2CJYA

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-Ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cjyA00
2QL5A 4QU9A 1RE1A 2QL7A 3NS7A 5LU8A 5IBPA 3DEKA 4EHKA 1NMQA 4N5DA 4NBKA 1NW9B 2NN3C 3GJSA 3R5JA 5JFTA 3P4UA 2WDPA 4PS0A 4EHAA 4JR2A 4NBLA 5LUBA 1SHJA 4DCPA 3D6FA 2CNNA 4ZVPA 4JR1A 2H54A 1RHRA 2H4WA 2J30A 2FUNB 5IAKA 3H0EA 1F1JA 3BIJA 3E4CA 1SC4A 5IC6A 3R7NA 3QNWA 4DCJA 2J33A 4QU5A 2H5IA 1GFWA 4FDLA 1RHJA 4PRYA 2QLFA 3V6MA 4ZVUA 4QUDA 1KMCA 2K7ZA 3EDRA 3NKFA 2CJYA 1SC1A 2DKOA 3RJMA 5IARA 4N7JA 4QTYA 3H11B 1RWKA 1I51A 2CNLA 1I3OA 4JJ8A 5LUAA 3S8EA 3V55A 2FQQA 4EHLA 3DEHA 3ITNA 3V3KA 2CNKA 2QL9A 1CVRA 2C2MA 1RWWA 3PCXA 4ZVTA 4EHFA 2H5JA 2CJXA 2C2OA 3D6MA 3GJQA 1RHQA 5I9BA 4QUEA 2J31A 3KJQA 1K88A 4ZVQA 3P45A 1SC3A 3UO8B 4ZVSA 2J32A 3H11A 4JR0A 4QUGA 4PRZA 4NOJA 3H1PA 5IANA 2Y1LA 4FXOA 4QUBA 4D3ZA 4JJ7A 4QUIA 2C2ZA 2XYGA 3EDQA 3PD0A 2Y0BA 4JQZA 4N7MA 4NBNA 1RWOA 2P2CA 4LSZA 4N6OA 3R7SA 3GJRA 3KJNA 1M72A 2XZTA 1RWVA 3DEJA 3D6HA 3IBFA 3R7BA 3UOAB 3V4OA 3IBCA 4QU0A 3R6LA 4IYRA 5K20A 1PAUA 4EHNA 3K7EA 1RWMA 1QDUA 2C2KA 2QLJA 4I1RA 5IC4A 2CDRA 1K86A 1RWXA 2XYPA 1ICEA 4AWBA 3SIRA 4QU8A 4D3YA 1JXQA 4QUHA 3V6LA 3NR2A 3DEIA 1SHLA 4QTXA 2QLBA 4EHDA 1QTNA 1CP3A 4AW9A 2HBRA 3S70A 5I9TA 4HVAA 2HBZA 4NOMA 4JB8A 5H0IA 1F9EA 4NOLA 4DCOA 2H48A 4QUAA 4N6NA 4ZVRA 4EJFA 5IBCA 1RWNA 1RWPA 4HQ0A 5IBRA 5IAJA 4IEFB 5IABA 3R5KA 5LU9A 2H4YA 1I4OA 2XZDA 4HQRA 1PYOA 4ZVOA 3KJFA 1NMSA 3H13A 4AWAA 2H51A 3OD5A 1BMQA 4I1PA 1NMEA 3GJTA 5IAEA 4QULA 4D3XA 5IAGA 3R6GA 4FGUA 2XYHA 4JQYA 1IBCA 4N6GA 2H65A 1RHMA 1RHKA 1I4EB 2FP3A 4QUJA 3SIPA 4EHHA 4JJEA 2AR9A 2CNOA 4FEAA 4M9RA 4NOKA 3V4LA 2C1EA 4PS1A 1QX3A 5IASA 2HBQA 3PD1A 1RHUA 1GQFA 2HBYA
chains in the Genus database with same CATH superfamily
1PWYE 2R66A 3AILA 5JNLA 2I2AA 2FEMA 4E5KA 4ZFNA 3K9FC 3ZD6A 3EBPA 1I5RA 1M5UA 1N3IA 3NVAA 3LXUX 4HZIA 5EJFA 3OUUA 5A0FA 4HATA 1NUAA 2WHQA 3P2JA 2BISA 3RVOA 1RI1A 1E1RA 2JDID 4UCXA 2VBFA 2XNSA 1Z0JA 3BMCB 1SKYB 3VC1A 4IGEA 3R7AA 1M7BA 4LXHA 3MWEB 3KOOA 3HUDA 1LGYA 3M2PA 5KKAA 3VYRB 4XDGA 4DM3A 2HT1A 3RVPA 3V1YA 1SVWA 3K9LA 3ZCSA 3VKVA 3G9ZA 4AMYA 5K3OA 4WXEA 4EENA 1L4EA 4N18A 3B6MA 1YBVA 4YMIA 3ZZMA 4DZZA 3FOZA 4KODA 2FHSA 3I2YX 3SJAA 2QJOA 3K1AB 4G2TA 1ARZA 2AFHE 3BK7A 3IVGA 5C7YA 3S6JA 5C5IA 1GA1A 1ILEA 4GLFA 1N34B 1E5QA 2ZS8A 3IUEA 4IFEA 4KHZA 4Q9IA 3VO8A 4EH1A 2HW8A 4RXUA 1N5JA 1TJ5A 3F74A 1SO8A 2QW8A 3ICWA 2YTZA 4LHXA 4IFBA 1PV1A 1ST2A 2IEIA 3MBOA 4FOLA 2IHBA 4KE7A 5CGQB 4CM8A 3SC2A 3T5GA 2OQ2A 1GTSA 5KHAA 1PZEA 4G9EA 2GAIA 1Y3DE 4K6MA 3LHFA 1LFAA 1BDMA 1FNBA 1MRZA 4PO8A 1FUUA 2NO7A 2AEFA 4J1QA 4WL0A 1QH8B 3TI9A 1E79A 1NG9A 5DASA 2F59A 4JEMA 3GZTB 5DNCA 3LD9A 1GQ2A 2AJDA 1Z15A 2BBWA 2GJSA 4LZJA 4RIFA 4TYPA 4E21A 4EFKA 4R41A 3ER6A 4J4TA 4AXBA 3EXFA 1VBNA 1IY1A 1YS1X 4NFLA 5HK9A 2JJ1A 4BZXA 2DT8A 4ZIRB 2ZTLA 1X7DA 3OLZA 3EXIB 1W34A 1X8LA 3AKDA 5GV8A 2QLJA 4O59O 3BA6A 4EPYA 2WIGA 3ETDA 5LYJB 4DRZA 1ICEA 4NICA 2O2CA 3TAXA 1SC9A 3RFCA 5EJMA 1EFCA 1ML4A 4KAAA 4KWEA 3OCWA 3AFGA 4OATA 3ANSA 1DJNA 3KBOA 3ZW8A 4OIMA 3OZUA 4EELA 2WB2A 1H1TA 1M2KA 2NUTA 5K3DA 2IHVA 3WTCA 4RTOA 5DHUA 4MVJG 4U6QA 3BWVA 3A1FA 2P6MA 2NVUB 3QSGA 5CVTA 1TK3A 4Q1CA 2BZSA 3T3PB 1PFUA 3OKAA 2ID4A 1RZVA 2QTMA 4C2AA 1P72A 3GJTA 1HL3A 2FR1A 1OWLA 1JI3A 2TMYA 2LIPA 3I05A 2MT9A 4OKNA 2CLEB 5DULA 3TBFA 3KR9A 1YZYA 4YJGB 4P6VF 3NORA 2N1BA 3NIBA 4E5MA 1Y1RA 1XVTA 5TGDA 4DMHA 3DE5X 3JATA 1USIA 4WOPA 1A04A 3VI4B 4RFSA 5GP1A 2L42A 4HNRA 4Q7EA 5EIOA 4YXWD 1PSDA 1U3UA 1E4EA 1ZGJA 3II6X 2RHHA 4MGZR 2PYDA 3IESA 4PBTA 4PYKA 3TLAA 4DUYB 4GF5A 4N03A 3SEQA 3GP8A 5DMXA 2AI3A 2PBLA 3PWSA 2YDXA 5IBPA 3QU2A 3ZIAA 3GYBA 2Q6TA 1E3EA 4PQYA 3X1DA 2MYUA 3W8DA 1SOWA 1PKXA 3QUAA 4Z1MA 2IHYA 1FK8A 2F9FA 4HWRA 4O2AB 4Q37A 2I3AA 3ND5A 2XD4A 4NXMB 1J2EA 1RM4A 4URZR 5D86A 3G7SA 3TINA 1TGYA 1K8RA 2FUCA 5FQOA 3H97A 1F0NA 3U56A 2HJRA 4JC8A 3TPFA 1SVUA 2HCJB 3DZJA 1SHTX 5KYKA 4RLHA 4ZVKA 3MJ4A 4F5ZA 4PG6A 4BVLA 2Q6OA 3V7UA 3STUA 4FU0A 4QUDA 5CNJA 1KPGA 2HNBA 2V7TA 1T1EA 1K9VF 2IC5A 1CF4A 5EJEA 4OGKA 4QEDA 4XFKA 2J41A 2R1UA 2R4QA 1JFRA 4HEHA 1FUKA 1MA0A 3K09C 2R6AA 3BBPA 4RK4A 2P3LA 2RHOA 3A9VA 2C4TA 1RS0A 3LBHA 4TLAA 4UQOA 3RJ9A 4KSYA 1F4LA 1XP8A 3H6HA 3TR0A 1Q57A 4OFBA 4CL3A 2YZNA 4JI7B 1GNLA 3NHSA 4NZPA 4YHHB 2GPYA 1QKJA 1EVJA 1V96A 1ZOOA 2BFMA 2QT9A 2IS4A 1KH2A 1WWKA 4OGGA 1RIIA 3OTHA 4XSGA 5HSGA 1MR3F 1DMRA 3MLBA 4F0JA 1HZZA 1FMTA 4LSZA 1P74A 2L18A 4UOEA 2FWJA 2VBCA 2AG1A 4JP2A 1ULHA 2XQIA 3B1ZA 5FOUA 3IBCA 4F71A 2FRXA 3TZBA 4MQBA 5IHXA 1PJSA 4D9NA 5KYTA 4P5PA 2VSNA 4I5IA 1CUGA 2R7MA 1JR2A 5AM3A 3T5MA 2C4KA 4OBBA 3BIXA 2B6NA 2OB2A 3OLWA 1EZ4A 1CJTC 2J5KA 3CIOA 1I3NA 3IOCA 4IDAA 5DJ5A 5SZJA 3ZYCA 5EHZA 2E85A 4BRWA 3BN3A 3RJ5A 2CLLB 2OLKA 1G5HA 1HYHA 2FQWA 2VTDA 3SXJA 3B7GA 4ITUA 4ISBA 4E4RA 1ZH0A 1HSZA 1ODIA 1XRRA 3F0TA 4GZLA 3CIFA 2H07A 4QDKA 5AM5A 5T4FA 3T9CA 1JEQB 3WJ1A 4PLTA 1E7RA 4TX1A 3AINA 1NI3A 3QG1A 1A71A 4ZAFA 1J07A 4HDNB 5BWNA 1ISGA 3D6AA 4UBJA 3KJGA 2VK2A 2VTBA 2C5GA 2FLVA 3ENVA 4U7DA 3EC1A 2H5EA 2ZJYA 4PCUA 5IZ4A 4RTMA 3ER9A 4I1PA 1Y6FA 2ONCA 5LQAA 2GCGA 5JJBA 2NXCA 2QMZA 2FMTA 3AF0A 5K0LA 2O2XA 4BVJA 2AN3A 1F3OA 3C4QA 4NCAA 4X6XA 2WYWA 5IF3A 4JJKA 5M7EA 1G8GA 1YQDA 1UKCA 4G1UC 3HTXA 3CEHA 3WDSA 1A72A 3V1UA 1E3QA 4X7PA 1KH1A 5KSOA 2P62A 3CEMA 1H2AS 2V55B 1J8QA 2GEFA 3IPLA 4M7PA 4JI0B 4C7OA 3B5IA 2Z8YM 1YRWA 4RQBA 5CLQA 3IEXA 4GS5A 1XD8A 4EO9A 3SIWA 3AV0B 3T1OA 1LRKA 1V45E 3NHBA 4BASA 3K73O 1JYSA 3D6FA 3S2UA 4ERNA 1SBHA 1OW3B 1RYFA 1T8PA 4JWKA 3D64A 1E3SA 4D6PA 1AGRA 3U9TA 4V39A 1Z63A 2DFNA 4G8BA 3RSHA 1JH8A 1RMQA 2OC4A 1EM8A 3E27A 1YKGA 3GGDA 4GGMX 4LGCA 4MVJI 1FYXA 1DFHA 2QYTA 1EE2A 1W35A 2GSWA 3ETLA 3HJAA 4G1MB 1SHKA 3H4MA 4BJHB 2YS7A 2VT2A 2YQ5A 1SD2A 5EE0A 3E2MA 1X77A 3TIVA 1NW6A 3LUJA 3DD1A 2ZRAA 1XE3A 1FSFA 2A5GA 1BA3A 2EFGA 2GTHA 1YNOA 1OFUA 2D1FA 1D2EA 4NHEA 4XPIA 5IJ0A 1V6AA 1RQPA 1YS4A 4YONB 4MKZA 4WI1A 4CLEA 1EYZA 1TIBA 1UK9A 2G5GX 5EAIA 2B21A 3CVOA 2DX7A 3DOFA 2VYFA 1OYYA 3SZLA 3HNOA 2C3UA 2G1AA 1C8BA 3D4OA 3ILHA 3K3PA 2Q5LA 2XCQA 4B43A 2C7VA 2ZI3A 3VO1A 5C7OO 5AKYA 4QX6A 3S55A 3ADDA 1J1UA 4NFHA 4LTNA 4HEQA 3HS3A 2CXOA 2NTYC 1LFDB 2HJGA 3ANMA 2HN9A 4XGIA 2C2ZA 2FKAA 4B32A 4C0LA 4C6TA 5F1YA 4J16A 4FYWA 1QP8A 3QHAA 7REQA 3GLFB 3Q8MA 2XZTA 3DTVA 1RWVA 5F98A 4ZZIA 1U0RA 3AUAA 5HW0A 5J9FA 1ZOSA 4KZKA 4D3SA 4WLNA 1PK9A 2RGYA 5DGXA 4EWLA 3EGIA 1IN1A 3LPNA 4GNKA 3VH3A 4DRYA 1ENYA 2AMJA 9LDTA 4JYMA 5DI9A 3PQCA 3CH5A 3HP7A 3QUTA 1R6VA 1OE0A 4J07A 4RELA 1YJ8A 4BMDA 4CLOA 2OPHA 1SA0B 2CV2A 3GPLA 1C9EA 2BFCB 2CD9A 1AC5A 2GS9A 3H1FA 4I6JA 3WLLA 3BMOA 1QKIA 2VP0A 3VGPA 1ODKA 4EITA 1EGVB 3E9ZA 2PXAA 2OB1A 4KU4A 2L2QA 4HVAA 2OO5A 5H4HA 3B7WA 1P7VA 5CFLA 4ND8B 1F9EA 1SU8A 1X14A 1YBFA 1MJFA 3WIDA 2BFOA 4IINA 3D8NA 3PRYA 4CQMB 3KQQA 4ZALA 5CVVA 1DU4A 4NCNA 2PZMA 4AUMA 4NIMA 1MQAA 2BR4A 1WEKA 2R5WA 2QRPA 4C89A 2FPKA 3L4JA 1ISPA 2GPTA 3GD5A 4OUDA 4A1FA 7YASA 1KYTA 5CA1B 1MIHA 1X7HA 1NP7A 1VCOA 1X2EA 3PUXA 3H5IA 4OXNA 5DNYB 4E1BA 3OZRA 5DBOA 3Q9SA 5AXBA 2JBWA 4ML3A 3R7LA 4CE6A 5T5QA 1KKUA 1GKYA 3U7HB 4Y1GA 2FG5A 2P6PA 4BKQA 1BXZA 2V3VA 3GRPA 5E9JA 3P4XA 2QI9F 5DXAA 2BE9A 4B71A 5KCZA 1ZD4A 4CEJA 1UK6A 1VRCA 4KW7A 4RL4A 2GK4A 1A7KA 2IIVA 4OGLA 3H5LA 4YY3B 2AQHA 1JE0A 2JFFA 3IQDB 5B3LA 3N75A 3TNYA 1JMKC 1A8QA 4KXYA 2A35A 3CLTC 3TL2A 2VXCA 1I32A 1F60A 3HNPA 2FPPB 1ZK2A 3AVQA 1HQDA 3ZDDA 1QIHA 1POWA 5JDCA 4EK9A 1VG1A 5KVQA 3TW6A 1N2ZA 4PRLA 2X1LA 5AJZA 1V5FA 3BH6A 3AVVA 4BGUA 3DBRB 3R7NA 3R41A 1VCHA 3ZGXA 1BS2A 2PK3A 4MKFA 3X2EA 2H5IA 3RRFA 2ZTSA 2GN1A 5EWLB 5CXQA 1LZLA 1L5SA 1RBQA 4UATA 2X8BA 4OI0A 1M8GA 5EOVA 2RKBA 3K6JA 1XJCA 4KXFB 5LLDA 4AYWA 1JJBA 5IXYA 4HPJB 2CDNA 3RYTC 5B1YA 3IT3A 3UKJA 1SC1A 5E9AA 5JZBA 1E60A 1YDEA 3PPWA 5EXEA 4ZHQA 4EIWA 3PX3A 4G0PA 2J0UA 2CHGA 3V32A 1OLUB 4JBYA 4G1VA 2QNIA 3OI7A 5INTA 3CNBA 1N57A 2VUIB 1UJMA 1A27A 1JDUA 5GIOE 1RU3A 4REQA 1CUDA 2GAJA 3DF9A 4N49A 1K8QA 2GN2A 5A05A 3EXEA 3TDKA 2HK6A 5TS2A 3AUTA 2QY9A 2Y1WA 3UUFA 1XDWA 3G8DA 3TUJC 1M6NA 2DY1A 2PQMA 5FLYA 4D3ZA 1T3LA 4AVYA 2BTEA 2J0SA 5D3ZA 1DXYA 1U3FA 2V74B 4MYSA 2QVCA 3TD2A 2QMHA 2JGLA 4ZOEA 3E3OA 3EZFA 4J3NA 4BLVA 1QP7A 1Z16A 4RYLA 3GF4A 3IBFA 1IJBA 2Y1OA 4OM8A 3FPGA 1E1DA 2AMVA 4NH4A 1BJRE 4LKOA 1ADJA 4BTLA 4DIFA 3RKUA 4DQUA 4M89A 4L3VA 1GTZA 2VRWA 4MWTA 3O8CA 1FDSA 1NBMD 1ZRHA 2QYOA 2O2JA 4A5OA 4YRLA 4A91A 1ULZA 4E4TA 4HAVA 3BTUA 5JVDB 1YS6A 3E81A 3LY8A 3I6MA 5K51A 4QICA 3NNDA 5JSQA 2WPDA 3NOQA 5G02A 4PPFA 1A5TA 2Z5GA 1YRLA 3EFOB 4AS2A 2ECQA 2N75A 4ZI2A 5T4BA 1SKAA 3NWEA 3ZLTA 5HM8A 2O0LA 1QK4A 3DLBA 3IR7A 2QRNA 3VFDA 4EPRA 1W4BA 1BVUA 4LJKA 4HAYA 3HDTA 4WK6A 1VHWA 1FP1D 1H22A 2EFCB 3U3KA 3EVAA 4BBZA 3O2NA 5KTTA 3B53X 5FTKA 1VOTA 4XARA 2CXQA 1A8UA 1FQKA 3I9FA 3PITA 5DPMA 1OWPA 2CEKA 2F7SA 4F3NA 3I8SA 2IUTA 3L07A 3RO7A 4G01B 1TB4A 1EZ1A 3S5JA 3OJEA 2Q1TA 4G24A 2ANBA 1O94D 3CRQA 3KBBA 4WUVA 2PXHA 3U40A 4PC3A 3KOMA 3FCUB 2Z8ZA 2R8ZA 2O8CB 1W5TA 1Y7PA 4GM1A 3U4AA 2FR0A 4Q9KA 2Y6VA 1Z36A 1GTJ1 1C4XA 3LFTA 5LWQA 2XQVA 1WDMA 3FCCA 3J81k 4OHUA 1TQ4A 4GC9A 1I2AA 1V71A 4B7CA 4ASUD 1TNDA 4OY3A 3JWGA 2CMKA 1JA9A 2B30A 3JWIA 3ORFA 4RSMA 4V0LA 3JQAD 1CY8A 4JC4A 3WQRA 2Q3HA 2VDPB 1TM5E 4OU5A 5KSWB 1SBQA 2W2PA 3OZ7A 4UHCA 5CH8A 1NUUA 3EUAA 4M6WA 1COWD 2QMQA 4OJTA 4CM8B 3C3CA 4ARIA 4BU1A 1QC5A 4ENUA 3ZE8A 1EIZA 1FVXA 1TZJA 4WT7A 1J06A 2G28A 2PWZA 1TA0A 2WWTA 5FR2A 2E1PA 2IYOA 2BMEA 4WXHA 2WWVD 4D57A 2GD0A 1BMTA 2QG6A 4KQWA 1RKUA 1DAIA 3FMOB 3JAWB 5ECWA 3QX8A 2YV3A 3OVMA 2FZ5A 2PVCA 3I0NA 4FMPA 1CBUA 1B42A 2ACEA 3L7AA 4GUDA 3KSMA 3OJXA 4MB6A 4O33A 4OA8A 1L7AA 3EOZA 4X6YA 4BFTA 3TXAA 1L3IA 1SG0A 2PJUA 4RA6A 5A02A 4KB5A 1GZ7A 1I3OA 3IVAA 3PVZA 1T34A 5KDDA 4CIVA 3FKSA 3ABZA 4DVJA 4C1BA 2PR2A 3ITNA 1JHRA 4DPLA 1DRVA 1Q0ZA 1E9EA 1A3CA 1A4IA 1O96A 2JD2A 2O20A 2QT0A 2WJJA 3F90A 1D4ZA 3GJ6A 3HABA 4BLQA 2O8FA 3OEYA 2FMKA 3R3VA 3FOCA 1IHPA 3FOFC 2OL4A 4N3NA 2QX8A 3DBRA 3PQDA 5FTMA 4MZDA 1PQ4A 3SWWA 5MHTA 3ESYA 3JWEA 5TX7A 5DW3A 3RTEA 5AVZA 2WHYA 4LRWA 5JRJA 1QP0A 5F3RA 1KVQA 3EGDA 5M3BA 3OUZA 4PEVA 5DHSA 2BI4A 1NL3A 3B60A 5JQWA 3I9LA 1ESCA 3N76A 2ZM6B 1UODA 3MWFA 3P0JA 4BZPA 4Z54A 2C57A 2X0FA 3PEWA 2W90A 2CLIB 1ODJA 1PTKA 3T4PA 2E4WA 2EJTA 3OQMA 1DJMA 2JIDA 3G0OA 4YO8A 5EHIA 3TXXA 4YRGA 1O0SA 2CV0A 1GAEO 3O92A 3L9XA 3B3QA 1RXUA 1DJPA 1K6IA 3CW9A 5SYNA 5AH0A 1XAGA 3V7FA 4OQEA 3OCJA 1S0UA 2GZMA 1FFGA 1XT6A 2QD3A 3BJZA 4TL9A 1K4YA 2ZIZA 4OLAA 1QYRA 3AJ9A 3R6WA 3RHSA 3CZMA 1Z8FA 2YIMA 3FMIA 4GMGA 1OBVA 1XZCA 4AN0A 4C7BA 5K0NA 4PTLA 4BXOA 3ON5A 1T5TA 3GFBA 4RVFA 2I1WA 1J5XA 4RZXA 4FHZA 4DDWA 4JP8A 2B61A 2VYCA 3UV3A 1HLDA 3GUUA 5AVTA 1G20E 5L7WA 5IH3A 3T15A 1WXIA 3FCOA 2Q3DA 1CR2A 1TUBA 1D7AA 1Z45A 4HKTA 4RA9A 5FA8A 3Q9UA 3N8NA 4EECA 3B9QA 3D3WB 1IY0A 2IA5A 2GTIA 4IGAA 4PYIA 4CTJA 1KDPA 3OEWA 4CLRB 2GKGA 2NO5A 4CTKA 2ZGVA 3BGOS 1N6PA 4E07A 2AFIA 1FFWA 3EFEA 4G5XA 5JCPA 1U3DA 1GWNA 4U2DA 3IUNA 1TCCA 1SCUA 4KX5A 1PHRA 2NAPA 3QMMA 1HZJA 4JJ6A 4X20B 5I7RA 3EZ6A 2HRZA 1YCHA 3OC0A 5DI3A 4Q47A 4HB0A 1Y80A 2A9KA 2QL7A 3PQ4A 4GICA 3I83A 1QE5A 1EP3B 1R0LA 2ORED 3E0XA 5G1OA 1HORA 1NQXA 2Y71A 4BX0A 4TLDA 4C2BA 4FCCA 4Y2GA 1LQ2A 3M9XA 1GCGA 2A94A 3PNLA 1HETA 3IELA 4NJOA 4FR5A 3W5UA 1UXGA 5BYAA 2DTDA 1Z29A 4M0KA 3LQQA 1ONNA 2NACA 2C5FA 2BAGA 2HQSA 5HZHA 5GJBA 2JLRA 5E4YA 2FDCA 3RSLA 2ISSD 1WXEA 2RJNA 2Y8EA 3FGZA 3ITKA 2J9YB 3PGVA 4EI8A 4MRNA 2WWRA 3CN9A 4HTAA 4RGQA 4M1EA 4U39A 4NPCA 3WQHA 5K3SA 2IY9A 3TMAA 3I0MA 3HMKA 4DC9A 1EFVA 4O4HF 3TD6A 1YR7A 2JJ8A 3PQ8A 1LTQA 2AVNA 1PD1A 2V7EA 2W8BB 2WYIA 4YP7A 5JBQA 1X7YA 1MB2A 4CQJA 4OHOA 2JLCA 3ZY2A 2EJVA 1GXSA 2QGNA 2YWJA 4AJKA 5FFNA 5JPIA 3OE4A 3HWWA 4RJLA 2VAPA 3WYGA 2BCEA 2ZYUX 4IDEA 5A6SA 4EUEA 3HG7A 2RGWA 3X1ZA 4NSNA 4XAQA 2CF6A 3EZXA 1FW8A 1Z2EA 3KJQA 3WOHA 2R4TA 2VDRB 3CCCA 3JTEA 3LBNA 1Y89A 4NNJA 3WMGA 3F98A 4MITA 5TMPA 3VKGA 2L82A 1JKMA 1QIJA 3VU0A 3FG9A 4ZJUA 2A2ZA 5E4FA 3PUVA 2ADMA 2XNCA 3G9UA 4MVJD 4U7PB 1K8ZB 1OV6A 3WLNA 4F72A 5FUYA 3HDYA 5I7AA 3FXAA 2WKQA 4LA4A 3SS8A 1NJ1A 4AKHA 4H6WA 2WWGA 3NBXX 1AQLA 3ELBA 2HMAA 2BTQA 4YJHA 5ADVA 3KOYA 3V1KA 2X2FA 4LSMA 3QVGA 1E9SA 1OREA 1GP2A 1W5AA 1XYVA 3D3EA 3IXQA 3PU6A 5B2ZA 4MO9A 4BRSA 4B6RA 5K03A 4BVKA 3MTQA 4GVXA 2XKBA 1P33A 3RYFB 3AL0C 1B8NA 2CXRA 2PM8A 3SHQA 5FUMA 2JL1A 3NWPA 4MCJA 5C80A 2RE8A 3T7EA 2IHTA 4RAQA 1X8JA 1H2YA 2LKDA 3IQHX 1YQ9A 1T29A 2AX3A 5DNWA 2PGAA 3V7NA 1N6LA 3Q7TA 1ZXBA 3Q7QA 1USKA 4O4IB 1C3XA 5EHXA 3T7AA 3K1ZA 3ZCQA 4D9BA 3DQZA 1EG2A 2BCJQ 2HBRA 3QOFA 3TW0A 5JFOA 4DMUB 4V0RA 2GK6A 4JMLA 5DGIA 2WF8A 3I34X 5H3LA 1Z34A 2WU1A 2O6HA 2H48A 1SCBA 1BW9B 5CM8B 5D7BA 5IAJA 1YBMA 1KE1A 2J5BA 4IEFB 4HLUC 3KXPA 1B0AA 1UQTA 2QORA 3T12A 4FI3C 3S99A 4R1NA 3OD5A 2B83A 5CJ2A 4G0UA 1T9GS 2NU9A 4AKTA 4UZSA 4D9JA 1NNEA 1PSWA 4FFLA 3IBTA 4GP9A 4BP1A 3PNVA 3NXSA 2ABWA 4JI2B 4A16A 2YMQA 3EASA 2V9PA 2ZIVB 4N8SA 3KXKA 1IWOA 3ZGOA 3FPEA 4KR3A 1I7SB 3E1SA 4R9NA 5C8YB 5K3CA 1G18A 1DWOA 4ZK2A 2JI6A 3AW9A 4BVHA 2H7YA 3G8CA 3NBAA 2YDYA 4GI3A 2O05A 1Z6TA 4KE6A 3TF5A 1CQIA 2XGSA 3P9ZA 2EHJA 3H4VA 1EU1A 4G9BA 1C1YA 2XTZA 4HUJA 4FMCB 4JT8A 1TJPB 1UWKA 5CVUA 5ES3A 1L5KA 4JI4B 4DCPA 4XM1A 3AHHA 4FYYA 5CB4B 1JBEA 1R2QA 1TZCA 3MF4A 1O4WA 2BMJA 3P20A 5K0TA 1BW9A 5MDHA 1QCYA 1SC4A 1M1YA 4Y9TA 2FW7A 4TVBA 1PZMA 4E70A 1E63A 3CH7A 2FMIA 2Q0XA 3IJPA 2X4GA 1XZFA 2Q5JA 2VT3A 3RVNA 1F14A 1EBFA 1OH7A 3U4DA 4INZA 4LECA 3C6XA 1JS1X 2R8YA 1KSHA 1Y7IA 1M5TA 4RESA 3A28A 2OESA 3VOSA 3DPSA 2QL6A 2Z58A 1O6BA 4UTRA 1JAYA 1WUYA 3VZPA 1P1RA 5JNVA 3W6ZA 2CB0A 1WB9A 3GDWA 2CN1A 3AOGA 2QN2A 1UMKA 3E15A 3EPJA 1KK2A 3D31A 4RTJA 2C2OA 4WERA 4YCMA 1D03A 3K8OE 3IA7A 1VECA 5LZ9A 1SC3A 1Z56C 3SNKA 3VVBA 1NVDA 1O6CA 4A5SA 2RGXA 4N8EA 3N39C 4PVCA 2HK9A 4D42A 3GDHA 2H2WA 4FYPA 5EZYF 2HLDD 1SU7A 4BBAA 1ZNYA 2ZBDA 3PYMA 1X8XA 2HO4A 2R7LA 3QV2A 4YQZA 5HIJA 1L7MA 1T2EA 4GU5A 4RFLA 1JYEA 4ZQHA 4R81A 1P1FA 4NYMR 1J20A 4R4JA 3LU1A 3SZGA 4EHNA 2VJMA 4AL4A 4J8PA 4J6FA 5JQGA 4P4NA 3RVLA 1J0EA 2QE7D 1LBTA 3WB0A 2ZCUA 4BNXA 1FS6A 1E0DA 3NWBA 1FTNA 1T0BA 2QP3A 3EW7A 1M1NA 3DULA 4V38A 3V6LA 1X7YB 4D3YA 2JHAA 3F8SA 3KQTA 2HU5A 3CW8X 3FKJA 3P9KA 4HWKA 4C0QC 2A0WA 5JSHA 3ZQ4A 2GHTA 3V7WA 2Z09A 2FWAA 1YVUA 3STTA 3LHKA 1ATZA 1B74A 2RAUA 3V7YA 4FHEA 1RXCA 3EARA 3M6UA 1MXFA 1ETUA 2AZTA 4KO4S 5AW8A 2BMWA 3AF1A 5ALIA 4CUZA 3VSEA 2W6MA 2P9QA 3Q98A 4HV4A 3GV0A 3MBKA 1QV9A 2B82A 4ZODA 4F9FA 3COPA 3IQWA 1Z3IX 2VQSA 4YFVA 2IIBA 2C03A 1E1NA 3B48A 3H3JA 3ZS8A 1V5IA 4G5RA 2FN7A 3PE6A 4D82A 5HOQA 5DOVA 4WOCA 3E7PA 4F8YA 3W1WA 1N7GA 2WR8A 1Q1AA 3NT2A 4L76A 2QZPA 4TMYA 1H2FA 2FPGA 2EHDA 1QBKC 2FWPA 3M82A 4US1R 2W2TA 5AHWA 5BQ5A 4BIIA 2G0AA 3CLHA 2BGUA 2BFEB 1P0PA 2VYQA 3O9MA 5MFPA 4GOJA 1DRKA 1VXOA 3RYFA 3U4CA 1PR0A 5K1ZA 4EG6A 4RHUA 3TZQA 5AKZA 1K89A 4I1SA 3ZVLA 2HBQA 2ZYSA 5LMZA 1SKUA 2P9YA 4KO1S 1XA4A 4UD6A 4MW7A 5DLDA 5A1TA 2ZYHA 1KIMA 5AUNB 1NT4A 2EJCA 2HIAA 4Y3UA 4J0JA 1NW9B 2VLIA 1GGNA 4HDNA 5EHGA 3T94A 5JI2E 1R66A 2ID9A 4K8RB 5CCDA 4B6PA 1QTQA 1T3HA 1JG1A 4CM1A 4LX8A 4HDMA 3DNPA 4GRIA 1KFBB 4W5RA 2COKA 5DSXA 1AMUA 3ZPXA 1IZ8A 5BWCA 4CT5A 5IAKA 4NZYA 1RWBA 5F12A 5F2NA 2BN4A 3JRWA 1RJ9A 4RTPA 1P45A 3GA0A 5TMDA 2IS2A 5K3AA 1GDHA 3Q3JB 4H1WA 3NDBB 4ZZ1A 4FDVA 1SUSA 1XD2B 3AG6A 4HH0A 1FP2A 4C01A 4MQEA 5JYBA 1IZZA 5HQ3B 4ZMRA 2WWWA 4GP7A 4GH5A 2X1MA 4N01A 4URFA 4YDHB 3HXLA 4EKEA 4F92B 3L7MA 4YUYA 4DUZB 4N7JA 5K3FA 1RWKA 3E3LA 1URPA 1N3YA 3GHYA 2VZLA 2X0IA 1ZL2A 2X2PA 2OBLA 3GH3A 3GRKA 4H7JA 3RVMA 5IWAB 4Q19A 3FETA 4QYWA 4UHBA 3ONFA 4UASA 4M8IA 1TK9A 2O8NA 3CJRA 3NHAA 4H0NA 1MQ9A 1XZGA 4X1YA 3SQMA 2PX3A 4M87A 4IS2A 1J56A 2X0DA 3ST7A 5JAOA 1V16B 4D45A 2ZROA 4PFQA 3OZDA 2WV9A 2HSEA 4UM9D 2BUCA 5E6RA 1W44A 4B7XA 3Q8XB 2B37A 2B4RO 4MI9A 5BMVB 2EWVA 2H4ZA 4GR5A 4YRJA 4BFVA 1VE5A 1JJ7A 3PR2B 1BZYA 3ONDA 4MR9B 4UZFA 1MPTA 1RACA 4IFTA 4LGMA 3MWLA 4KR7A 3R4VA 1FNSA 1JQKA 2HHLA 2O7QA 4GI7A 2OK8A 16PKA 2NQTA 2ZRFA 2WIKA 3F9CA 3ZLBA 3VR2D 1BXGB 1OR8A 3BGWA 3WL7A 4IH1A 4P3XA 1LQUA 3BBLA 4TM7A 3VYVA 5CW1A 4E33A 3ROEA 4RF3A 2ATXA 4CMJA 1KQ3A 4IIUA 3U7IA 3QV1A 1FMJA 4KWCA 4WEOA 3U1VA 3VZDA 1H1DA 4MVJM 4CBVA 1QZZA 3A7EA 4XX0B 4LQ4A 5LLTA 4TWJA 1Q3KA 1JEEA 2OD2A 3I09A 1SCIA 3ESQA 2DBRA 4LHEA 4I3FA 3MBIA 3BTSA 4E2YA 4TWIA 3FLBA 2YZGA 1E2NA 1EDZA 1WXWA 1E2KA 3EVBA 2A7QA 2GVNA 3M81A 1DKQA 3GJ4A 5B2FA 3DZHA 5KMGB 1L5FA 1J8FA 1DNPA 5K8IA 1M34A 3CX7A 1J42A 5HFAA 5EC8A 1Q74A 2YR0A 4YIKA 1K7EB 2KE5A 4Y2XA 2PCLA 5ALMA 1A9RA 2RK6A 2ZEJA 1YE8A 2VH5R 3AZOA 5A7GA 4TROA 2ETVA 3LT5A 4JL8A 1M2JA 4L4RA 2C5HA 3GEDA 6REQA 1Y9ZA 4H16A 4OV6B 1YXMA 4BKMA 1C3LA 3FUUA 5KNDH 4F4IA 1JVSA 1E5TA 4MVCA 1CXZA 2ZUTA 2NV6A 4YAOA 1MENA 3EG9A 2Z9CA 3N3BC 4M9QA 3VU3A 3X1YA 4EHAA 3HM9A 4R54A 3HU3A 2B69A 4BO8A 3RC8A 3V1TC 2C99A 3F5SA 3OMLA 4F3KA 4K46A 4J1SA 1MQ8B 4IQFA 4LPKA 2JJ1D 3T4UA 1ZC3A 3ROQA 5AYVA 1GNSA 3UM9A 3KVVA 3E05A 1V1JA 2B1JA 3F5MA 3OPNA 1OZGA 5DDIP 1MORA 1BCRB 4O5AA 3EGWA 4I46A 5HKAA 1FDVA 3FTNA 4M88A 4O2LA 5THXA 2WOOA 1MEOA 1L5RA 4MOWA 5F76A 1LV8A 2C82A 2IODA 1AO0A 5I51A 4PY2A 4R8VA 1JDBC 3PGJA 1I51A 2IQ5A 5CX1B 1HG1A 2Q4BA 2Q07A 4NWIA 4CR7A 2VDMB 1BXRB 2Z95A 4LDRA 1C8KA 1GL6A 5ALLA 1QH0A 4I4NA 1TVKB 4HXYA 3PWKA 2ICAA 4GLOA 3D8SA 2H31A 2WJGA 3ZI4A 2Z2ZA 2E4XA 2H7XA 2G9RA 3A4TA 4R0NA 3L5OA 1FXWF 3C3PA 5DGDA 1JTFA 4AMZA 3HU2A 2HREA 3HSSA 1QG2A 1NONA 2JCGA 4QUBA 1ZMRA 4P58A 3ADKA 3T06B 4YRCA 4E32A 1P9NA 5FPKA 1X7XA 4R0VA 1HKUA 2ZSIA 2IU4A 1ZK1A 1DX9A 3BSWA 2PJZA 3FA2A 4LV5B 4FEEA 3GJ0A 4OEHA 3DMFA 1AV6A 4C7VA 1X74A 1JXOA 4JCOA 1DHRA 1EH5A 3GJXC 4D8TA 2PS9A 4BLOA 2ZDQA 1L3CA 1JZQA 4Q39A 2E6UX 1DOHA 1JIIA 1L0BA 3G2OA 4KXNA 1NVMB 5JT1A 1EWQA 5EJ9A 4UM8B 1AV7A 3IQFA 3RUEA 5K8CA 1GQSA 4G5FA 4JELA 1SCNE 4KQHA 1AGPA 4DQDA 3FR8A 5JJKA 3A3KA 3T38A 3FZEA 3DLIA 4XR9A 4UHEA 1HGXA 2FEPA 4PQRA 3TE7A 1LJUA 2FFBA 3ZHSA 1F7UA 1ADFA 2FX5A 2V5UA 1ZU4A 2AZ4A 5IUJC 1HDEA 3HB7A 3QNUA 1X9IA 5LOVF 1BDHA 2IXEA 3BE5A 3JVEA 3IXLA 1YO6A 1EVYA 4L8LA 2O2SA 1XZIA 4ZQCB 1D4FA 2XCIA 3I58A 4MP6A 3WOVA 3I9MA 3TJRA 1T6NA 1Z6ZA 4M0PA 1YE3A 1CUUA 1NVAA 1YRYE 1B41A 3E7DA 3WJ2A 2IYQA 4S3MA 5AT1A 5KQMA 1R9GA 3TQQA 4DQKA 1SBTA 2AFIE 4DDHA 1HPLA 2JFOA 1ZDMA 2YRXA 3EXFB 4IBOA 1EFDN 1GYRA 3F4KA 2BL4A 4PAMA 1MB3A 2C29D 2CYCA 1F0YA 2PXCA 1ANKA 4X8OA 4XRRA 1EFRA 1R9NA 4EG3A 4ESVA 4LF7B 1U6JA 2HBYA 1FMLA 2Q8PA 2HB6A 5J23A 2OORA 5C46F 5E6UA 3KPWA 2W22A 2EKDA 4FSDA 4YDRA 5DNUA 2CL5A 5JE8A 5J2TF 3ROKA 3SVTA 3THOA 2QZJA 3C3DA 2R1ZA 4EA7A 3BTVA 3KPYA 3OH8A 3I64A 3ADBA 1O87A 2AH5A 2EF1A 4GMXA 3RTCA 3VU8A 3RU2A 4DGSA 2FW0A 3E22A 3EY4A 1DSSG 2PU7A 2PL5A 1AA9A 1J97A 4L5BA 1JTEA 3H0KA 2EW1A 4HGYA 4QARA 4M8SA 3TECE 3NV9A 1GGVA 3WLPA 4ZOAA 2C94A 3IILA 1W93A 4C4SA 2ZCJA 1FLNA 1XXHB 3LVRE 1BCRA 1PWZA 3G8AA 3QU5A 3PLNA 1FSZA 3VPFA 3HI4A 1P4RA 2ZSDA 2DQYA 2JI4A 3DL7A 1GTMA 3QPVA 5HFJA 1MAHA 3EVTA 4DCUA 4JJIA 4BQIA 4D0RA 1K75A 3RSQA 3L1IA 4BRUA 4ECAA 2I4IA 3QKSB 1HEUA 2AI1A 2WF9A 3M5CA 3JD1A 5CXSA 4F8JA 3ZHCA 3EAQA 1TW3A 1YI0A 1C7QA 1ZMTA 3OZCA 5I9BA 3JAMA 2HF2A 3NW9A 3IGFA 4YQYA 3FWYA 2W58A 3PRKE 5D2CA 5KKNB 1JQ5A 2VCEA 3LJKA 4JY7A 4X63A 3ZV6A 1HSOA 2OV6A 1VSQA 3O47A 2WU3A 2PNJA 4Z0HO 4EI9A 5DXJA 3VJLA 3D4PA 4HDQB 4KUEA 2K5UA 4CNBA 3KQYA 1A8PA 1Z5WA 2NT3A 3ET4A 5IG2A 1BD3A 3AKYA 3C3AA 1K66A 5BNTA 3LP6A 2D5BA 3JPWA 5DBIA 3WLQA 3WGUA 4TV9B 4Q7QA 1U0TA 4KQIA 3EGCA 3UANA 1UMBA 1GSAA 1J09A 1XD2A 1YMUA 4AI6A 4OLJA 1HF3A 1L4HA 1ZVMA 2D0PB 4BC1A 4UARA 4DDUA 2DMRA 3ZV4A 4JKOA 4YJFB 3WO1A 4UEQA 1UDCA 2P3SA 3I5XA 5K4HA 4PO3X 3GAAA 1MAVA 2HZ7A 4I9UA 1Q7RA 2AQ8A 3Q7IA 5JRDS 5K8UA 5F5XA 2ONYA 1A5BB 1CRZA 1JRLA 2WINI 4MIYA 1KK3A 1TJ3A 4ZT2A 1C30B 2CUTA 1WHSB 3ZI0A 3I6YA 3ASYA 3RK1A 5JS8A 3SXUA 1JDSA 1R64A 4Q93A 5KEIA 2ZFUA 2JGRA 3K6SA 3DCYA 2I4TA 3KL4A 2O4UX 2HDNB 1U04A 3NVMB 5H1YA 4CMKA 4QIHA 1IB6A 3PV0A 4A0QA 2V0GA 4YB8A 2Y1KA 3O4FA 5G53C 5JFGA 4POOA 1BS1A 3UGKA 3WGQA 3JYPA 3D59A 4QWMA 1O2DA 2H18A 3I4FA 4JLWA 3SX0A 3GLHE 1XAIA 4QAQA 4A0HA 3IE1A 3JSAA 1P0IA 3IVCA 1L4GA 1JYFA 4KQGA 2QR3A 3N6VA 3FYUA 4Z0PA 1SQGA 3FZNA 3HSYA 1DLIA 1ISSA 3GFTA 3HFGA 4WHMA 4XEHA 4C78A 4CMIB 4JXXA 4G5YA 1PL8A 1Q16A 2G63A 2V6IA 5LLSA 3VR2A 4I55A 4ARZB 7REQB 2VUTA 2SHKA 4K05A 4DBLC 4HWSA 1HTBA 3H84A 2DFPA 1OBCA 3C41J 3IUMA 1CIJA 4OXYA 3INTA 5CIWA 2XI4A 2ZE7A 4RVUA 3PQ2A 4Q66C 3SJCA 3PNPA 4AG5A 1N36B 4OX9Y 1GLGA 3P96A 2X4DA 3T5PA 3UWKA 2BEUB 3DTVD 2G4VA 5BY2A 1P0MA 1ACLA 3OU7A 4CIAA 1QAMA 3GQBB 4MYDA 4JROA 3ZWWA 3U26A 5CMLA 2CLOB 3WKDA 5J1SB 3L4BC 4B2YA 3U1BA 4C0AC 1B6SA 2MYNA 4P8RA 4FC6A 3WBKA 1SZPA 3B9RA 1BAPA 1YOVA 3GFQA 3HJTA 3NPAA 2IBTA 1YGYA 3C3XA 3I0ZA 4ZOLB 2AS0A 3WB2A 4UVHA 4MMYB 4LDQA 1IM2A 3OOEA 4PFSA 4BLUA 1RQRA 4EKDA 1NI5A 1A8IA 2A5DA 4HUQA 4WSOA 1VL2A 2YXDA 1C3JA 1NRXA 3D2BA 4DV1B 1D4AA 2OWEA 4S1WA 5IARA 1BDIA 1L1EA 5GQSA 5CDGA 3S8EA 4C7XA 3QU9A 1AMOA 3ZKAA 2RKOA 3ZVRA 5C52B 1K2VN 1PK8A 1W0CA 1Z7EA 3PTZA 1Q84A 3W2FA 5GZ1A 2YFYA 1OASA 4RMHA 4K9SA 4D80A 2BHTA 4L4UA 3K09A 4OCZA 3RWMB 3QFCA 2Q2VA 4CI9A 3FRHA 4R3WA 3WLKX 1XBTA 1MH9A 4KFTA 4QYMA 2QRQA 5HMMA 1JLHA 2HPHA 4IO1A 3K0CC 4WN3A 4C0XA 1ESEA 5BWBA 5GM2A 1WOMA 2R68A 2X3UA 1R6XA 1VKJA 1WP4A 3JQBA 5IC5A 3EIEA 2VP9A 4P4UA 1NY6A 1X13A 3NP7A 2QENA 4I4TA 4X8HA 4ZOLF 2FEAA 3WQQA 5E3HA 3TB6A 3EUFA 4P81A 4R69A 5ALVA 4W1RA 3L8CA 4D41A 1DAOA 2VDKB 1VQ1A 2PSJA 2PUDA 4FYVA 1INLA 4DV5B 2FFQA 4LHVA 2NT4A 4M9CA 4OQLA 3CXUA 1MIOB 4B8ZA 3VZBA 1UM9B 1GY8A 1JFTA 1SIOA 4K0KB 5ALEA 521PA 1OB5A 2RSLA 3OY2A 5FRDA 3NR2A 4X1YB 2OENG 3ZZTA 1F5NA 2I1QA 4R2KA 4W63A 5GOZA 5EJ5A 3KWJA 4OH1A 1E58A 3V80A 1QPGA 2WG1A 4JUBA 3A3PA 5BQXA 5C1BA 4JB8A 5J47A 2XSZD 5KS2A 1QR2A 3TZ6A 3AYXB 3VR6H 4ZHSA 2EX0A 2BM0A 2I99A 5CG1A 2YOFA 2CW5A 5LP6F 2RG7A 3QBJA 1S8AA 4KX3A 1P3DA 3T61A 3WZLA 1GG8A 3QELA 1GEGA 5AVYA 3VSBA 1ZVJA 1T0HB 3U4QA 5EI5A 3PC3A 1GZHB 4GRDA 4YASA 4ND3A 1RR6A 5GZ6A 4GOLD 4I55F 5T3UA 3RUHA 3S7TA 5C4GB 4BNIA 1G8FA 4DHEA 4EUKA 3IT0A 3B5EA 4JLNA 2O48X 2R0QC 5EG5A 2XTJA 1TJYA 4R31A 5IDYA 2YJNA 1H23A 1UUFA 2R6FA 1Z6AA 2HWKA 2F43B 3W4JA 1BWRA 2Y92A 8OHMA 3E4DA 5HVNA 5AVSA 5JFTA 1XMQB 2BKEA 3KQPA 4DWWA 4L9SA 3E18A 4QTYA 2CL7X 1T1SA 2B5VA 2QTLA 1O9GA 4D9IA 1EHYA 5FTWA 3RSSA 4N5DA 3CPJB 1Y1TA 3EN0A 1AXRA 1R8YA 1Z6YA 2MU1A 1T1JA 2P5UA 2CBXA 4HDCA 1F6WA 2CVOA 2O3QA 5F7OA 3O0TA 1NFQA 1OLSA 4QSHA 5DTJA 4P34A 4PINA 3U7JA 4P08A 2XMGA 3VU1A 1KHTA 2AX4A 2HRCA 2OUKA 4IICA 2B2CA 4OQDA 4KVAA 1KSGA 3KK0A 2F1IA 3PICA 5EIBD 3F1KA 3NNSA 3KJHA 1IATA 4ARSA 1H1LB 3TEJA 3BZUA 4IIDA 4EGAA 3CZ4A 2E6KA 2IGBA 1SOAA 2AI2A 1T9KA 2VP4A 3BK1A 2B34A 4UE3S 2J7PD 1EFPB 3F3KA 3AG5A 4F38A 3ND9A 1P9RA 1UT8A 1VMIA 1WOYA 2YY5A 3AWDA 1TMKA 2MSNA 3K5WA 1V95A 3IDQA 4IH9A 4OXXA 2XWPA 1GPH1 3L0YA 4UXIA 3OPQA 5CFQA 1U8YA 4UVGA 2YNMD 3CUYA 3HKBA 1O58A 1QE0A 2G4LA 3OZXA 3R20A 4P2GA 4XJSA 1KZ6A 3LY7A 5D3KA 2XA1A 5FPYA 3KPJA 1A5SB 4IKOA 2Q2QA 1C0PA 2BR5A 5DBHX 4CZ2A 5I45A 2O06A 2A9FA 2WSBA 3OF2A 1H3FA 3SYKA 2APJA 2EQBA 3EVDA 1IOLA 2DULA 1BFKA 4HMPA 3VR3A 1DKUA 2G06A 1ZD1A 4RIIA 3WL5A 4RCYA 3KHKA 3D6HA 1ZIYA 3VU9B 4JLMA 3DZGA 4M0FA 4LZZA 3R4CA 1ZVKA 3A37A 3RYCB 2XGOA 4W6ZA 4DSNA 5DNDA 3EFBA 4J0DA 5EXTA 2FFAA 2XZLA 2H52A 1R5OA 4LOKA 1R50A 1ZU5A 3SIRA 4YRMA 3F6RA 1R10A 3A1TA 3KVRA 4QUHA 4WVFA 4X61A 5EFOA 5E0KB 2DQ4A 5JXWA 4QQFA 2VHWA 3EBLA 1FS4A 1RJEA 4TS1A 1CQZA 4XTRA 5TDHA 2B1RA 1XPUA 1TOAA 1OVMA 3GVCA 3LUGA 3QMPA 1UOOA 2G67A 1GUDA 1G1AA 2LTAA 5E1BA 4RDXA 1N92A 3O84A 3RS3A 5L3VA 3KVOA 9ABPA 1YNSA 5KYWB 1I0ZA 3SJ7A 3H7AA 3TN7A 1MZPA 2YXBA 4HTFB 4S35A 5LOVA 4G0NA 1T9BA 3PQFA 4QDXA 4V02A 3KLBA 4HS4A 3S40A 2Q99A 5HJ7A 5KNBD 2JFWA 2V7BA 5ILGA 3LIPA 5DM60 3ZDFA 3D2CA 4IDDA 4FEYA 4EQZA 3KO8A 2P5SA 4HDRA 1ZRSA 2UXBB 3DVSX 3FLMA 3BZBA 4HAWA 4FZVA 4IAOA 4QO8A 3BZWA 4I36A 3G6WA 2RBGA 3LZCA 5E7JA 4H15A 4F6CA 4LPSA 2CMFA 2YH2A 4KI0A 3LGSA 3K2BA 3R76A 4EHHA 3R5XA 4MUYA 3R09A 3ZHYA 3DKKA 1DIAA 3PBKA 4I66A 3VDMA 4FFDA 2HWWA 4TQAA 1E9CA 4KDEA 2EATA 3RIGA 5I3ZA 1JQEA 3UHAA 1BHO1 5HGJA 1KI8A 3OT1A 5JJLA 4HZUB 4LHSA 2BHSA 1ZA1A 3MN1A 1VCNA 1OSNA 2P9HA 2X0JA 1E8DA 3R5JA 4TWAA 3W2EA 4YH1A 5EHQA 2AXNA 2DKNA 2VJMB 2X14A 4H59A 4CLDA 4NMLA 3ZY4A 3FRIA 3ASVA 2YJ3A 4E12A 1XMPA 4K8OA 4QNNA 2ZIXB 4E08A 5IT9A 1S2NA 2PX5A 1L5QA 5COAA 3L49A 3PJEA 2GJ8A 3AR2A 3CNNA 3DZKA 4FONA 2P4HX 4JLBA 4DF3A 4EJ0A 4EYKA 3E1KA 3VHXA 1ORDA 5DWDA 2IUSA 1MZVA 1ZUD1 2WSLA 3H1EA 3GPBA 3ZD8A 2XWJI 4FGWA 1W4RA 3BK2A 4UVDA 1OGIA 3O75A 4C3VA 4BFXA 1IJEA 3NUGA 4MUNA 3O31A 1JR3E 4TQGA 1DXHA 3IEVA 1Q1NA 4JB2A 4NAHA 2BEWB 3GCWA 2AZDA 2JRCA 2EP5A 1Z0FA 3C3JA 2DUNA 4GX1A 4MWSA 3T3HA 1IWBB 1ESDA 4TVOA 2VG8A 4PCVA 3L18A 4OGFA 2QUBA 1B4DA 3R3ZA 3ETJA 4KIWA 3REFA 3GT0A 4Y2RA 3D7LA 3KZXA 2WTBA 5LFAA 4Z7QB 4HDSB 2ZRIA 4KV9A 3M4JA 1I7NA 2HQBA 2CDBA 3B1VA 5CDFA 1QG6A 2HJVA 1W1WA 2WM2A 3T1YB 4X20A 2EU8A 2I03A 2JASA 1U0JA 4MGKR 4WNYA 3Q3IA 5KTPA 2XDQA 2XKKA 3GJRA 3T7JA 2Y1DA 1UJNA 1WCV1 5L3SA 3K4HA 3V2IA 5KSPA 3C8UA 2Z8XA 3ZHOA 3S0JA 3MYYA 4KPUA 3T3MB 3L43A 2J9FB 1V8ZA 1I6LA 4XR4A 5LB2A 1F2UA 3ELDA 1HE4A 2DAPA 1P1BA 2RK4A 3JQRA 3KLPX 4MUHA 2IYUA 4CM5A 4EZEA 5EKDA 1D1PA 1KBQA 2XNDA 5E7MA 2HCFA 2WHPA 3W5HA 3EZNA 5G4KB 3VC2A 3BQMB 5AW7A 2H1HA 5AIAA 4BFYA 2D8AA 5K09A 3KOUA 1GUZA 1EDDA 1F12A 1F2DA 2MSDB 3IUJA 3KXDA 2LUOA 1FUIA 4TXNA 4X8LA 2EFHB 5HF6A 4O1IA 3WYFA 2QNBA 2WLTA 4BEVA 3AFIA 2ET6A 3H8SA 3ODPA 4RS4A 5A5VA 3DWGA 5AM0A 1W75A 3K5PA 3OX4A 2ZRHA 3DW1X 4TV9A 1HDGO 5JH7A 3DV0A 5CEEA 3CBQA 5HA5A 3THYA 4LDPA 5A4FS 5MFZA 1UXOA 2OYSA 3G9XA 4C2TA 4HXFB 4IUBS 2XYHA 3V1LA 2P3OA 3HUEA 5AK3A 1VC2A 1T26A 3WMWA 2WZBA 2AK3A 1U2GA 2CL6X 1YBAA 1QQAA 1IOWA 3WFZA 2IH2A 2XSZA 2FEXA 5H9VA 1E96A 2FGJA 2ZBFA 4UPDA 2BD0A 4F2DA 2QYHA 3HBJA 3CYFA 4XDZA 1O7JA 2QUJA 2XNKA 1XZKA 2V03A 5FULA 2HEIA 4PLZA 4MW2A 5JO0A 1AS2A 3LQ4A 5BOVA 5D5PA 3P4UA 3GGCA 4L6AA 3AI7A 4IY1A 1TT7A 2WSYB 4JEIA 2IXTA 2Q0QA 4M9XA 3FLEA 1DTSA 1WABA 4WESA 3TEFA 821PA 3GLIA 1PUIA 4HNVA 1H2XA 3R9XA 2VPYA 3D8UA 3GJ7A 1NVEA 3LKDA 2HV8A 2Z1DA 3S2ZA 2YASA 3JY6A 4TLMB 3ID6C 4V0ME 3M6VA 4TT3A 1USGA 4CKXA 2A9OA 3WGKA 3F46A 1AHNA 4PONA 3A1DA 4YPOA 1EI9A 4IGKA 5CURA 1P5ZB 2GXQA 5CVJA 2ZJOA 2OFPA 4LI3X 4YNBA 2P9JA 4BNYA 4ZGWA 1EK6A 4UM5A 4Z1MD 1JHDA 1PDVA 4U9HS 4EY6A 2H8GA 3OFVA 1GEEA 2F6RA 1P17A 1GILA 1Q0PA 4CEHB 3C8DA 2D62A 4DWJA 2RFLA 3ICVA 1P1KA 1RAHA 1USUA 4S2EA 2HXSA 3OO0A 1PI3A 2C78A 3D1JA 3N0WA 4I50A 4YRDA 5ALNA 1O5IA 4OK6A 3KEQA 3LF2A 4PLYA 1TM7E 4R1TA 1J2RA 3PUIA 1GUFA 2FPOA 2XQKA 1VHJA 4TXJA 4IHQA 4G5HA 2QRVB 1T2DA 3CONA 4R2IA 2CCJA 2XUPA 4LBWA 3GP5A 1XHLA 4AZ0A 5U9CA 3GU3A 2V4MA 1DAKA 4GXQA 3U62A 2J7PA 1ISIA 1ZMOA 5BN3A 4URWR 2W00A 1WPRA 1K4MA 2A6PA 1XPOA 4DLKA 2HEGA 3UGJA 4M98A 4F1KA 421PA 2CFTA 3E2IA 3OZIA 5GVSA 1HDCA 1HT3A 4NI5A 4PSCA 5DLQC 3N0TA 1JEDA 4JL6A 4Z49A 3SK0A 1K92A 2JG3A 4PIVA 5IC4A 1ONSA 4D26A 4KR6A 4RV9A 2VF4X 3PT9A 2XNHA 1HFKA 4PX2A 5CD1A 1YQEA 3WG9A 5DI3B 4XI9A 1ZGAA 2IZ7A 2NQ8A 5E2IA 3QLEA 3KQOA 1JEAA 1B14A 4LJ5A 4P33A 4P4SA 3FPLA 4Q9NA 4D4GA 5JCXA 1TVMA 2O59A 3RC1A 5KAMA 4PZPA 1E7QA 2QD4A 1KJ9A 2FDXA 3OX2A 3SC6A 3WLIA 1ID8A 4OMDA 1R7RA 1E94E 1K7CA 1TAUA 5HRAA 4I5EA 4MV5A 5ILQA 1KZ1A 2XVMA 3CJTA 1P77A 1XIVA 3D6TB 4RMNA 1NAHA 4D9MA 2BCGY 1QO9A 3G0GA 1GLNA 2VOJA 3KS9A 1YH3A 4DZTA 3EMKA 3IOBA 1UINA 2ZQ5A 2GWRA 1QIDA 5EP3A 1GG5A 2QE6A 4CU5A 5I01A 5L7YA 4KRFA 5CLIA 2GBGA 1QTRA 4MVJA 2BGRA 2ZJBA 1DUIA 1M7GA 2GEUA 2YUTA 5FEMA 2VNAA 1XEFA 2WD8A 4AYXA 2YWRA 4IFIA 1ACMA 3FDIA 3UK7A 4D4IA 2HIMA 2XUFA 3SX2A 5HJEA 3DBIA 1RPZA 1FRVA 4QUJA 4C6RA 2YOHA 3L82B 4EBBA 3SQXA 1VJTA 3SI7A 1V7CA 3EWNA 1PFVA 1ZPDA 3IAS6 4FN5A 4G07A 4LFAB 5FUXA 3MWDA 1UIMA 4AO7A 3I73A 1RM3A 2F8TA 5B3JA 4J49A 1TVKA 2HMTA 4OLBA 3ZK8A 1NLUA 2ZI7A 4EGQA 1NN5A 1QQTA 2KMLA 4REQB 4XD7A 2YIJA 4LISA 4DMKA 3TYXA 1YVPA 2XCUA 5E7QA 1ZNZA 2XQJA 3IAUA 4IRXA 4O4JA 3GZNA 3RRJA 1YWGO 4LOHA 2WKRA 4LYEA 4PXAA 4XX1A 4PG7A 5ALKA 3RROA 2XA9A 4A2CA 2C58A 4F3YA 3CLUD 4B4WA 1T0PA 1ZA2A 1E5XA 1S2DA 3E84A 4ZCRA 2C7BA 1FE8A 2VC2B 5LNK1 1UBHS 2D4AA 1IJFA 1GL7A 4RHCA 4BO7A 3DVAA 3BAZA 4LOAA 5AVXA 1L5MA 2PL9A 2PT6A 1JKXA 5C3MA 1PCXA 1U1EA 2QE7A 2VFAA 1LX6A 2EL7A 4QGFA 3P9CA 5KQSA 1KFKB 1BGWA 1JQ3A 1KOFA 4NJEA 1Z4NA 4LOJA 4F91B 1XQYA 4MGEA 5ER9A 3PHGA 1GZVA 2FGKA 2GBIA 3ONNA 2FPGB 3Q41A 4FYJA 4IPTA 2OXTA 4F4HA 6Q21A 1U7DA 3AU9A 5F77A 2GEKA 3CA8A 1JNYA 4MS1B 3ZXSA 4OSOA 3V46A 4ENWA 2Y1XA 3FPKA 3AEQA 4RGBA 4S05A 4RLSA 2ZYRA 1SVMA 2MSKA 4MQ5A 1RI5A 1XDSA 4TSKA 3GA5A 4RBNA 1I6MA 1DT5A 2WBLC 1OXKB 1CF9A 1U7PA 1WO8A 1GIAA 2VEOA 3H1PA 3VUFA 4B81A 2QUZA 3H2GA 2N1MA 3KYCB 4CG0A 4JBWA 4EJSA 2GMWA 1QIKA 1JHAA 1XEWX 3AVOA 4RF2A 5KJ1A 4PQGA 4QLOA 1NXQA 3S2FA 4JGGA 1EA5A 1DPFA 2C97A 3JS5A 3LWBA 3D3KA 3QY9A 5LCXA 1D1SA 3K70B 4ZT5A 4TS3A 3DEAA 1APBA 5HRUA 4QU0A 3MINA 4DMMA 5BRJA 3T1QA 2VDQB 4FXPA 4LRSB 3BB1A 2D74A 1O08A 2BFDA 2FCRA 2P6OA 1HL7A 4J6EA 4P3PA 1RLJA 2O0MA 4EY3A 4ZAZA 2B4AA 1XMSA 1XWFA 2G40A 4OXIA 1GTRA 1GTVA 2R1TA 2F1HA 3HFJA 1KMNA 4LJ8A 3T0GA 1L1RA 1GAJA 1PT9A 5L7TA 4YAEA 1VKOA 3MCTA 1H5UA 3UWPA 1IN7A 4HWPA 4Y67A 1AGXA 1T3ZA 3O82A 1WW8A 3TSWA 1T2NA 3VH2A 1OZFA 1DKOA 2V0NA 2XCLA 3A04A 1MTOA 3HWRA 4BVFA 5GTDA 1V6CA 5LC1A 2FF5A 3Q3GE 4DSOA 4ZJZA 1CRPA 5BW8A 2QRGA 2CE7A 3CO0S 3GGOA 5FL7A 3GJ8A 3WGLA 4CLOB 4N65A 1NPTO 1OXBB 3R8CA 3ZHRA 1ND5A 3FJ1A 1OPXA 2RGEA 4K9PA 3NWOA 4B4VA 4DNXA 1NVUQ 1ZNWA 2ATVA 2XWBF 4AICA 4I5GA 4K9DA 5I8PA 3M6AA 1CZOA 3M6XA 4G6ZA 3IFSA 4Q21A 4ENVA 5JBIA 1C1DA 4CTNA 3O2QB 4GWLA 3DWIA 2C2YA 2P4EA 3SSNA 4FT2A 4AO6A 2M9MA 1UOQA 1KAOA 2V9ZA 2VQ3A 3N2KA 4NBTA 4G97A 2O3UA 5BMVF 1ML3A 3Q87B 4B9EA 4H4DA 4XCQA 4FFOA 1ZOLA 1GRRA 4CG2A 4X6LA 5CDUA 5F64A 2JFVA 2PE5A 1RBZA 3QQPA 4DLXA 4NYIQ 2NPIA 3CVJA 4W1SA 3RAEC 4TKZA 1MC8A 1WDWB 2O0JA 3OA2A 4U6SA 4S24A 5F1PA 5FJIA 4HVLA 1NMQA 2AD1A 1B3BA 4GBGA 4OL9A 4BCDA 2J59A 4HQNA 1NVBA 3HA7A 1I4TD 2ZETA 1S89A 1U1FA 2XNDD 1BSVA 4HD8A 1NAIA 1ZI6A 5IUNC 3FPCA 1R0RE 3GBSA 3DZBA 4R9SA 3I9V1 3QIVA 1E62A 4H2DA 3CY6A 5BT8A 3K0CA 5CG2A 5KVVA 3CNLA 3UT5A 5CB0A 3PDCA 4UNPA 5DTMA 1D04A 1DC6A 4H27A 2AB0A 2R85A 1RKXA 4IG4A 3WDLA 1TTPB 1WTAA 3PCTA 5M5BA 3CLTD 3KETA 1PZXA 2ZYIA 4FLFA 2G9UA 1Z2DA 2W37A 2C3PA 2WKSA 3STYA 1QYXA 1R6UA 4NG4A 1KI6A 3RBZA 3G0IA 1XLWA 3KKEA 4PC6A 2CZCA 3BQ9A 3IOMA 1XR3A 1P4SA 2E1RA 3OT1B 4IX9A 5I7OA 4C4TA 4MRVA 5B3KA 4YP6A 2HWXA 1A5AB 2X5KO 2DHRA 1YIAA 1HDRA 4KSBA 4J2HA 4L9WA 1UDAA 3T7RA 1QQBA 1U31A 2AQKA 2GBLA 4PX3A 3CF6R 2ZJ6A 2EERA 1W48A 2NX2A 1GPWB 2JCSA 4H18A 4MV7A 1AUQA 5BVGB 5H3CA 1UP4A 3HY4A 7AT1A 4HLNA 3WO0A 1Y1PA 1Q0HA 1XJ5A 3Q0IA 4FUQA 4V24A 1OB2A 2QOEA 4RYDA 3NBZC 4NAUA 4TUYF 4YJ3B 4WOKA 3JX9A 4PU0A 4J90A 1KU0A 3EDQA 1VIVA 1VLHA 5BUCA 2HK8A 4XOIA 1V8DA 2B2NA 2HSDA 4HTFA 4YRNA 1FFXB 2XHZA 4XDHA 4JEUA 3L8FA 5EFZA 3R7BA 5LQDA 5AUPB 3B51X 3U7EB 1H0SA 1PAUA 1UOEA 5L4NA 4JSYA 3VMFA 4AZVA 2I6FA 2LV8A 4MYTA 4IWNA 4KXUA 5TJ9A 4IEIA 1LS6A 2VT6A 3H83A 1THGA 3HN7A 4HJXA 4XFDA 3SN6A 3T9FA 5KNBA 3QE3A 3JWJA 3KFVA 3QJYA 3K9WA 2VHZA 1B0PA 4QTXA 1MO6A 4HNAA 5AM1A 1AK9A 2P78A 1P4GA 1X8KA 1GV0A 1PR2A 1GVHA 1R3UA 1U5CA 1WIWA 2AV6A 4QJ4A 3UJ8A 2UYYA 3OQ1A 4IJVA 4PZZA 4P4LA 1UBLS 5AI8A 5EXSA 4F5WA 1N2SA 1UM8A 2LDBA 3VJKA 1X1EA 1U0EA 1XQ1A 1YI8A 3W5VA 3GWGA 3B3FA 3GAZA 1YB6A 2A0YA 3L8EA 2F3PA 1GUBA 2A1TS 3JVDA 5ALFA 2NTVA 4JI6B 2KPOA 2WSMA 3H3FA 4QXRA 3W8EA 1GCIA 1L3BA 2CMDA 3Q7SA 2QM8A 1QRTA 1NFFA 1NI4A 5FBQB 2GRJA 3CF0A 3TLGB 1C81A 2QZSA 3AL3A 2I9PA 1IHUA 2EP7A 3L2OB 5IXJA 4XEUA 2HJSA 1ADBA 1KYYA 1RYDA 3W1VA 2P9ZA 1Z0ZA 1A2BA 5DVZA 1UPXA 1PR1A 1MG0A 1BWPA 1N9KA 5A4MS 5DT9A 1DUSA 4W82A 1GLVA 1T1RA 5CAEB 2QW1A 4NKRA 1WEHA 5ALXA 4W5TA 5KTYA 3PXDA 4CXMA 3Q8LA 1GGMA 1UKAA 3V4PB 1N2CA 4XWAA 4UMDA 3MOSA 1O97D 4MSUA 1W2HA 2W6CX 5D6NA 3OECA 4NECA 3USES 2CB9A 3GEPA 3UG7A 1LD3A 4H3SA 2DP4E 5JSKA 4E2WA 1NE2A 2FVYA 5KYWA 2W6OA 4IIHA 3SGLA 5JS7A 4M0CA 5CFRA 3QLUC 3THWA 2DECA 5AVVA 3NC1C 1HE8B 3E2PA 4QJ5A 2JEOA 4LNAA 2LE0A 2J33A 2WUDA 2FDRA 2I62A 2HNAA 2CLMB 1V4NA 1ONOA 3L8HA 2Q50A 2XB9A 1L8OA 3LRXA 2DSNA 2XD9A 3ZBQA 1Z26A 4LYYA 3DAGA 1FDUA 4R1MA 3CLVA 3SCZA 4A8JC 4CW7A 2Q0HA 4NLLA 5HILA 1T3SA 3SMVA 4IHJA 3K8QA 1LQTA 4RL6A 1VIMA 3IIMA 1RCUA 2YFHA 3NEAA 4OYRA 3TTWA 1SFRA 1BQEA 1PR6A 3R3HA 4PC2A 4WLEA 4MHOA 4ND1A 5A3SA 3ZE0B 4CPDA 2J3JA 4TRRA 5DXFA 4UW9A 1W49A 3EF0A 3UJNA 4J03A 4KREA 4QRHA 1NE7A 5JNRA 1R0WA 1GDDA 1XELA 4LRYA 1JLLA 4BP8A 4ITVA 1HXHA 4M1QA 4YEDA 1XQ9A 5KWVA 4Q5IA 3W5DA 4JDPA 3R0XA 4XCVA 1SEVA 2AD5A 1DEAA 1YQQA 3LXMA 3RANA 3TH5A 5FFFA 3WP0A 2ILTA 1U0HC 3WBBA 3IPRA 1T10A 3BERA 2G1KA 1PG0A 2I22A 4II3A 5EMHA 4KFRA 4FCTA 4OHXA 2OPBA 2CUKA 4RZSA 4U00A 1JDZA 1ULSA 3OKFA 5FOQA 5I7HA 3D54D 1H6BA 3QUBA 2NYVA 2JBAB 4KFSA 3D7MA 4UBNA 3OQ6A 1YUNA 2O3JA 4OQYA 3UAXA 5KNCH 1RPJA 4NDZA 2JIBA 2JH8A 4Q7JB 2DRIA 2CZGA 1V5EA 5IK2D 1Y63A 1NLYA 3FTPA 4RD4A 3SOZA 2CXNA 4PLPA 3JZMA 1I0LA 4D0NA 1N9GA 1IVNA 3UA3A 1ST3A 3PIDA 5JNSA 5DFAA 1TIKA 3H6GA 1HYEA 1JU3A 4NCXA 3HN6A 3RRNA 1L4MA 1NJ5A 2P1RA 2WILA 2VSQA 4BO0A 3ZCRA 1G42A 3HWSA 5JZSA 3O03A 2RCYA 3BILA 3Q72A 2AFHA 3TW8A 1I4OA 1RIFA 4KBFA 2HSJA 3AP3A 2XKJE 1IEQA 2OEPA 2YZKA 1SG9A 5TB5A 2G9VA 1M76A 4JZKA 2ZDHA 1CUIA 3N0RA 1IAVA 4LYFA 1VE9A 4GOMD 3P19A 5LDGA 4QFCA 3M5DA 4R98A 1L5VA 5AW2A 4PTYA 3CBGA 5JR3A 1B6GA 3WHKA 3IHLA 3MTBA 4JJEA 4BLSA 4J0QA 4CM4B 4Z4IA 5CVDA 3UJPA 1UBUS 1QVVA 3B3AA 3KEFA 1TVEA 4D1YA 3FPAA 2X13A 2C5LA 1G16A 3ZX5A 4NARA 2H3EA 4YRTA 4B7UA 2G72A 2MR5A 3CX4A 3GT3A 4PZ9A 4RH0A 5JY1A 4UU0A 3JTMA 2FI1A 4E14A 2V9CA 3FHTA 1P75A 3W4KA 1KQFA 4NBLA 4M1SA 4XIYA 1SHJA 4GWGA 2GXAA 4V0MA 1NW8A 1OILA 4HGRA 4KAXA 4JYCA 1B15A 3X1MA 3LC2O 2BP7B 2V4ZA 2XMBA 3L04A 4MYRA 3NAMA 1BDJA 1B76A 5BSEA 4B3TB 1P19A 1XDGA 1T3TA 3RSGA 4QFDA 1JLKA 2OSVA 1KY5A 5KNCD 3K35A 2VZ0A 1PD0A 2AOUB 3KXLA 2OYRA 3KYIB 4RK5A 5AXDA 3ROFA 4JI8B 3IMCA 1G59A 1FU7A 3QEOA 1BCSA 3RS2A 2DC1A 4FJ1A 2RH9B 2A14A 4G0YA 5AQEA 1LS1A 4A10A 4JLJA 4E6EA 4EVQA 4L3OA 1Z62A 3CZQA 3HWX1 3T54A 4DBZA 1PLKA 2X8WA 4XVHA 5BSUA 1BVRA 1O9BA 2Q49A 3NC4A 3L6BA 3QKSA 3CT4A 3LUFA 3E3AA 3M0EA 2ZATA 1D1TA 1CSEE 2XUDA 3D6MA 2X0KA 3L77A 2KWIA 3BM5A 3QW2A 3A6JA 4IQ0A 4WTOA 4YT8A 4UQLA 5IAAA 4D0LB 1P5FA 2HMSA 4RA6B 1M0SA 2Y3IA 3ZQKA 4C6SA 3PHJA 3EFOA 5IH7A 3A4IA 2FYTA 3GBVA 4HLDA 4QELA 1UC5B 1SUDA 3PA8A 3PR1A 1VDZA 3VC7A 2WYUA 1FJ2A 3K0FB 4LG1A 2NLOA 4BNKA 2QX4A 2G9ZA 1YRHA 5EWJA 2ZPTX 4JWTA 3LKBA 1O5TA 4HYYA 3WA6A 1OJLA 4IZ6A 5CGZA 5K0EA 2NO0A 2GM3A 1DRUA 2P79A 3GW8A 3MC1A 5CLGA 3NM4A 3WHPA 3UXMA 3FNBA 5LVAA 3LX5A 3AQIA 1XZHA 5ENVA 2G71A 1L5ZA 3AM1A 3DWFA 3PK0A 1M34B 5JS6A 2VZ8A 1RWXA 2W7TA 3DMRA 4GMFA 4HADA 5FWXB 4OFZA 3WK4A 4AY2A 3LUKA 1JJIA 3JQAA 3UAGA 4FDAA 1BX1A 4BQOA 4CEIB 4YJ2F 3EVZA 4LQCA 1E4EB 4MR7B 1DZ3A 4Y2PA 4ZQGA 3RUCA 5BR1A 5IEBA 3NHFA 3ZR4B 3FFBA 3IIJA 1ZLYA 5IDQA 2D5CA 1KYIA 2YHUA 2DPMA 4XSHA 3BXHA 3REGA 4IIGA 1AKVA 4E5NA 2O7VA 3RWOA 1K97A 1WXXA 3K0BA 3DO5A 1PWXA 4YAIA 3AEUB 1ZXXA 4E22A 2VP3A 1K6MA 4DXDA 2NVBA 4Q3EA 1UBFA 2PX6A 3DA8A 4FNOA 1J4AA 1GNVA 4W5OA 1MC4A 1I2MA 2Z0MA 1HG0A 1XP5A 4FYIA 3R9XB 2WYHA 4M1OA 4C88A 5KYUB 1OQAA 3A8TA 4PSVA 3PD7A 1DDOA 4OX9B 1QTIA 2ATIA 2R6JA 4K40A 5C8DA 1R74A 1IUKA 1P6UA 2Q3JA 1C8VB 3OQIB 3G5LA 3V8RA 2QS9A 1UBEA 1ZC4A 2D3TA 4N1AA 4U2KA 5DEIA 2QJTA 3CZCA 1ZHHA 4AUEA 1XAHA 1J25A 3GIDA 4Y1FA 3SS7X 1OFVA 1WZ2A 1JR3A 3S81A 3OOYA 4MDFA 2CK3A 4QU9A 3GUZA 3HMQA 1UMDB 1U0SY 3B1JA 1XMIA 2VRNA 3O8DA 2WJ6A 3QEMB 4XWTA 2P2ZA 2G1JA 3A1SA 4M99A 4RO0A 4O2BA 4B74A 2WVGA 1PZGA 4C22A 4QTTB 1DO8A 1FDOA 2NSLA 1H4SA 2ZRKA 4WOBA 1WG8A 4RY2A 3RAFC 1DJLA 1E6LA 4EVSA 4CV0A 5BW6B 1BKSB 2CXUA 1U0NA 2YW2A 1D6MA 1N5OX 2WU8A 1DQNA 1F7VA 3H2JA 1RQNA 2Z5FA 3BIJA 1Q20A 3AONB 3LYHA 4HHEA 4BBPA 2TSYB 4BJ5A 3U80A 4QRIA 4PCLA 5MGNA 4CF3A 4QU5A 1EQAA 1G20A 1G5QA 2JGNA 2KW5A 1DAMA 3A3OA 4GYKA 2H1WA 4YUVA 3ZWDA 4KLNA 3PQ5A 1PQPA 3SR0A 2D7CA 2ZWVA 1KMCA 1IN4A 3FUTA 3G85A 2KHZA 2OXCA 3KB8A 4KQEA 5IXSA 2HPAA 2BH2A 3EDMA 4LMRA 4C04A 4EUNA 3WDKA 1UIRA 4YI5A 1OROA 1SAYA 1T4GA 3EMDA 4TTQA 2IYRA 3FMPB 1C4KA 4GX2A 1RC0A 2QN7A 4A8HA 4RADA 4C0WA 4YPVA 4KPYA 3I62A 3TO5A 3EH2A 5I8ZA 2F4VB 1DDGA 3AX6A 4CT0A 1IHOA 5B58C 4M0EA 4TLLB 3ESCA 4US0R 4LHZA 5ER6A 1HE3A 4O2BB 5TPWB 3MS7A 4YR7A 2PANA 3WWEA 2AN1A 4MV8A 1KFCB 1EX7A 1J2UA 4KN8A 1QJ4A 1BVYF 1XZLA 5CYFA 2CLFB 4FE3A 4BOYA 4CM3A 3Q40A 4V1CB 2F67A 1KWGA 4B4DA 2GPBA 5BORA 3OD1A 5IN5A 2QMUA 3BMNA 1WNTA 4EF5A 3PCRB 2PV7A 2YFKA 1XROA 3C1AA 3JQ8B 1K6EA 2OFOA 3QKTA 1Y5NA 2HA3A 3N8KA 5FWDA 3VPBA 3W7AA 4E1AA 5BV0A 1QB7A 1IK6A 3DAFA 1T9CA 4L5AA 5CA1F 1PBNA 2Y4OA 2FG7C 2OQRA 1M3SA 3ZXIA 4JLPA 3I01A 2WD7A 1CR4A 1E79D 1PS9A 1TLLA 1TRKA 3AF4A 4UAGA 4W1PA 5AW9A 2NSYA 5EERA 3D4LA 4JC5A 5KJ6A 3ZCTA 1Q7CA 1G21B 2HLDA 4QAJA 5ADUS 4JU8A 2FZCA 1D0SA 5L53A 5CJJA 4YJKA 6REQB 4HXGA 3UQYS 2VTKA 1GADO 4N3GA 1XD9A 4P82A 1AQ6A 3TOXA 3C3KA 5KTNA 3AR3A 2VJCA 2H2FA 2GK3A 1DQZA 3KZMA 2A1TR 3QLJA 4FYMA 1V43A 4HNHA 3WKEA 1XJQA 3ENKA 4TYYA 2Y1EA 1P61B 1H0RA 5DN9A 1R4ZA 2IE8A 4QEZA 3SEAA 1Y3BE 4JLDA 2GARA 2YIDA 4AZ3A 2JIOA 3JYNA 1VP3A 3ZHQA 2ESRA 3A2LA 2PWAA 4PE5B 1MX9A 1YRAA 2QAJA 1G8YA 5KU1A 3OIDA 4CIXA 1ZIDA 1YZHA 1GG2A 1MJGA 4I3GA 2B4KA 3ODGA 3V9AA 4FHFA 3QEAZ 1K5HA 2F3TA 1ZUNB 3I6BA 1NBAA 4KYVA 3MHPA 3U3ZA 3T34A 3ZYZA 4ZDKA 4FYKA 5D1NA 4BWGA 1MRSA 4PS1A 1NMXA 2IZ5A 1UT5A 3UJCA 1K7SN 1TRHA 2ZTVA 2ZZKA 1WUKS 2GA9A 3PEUA 3X43A 2XCTB 5CB8A 2IL1A 2F00A 1FNNA 3B6JA 1EIWA 4KN6A 2GVDC 1HRKA 4RS3A 2ES4A 2IZOA 3DOUA 3IUYA 3P71T 1HH4A 1WMFA 2C95A 2JGFA 4M0UA 5K8TA 3VNSA 1C80A 1C4OA 2C77A 2PMDA 3DNFA 3E5MA 2QEQA 4GT1A 4RE5A 4LKRA 2IS1A 1NC1A 1SOMA 2UVPA 5BVHB 2VHQA 3WYNA 2QPOA 2XMRA 2C00A 3IV7A 4GGPA 4DA9A 2OILA 4OSEA 4DLNA 3BWYA 1L6IA 4WCDA 1JZTA 1K68A 3RAGA 1YIDA 2EQ5A 4JUAA 5LQUA 1ZM7A 3CEPB 4UTXA 1NKSA 4R7ZA 2JBHA 3C6MA 3LZDA 1DRJA 3R0JA 3W2TA 3MAJA 3W6NA 3W78A 4TTVA 4TXMA 2VF8A 2FB9A 2YMMA 2B98A 4V0QA 1OIVA 2L17A 5J59A 3QEBZ 2YXEA 2UUAB 2O8BA 2V7GA 1VYHA 2HY7A 4PIPA 1TTHA 2JLQA 3M6WA 4ON9A 3WK7A 3L7OA 3LLMA 4OHKA 2F1RA 3QKWA 3VR6A 4CT4B 4F4DA 1M75A 2L69A 2I6XA 1OVGA 3A9WA 3AK4A 3QVJA 4CKYA 4CEJB 3MPUA 4KMRA 1QG0A 1DFIA 1FVFA 4FVTA 4UTZA 3WXMA 4CGYA 4PYRA 4RZIA 1PUXA 2ODBA 4OB8A 1RM5A 1MABA 2N0SA 1FXWA 3P1JA 2ODNA 1ODLA 1HLPA 2C88A 2I55A 2XIJA 1AUXA 2X7XA 2XE6A 2C42A 4C4RA 3F3SA 5IHPA 4DKXA 4IOMA 4DJAA 2FUG6 1A9QA 2VF5X 4RDCA 1SCJA 4CCYB 2WG2A 5I7WA 5TY0A 3U0BA 1H2WA 3DEJA 1KEZA 1AMNA 2B6HA 2OV2A 3ZDEA 2VXBA 1EM8B 1DEKA 3GUVA 1UMCB 3K92A 5HOEA 1JIXA 1RRCA 2C2KA 4UNNA 5E4JA 2Z1MA 4PSKA 3TZEA 3PJRA 1SQ6A 3U3MA 1UP6A 2WFAA 4Q3AA 2R5NA 2P4UA 1JWLA 4IJMA 1L5WA 6ADHA 2BRUC 3L0BA 3WRVA 1XG5A 5BPFA 2WYOA 4OK5A 1G8PA 2CGEA 4PNPA 4R2MA 4J76A 3ILYA 2HXYA 1MDFA 3VUEA 3FIJA 4WKOA 3QYAA 1NXTA 1U99A 1P5JA 2FA9A 3BKXA 2R4UA 1HY3A 1W0KA 1KC3A 1W6UA 2CJWA 2D1YA 3NEJA 4HZGA 5H0IA 3T7CA 3I1FA 4DYVA 3PTLA 5JNTA 2GPJA 3ML1A 3B36A 5ILOA 1RPNA 1PKEA 4E88A 5AW4A 2RIRA 1K3FA 2QX7A 4A3SA 4JD5A 3UEOA 2O9JA 1WB5A 4N40A 1ZZEA 4ZVOA 2XMPA 2AC4A 4FHDA 3T99A 5KHLB 4IIXA 4QJ3A 2XE4A 1KOLA 3WXBA 3PC4A 2HL6A 3G2NA 2X42A 5FUWA 1K27A 2XRMA 2FF7A 4H6VA 1OFHA 3C8MA 4O8ZA 1C9DB 3DM5A 4DIMA 3SKYA 4DSTA 3JD2A 1AHIA 3Q1LA 5I4BA 1O6ZA 3EVGA 3L0SA 4Z51A 1J1IA 2EBFX 1Z74A 3EPRA 4UCFA 1CRWG 1V2HE 1V4VA 1N7HA 3BH0A 3N28A 4G5GA 5KYNA 3MTIA 1N5DA 4PZDA 2RGNA 4EQ6A 3PQ7A 3P0HA 3I9JA 1BVHA 1SXIA 2EG5A 2XOXA 2VDWA 3AVTA 4J2TA 1FXSA 4MMZB 1SUIA 1X86B 1XZ8A 3A26A 1ECGA 3CE9A 3HU5A 5DGTA 5JWRA 2DWOA 4PHGA 2HA2A 3W5JA 3MAAC 2AG5A 5GAJA 1LVUA 3WNBA 4JUCA 4C87A 3KKLA 5SY4A 3PZBA 1CDOA 1YL5A 1CD5A 3T95A 1ZCZA 2LKCA 4G26A 4X45A 2BTOA 2Y05A 4BFZA 3DC2A 1MABB 1E2MA 3MVEA 2JEZA 4K9RA 1JR3D 1R4NA 2I8AA 4P2BA 4RKRA 5KYXB 4PLGA 4CUJA 3GCDA 3NGMA 1EFVB 2QF7A 4O4HA 3IAAA 1MH1A 3TFOA 1JJVA 3I5AA 1I5EA 3A1NA 5EE1A 1QAOA 4II7A 1JXAA 4ZV7A 1CTQA 5K2MA 1HNWB 2PZ8A 4V03A 3T41A 4HPWA 4WW0A 2QAGB 1EFPA 2MINA 4EUSA 4OHPA 5LUAA 3KELA 2QMOA 3DEHA 1D5CA 2NW6A 3QJGA 2ADOA 5DLPA 1KY3A 1MIOA 2IW3A 4YMSA 5ENDA 1PQUA 1NKTA 2OO7A 4UTNA 2QVGA 5KYYA 4B5LA 2FRDA 2CK3D 4L4ZA 3P45A 5AW5A 4DABA 1EBUA 1MO4A 1XRQA 2B7LA 4JP5A 3G2PA 3DBLA 2EOAA 4K28A 4M9ZA 4UD2A 4AROA 5JUWA 2B78A 2J4DA 3IBGA 2DWCA 3BWXA 2JD1A 3DT8A 1KC1A 1LPPA 2UVPB 1WMSA 2BDUA 2WJ4A 2QQ5A 3PPIA 1ZGBA 1DADA 2HKIA 3L9WA 3OE5A 4PANA 1FTQA 2X5JO 4NU8X 1XCBA 2F64A 3FRJA 3IQXA 5A9TA 1MX5A 4YMGA 1V7QA 3PPXA 3H5OA 4QE3A 3EHDA 1QGDA 1TX4B 3OC6A 4ZV9A 4OO3A 2CDRA 3OU2A 4F4UA 4RA9B 1U2QA 3S44A 1P4AA 1TI7A 2J3QA 2PEZA 3LECA 2IS6A 1NF9A 5JS2A 2C59A 1M1NB 2E4VA 1XVUA 4EHDA 3WR5A 4HB4A 3UXHA 4YRFA 3IMFA 3A0UA 1U2DC 4E7OA 1V1MA 2GAOA 5DNVA