIKA 3ZY6A 1CJUC 2H08A 2W2KA 3FSGA 4MUEA 1GN8A 3FOAA 5CT4A 1M34E 1MAAA 1NHGA 1NNLA 2NLOA 4LHWA 4AP5A 1QCCA 4EENA 5JWOA 2E4WA 2OCXA 4KIFA 2FW6A 3BN3A 5DLQC 3I0NA 4C2AA 2BZGA 1DHRA 4E1AA 1NSTA 2FW9A 1FYDA 3GCGA 3IIIA 4QD3A 3UK2A 3PEEA 1GLNA 1QKJA 4QTUB 3ZKWB 3SF0A 3WIVA 1DKLA 3ABIA 1P2UA 4MRMB 3GDGA 4PZ0A 3VNAA 2CDCA 4AZSA 5JJCA 5DNAA 2NUTA 3FJ1A 3ZE0B 1TADA 4E08A 4PNHA 3C3EA 5HJ5A 3LQFA 1ZGJA 3SS8A 5PGMA 1K5DA 4Y6PA 1YF3A 1DRVA 3KO8A 4LVNA 3ZH2A 1T5IA 4KQ6A 1ZJ4A 5EJGA 1NVVQ 4GRIA 3VOTA 5AVZA 3PHLA 5AI6A 2Z30A 4XDGA 3B6IA 4JP2A 4KQXA 5B53A 1RU3A 2O3UA 3EBOA 3UICA 5CA0F 3KQLA 4F06A 4C7BA 3QPUA 4INJA 3QVGB 3WLAA 4Q34A 3JWGA 2KPOA 1UOOA 3ENWA 3EZ6A 5HWSA 1GG2A 3LQ2A 5JBQA 4DV0B 1P5JA 1D1TA 1FEZA 3O1IC 4KWIA 4UHEA 2QYSA 4KLZA 2JIZD 3IAHA 4BVAA 1GTVA 3IVMA 4JQOA 2VPTA 2I6SA 4ISBA 4Y9SA 4A2WA 1YUBA 3SX4A 3QWIA 3RYCB 1XRSB 1RWMA 1R00A 3VZQA 1BCSB 3EIEA 4PLYA 3U4DA 4ZHQA 1PP4A 4ER7A 2C4MA 5L9AA 1LRLA 3K9QO 3KOOA 3BK7A 3OZFA 4JJEA 4R2IA 1TF7A 1TW3A 3KXIA 5JDCC 5HJ2A 4BO9A 3OQVA 4C0XA 3TTXA 4DPLA 1L7RA 1ICEA 3DE6X 4EFNA 4BVJA 2ZTMA 1MO4A 1J1ZA 2VP4A 4G0NA 5F5NA 4U7HA 1AIPA 1X86B 1DEHA 2Z2YA 3GJ6A 4ZA2A 1GNQA 3RS7A 2C2XA 3EVTA 2FUNB 3LV8A 4X6YA 1Z4IA 2Z09A 3JVIA 3QY9A 4HVTA 3ZU3A 3KQKA 2GK6A 4YJGA 1SK9A 5BQFA 4U5QA 4B71A 1Q15A 3TD2A 4IWXA 2IS4A 4J16C 1JIKA 3PD1A 4P58A 1V35A 1IZ0A 2FU5C 1RBZA 2J7PA 1ZN2A 3BWCA 3DHEA 3DEZA 3GJZA 4KAAA 5EZSA 4D3FA 4YJDA 2CJWA 4L6CA 1ZLYA 2ORIA 3TTTA 3LUHA 2WVHA 1ZRNA 5A7HA 1F5NA 2C1ZA 3EGXA 3LU1A 2WHPA 3P94A 1Z2PX 1S2IA 1L4GA 2QN8A 2ZTSA 4DC9A 5BP7A 1KRXA 4WFJA 1X0VA 2NU7A 4D92A 1UKCA 4LX8A 2HUPA 1JSZA 1H2ZA 5C8YA 2H3HA 2ZR0A 1C1XA 4TMFA 3DBOB 3SHVA 4ADSG 1F6DA 3THOA 4L5AA 3AL3A 4PHGA 4B0PA 1NOJA 1ILWA 1ZD8A 2IK8A 3N1UA 1NQOA 1USWA 3KT3A 3OBIA 1KR2A 3WDKA 4LW8A 4FVTA 4BX3A 4GZ6A 3X43A 3OOSA 2WNSA 3VR5H 1BRTA 1MJGM 2G70A 4HAWA 1HLFA 4WZZA 4EJ6A 5IANA 1M6HA 1QBKC 3DEJA 4M36A 1DKQA 1OOEA 2XUFA 3V7FA 3AI3A 3CZ9A 4WXYB 4F8JA 2GYWA 1E6EA 3DBLA 1F14A 1E1MA 1BSVA 2ANBA 4HDSB 4XE5A 1FDRA 3GN1A 4DLYA 4MLDA 5B7NA 3VNBA 5EPUA 3AUJB 4P4UA 4PV7A 2OL4A 2NACA 4JASB 1G6HA 1SUDA 4L7QA 1JG4A 3K0FA 3CGGA 1SUCA 3DTVB 5H1YA 1YGPA 4H6XA 1YAHA 1Z5PA 4OHVA 1GIAA 2WIFA 5BV2P 2SECE 2Q2WA 1IYZA 1I6KA 3HLTA 4K05A 1Y1LA 5FI1B 3W8NA 1ZEMA 2G8LA 1GUBA 1ILEA 6REQA 1W88A 3M3HA 4Y2GA 2B36A 4ZOLB 1E32A 2VG8A 1XJCA 4ILKA 3MAJA 4JJKA 1T5SA 4TSKA 4QTYA 5ITSA 2DUNA 3BSWA 2AEMA 5BN1A 4P3NA 2XV1A 3C8UA 3W5AA 2CNWA 4JL5A 3JATA 1PK8A 4FXOA 1ZSNA 4HWRA 3GGSA 4RPIA 3NTVA 5EWJA 5EIOA 1AUXA 4XVRA 3QE0A 3ZDDA 1EDDA 1KTVA 3MJVA 2OOKA 4FW8A 4ZCSA 1L6RA 2IUFA 1N6KA 4JKIA 2Z2KA 3I9FA 3M1IA 2AFRA 2FOIA 2ZXEA 3VDRA 2PD4A 1P91A 5F64A 1JA0A 3AETA 3SFVA 1NUQA 3EIUA 4U9UA 1XU9A 2QQ0A 2WSBA 3IYLW 3S8MA 5JCJD 3FSEA 1HKHA 1UBFA 2OD9A 2K7FA 2P3OA 1NXXA 2AEEA 4AJPA 2PJZA 1D4FA 1FVOA 1O6GA 1YDHA 4B34A 3LKBA 2IDMA 1KYVA 3Q6IA 2I4IA 3EG9B 4LXHA 4Z7OB 5E7QA 4BP9A 3QVJA 2FEKA 1XJ5A 1Y6ZA 3DMYA 3OSUA 2VHEA 4B2LA 2FP4B 2QX9A 5A1JA 4K9DA 5B1YA 4HEJA 2AFHE 9LDBA 4PLTA 2FWJA 5FPQA 2G9NA 4RZUA 4O5AA 2OT3B 2II6A 1VTKA 2XNJA 3NEPX 4J2HA 3ETLA 2CN1A 4HDNB 3H04A 2UZ1B 4X61A 4CR8A 4EMTA 3ZY3A 3NG1A 4ISCA 2PCJA 4N7JA 3TEFA 3PSAA 4ALIA 1C8KA 1O4VA 1YI8A 1LI5A 1V3TA 2ESRA 3HJTA 2VT2A 3KWMA 3W2GA 4Q4AA 4B4DA 4E12A 5AFSA 4TX1A 3CO5A 2WJAA 1TPYA 2BCEA 3F71A 4MYTA 3RHTA 4BLRA 4ON9A 5E6UB 3MTDA 3FPJA 5I7SA 4CLRA 1BCRA 4NRDA 4MW1A 1A95A 3IEIA 1MOPA 1L3IA 1LQTA 3OP1A 2SBTA 4JLJA 3FR7A 2X4DA 4LNAA 4ZI7F 1IY8A 5C31A 4HVLA 3GFPA 4B3MB 4M22A 1E62A 1I5EA 3ZWCA 4JR1A 4Z9FA 2WTMA 1TUIA 5K8IA 4P4LA 4I5IA 5D3KA 5AW2A 3DOFA 1OZHA 4PAMA 1Z82A 2XRZA 3P27A 3ICQB 3MS7A 3LP6A 4J0QA 4UOZA 2D1YA 4KRXA 5JNTA 3HJRA 3GRFA 1FNSA 3TK1A 3G1WA 1FW8A 2X3FA 2BHNA 4WESB 4R81A 1YVRA 2B35A 4ZO6A 2IWHA 3GFOA 2HX1A 3F3MA 4MVXA 1P77A 4E14A 1J2TA 2BOVA 5A9RA 4QBTA 1JQBA 2JAXA 3HBNA 4M1QA 1EYZA 4GBGA 2CZGA 4QRDA 2TMKA 1BRMA 1KKLA 3KD2A 4B0OA 5HUQA 2G88A 3PGLA 4K3VA 2O50A 4MDHA 4KDCA 3TDKA 2ZTLA 1N0IA 4MJ7A 1NNI1 1UDXA 4BB0A 2IBTA 5FA8A 5JASA 2A4MA 3VYUB 5JAOA 4YMTA 5AM4A 4CWAA 4CEIB 1HI9A 5IVKA 4CYMA 5KTNA 1P5ZB 1P9NA 3HCCA 4K7JA 3KQHA 1SXGA 1YCGA 1CUGA 1Q57A 1RXSA 2HV8A 2YNMC 2ZUBA 5EJ2A 5F1YA 5LP1A 3WSVA 5KNCH 1L5YA 4Q01A 5JJKA 3K2BA 1OYYA 4G63A 1J25A 2BLNA 3CCBA 1P7YA 3WIUA 3DEHA 4FDLA 1QFMA 1U1IA 4IHJF 3WWOA 4YRZA 1T34A 4IQFA 2YH2A 3S70A 2G09A 2BYTA 3FFBA 3PFCA 4FYXA 1Z26A 1E99A 4PLZA 4TVKA 5DM1A 1O9GA 1GA4A 1NW9B 1N6NA 2ZUSA 4MWTA 4PFJA 5CX1B 4ZXPA 3CG4A 4X1KB 4AWBA 2Z5LA 1AS2A 2ZWOA 1Z6YA 1FC0A 3X1JA 2O0KA 3EK2A 1OFGA 1NIJA 2ZKLA 1O7JA 1PVDA 1J9GA 2JFNA 5AKZA 1UPFA 1AHPA 3LPAA 3AJ9A 2H2DA 1IUPA 2EC5A 3ZCVA 1IK6A 3PUVA 2MYUA 1IAQA 4JUFA 3SXUA 4F2GA 1K3UB 3SSOA 1OAOA 1KE2A 5I7HA 3IP1A 3A4LA 4JC0A 3KP1A 2XE4A 2HR1A 4OQLA 2JFZA 4JV5B 1MH1A 1YIOA 5EMJA 4NYIQ 5CLHA 1EUCA 2R48A 3ED5A 1U1GA 4KEAA 3U7EB 3ZNOA 2LE0A 4AY3A 5BW4A 2WWHA 3ORSA 1WMEA 3KEMA 2Y1EA 2ZQ5A 5HQJA 5CXSA 1CNFA 5ARDA 3A6GA 4UHCA 2Q62A 2WWFA 1D4OA 1R6UA 1QX3A 1XWFA 4G6ZA 4NH4A 5KSOA 4MKIA 2ZTVA 4DYHA 2H7XA 2N1MA 4C7VA 3M5PA 3CEHA 4WN3A 4LXUA 4OQ4A 1VYVA 5ANRB 3CX8A 5L40A 2YICA 1Z3IX 4AROA 4MW0A 5TEVA 1P0MA 3I5XA 3E6AA 3X1MA 1U0FA 4AZ3B 2QX7A 3DC2A 1QAMA 1QHEA 3K1AB 2O7NA 1M8GA 1ZA1A 1ZMBA 4UOEA 3E9NA 1CUEA 3C6KA 1ZS9A 5FFFA 1L5OA 4V0NA 4EDHA 2ZRPA 521PA 1SHUX 1N2HA 4TT3A 3WLIA 4EOGA 4JLDA 4ACBA 2W6ID 2C8LA 1EESA 4PW0A 4R7ZA 1FUYB 1YQ9A 3GUVA 4ASUA 3FCXA 5BYJA 3NXSA 4LYYA 2A5JA 3V9PA 1SU8A 3HRHA 4QARA 1YKSA 1K8QA 3DVRX 3FLMA 4DEYA 1UADA 2J9RA 2OHFA 2OGSA 2YZMA 4GLJA 4HNRA 4JVSB 2Q46A 3ESYA 2KHZA 2MSEB 3LX6A 4NG4A 2ZYWX 3K9GA 2VOJA 4L4XA 4PWZA 2JZOA 3ROEA 3T1HB 2YYZA 2O54A 4IIJF 1HM5A 3UY4A 1VPTA 3UYLA 4HUQB 5FFNA 1MEEA 1J5XA 1Y8AA 3A0RB 1LS6A 1MC4A 2P9YA 4WEOA 4D82A 1ZAYA 4MDFA 2LNDA 1ZMRA 4LOIA 4ZPJA 3Q0EA 3C7CB 1T13A 3OM0A 4RTQA 1UBSB 2B9EA 4DVGA 3OWXA 1VE3A 1CZNA 1BCSA 1KYZA 1SUSA 2VSXA 2QUAA 4KIWA 4LRQA 4BVKA 5A0VA 1DAFA 4Q1CA 3TSYA 1ZZGA 2XUKA 3KHSA 3G9QA 1GFWA 3QIVA 4FCCA 5J2TF 3S1AB 1R8SA 4LZLA 4BXOB 2ZWMA 3EGCA 4YP6A 2GBPA 1WR8A 1KEEA 2XRYA 3AINA 3TE7A 3NWOA 3E2MA 3FKJA 1I14A 4N9WA 3DNPA 4H3VA 3HWX1 4QQFA 4Q9JA 5DM60 4ECEA 5KREA 5L3QB 2IEGA 4B3DA 1JALA 2UXBB 3WFJA 2H7YA 4MQ6A 4X7PA 3IV7A 1WCYA 3BMOA 4A27A 3FDZA 3IDSA 1B6GA 4LDJA 2Z9DA 2QW1A 5KJEA 4BNZA 1MV8A 2WF5A 2OBNA 1URPA 3OFNA 4QYXA 3RFFA 3WMWA 4P2GA 1WDKA 4M8SA 4PC3A 3R3VA 1SBQA 2HF2A 3HP4A 3L06A 1QVAA 2YL2A 1R64A 1TGVA 1O3YA 1KHTA 5GIPE 1AMOA 3O8BA 4QPZA 3GDHA 1DAOA 1A7KA 2ARKA 2QVZX 3FNGA 4J7CA 5T57A 3B6MA 3TKAA 3DXXA 1M2JA 3JVVA 1Q0HA 4FDMA 1C4WA 2P1ZA 1RE0A 1C7QA 1UC5B 2V7GA 3ZHXA 1WABA 1XTKA 3NHAA 1TUBA 3EY9A 2RFLA 3EZGA 5HRUA 5THXA 2ASVA 1FBTA 1JYSA 5ALQA 1PKXA 2EBWA 3QF4A 1MV5A 1BXRB 3BIWA 1XLUA 2VLIA 1NOKA 3ICOA 4WOPA 3AR4A 3CE6A 4CHGA 1KH2A 4B3IA 3D7LA 3GLHB 3G9XA 1S4MA 3OUTA 1DX6A 1M2HA 1H4SA 4KU4A 5BSUA 1RQLA 2D7JA 2BFEA 2YFQA 1SVOA 2HPAA 4PZUA 5CT5A 3RS5A 4BO1A 2Q3MA 4C0KA 3FUUA 4FMPA 5CBPA 2ATXA 4X24A 4XD7A 4JKOA 1BE1A 4JGIA 4D9CA 4WBNF 1ADYA 3RC2A 3TXXA 4OATA 1I7PA 1Z68A 3U7FB 2Z3ZA 3UIEA 1UJMA 1DSSG 1GSAA 4YXWD 2QJTA 4JLOA 4M55A 1XLTA 2ES4A 5AW3A 2Q5EA 3UJ7A 3PQ6A 2PL1A 2QW0X 3JZFA 5D3MB 1GTG1 1PF7E 3UQYS 3U39A 3GLFA 3OJEA 4FHCA 1PJSA 4KXWA 2Y4OA 4ESOA 4MYUA 5TB5A 4RDXA 2KE5A 1SPBS 1JILA 3JQAD 1GG9A 1E2KA 2AHOA 5ALJA 4BFSA 3D31A 1M2OB 1IDOA 1MVNA 1T29A 2CDBA 3KQQA 3L49A 2PXAA 4FYJA 4MUBA 4R9NA 3ND8A 5GV7A 4B43A 2PZFA 3LQ1A 1B16A 2LZ0A 3I9V6 5IN5A 3TBHA 3ZBPA 5AK0A 1K7CA 2C5FA 3SVTA 2E4UA 3K0SA 3MCZA 2E21A 4RKWA 4WCFB 1BX3A 3BMXA 3JD4A 3ISJA 4J1SA 4K03A 1HT2E 1ENPA 2YCLA 5TJ9A 2CXHA 4BNHA 8MHTA 2J32A 3G0DA 3LDGA 2RBKA 4PFSA 4YUZA 1H4TA 3BIJA 4JLSA 1NVEA 4B33A 5BW6B 4LF4B 1VHLA 4LJ4A 3NHUA 1H5UA 4DLXA 1B42A 4D9GA 2XTAA 4UD2A 3KKNA 3UANA 1M33A 4EEXA 1W0CA 5F3RA 1XMIA 4MW9A 4DBVO 2R4QA 2OD2A 2PU7A 2ZDGA 2O1SA 3BXPA 5HDBB 3QF4B 4B4WA 2WIKA 5L3RA 2GEBA 3V8VA 1ZM4A 1TM5E 4RKEA 4YLYA 2O5RA 3PQ3A 1ADFA 4M1WA 4R71A 3G23A 5KINB 4NABA 4ENVA 3TCNA 4UKDA 3NIWA 3PWZA 4P31A 1PR3A 4HUQA 2ZRCA 3V4LA 5B4TA 1T9DA 4Q66C 5IMSA 1NN1A 1L5FA 3UJNA 3EOZA