2CKBH

Structure of the 2c/kb/dev8 complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Major histocompatibility complex
molecule keywords ALPHA, BETA T CELL RECEPTOR
total genus 61
structure length 274
sequence length 274
chains with identical sequence I
ec nomenclature
pdb deposition date 1998-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ckbH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2ckbH01
4MJIA 5I2IA 3SJVE 5E8OA 1R5IB 2CJUH 2JCCA 2R56H 5DVKA 1AGCA 4C55A 3NFSL 3KNBA 3C6SB 4YH6A 5GXBB 3GSOA 5EBLA 4LL9A 1PBYA 2UUDK 1TVHB 1T1YB 3AFLA 4NRYB 3W5NA 1NAML 3G5YA 4KY1L 1CFVL 4XHJD 3M07A 5TQ0H 4JFQA 3LQZB 4GW5B 3P9WB 5F44A 2J8OA 3TV3L 1T0NA 1RI8A 1XZ0A 4LLMB 3TPKA 3O3DB 2DJUA 1HXYB 4YHIA 4OLVL 1BAFL 3QHFH 4MS8D 1XFPA 2HMIC 4LDEB 5T5FL 4JFDA 3T77A 4PRID 4PGDB 1KSRA 3MRIA 1WFNA 3CXHK 3MLYL 5I66A 4QTIH 4ZYKB 3ZKSD 2X4OB 3ZT5A 4CADB 4XCNB 1DEEB 1WEJH 4PJ7F 5C86A 1P7QD 1PEZA 1MFBL 1NGQL 4OUUB 5FGSA 2OTWA 2VLJE 1G9MH 5C7XL 1EMTH 1AO7D 4JFPA 2JLLA 4MZ2A 2QSCL 4HK0B 5D2NA 4WUUB 3KS0J 1RVFL 4GRWB 1Y6NR 4MSWB 5GISH 4PLKC 4F7CB 2R2HA 4M6ML 1C7SA 1P7QA 2HFTA 2OP4L 3TYGH 3CX5J 2GJ6B 2DKUA 3VD5A 5IMMB 5DJYB 4EN3B 1T5WA 3DVNB 4K8RD 4PJHB 4GRLD 4DKAA 4M43H 2J8UB 4WV1C 2DDQH 4X98A 3ZDXE 1BP3B 2WIMA 2D03H 1KXTB 4NZTH 3CDGB 5KZCD 4I48B 1RK0B 5L0QC 3VFOA 2QADB 5JDJA 4MXQD 5CSBA 1V05A 3DYOA 1RK1B 2R0WH 4JZJB 4ZUUA 3U0TB 3RWDA 3MFFB 3MLTB 3ROLA 3SKJL 3U7YH 5CD3B 1H3XA 1UM6L 3NFNA 4XNQA 4ZS7L 3C6LD 1FFNB 5ESQB 4RFNB 1TPXB 1BJMA 3IXTA 3Q6FB 5ADOH 4YHLH 2VDNH 1KPUB 3I50H 4TRPL 3BQUA 1RIUL 4RRPG 5EU5B 3DETC 2K7QA 4J7RA 3ULVL 4MNGB 2YD2A 3MV7B 5IK3B 1RIHH 1AR2A 3OX8B 5D70L 2YR3A 3OSKA 4XMKH 2XT1B 3PNWB 3WHE0 3B2VL 3QCUH 4GAFB 4KK5C 1MNUL 2HKFL 3TN0A 2HT3C 5FM8A 2P5WA 5HHOD 4WFHE 3LQZA 1CGWA 3QEQD 1QRKA 4XNUH 1R3HA 3EJJX 5J6GA 1N5AB 4AENA 1ES0A 1Q0YH 4M6OL 3UC0L 2EO1A 2YD4A 1VFUA 1A6AB 5IV2A 2GSIA 1F90L 2VIRB 5I8CA 2OL3A 3RZCA 3QFJD 4ONFL 2I24N 1HILA 3NPZB 5CSZA 5I1EH 5DJ0B 3G08A 1QHOA 4RAVB 1X6LA 5CBAA 4TVPH 2VZOA 5EPMA 1PKQB 1TZGH 6CGTA 1GOFA 2QV2A 5E8EA 3JBG7 1DFBH 4IOSD 4LIQE 3MV8D 1MH5A 2M26A 2AK4B 1MY5A 3V4VL 3ET9F 5DMIL 1MF2L 3MOBH 5EZIL 4GKNA 4HWEH 1MCCA 1K4DA 4JJ5B 1TZIB 3SE3C 4X6DA 5GGTL 1IQDA 1BGXL 3FO1A 4ZSOB 3EDJA 5FF6B 1CLYL 3F6LA 3HFML 3WLBA 1EPFA 3KPOB 2DM7A 3TCLA 4ZO9A 1E4WL 4NC1C 5BS0D 4DW2L 1Q9WA 2I07B 1JFQL 4OCNC 3GRWA 1JJUA 4ZO6A 1FPTH 5CCKL 1I1YB 3CVHH 4QRPB 4PRHB 1BPVA 1BQUA 1FZKA 2CK0L 4M6OH 3UC0H 2E7LA 3PHOA 3VXSA 3TWCH 3DURA 3VFOB 3K4AA 3OGCA 1NCCL 4HKZA 4H20L 1N59B 1J5OL 3MRLB 2WWKO 1MPAH 1EXUB 5C07D 3RWIB 4RWYL 3UJJH 3QCUL 3C8HA 1HYSC 5E70A 2R1WB 4WCYH 2KKQA 3NAAL 3QDME 4JHBA 5GIRB 1EO8H 3HC4H 3HCVB 4LSRH 1T66C 3VFRA 1GGYA 5J1TC 3NACH 1CG9B 5EO1B 5EUOE 4MA1B 3BPLC 1XT5A 1KJVB 4UQ3A 5C0AA 1ACYH 2JTDA 4Y88A 3GMMA 5DQDL 2PR4L 2VDKH 2D7MA 5KVDL 1OTSC 5SWZB 4FFEX 4YNYA 2V2TA 4P5TC 4XB7A 3TT3H 4EI6A 3VFRB 5EU6B 1INDL 1FL3A 3VXQA 3INUH 1GH7A 1CXLA 1AGEA 3JTSB 1ZA3A 3KXFB 1CD0A 2NY1C 2XFXA 4TNVK 5BVJB 1HH9A 3FT2B 3ZSTA 1G7PB 1S7WA 4Z6AT 5DVOA 1JYVA 3ESUF 5HPOA 3BP5B 4I0PB 1MAKA 1SYSA 5HI3D 1FFOB 4JFOA 2O5YL 4ZO8A 3ARTA 3UZEA 2OZ4H 3P9MA 5F7DB 4NZJA 4OCRL 4UINH 3E6HA 4Y19D 4WU5A 2WUBL 1JPTL 2P42B 5EB9A 1A6UH 2BX5A 4LMQI 3KLAA 4WW1B 4X7FC 4H25A 5DJZB 1NEUA 5HHNB 2XZAL 1NGXA 4X6DB 3HTLX 2PYED 1BOGA 5A1AA 5LKNA 3SDCB 5ADPL 5F7WC 5ALBL 1I1CA 2A2QT 25C8L 4PJIF 5ESVA 3REWB 5J4MA 4ZPVA 4OFDA 3A67L 3MLYH 5H94A 1I7UB 1MWAH 4LPYA 4U7MA 4Y2DD 1NGXB 2H26B 1T6VN 4U0QB 3ZDZE 4WJ5B 4F58H 4ZDHB 4ETQA 2P5EB 1NGZA 1KEML 5DD5H 1NCBL 3MCLL 3LEYH 4LSTL 1H8OA 4KI5F 4FFVC 4DVRL 3BIBX 3WL9A 1NFIA 1DVFA 5F9AC 5FA3B 1JF1A 1KN4H 2EYRB 3O45A 5F9DC 4NQDD 5CHNA 5LVEA 5E5UB 2NY6C 2GW5A 2WP3O 4ZXBD 3VMPA 1I1AC 3PL6D 2CR3A 4JHAH 3LZFH 2P5EA 4PLJD 5GS3A 2V9QA 3BIKA 3ULUL 4WFEE 3VD3A 3BRGC 3WHE1 2WIIB 3M1BB 2JJSC 1INEH 3HB3D 3UPCA 4S1QH 4XPGL 5TDOB 3BH9B 4RA0C 1U92A 2G60L 4OF3A 2WY3A 3GSRA 4NQDA 3X14B 3X12B 3GSUA 1MRCL 1ACYL 1QR1A 2DLHA 2P7TB 5LQBL 3WEXB 4R97B 4G8EA 2DLGA 4JG1H 3HE7A 2BNRB 3QDGD 1A5FH 1V7NL 1FE8H 2UVFA 3AREA 1X5GA 3UTTE 1C1EL 2IWGA 3U4BL 3MV9E 5SX5H 4NCC2 5C0BA 1A6TA 5GSVA 3C9NA 4BZ1L 1Q1JH 5CSGA 1JWUA 5D6CB 2LVEA 4N9GB 5HGAA 4FQ2H 2Q86A 1HI6B 1KN4L 1AGCB 2PXYB 3WDIA 1HHGA 1JE6A 4PJ7A 4M5ZL 4S1DC 3VWKB 5FHBL 4N5ED 5GGVY 4P4RA 1N3NA 5JOPE 1V7NH 3IS0X 1TQCB 3V6OE 1CXHA 1H3WM 1U91A 4U1KB 4PLKD 1YUHA 4LPXA 2Z31D 2QQLL 1I7RB 2QQNH 4PS4H 2CDEA 1NFDB 4K3DL 4LF3B 2NCMA 1HHGB 1NL0H 4B7IA 1A4KB 4QRRA 5KS9B 3L95B 2YKLL 4QRSB 3G5ZA 2UZIL 3QUYB 1U58B 5B22A 1XIWA 3JWNC 3MA9L 3MSPA 1ONQB 3UMTA 3GIVB 1X5LA 4F7MA 3D48R 5EOCH 4I13B 1T1XA 3O8XC 1J1XL 2W07A 1ZGLA 2A6DB 1FNGB 4IOFD 1KTKE 2B5IC 3LKSB 5HGDA 5I8OL 1TTGA 3HPJB 4ETQB 1JRHH 1EZVY 3ZDYE 3H7LA 1DEEA 1I8LC 2VQTA 1BJ1H 3QIWD 4GXVH 1KEMH 4L8DA 5DD5L 3DGCR 4XPHH 4LOUC 2A38A 3LN5B 4HGWA 5FA3A 5C08D 4UV7H 1S7SA 1K3IA 2V9TA 4NPYA 3OKOB 2E27H 3LQMA 1JP5A 1AQDA 3VD7A 5F21B 2X9XA 3WNNA 3CX5K 3MRJA 1QLRA 5EWIL 1ZHBB 1D5IL 1MCLA 3NZHH 1HN1A 3KPTA 2WV3A 3BPNB 1S7QB 5EUKA 5F7HA 3DXAB 4FQXA 2V5TA 4G42B 1YN6A 3TVMA 5C0EA 2B4CL 4NRXA 3T65A 1KT2A 2C3HA 2VH5L 5H37G 3BGAA 1ADQL 2EIBA 2ZUUA 1RIHL 5DXWA 3CGTA 4G3YH 4XVSH 5I74B 1EHLL 5CGMA 3WD5H 4YHOH 3HZYA 4IDJL 2GSGB 3DYMA 43C9A 3EOTH 4NRZA 4DCQA 2ICEB 4K3EL 3D85B 2ENSA 3QXDA 4LSVH 5T3ZH 1EO8L 3HC4L 3AS0A 1DVFD 4P2OC 4XVJH 5MENB 1QR4A 2VOTA 1GOGA 5FYKD 1Q9OB 4ORZC 3AY4C 3ROOA 4XTRD 3B6SB 4KXZI 4X9GA 5I30H 3OKDA 1WUNT 3U6RA 4PY8I 3RHWK 1MHCB 3RAJL 3FRUA 1QFWH 1FNLA 1J8HE 5F71A 1IZKA 2WWKT 3QIWC 4OZ4A 3OX8A 4M1CD 2DQEL 1MCFA 2GJ6D 3MJ9H 4MNHA 2V7HB 2VDKL 4PJ9C 1N4XL 1YNLH 2Y07H 1PZ5A 3KYKL 5HYEA 5MEPA 1J8KA 5A2KH 4TUOA 3JV6A 3KPSE 4RGMC 2CRYA 3LB6D 3PV6A 3MRCA 4OLZL 1FG2B 2OP4H 1LQVA 4MA3B 5F6HI 4ZTPH 2Y72A 4KROD 1UACL 3QUYA 5DC0A 4M61B 2NY1B 1KULA 1A6AA 5T3XE 4YDIL 4E41A 2GK0B 1G9ML 2KDGA 2E9BA 2XICA 3FZUC 5I1AB 2E7HA 1K2DA 4NHUA 1J1PL 2H6PA 3D3VB 4X6DE 2OBGA 4I0PC 3LIZL 4N0FA 5BVPH 1G7LB 2FZ3B 3F12A 3QEHA 5ICXA 1B0RB 3BPLB 1CE6A 3LHPH 4ODVH 1T22B 3GGWA 1GGCL 5E9DE 3QRGH 1G7QB 4OLVH 3S5LG 1LO0H 4ZSOA 3WFHB 1D5ZB 1AXTH 1UWEL 4GS7C 2VDOH 4C83A 1XF1A 4Y4FC 4R7DA 1BEYL 5TDPB 5HXMA 4KY1H 5IFJB 1XIWC 4TQEL 5T1KA 3VG0L 4XMLH 1MVUB 1IC5H 2XA8L 4KRPC 3IGAB 1MNUH 2HKFH 1NUDA 3MOAL 5ERWB 4HKBA 3LB6C 4N90D 3PGFL 3QYCA 4P5KA 1O5DT 3FO9A 2GKIA 4IRJD 4XVTL 3D69B 5TQ2L 4HJJH 3S37L 5E8DH 4F37F 3OGCB 5DC9B 5ISZD 5JPMA 3O8XB 3ORJA 5KVEL 5E5MB 4K94C 3EOBA 1HWGB 4NBZB 2XTLA 1UM5H 3IDJA 1MFCL 3L5JA 1Z5LA 2MQ3A 1CCZA 3HMWL 1U95A 5I1LA 5GGQL 3OKMA 1KCGC 1ORSB 3SKJH 1SVCP 1A7NL 3QDHA 3BKCL 4CL7A 4MCYB 3P4OA 5IVXE 1K5NA 2AKRA 1AKJB 1KIPA 3GBNL 1HXYA 5D2NB 4YXKL 4P5TA 3RWFB 2W9LA 1MQKL 3W5MA 4ZUTB 1KLUB 3GMLA 2X4UB 2G5RA 4OT1H 3B4NA 1HNFA 3TO4C 4MD5B 4DVBB 2AJUH 3P4OB 1ITBB 5T33L 2C4XA 1FG2A 2ZPKH 3LD8C 1EGJA 2IG2L 2HFGH 3QUXC 5DJCA 3LS4H 3MO1A 3OHXA 1YNTA 4WTWA 1ACZA 5D2LE 1DQDL 3FJTA 1EMTL 5E0QA 5KW9L 4LAJH 5KAQG 1ED3B 3VGAC 3UP1A 4NQSB 4L4TB 4CN1A 3Q5OA 1U8LB 1TLKA 1S7TB 2X89A 2D4DA 1UXSB 5EBMA 4P3WA 3UYOD 4XNQB 2WINA 5GRUH 4I0CC 3E6HB 2GJ6A 1RY7B 2EIZB 4QTIL 3GMRB 3WFBH 2QKIB 2QBWA 1XEDA 3MV7A 1P7HL 2X4NB 2CUIA 2Y7QB 3BMVA 4BK4A 1BAFH 3QHFL 3KPRA 4C83B 4TOYH 5I8KL 3MUZ1 1T4KB 3UAJC 2C1OA 3RDTA 5D5MF 3TN0B 3MXVL 3BW9B 3S35H 2YOCA 3QDJA 4PJAF 2P47B 5IMOB 2XWBA 1PGRB 3UTTA 4KKCD 5C0AB 2KQMA 1ZE3C 5ESQA 1JBJA 3V5KA 1CDJA 4PTTB 1D6EA 1MQKH 1T83C 1CXFA 3RVUD 4M3KB 4R2GC 4OCWH 4N0UB 4B53A 4WWKC 3MLPA 1RUQL 4KZDL 4U6XB 1JNHB 1XGRA 1I8KA 1RUKH 1M71A 5CP7A 1NLBL 3FOMA 2AK1H 4R96A 5HYQB 4UOW1 2BMKA 1AY1H 4XNYL 5DGQA 1NAMA 4XRCA 4HBCL 1IAKB 3BMWA 1AY1L 5BXFA 4MJIE 1A64A 4EXKA 1YYLH 2YBRB 1WAAA 3VFMA 4R96B 4POZD 1MFEL 1A1NB 4PJCF 2JB6B 5FUZH 4XVTH 3TIEA 1NCAH 4OCWL 4ZUTA 1YEJL 1B0GA 2RIKA 4AMKH 4EN3C 5IEHB 5DMJB 1TVBB 3QHZL 2BNRA 5IQ7H 3ARWA 1CT8A 5IWLC 5KS9F 2X9WA 3MZTA 1J1PH 1RZ8B 4AH2A 1OAQH 1JHLH 3VXMD 1U8JA 5H37H 4S2SB 5ANMA 3IKCB 3MX0A 3O6MH 3V7AE 1NC4B 4MNQB 1AC6A 5DYOA 4LLAA 3VJ6B 1UA6L 4OF0A 4GRWF 3PDOB 3HMXL 2UZXB 4GBXD 5B3NA 3MGOA 4X7CC 1A6ZB 2OYPA 1N0XH 2C3GA 4BJLA 4XZUB 3VFWB 4JHWH 2EDOA 2FO1A 1HEZA 1WC7B 2QR0A 2Y07L 4LVHC 1LEGB 3AU1B 3GSQA 1RU9H 4HIXL 4HK3J 4YR6B 4RZCB 4N1CA 3H3PH 4IMLA 3FONA 4NN5B 1LMKA 2MPAH 3MR9B 4PR5A 3C60C 5JQ6H 4MA8L 2ZCKL 3H9HA 4ERSH 3SKOB 4Y19A 1JZ4A 3TZVC 1ZHLA 1J11A 2IPTL 1VPOH 2YD7A 1UEMA 3DRTA 5KVFH 1HSBB 2FGWH 1OGAB 1YYML 4PB9H 1QVOB 5A43C 2AV1B 4RAUA 5L6YH 3QHTC 3HC3H 4FS0A 4PJ8A 3RKDC 3PQYB 3QUYC 2BFVL 2CLZA 2VXUH 4PP1C 3U2SB 2CIKA 1JL8A 3O2VH 5BZDB 1YDPB 2B1HL 4A6YL 4IRZL 4JY6A 4IHOA 5EZOH 1IAMA 3CLFH 3I6KA 2K1MA 1T1WB 4M03A 5JW5A 1LHZA 1QKZH 1MHEA 4PY7B 3UZVB 5CS7A 4EIZC 2IADA 3BP5A 1KJVA 2AEPL 4UQ3B 1OWRM 3CUPB 1NC2B 4DUXA 1T7WA 2GITA 3RWJB 3NA9L 4WENB 5DUML 4I3SH 3X11B 4J4PC 1RJLA 2BOCB 2Y1VA 1QLEL 4N9GA 4OD3L 4ZOAA 3P4LA 1KB5H 1ETZB 3KYMB 4H5SB 3IJYB 4XNXL 5E00B 1F4YL 4LSVL 1CQYA 5ESAB 5INDA 5T3ZL 3B43A 5J6HA 4FNLH 1CI5A 2AXGB 1FSKB 2GTWA 2Q3ZA 3Q3GB 1Z0MA 1OTUD 2YD5A 4P2RE 3U9PH 3ZZ1A 3SDAD 5BMFL 1T3FA 3BI9X 2MNUA 4JO2L 1SEQH 5DSCA 5TQ2H 4U2ZA 2ADIB 2GTZB 4JRXE 1BBDH 2QEJA 4OKDA 2FIKA 3ZHLA 2NY0C 3W9DB 4IM8A 1IQWH 1MHPL 5E1AB 1A4KA 3IJSB 4QRRB 3NCJL 5KS9A 1YA5A 1OAZL 4LASH 5F93C 3EBAA 1KJ2L 3R8QA 3WXWL 4YBHA 3BD5A 1U6AL 5F7DA 1Q9OA 2OSLB 5HHQA 1H5BA 5I74C 4LSSL 4I3GA 5DEGB 1NJ9B 1C08A 3GRWL 4LCUB 3IT8D 1A1OA 4NO0A 3FL7A 4JR9H 4YHMH 3AMKA 3QWQB 3ULUD 4J23A 4NQEA 2MOVA 4D9RE 1LO0L 1DE4A 1ZKAA 1GGCH 4WHYG 1OGTB 5ID0A 5DRXB 1QEWA 3OKLA 5JUEH 3NFPB 4S1DD 4Z9KB 2H8PB 2DYPD 3JV6B 2IANA 2DLFH 3G5VA 4GKSB 5AD0A 2ESVA 1ERNA 2NZ9C 3LIZH 4C56A 1QSEB 4WTZA 5ITBL 3HZMB 1EV2E 4J3UA 5TDNA 1IMHC 3OKEA 3Q5TA 2XXMB 1NKOA 3WL9B 2E7CA 3D9AH 4OB5H 5I0DA 2KZWA 1G9MC 5F7EL 3MA7A 3RY4A 2X7LA 3DXAA 4DEPC 5T1LA 1MIEL 2QTEA 3IJHB 5HYSA 1FYTB 3DRQA 4U6VH 3EOAB 4ODXA 4KMLB 2L7UA 2SEBA 2WBWB 3O6ML 3B9KD 1QRNB 2NYYC 4F8QA 3PABA 5FO8B 5TFSH 5D2LF 4M7ZB 1MAMH 2UWEE 1QR1B 2NTSP 2CK2A 4TPRH 4Q9CA 2X1PA 5C0BE 4S1SL 3CZFA 3EO0B 1YC7A 3IDGB 4RDQF 4JPIB 5B39G 5D7SH 4NM8L 2CRZA 3EFDL 4OCLC 2AV7B 1VERA 5IF0A 3RNQB 4MJ5A 1NUGA 4DN4L 5KVGH 4KUCF 2ILLA 5CINL 4G43A 3K4ZA 5ALCL 4XPBL 3THMH 3VH8B 4EUPH 3TBTB 1AGFA 1ZHKA 1RUPH 2A6IB 5HHXL 5F89A 3QG6A 2P44B 3W9EB 1EHLH 1UWXH 5EUOB 3TA3B 1FIEA 3TIDA 2XA3A 3WNOA 4P4KB 1AP2B 1GZQB 3L3HA 2V17L 1SBSH 4RIRB 3PP3K 1Q9LB 1U91B 2IBBA 4U1KA 4BFEA 5DEGA 4Z76A 3VXNA 1CN4A 1NANI 3D25A 2XZAH 3QIUC 1JMXA 2IMNA 4EI5A 1JK8A 3C5JA 4LKCB 1OOAA 4IDLA 2EE3A 1S7RA 2EH8L 4CMHB 3CPLA 3BX7C 5E5RB 5D1ZA 2ZKHL 4X6FB 3QUXD 1UH2A 2ESVD 4MQXC 3NN8B 4RDQG 2ESVB 1F3JB 1C5DB 3JVGC 1U8NB 2CQVA 5CJXC 5KJRL 1MFAH 3WFHA 3WKNA 3CVIH 1BWMA 3WFBL 2FATL 1FC2D 4HGMA 4GAGL 4UU9B 5DFVD 5D1ZD 5CBEB 4TSBH 5ITFA 4H8WH 4H8WC 5LG1A 1BWWA 1CFSB 1I3RA 2X4RB 3UBXG 3BDBA 1QQDA 1WISA 4P5MB 5I18L 1I3GH 4HKZB 1DJSA 4HXBH 1ADQA 2Z35B 3TT3L 5DI8B 3VRJA 4PGEA 4R7NB 3B2UD 4O2CB 5JLZB 1U8MA 3C5ZA 3HZVA 4YPGB 1DBBL 5E2WH 3EYSL 1NGWB 3FQTB 1N5YL 3V9FA 2BNQE 4LLWB 4MDJB 4ODXB 1PLGH 4Z77B 4X9HA 3MLZH 2NLJA 3C60B 3L3KA 5CMAA 2A6JA 4XPBH 5CJOL 1CDCA 1MY7A 1FL6A 3RX7A 4DN4H 4HH8A 2NX5D 2IAND 2FEEL 2RCSL 5DZOA 5FUOH 3CFEB 3KWWB 4YHIB 4PGCA 2IBZX 4IRSA 5HVHC 2F15A 5D1XA 1T89A 2GHWB 2M8XA 4PFEA 4DZ8B 2EE9A 3ECBA 4KPHL 1M7IA 3S34L 1DQMH 3P11L 1D9KB 3PV6B 3QXDB 4AK1A 3TJEH 4U1HB 1GXEA 1FNFA 5E6IA 4G6AC 5FYLE 3OAYK 1C1EH 1LE9A 5CJQH 2W59A 1ZVSB 2XZZA 5CJOH 2C9AA 4XMPL 5CCKH 1ZS8B 5B8CC 1FPTL 2LU4A 5EUOA 5FHAH 1UWGL 4PBXA 1E27A 4P59L 3MLSL 1BX2B 1K8IB 5DFVC 1Q94A 2CXKA 4OIIL 4TSCH 2MCPL 1S9VB 3TF7C 3VXRE 4Y5YB 5DHYB 3T0VA 4PJGF 3ULVD 1JNNL 2MKLC 4Q6IB 4RQQB 3CD4A 1RZKH 4NCDA 1A9EB 3M45A 3ULUH 4MAYD 3QWOB 4GT7A 2Y5TB 5EO0B 2OR8A 4N5UA 1KCUH 2IFGA 1PDKA 2BCKB 1JGVL 3KS0H 1QYGL 1SY6L 1PAMA 1T21B 3BN9C 4AIXA 2BY1A 1AKJD 2OL3L 3L3GA 4NBXB 5L2KB 2JELL 4F7TA 4GKOA 2H26A 3STLA 1Q72L 4UUJB 3RWDB 4F58L 2JELH 3LQAC 4KQ3L 1TTFA 1FZOA 4KDWA 5IB1B 4ENEC 3OAZH 4QTHB 1B0RA 2EKSA 4LLYB 5CIPH 4XHJC 1RUAH 3QEUA 3VXUE 3T8XA 4PJAB 3IAPA 3OXRB 4LSSH 1T22A 1MRFH 1WIPA 5FECB 3VRLE 4WDIA 5DT1H 5GGSA 4OLUH 3OBAA 2HJFA 2APFA 2FYYA 4M5YL 4QXUH 4HKJB 4HPYL 1IGYA 3PGCB 2M1KA 3WHXA 2WUBH 1JNNH 3SE9L 1FYTE 5HPMB 4X8XA 2GAZA 4MDJA 4Y4HC 1IKFH 3V6FA 3L5IA 2GFBA 4WV1B 2I9LB 3DETD 3LSOB 1T6WA 3CFBA 3BUYB 5A40E 4PJ9A 3RNKA 4U1MB 3TPUE 1UWGH 3DV6A 5FHAL 5D1XD 1KTLB 3ARDB 3UDWA 1FCGA 5CGTA 3MJ7A 3HCVA 4U1SB 3FCTA 3MRPA 3SDYL 4GW5A 3PWPD 5L2KD 1Z9OA 4GG6E 3SQOL 2X4TB 3QXVA 4UT7L 2NMSA 4OZGE 5DD6A 3V52L 4R97C 2DOCA 5C0BB 1MH5B 1GGUA 2A83A 3MLWH 3C5ZD 4MAUH 4QHNB 1ZANH 3P40A 5D70H 3QXUA 2HKHH 4R8WH 5E8OB 3NIGE 5E24E 2YRZA 1IQDB 3C2AL 3TA3D 2EXWC 3PXJA 4K7PY 2VZ3A 3V4UL 2HVJB 2NY0B 4DKEL 4NDMB 1RJZB 1M7DA 4P2RB 1BD2D 3PWNB 1IAII 4S1RL 1A9EA 1AHWC 4N8VA 3UJTL 1FL5A 4LFHG 5I1JH 4E41E 5DUBA 3OZ9H 1I4FB 2DLTA 5DJCB 3RWHA 1KV3A 3I84A 1KNOB 4DK6A 3HI5L 3G9VA 3EYFA 2LE9A 1I8IA 2D0HA 3D0LB 4HIIA 4M3JA 5AYUL 1G6RA 5DK3A 2E27L 3DSFL 4BSVA 3F65A 4L4TD 4H25B 4UI2A 4PREB 1D9KC 4NUGH 1NH6A 4MS8C 1MI5D 3H2WA 1TQBB 3FN9A 2IPKA 1G0YR 4PGBA 5JOFA 2OSLA 5DQ9A 1YEKL 1G7IB 5ESVB 2RBLA 1KG0A 4HDIA 1RZIA 5JXEC 3RY6C 3FFCE 4P0DA 1H15B 1OSZB 1F11A 4H26A 4P9HC 1BGXH 3LKOB 3QDMB 4Z7WA 5DS8B 2IJ0C 3HC0A 3ZTJH 3EDDA 3WS3B 5KSBB 2HFEA 2EDBA 1NBZB 35C8H 1KPUA 1WEJL 3RVTC 3QHZH 1OAYL 3DXAD 1HINH 2IANB 3MREB 3BN3B 1ZAGA 1UZ8B 2P8LA 5B39B 1A7RH 1SMAA 5I75B 2WBJB 2Y25A 2EKJA 3S4SB 2DYPB 3CUPA 2QQNL 2N1KA 5IQ9B 1MCJA 1A7OL 1RUPL 5HHXH 2BSTA 3BT2L 1B0GB 5IEHA 1T1ZA 2F54D 3D39D 1YEEL 4HUXB 2VJXA 5HYSG 4LCWE 5FHBH 1U92B 5CGYD 3WUWA 3DI3B 1MEXH 1RAMA 2H2SD 5F1KC 2YA0A 4PGJA 2GCYB 3UTSB 3TJEL 1B6DA 3WS6A 2G9HB 1KELH 3P9MB 2VISB 3BP4A 4XP1H 5TE6L 4OZIF 4NQEE 4H0GA 4CMHC 3GMOA 5J9PB 1UVQB 3SE4A 5JPNB 4KKBC 1MAML 4YHYB 4P23A 1MELA 4K7FA 5DO2C 2CJUL 3SN6N 5LJYH 3QNZA 2IEPA 3TH3T 1A1NA 3Q6GH 2NW3A 2BNQB 1FNAA 4RGOH 3WIHL 4WVRA 1AHWA 2B2XL 5HHQB 3CJJA 1JTTA 3C9NB 3DVGB 3DLQR 1JWUB 1AIFA 5E2WL 4JE4B 4ZS7H 1J86A 2BY0A 1UM6H 4YGVA 1L7IH 3X3GL 5IJVA 2FWOA 1MCHA 2IH1B 1IE5A 1HKFA 3QDJE 5ENWA 3E2HB 3T2OA 3SBWA 2VXTL 3L7EB 3JSSA 3ZT6A 3DVFA 5J12C 5KG9A 3TBYA 1WWBX 1FJ1A 1G6RB 1H0DA 2MTPA 4OQ1A 3RZCB 4GW1B 5I8CB 4NNXB 4R26L 2HT4D 4PRAB 4APQC 2VXTH 4V1DA 3UO1H 4L8CB 4GAYB 5EC1B 5I71C 2ICES 3HNVL 4JANB 2BXYA 2FJHA 3BVNB 2NY1D 3LEYL 5D2LA 1S3KH 4KI5E 4HDIB 3S97C 4Z7VF 1MI5B 1HHKA 3AXLA 4NO3A 2Y5EA 3C8DA 2B1AH 4EN3D 4LVNB 4MWFA 5D8JL 5IESH 3IETB 2Q76A 1R24A 2IADB 2HG5B 3FO1B 2AJUL 3HKFA 5FB8A 5FF6A 5D7JA 4P49A 1QFUL 4JDZB 5T1DL 1KPRA 3QISA 1U6AH 3VU2A 2FJGB 3MACL 3OB0K 4MB5A 4LASL 5I1HL 5T1KB 1QRND 5EZLA 2NY2B 3QUZC 4WW2F 5FGCB 5J13B 3C5SB 2IGFH 1AQDB 5GJTH 3U0PB 4LP4A 2JE8A 3RBGA 5MEND 5JHLL 1JWMA 4NSKA 3PIQA 4ZNEA 3OKNB 5F9JB 1YEIL 2O5YH 5E5MA 4OZIB 2ZUQB 4PJHF 4GKZA 5JHLH 3BGFC 4WTXA 4F15B 4KTEH 3C5ZB 4GQPH 4PIRF 4Z0XB 2O93L 2XZQL 3HE6A 4PJBE 1OAKL 2F54A 3ULVF 1YUHB 2DN7A 3RVXC 3U7AA 3ZE1F 3GSNH 2XZCL 5F1SA 3K2UH 5MP6L 3T0EC 1UZ6E 1WF5A 2F58L 2DQCL 5FV1L 4WNQA 3QNZB 3SCMA 3U0WH 2KZ1B 1BZ7A 4Z7NE 1DE4B 2R56L 5F88B 1R0AH 2CDFA 5EU3A 2I60L 1AE6H 5DRXA 4HAGA 2PTTB 5FYJD 4FTVB 5JZ7D 1BEYH 1TJGL 3NCYS 1G9NL 4L29A 2VDOL 5AD0B 5D1QB 1I9RL 4HIJA 4N0RA 5IBUB 4U1IA 1SYVA 4JO3L 4U1GB 1OHQA 2CO6B 3CCHA 5IR1B 2WW8A 2ENYA 4L5FH 1H3PH 2CUMA 4MSWA 5E08H 2CGRL 3EYUL 3O9WB 2PTTA 3D9AL 1S9XA 4NP4L 1NBYA 1JGDB 4QWWC 3T0EE 1V3LA 4NHCH 4NN6C 3TP4A 3RVTD 1CFBA 4HS3A 3LD8B 1YECH 5ABDE 4L4VA 1P5UA 3STBA 2EXWD 1IT9H 5IR1A 2EDFA 1N0LA 2WAHA 4BKLB 3VE0B 3NCCB 3WE6A 1FYHB 3DHMA 4HG4J 3G6JA 3K2MC 5EZJA 1F6LL 2V9RA 4LBEA 1FNEB 4PJXE 2OQJA 4BH7B 2XQBH 2B2XH 4K7PL 4YC2B 2BCKA 4PTUB 3L1OL 2R8SL 4EI5C 1GC1L 1OM3L 4LCYA 1N4XH 1YNLL 1L7TL 2W65A 4W70A 4UNVA 3VFSB 4K23H 5A2IH 5DK2B 3MJ9L 3DTXB 2ICEA 2AV7A 3ABZA 4WI3A 4GRMB 4PV9B 5GRXG 4KRLB 5ISZA 3VGAB 1JPSL 4JRXB 1KXVC 5J1AA 3PNWA 3B3IB 1DSFL 1ZLUH 3WJLC 3T4AA 4OJFL 3W9EA 4P2QE 3LQAL 2FH8A 3KJ4C 3WS6C 5GGSB 2WP3T 3O4LD 1ZA6A 3F7RA 4RCAA 4O51A 3EDKA 3FHQA 1N7ML 5K9KA 3CC5B 1K9TA 5LGJA 1F4YH 2JIXA 4XNXH 5GHWH 2JKXA 3PHSA 1P6AB 2YXFA 4XNYH 1ZS8A 4HC1H 4FFWC 5MEPB 3FQXA 1Q0YL 4E0RB 4I3SL 2D2OA 2VNCA 4POZC 4UMGA 1K8IA 4WFFD 2AP2A 2ICWA 1UG9A 2XTJE 4XCEB 1DR9A 4JFYB 2Y36H 1NDGA 1EBPA 3KPMB 3CLFL 1KCRH 2GT9B 2G5BA 3RUGF 4CN4A 2YZ8A 3QXAB 2DF3A 5F8RC 4YFLF 3SE3A 5D7IA 3OR6A 1MCKA 5C6TH 1U8JB 3MBXL 3TT1L 2VSCA 1PG7X 1I3VA 1BJ8A 3CCHB 4N0FB 4PJAE 4XAKE 1EDQA 4BQ8A 1LGVA 3SGDI 4CDGC 4JKPH 1KLUA 4JLRB 1LVEA 4B7LA 3IFPB 1DUZA 3D2UD 5C0DA 5HVWA 3VFTB 2RFXA 3S88L 1IAIL 1A6ZA 1H8NA 2FHFA 3C87A 2R2CA 4ESKA 1HI6A 1JCKA 1F4HA 4G7VL 1T80A 3SE4C 5AZEH 4JLRA 4L8DB 1OAXL 4IBLT 1I85C 1UWXK 1JI1A 1KLGB 2R4RL 1WLHA 4QY8A 2B0SL 1KIQA 2DWDA 3NN8A 5EBGA 3UJTH 1RU9L 1MREH 2R1YA 4P99A 1S8DA 4FFWD 4PP2A 5KW9H 2B8OT 3BFOA 3GO1H 1A4JB 1IGYB 3FQRA 3PGCA 3RTQC 2VLLA 3F8UB 4GSDL 3NIGF 2DD8L 3VA6A 4BFGA 3MRDA 4JZJC 2QQKH 2X40A 3KYKH 1A6PA 1TMCA 2FSEB 2IG2H 3LSOA 4EDXB 2EDEA 4JB9H 3TYFA 3QUKA 3I02B 2VITA 4APQA 5DQ9B 2CIKB 4UT7H 1FSKC 3VFVB 1Q1JL 3BWAA 4KU1A 5E95B 5JO5B 5TE6H 5LBSH 2E8ZA 3GZKA 1IGCL 1MFDL 5HYFA 4D94A 2LABA 1KXQE 4MJIB 2AGJL 4GUPA 3WJJC 4O58L 4EI5D 3V7AG 3DMMD 1VFAA 1I7TB 4PJEB 2P24A 5GRJL 4AT6B 3L3OB 1GVIA 4KHTL 2W60B 1U8KB 1PY4A 1RJLB 3NCMA 4HBCH 3MREA 4LRNL 1LD9B 5IJKA 4PBVC 3BAEL 1WK0A 1UM5L 1QNZL 2ICWB 1AXSA 2QL1A 5HHME 5T1KD 4DGVH 3K4DA 1FZMB 1FO0A 1MRCH 1DBBH 3BPCA 3JZ7A 5D7LE 4MNHB 3TZVD 4PJGA 4HJJL 1A7RL 3V8OA 3CAFA 1PX4A 5BW7A 4HXBL 5GGUB 2GI7A 4HUKB 1K8DB 5KANG 5I18H 4ZS6C 4IS6A 3ZHDA 2DQJH 4CU8A 3T0DA 3UX9B 5HHNA 2D9QB 4J12A 1S7TA 3FKUS 3SDCA 5MI0C 3WXVL 3KHQA 4GMTH 1UYWL 4RMRA 4ZUVA 3S35L 2ZP0T 4D9QD 1KJMA 4OV5B 2R0ZH 3QUZD 1V3JA 5DD1H 4K3HA 5F3BA 2WBKA 3BKJH 3BKJL 2HT2D 4X4ZA 3QRGL 5IROA 2OMNA 2R0ZL 4FFZH 1NGPL 4GG8A 2VDML 4OD1H 1II4E 4EQ3A 4MNQA 1NBQA 2CMRL 4K3JH 4NBYB 3UO1L 3VJ6A 5CWSA 3HUJB 4KQ4H 3MRKB 4YDVB 3KDMB 1FH5H 4RFEB 1JTPA 3Q1SL 4C4KT 2KL6A 1WAAE 4G6FB 4QCIB 2UY7A 5MEOB 2OCFD 1AO7A 3EFFA 3DSNA 4X9FA 2WUCL 1T89C 2AXJA 1DQQA 1HOCB 4ODSH 3MV8B 3X3GH 1OLLA 1GL4B 3P73B 2CPCA 4YDIH 1CTNA 3FO0H 4EEEA 1J0IA 3SKNB 3VI4F 1RZ7L 4DGYH 5BO1H 1NFDE 5DRNB 3FFCB 3UZQA 3D2UA 4CMMB 5F8QC 4DOHE 3RY5A 2FR4B 4ORGB 1CDUA 2FX7L 4JANA 3T0WA 4RX4D 4L9LB 2GAZB 3FB7A 3SDDB 2VDQL 4XP4L 2EDHA 5T1MB 3IXTB 5BOPA 4J8RB 3KPRD 3ARPA 5LBSL 1FO0L 4RFNC 5HYJD 8CGTA 4ETYA 3RU8H 4U0RC 3AS3A 3RL2B 3D87B 4QRTA 5TFSL 4I18A 4YK4C 5C0GB 1JGEA 3TPUB 2VDPH 1DBKH 1JGUL 2C7UA 5IIEA 4JFFE 2OR9H 4DFIA 3RWEB 3ALPA 5D7KE 1SMOA 1S7XB 1HDMB 4P4RB 4WI4A 4FN0A 1YEGH 1RZJH 5I73C 3TBSA 3BEWB 3VXOB 2ITCA 4XPGH 2D0GA 1KPVB 3KR3H 2CR6A 3EGSA 3MLUL 2YPLE 5C0CD 4P4KD 1A7QL 1IGML 1FRGH 4QRSA 4M7JH 2F74B 1W8OA 3VXUB 4XP6H 4H20H 1BQHB 1P7KA 5IT2L 1P9MC 1SM3H 4OZGB 2F53E 5IHUH 5DJ8A 4I77L 1NDMA 2W0FA 5C07B 4DK3A 1NFKA 1E4KC 2CO7B 4HWUA 2W9EL 3ARGD 43CAA 4I3RL 3MCLH 3WBDA 1MCIA 3NIDE 1OW0A 4JKLA 4Q0XH 4AIZA 1BZ7B 1OGAD 5I66B 3MRFA 1S5HB 1IGJB 3EYFB 4Q0XL 1MCOL 3OB8A 1HSBA 3IU3B 3MRHA 4YIQA 4K8RC 3OAUH 2E8YA 3P0VH 5D6DA 1D6VH 5IKCB 2DQDL 3V0VA 5FM5M 2HLFC 3BYYA 3MUY1 3AS2A 1KPRB 5DRZA 5TPWL 1X7QB 1QBML 2ATKB 1DVFB 1QSED 4MVBA 1GC1C 1I7ZA 4I9WE 2NW2B 4Y1AA 1NUNB 3RFZC 5EA0L 3I85A 3QXTA 4TSCL 5B8CA 3PJSA 1YMMA 1A21A 3CXDH 4MB4A 1Q0XH 2BSED 4RGNE 2G9HA 4QRPE 4QT5A 1WGOA 3UTOA 3V5DB 1UB6B 3ME0A 4G6KL 2OJEA 4OM1L 4HQQL 1NCNA 2YA1A 2R29H 43C9B 5I1DA 1LWRA 4MJ4A 4OJFH 1YMMB 3AVEA 5E6ZA 4HFWA 5EO1A 1VEMA 3PWUA 1QKZL 4XWOD 4TPRL 1AHWB 2BY2A 1FVDA 5ACMA 4KPHH 3VGBA 3B2VH 3U4EA 3CH1A 4HXAL 5KN5A 5K93A 4OCYH 2XNAB 1BLNA 4OZIE 5FYLH 3CK0H 4F7PA 1FGVH 3GK8L 1NSNH 4Y4FA 2EEAA 3VI4E 4G5ZL 4J3VA 2BVQA 4NJ9H 1EAJA 5FOJA 5I17B 4PP8C 2HAZA 3WNLA 1K3ZA 4N8PA 3FQWA 3SGJC 4JZJA 3AB0B 2IALB 3HUJF 4XGZB 1P6FA 4HH9A 1ADQH 3FO0L 4ODBD 4PJXF 2IAMB 2IPTH 1PG7W 2DM2A 2VR5A 1AFVH 1XGRB 1QSVA 5C71A 2OTUA 2I5YL 2EEBA 1KUMA 4XP9H 1ZHNA 1GPOH 2UV3A 2LTQB 3SDAB 4PRPE 1RUML 2NR6D 5DRWA 3RHWF 1P4LB 2DQTL 3GSVA 4HHAA 4HS8L 1HHIA 4JDVA 1GSMA 4H1LA 1AD0A 5HI5D 1BFOB 2HVKB 3TIEB 4LDLB 2HT2C 3QNXB 3L3JB 3ARVA 1VSCA 2D3VA 1YEDA 3QQNA 4CW1B 1NC2D 1QO3A 4CAGA 3BH9A 2P8PB 2PXYD 5D93B 2YPVL 5AZ2H 2JF1A 4Q74A 1CLCA 5IKCA 5T1LB 1J1OH 4QNPF 3S35X 4MQXD 1HWHB 4PLNC 2OI9A 4HWEL 5JA9A 2X4SB 2DQDH 5E8EB 4C57C 3PQYD 3T2NH 5IQ7L 3CH8A 3PGDA 2JCCB 1BBDL 1IM3B 3VCLB 2ZG2A 2ATPA 5JR1L 4LHJB 2PW1A 2F5AH 3QAZB 4OSUL 3VFWA 3AY4A 1HK6A 2MCPH 2WNGA 5LGHL 4P2OD 4FP8H 4KTEL 5F3HA 2XRAH 1TVHA 1AJ7L 3AMLA 2OZ4L 4NRYA 3BIAX 4WIQA 4Y5YC 3IDUA 4TTDD 4U0RB 5GRYA 4JY5L 1I1AB 1R6VA 3PWLA 4X5LA 4LSUH 5KSUB 1KLFA 5FYJL 5KSAC 3X12A 4HJGB 3VDAA 3MCKB 3MRGA 5GZOC 4KAQH 3RPIB 1FFQA 1BVKA 3LKPA 2RHEA 5D7SL 4UDUB 2XQYK 3O2DL 4XC3H 5IM7A 1TCRB 2NX5B 3C60A 4JM2B 3SOBL 4AEIL 2HTKD 5E8NA 3SGKC 3MNWB 4XPFH 1LNUA 4QXWA 1AGBA 3ARDD 5D1XB 1RZJL 1CDBA 5HDQH 3QI9A 2X1OA 4QHNA 2AJXH 4ODWB 4M6NH 1EAPB 3NACL 2DD8H 3BKML 2VDRH 4HZLB 4NO5A 4PJ8C 1G1CA 3LH2L 5KVFL 4ZPTB 4YXHL 2VDPL 1X5XA 4P5TD 1ZT7B 1MLCA 4G9FE 2F9BT 4ELME 3CDFA 4CVUA 4I4WB 1C08B 4IRJC 3GNML 3VGGA 2A74B 4LARH 3PWNA 4YFDB 3SDCD 4MA8H 2B0SH 1DEDA 4PJCA 1P1ZA 1Y6KR 2JB5L 2BSSA 1OB1B 3DO3A 3RA7H 5I73B 4PYGA 1F00I 2AABH 2VC2H 4N1EA 2V5SA 3O9WA 4YDJA 5CBEA 3UXFA 3TFKD 4FFYH 1S9XB 4NC2B 1GYAA 1NGPH 2GJJA 5ILTL 4Y4FD 5C8JA 2B7DT 2XPGB 4ZFFA 1MSPA 4CRPA 5IFAL 5GJSL 4K94L 3MRMA 3TN0D 2V2WB 3K1KC 2X4NA 4ZNEE 4PV9A 1T5XA 3LS4L 4MVBC 4D0BB 5I19H 1DN0B 5CEXA 2ERJB 3C6LB 3MBXH 3TT1H 1S7WB 3T1FA 4LLVB 3G5XA 4PG2A 1T4KA 4PJBF 3V6BR 4XBPB 5ICZA 2VL4A 4NO0B 4Z0BH 4XXDB 4GG8B 2H45A 1ZVHA 2OXGA 3ULUC 3C6LA 5D5MA 3KPPA 3R8BB 1KBGH 1YC8A 4F3FB 3VFVA 4K9EL 5IVNA 3O2WH 5IFHL 4PJXB 4HUVB 1UZ8A 3BAEH 3QAZC 1J0YA 1JWSB 4JFHE 2F8OA 3R1GH 4KTDL 4MXVF 4JHZA 2BNRD 3FOMB 4FNLL 1G0DA 5F7FA 5C0IB 4ONFH 3KPPB 3REVB 3MNZA 4UDUA 3V79C 5E8DL 1RUQH 2DIBA 2YK1H 5JORA 1FAKT 2UWEF 5IF0B 2PUQT 3NIFE 4NN7C 3QJHA 2FIRT 4ORGA 5B4MD 12E8L 3QWRD 5SWZE 4WWKA 4HS6B 3SPVA 2AW2A 2ADFL 1KGCE 1AQKL 1CLOH 4Q6IA 3BZFB 4DJMA 4Z7VA 4TQEH 4FQJL 3CFCH 3H0TB 3TA3A 1R5VA 4O4YH 4V2BA 5T3XH 4O00A 1GRWA 4H1LG 3TH4T 1GZQA 2R0KH 2VXUL 3UEZA 4JFFA 5FO8A 1KIPB 2PYEA 4K7PH 2ITDB 4FTVE 1RIUH 2AK4D 4TOYL 2FBJH 3BDYH 4G8IA 3WLBB 1F4XL 3G04B 4Z7VB 1YYMH 3FZUD 5IW1B 1R5VB 1DUYB 3PDOA 2NY4D 4G9DA 4JPIA 5CKAA 1RZGA 1P2CB 3G5YB 4GRLA 3MMEB 2HN7A 3FN0H 5EUOF 1DBJL 4UIMA 5BV7C 5BRZE 4K07A 3S3PA 2IH1A 1ORQA 5JMRA 2Q6WA 5D1ZB 1XF4A 2RGSA 4K7PX 4OLEA 3HR6A 3DX6B 2BNUA 1U8PA 2YEZA 5JIIA 4D0DB 1HQ4B 2AERT 5IVZB 1MUJB 2EIDA 1URLA 1XGQB 4PBWD 1MVUA 5EU6E 1E6JL 1H3TA 3FOLA 4KKLC 4KUZL 1ORQB 1FGNH 4Y19B 5IW6A 1YQVL 1BQLL 4UU9A 2VXQH 2VXQL 5C1MB 2ZUSA 4QY8B 4P5MA 3TBWB 3E6FB 1WBXA 4F7MB 3E3QE 4M7LL 5DWUL 5C6WH 5B3JE 1EVTC 3P0GB 4IJ3C 5T3XL 1M6OB 5FGBC 2V2XA 4MA7L 3MUHL 4JG0L 3B5GA 4OZGF 3E3QC 1GGTA 4JFPB 1NGQH 1IM9D 3VXTB 3CPLB 1XGYH 4LF3A 2AQ1A 1CZ8H 2DICA 2P49B 3L95A 1GZPA 3ES6A 3EIFA 3QCVH 3MBEC 3D3VD 5MEQB 4YK4B 5J7CC 2EDJA 5HHMB 3FN0L 5IMMA 2A73B 5IFJA 3IF1A 3GIVA 4HAFA 2D9CA 3QIUB 1JYWA 4G9FB 4FXGA 5DJ6B 2NY5L 3BDYL 3MNZB 4YHOL 3RI5K 3VWKD 1K4CB 4K71C 3QUXA 4OGXH 3QQ4A 2CH8A 2DYPA 1Z6JT 1S7XA 3SE9H 3W2DH 1QSFE 3MRQA 1IILE 1EGJL 1PJ9A 4FQJH 3S6CA 5CJBA 1XF2B 3C08H 3MOAH 3NZHL 4DKDC 3N9GH 4FMKA 3WO4B 5C0AE 1TFHA 2BHUA 3F7PC 2Z31A 2IQ9L 5GPRA 1CE1H 3MV7E 4XNMA 1U8LA 1RUAL 2DJSA 2VLMD 1CTOA 4JFDE 4OIAA 2XYCA 3I75B 5JQHC 2R4SL 1UCBL 2KBGA 5E2VL 3WFEH 2XQBL 1FVDB 5LXGH 1Q72H 2HT3D 3GMOB 3K80A 1YNKH 3GMRA 3NCYP 3TJHD 4XI5C 3F7VB 4UOW0 2X4PA 1EEYB 4JJ5A 5D71L 1KCVL 4PREA 2OL3H 1XGUA 4H88L 4BA8A 1VFMA 3QIBA 4U4BA 4AY0A 4TNWK 5A2JH 1HH6B 4W6XB 4JRYE 5D1XC 3IDMA 4YX2L 3TCLB 3D85A 4OQTL 5IVZA 3UTSE 4HIHB 3MGOB 2AXFA 3L6FA 1B3JA 5M7QA 3ILPB 1LO3L 3FB6B 1WCBB 1WTLA 4MA7H 1KB5A 1Q94B 1OM3H 3IDYB 3NGBB 4NZUL 4NM4H 5SX5K 3OKDB 1IM9B 3L1OH 3QJFA 4H1LH 1EFQA 5EBMB 1R3KB 3TYGL 5ID1A 4JGUA 4MNQD 5F1NB 3MZGB 2C5DC 5HDQL 4ZXBA 4L8CA 2HFGL 2X7LB 2EDKA 4RGOL 5C7XH 3P0YH 3U82B 1EJOL 5B38A 4P2CG 1N6VA 4MQ7B 1J05B 4O2FB 3C09C 1L0XA 5CZVH 1F3DH 1OAQL 2DQCH 3U0WL 4HWZB 1LP9E 1L0QA 3R06A 3ELAT 2DRUA 5MI0B 1M05B 4X5WB 1UKTA 5D7IF 3S34H 1WFTA 1Y0LA 3DTXA 3W0WE 5CAYB 1OAUH 1UM4L 4HF5L 3UPRA 3M8OH 2XWBB 4YC2C 2VISA 2FNBA 4YBQC 3MV9B 1H3PL 2M2DA 1EHAA 2AI0L 4OFKA 3EGSB 1M1SA 3U0TA 2XN9E 3TO2B 3PDDA 2DS4A 5IEKA 2R39A 3JWDL 3MRNA 4IOIB 5D96B 3IKCA 2VL5B 2G2RB 3DIFA 5LGHH 4RMQA 4TULL 5KVEH 4G8GE 3QB7C 4TSAL 4UZGA 5JR1H 1HKLL 1MJUL 1U2CA 2XWJB 4XPFL 4LVNC 5HPMA 1H3UA 5F6IC 3SJVD 2BSRB 2ICWI 2UWEB 5GQBA 3ARGA 3D5OF 4AYFA 5DJXA 2VLJB 2XZCH 1W0WA 1JMZA 4GAGH 4OLWL 4E5XA 2YBRA 3RVXD 2YPKB 2OTUB 1FVEB 3G9AB 2X1WL 2IPUG 4Z7UF 2FHCA 1OTSD 4Q9QH 2DIAA 1FJ1B 3VXRA 2BSRA 2UWEA 2YPVH 5ELIA 1YN7B 5AZ2L 4UV7L 3LEVH 1T0MB 4Q7DA 1YEKH 3VA2C 3WLWD 3QBTB 2BOBA 1U3YA 1T0PB 1MJ8L 2D7NA 4NUGL 3MRRA 3BYTA 5SWSE 2NW2A 4UIKH 5TF0A 1G7PA 2FHBA 1R24B 1YMHB 3DUUB 2B4CC 4Z95L 5EIIB 3O4OB 4OGZA 4ONGL 3A6CH 5DVNA 4QXTB 1AFVL 4PRHD 5I9QC 4QF1B 1CGTA 1KLGA 2VLJD 3B2UC 1JHTA 4Y4KA 3BPOC 3H42H 5I16A 2ED7A 4PS4L 1W2KT 2X4OA 3OR7B 4M4PA 1MLBB 1Y18A 2FD6L 4LPTA 2VLKB 3E2HC 5EFIB 1UACH 4QHKI 3DROB 3KPOA 4PRPA 1WWWX 1DQLH 3OTTA 4XAWH 1W0YT 2BXZA 2OK0H 5EORH 5DJDA 1CGUA 2FLBT 3NOIA 4L3CB 4J1UB 1JNLH 5L8JB 4Y2DC 3H8NA 3RGVA 3REWA 5E9DB 4NWUH 1TZHB 3G6AB 4LCWA 2A6JB 4Y2DB 2CUHA 1CD9B 1S9YA 4AM0B 4NM8H 1YNTB 5J11B 3DROA 3V52H 1OPGL 3O9WC 3RUGB 4HX1B 1YQ2A 5MERA 3A6BL 1FN4A 1KELL 3QFDA 1T66D 3HE6B 3INUL 1WV7T 4NFBA 5CIPA 3V6ZB 5KSBF 5D1QC 1EXUA 3H3BC 3U7WH 3PABB 3HB3C 5DK2A 2E9JA 1CGSL 4Y4HB 4TUKL 1TJIH 3O45B 1BJ1J 3TBVA 4CJ1A 2XKSA 3DBXA 3O6FD 3EJZD 1SEBB 1MFCH 4B0MM 4IRJB 5HI3C 3MNVB 4MAYA 1W72L 2N4IA 1CFTB 1ZA3B 4ZXBC 2WLZA 4MHHI 4NKIH 4LCUA 4V2CB 4CVZB 5EA0H 4Y4HD 1NPUA 4X6CB 5FKPA 2XN9B 4QRRD 1WCQA 4HEME 5D2NC 1C12A 5K9OB 3FMGL 4UTAH 1JRHI 3IXAA 1NMAL 1BF8A 4I2XA 4EI6B 2PNDA 4MNGA 2FL5A 5BRZA 5ITBH 3HN3A 3FRPA 4JZNA 3VXRB 2EE6A 3H9SB 2ADIA 5CFHA 5GZOD 3D18A 4LCCB 3JTSA 4EDWL 3O4OC 1IBGH 4J2XA 5DJZA 2ARJQ 3I6LE 4TVPE 5E8PB 3F12B 3U9UA 4JY5H 2HRPH 2FEDD 4HPOH 3VXSD 1E4WH 4GXVL 1H5BB 2J4WL 1TXKA 2XPGA 4ZFFB 4I0PA 4LCCA 4YEFA 3W82A 4PG9A 5FDWB 5GRVK 1J0JA 1HHIB 4JDVB 4Q6IC 2XG5A 2HH0H 5JHDE 5C0RH 4ZAKD 2X42A 4XVUD 1UJ3A 1MJJA 3KLAB 1XH3A 2FECL 1XF5B 4RMSA 4U6YB 3BQUD 4HMCA 5E2TL 3MMEA 4GRLB 1C5DA 3ULVC 3G5VB 1VCAA 1T2QH 2J6EH 2BJML 4JO2H 2WWMC 2J4WH 4IJ3B 4WFGE 1UJ3B 3TNMB 2AJ3B 5DURB 2HLAB 3MRBB 5DUPH 3MLSH 4W68A 2XKNB 3SDXA 5L9DL 4G80B 4NN7B 1A14L 4ODHH 1XGQA 5E6IC 1JGUH 5C70A 4HIEA 4EDWH 2YC1B 5AYUH 3EO9L 1FLTX 5EU4B 1RUMH 3O81A 1O7VA 1QSFA 5CIPB 3FQXB 1CVRA 4R0LB 1Z2KA 2OS7A 3B9VA 3ILQC 4QHMB 4A6YH 3IB4A 1LEGA 3AU1A 2ZOKB 3GSQB 4AZ8A 8FABA 4R0LC 2A9MH 2LV4A 4UB0H 1JPGA 4NO2B 1XAUA 2LTQC 3CNKA 3DURB 1CDIA 3KNBB 1IKNA 2PTVA 1S7VA 3ARBC 3CZJA 4GG6F 2OM5A 1A5FL 4QYOB 3HC3L 4P46D 1YY8B 1WWAX 5L6YL 4FQXC 4QHMA 2AVGA 4U3HA 3W81A 3H7BA 4TYUA 4ONHB 1FNSL 5CEZE 1ZT4B 5DFWH 4QHLB 3VWJC 5TF1H 3OJMB 3HE7B 1QTYT 4O4YL 4X4XA 5KSVB 1FDLL 4PJEE 4NKMB 2WUCH 1DUYA 4KJWD 1I3GL 5HI4C 3T65B 4JZNB 1KPVA 1E27B 1ZEAH 3GHEL 1XMWA 1NCCH 4IIQC 1VADA 1C5CL 4JAMB 4Y16A 3JTTA 4HIXH 4OLYH 1A7BA 1XGTB 1KNOA 4G6KH 5CEXB 4XNZB 4F9LC 1BHGA 1J0HA 4KQ3H 4CADA 4A6YB 5DJ8B 5F96H 4JPWL 4I0PD 5DUPL 4MJ6A 4V3DB 5M94B 3HMXH 4OI9A 3PG2A 3MLTA 3ROLB 5MHSE 2FX9H 3MRFB 2W91A 5DR5L 4YDJB 4QHUA 2CKBA 5E7BA 5TPWH 2VLKD 5IHBA 4M5YH 1J1XH 4LLUB 3WFCH 2P5WE 3EJYC 3EYQD 1EEYA 4N0CD 5JW3H 4KDVA 1U3HC 4NQCE 2FSEA 4PJDA 3LPFA 3P0VL 4XC1L 4WI8A 3UTTB 3WFCL 3PWJB 2FJFA 5IB3B 4BZ2H 1RMFH 2KPNA 3K8KA 4GRLC 5TDPA 5KBNC 1S5IL 4KJYB 4NNPH 1CFSA 1I3RB 1X9QA 1A0QL 5I1EL 4K94H 3HE6C 2Q3AA 3D0VB 1I8KB 4X4MA 3LV3A 3IU4H 3IF1B 3PWPA 5HY9A 2NY3D 4HV8B 4C56D 2CSPA 5IHUL 3CMOL 2YSSB 1CFVH 4JZOB 2DQIH 2JB5H 4XX1E 2X70A 1NCUA 4NQDE 4GG6B 1YJDL 2X4QB 1XCQA 4BZ1H 4DUVA 4JPKL 2EDXA 3BP6A 5EOTB 3OMZA 3MBEA 2F8XC 1INQA 3I9GL 3K3QA 5F7LB 3T1WA 3RWGB 2K9UA 4NYLB 2UYLA 5IMLA 2YSSA 4POUB 2P5EE 3OPZH 4WUUD 1S7QA 5EUKB 4OIIH 1HXMA 1FNSH 3SJVB 3F5WB 3RKPA 3O6LL 3ZKXC 4JFYA 1I9IL 4QHLA 1WT5A 1T21A 2G60H 4NFCA 3LCYA 4JN2A 3AS1A 5FO7B 3ULSB 4G8FB 1HQ4A 2XTJC 1JUFA 3CU1A 1EFXA 3DNKA 3GJEB 5IEKB 1TJHL 5AYQA 4E42B 3CDCA 2FBOJ 3K74B 2HWZL 4GH7B 2ITDA 3MV9D 2DJ4A 4XC3L 4FQ1L 1YEFL 1T03L 2CDGB 3O3DA 3U6RB 4RZCA 5I2IB 3CVHA 2JIXB 2VDQH 4XP4H 1AD9A 1ZV5A 4XCCH 2VXVL 2XWJA 4G9DB 2Y9RT 5F7MC 2AK4A 1OP3K 1JNJA 1E28B 3FB6A 1DQDH 3TIDB 3CVHL 5JOPD 5EC1A 1T1YA 5IHZB 1XR9B 1KIUA 1IM9A 4MAYC 1KEGL 2NTFA 2CDGA 2HVKA 2EH8H 4P5TB 1BF2A 3O41A 3O6FB 1S5IH 5F6IB 4ZSOE 2F5AL 1MI5A 4MJ5B 3MJ8B 3LDBB 3NCEB 2ZOLB 4NKOB 3AB0C 3DX9A 3OF6A 4DVBA 3RVWD 3WXWH 2R4RH 3TJHC 4ZUWB 1J87A 4ALAH 5I76A 4LHUG 2ZSVB 1DLFH 3HNSH 4Z7QF 4HWZA 4BUGA 5SWZA 3GIZL 2X4SA 5CZXC 1OP5H 5KJRH 2Z8SA 5KOMC 1NBVL 3T0EB 4UTBH 2FX9L 3W39B 3BZEA 5FECA 1CL7L 4JPVL 2XQYG 5BMFH 1A1MA 1UFUA 3HMWH 3IGAA 1I8LA 4M00A 1QBBA 4XXCA 3GGWB 5F96L 2CLRA 3QG7H 5KVGL 5IROC 2F5BH 1B88A 4NOBA 2ADJA 4GMTL 5IG7A 4UV4H 4NGHL 5HHMA 5C6TL 1JNHA 3VXPB 3EFDH 2GFBB 4GLRI 4OFVA 4KRPB 4X6FA 4R7DB 1FFOA 1IC7L 3HAEG 2D0FA 5DJ6A 1FVCB 1UJ3C 2FEDC 3ARQA 4TTGA 1NEZA 5IMLB 4J1UA 4HUXA 1FZJA 2VWEC 4WU5B 1KTLA 3OQ3B 1IRAY 1PSKH 1P4BL 3I3DA 5E2UL 1A3LH 3P30L 5KVDH 3V0WH 1L7TH 4MLIA 3LOWA 2VWEE 4LIQH 5ITFB 4GMSL 4EKXA 1HHJB 1AGEB 4NJ9L 1RK1A 4CBPA 5I75C 1JZ6A 4OGYL 4ZQKA 3QNYB 3JV4B 1LDPL 3LHPL 4KKNA 4KMQA 4W4NA 3MLVH 4HLJA 4C59B 1EA9C 4ZPTA 1S9KC 2KH2B 5FYKE 3GSWA 5E94A 1B4JH 1FV1B 4ZAKB 3JXAA 5KVMC 3QO0B 1R3JB 3FQWB 3MUGB 1Y6MR 4JQXC 4X6CA 2A77L 1J8HD 3IFNH 4YIQB 2NXYC 1HEZB 5GS1B 4NQSA 3EYUH 1U8HA 5F9WB 5GS1C 4I2XB 3NH7L 3B9AA 4KVCH 3B8YA 3WSQL 4OZFG 1YQVH 3K81A 3O3BB 4Y1AB 4PJ5D 1TJGH 1X5AA 3QFJA 3QWOA 4IIQB 2XIDA 1GOHA 3MLXL 3MV8A 2GYSA 3BVNA 4MQTB 3NIFF 3QEHB 3IFNL 5ICXB 3KLSA 4EN3A 5ID1B 1JHLL 4LP5A 4F80A 5JIKA 4R6UA 5EBWA 4RISH 5DRNA 1D6VL 3BPNC 4YHNA 3TH2T 4JFEA 4MWFB 1U9KA 1CIUA 1RURL 3AAZB 2Q76B 3UTPD 2W92A 2E6QA 3V6OA 5HGHB 3RY6A 5D71H 4XCYA 4B41A 1JHKL 1YDPA 4PJ7E 1F4XH 4YHNB 4OFIA 1A6VH 5EZLB 4Z8FH 3NFNB 2Q8AH 1G9EA 4X8JA 4HWBA 3TBVB 1RHHA 4ZUSB 3TV3H 1ZGLM 2VH5H 1I8MB 2APBA 5EBLB 2DL2A 5GJTL 3RVVD 3O6KH 1WFOA 3HZKA 2NXYD 1N2RB 1KACB 1ZHLB 4KZDH 4OTXL 1P4BH 4P9MH 1AIFB 4NSKB 5IK3A 2R0LH 2VABB 5JORB 2HJLB 1U8QB 12E8H 1YPZA 2UZYB 5DJ0A 4OKVA 4Y1AD 3QEQE 5I1IL 1QFUH 1DCLA 4FQIL 5T1DH 1XZ0B 4PJ9B 3RNKB 4N90E 1S9WB 4NZDA 1HKLH 1MJUH 1NGYB 1PW3A 5FA4A 3IVKB 5JHDB 4NT6A 5DHVB 5I1LB 3QFJE 1QSFB 5ISZE 5HHPA 1QPXA 1T1XB 2GK2A 3PHQA 4UNTA 2FCBA 5D8JH 1JV5B 5E99H 2B1AL 3D18B 4U1SA 4XPHL 5J13C 3U1SH 4FQCH 4NN5C 4Y5VC 3GFUA 4W6YB 1YMHA 2FB4L 3D69A 2AI0H 3WN5C 4WEBL 5ETUB 4Z7OF 1U42A 1TQCC 3MV11 4WHTB 4U7SA 4OAWB 4R4FH 3V0AC 2ZUQC 4APQD 1CG9A 1EUUA 4YAQB 3HNTL 3EOYG 4LNRB 4M8VA 2HJKA 5DGRA 4KJPC 4JQVC 3H3PL 3SDXF 4KJQD 5FKAB 4PUBH 3SGEI 4M43L 2YS4A 1L6ZA 1EEUA 3MRIB 1JNLL 4PRDA 1XF5A 4L4VD 2A74A 1JF6A 1NL0L 5KG9B 4OF8A 4DTGL 3PGDB 1DQLL 3UROR 4Y5XB 1P1ZB 5GJSH 1VHPA 5FKAA 1FGNL 3SKOA 4EUPG 2FO4B 5AAMA 3WIHH 5F7NC 7FABH 4BKLA 3RZCC 4KMTL 4Y8DC 2ZPKL 1EHNA 4N9OB 2BHZA 1IGTB 2IC2A 3FTGB 4J3WA 2VXVH 3ZYOA 4FQQA 5I8EA 4KHXL 3DGGB 4ERSL 3I2CL 5C07E 3U48A 4HMEA 5TE7L 4I18C 1LDSA 1BZQK 4UIKL 4U1NA 3ZKND 1WBZB 3ARFD 3DVNA 3ROOB 3DWTA 5HYJB 1G7MB 1KG0B 2VDMH 4OD1L 3U46A 3FRUB 1G7HB 4JFED 2WINB 3ARUA 4EOWH 1BVLA 4PY7A 1AGBB 2J8HA 4JDTL 3CZFB 2HTLC 1X4YA 3WS3A 3HE7C 1YY8A 2ARWA 2VABA 2NZIA 1SHMA 4YHPB 2BVUA 3P4NA 1R0AL 1BX2A 4OFYD 3ZMRA 4FQIH 3QPXH 5FO9A 4DEPB 1OP5K 2Z92A 4O9HH 4JHAL 3C08L 2GUOB 4CVZA 4I5BB 5A2FA 4E0RA 4IMKA 1I9JL 3DUSB 2FEEI 5TE4H 4LEXH 1T04B 3NPSC 1HZHL 4JDTH 5FYJH 4BM7A 3QJHB 4NQVB 4OM0L 1JGLL 4FZ8H 1TDQA 1JVKA 2EE2A 4LSTH 4OZHB 4F9LA 3JV5A 4FABH 1VKXB 4LVOB 2ZCLH 2IH3B 3PWVB 4PD4J 4QOKA 2J1KA 3EYVA 4NCC1 3O0RH 1ND0B 4QRUA 5IFHH 1U3HB 1NLBH 1IEBB 3G6JB 1KBGL 4GO6B 3ZE2E 1MWAL 1P4LA 3DYPA 4HHAB 3DSFH 5GSRB 1A1OB 2PYEE 1UM4H 4LKXB 4X6BB 2R2BA 2CIIA 4XC1H 3T08A 2H32A 3T2NL 1E4XL 4OI8A 2DWEA 4LCYB 5HD8D 2GK0A 4QGTA 4JG0H 1EJOH 1NMCC 2AJSH 2I27N 3EO1B 4C56B 4YXLL 4PJBB 3UPAA 3N1PC 5J1AB 1UVQA 2YXMA 1FBIL 4OZHF 3P9LA 4R9HA 4YWGH 4PJXA 1X4XA 4WJ5A 1Q9LA 3VDBA 3WE6B 2DTSA 1MCEA 4Q97A 3VW3L 4XCCL 5BQ7A 1FNGA 5F7YC 2PW1B 3UCRA 2FR4A 1P9MA 1JK8B 4R26H 1C7TA 4LLQB 2NY3B 1U0QA 4JCMA 3ZTNH 3FT3B 1GGIL 1NFDF 4BFBD 3VD9A 4XP9L 4WUKL 1XCTB 2O5XL 5C0FB 3S36X 4J8RA 2DQUH 3GSNB 4PRIB 5BS0B 3QUKB 5TF1L 5DQDH 3ARBB 5GGQH 5T3ZE 2H2PD 4QRTB 3DPBA 5JW4M 4V1DE 4GBXC 3O6LH 4O2EA 3QDGE 3TM6A 1Q38A 2A1WH 2ZWLT 3L5HA 3UTTD 4JDZA 4Q9RH 3GBML 3DMMA 3UJIH 3IDGA 5BZDA 3C2AH 5MEQA 1J8HA 4JM2A 4G3YL 4LSPL 4XVSL 2O61B 1F58L 3S37H 1I3UA 4JJHA 4KZEL 3SGDH 4AG4L 3QI9C 3QH3B 4G9FA 4HPYH 5D93C 4G43B 1DUZB 1LK3H 4KK8D 2X41A 1NCWL 3PQYA 3OKMB 5F9WC 2ORBL 2W0PA 2PCPB 3WN5B 1BFSA 3H7BB 1IC7H 3PWLB 4MNGE 4XBGA 3TWCL 4OZIA 4IRSC 1FCCA 1QLFA 1CD1A 1J10A 3LRSB 4L4JA 1IGFH 2IH3A 3IU4L 3PWVA 4QOKB 4QHUB 2Q86B 3AROA 4NOFA 3FB8B 1YMMD 1BFTA 3LDBC 2NY5H 3SO3C 4MLSA 2YN5A 4U1JA 3O6FC 4XNMB 5C0CA 2NY6B 1YN6B 4FP8L 5HHOB 3RTQA 3BN9D 4FQHB 1U41A 3O2WL 3OJDA 2VLRD 3LKSA 4RNRA 5HGBB 3WUWG 3QCVL 4L3EE 4JFDB 3T77B 3HNSL 2RAMA 2WBJD 1PZ5B 3LAFA 4U1JB 1KENH 4HUUA 3MGTA 3IU3A 2BC4B 1OSZA 3WNMA 3VG9C 4FMFA 5DT1L 4PJHE 3MA9H 3BE1L 3LKOA 2PTUA 2UZIH 4ONOA 1ONQA 5AWNH 2YRPA 5DF0A 4CJ0A 5JDSA 3DJ9A 4WW1A 2VR4A 1MHCA 2ZUYA 3S5LA 1V3KA 1JPST 5K9JL 3IRZA 4TVPL 4RQQA 2H8PA 3UAJD 4POYA 5C08E 1QLRB 3IDXL 2HRPL 4D9RD 4JPWH 4P4KC 5C09D 5KTEH 5D1ZC 1VGEH 1BD2A 3MCG1 2VLKA 5EFIA 1KB5B 1I7TA 5DI8A 1G84A 5F1IA 5D5MB 4OZFA 2UUDH 2NY7H 3LRGA 4RMTA 3D6GA 1SY6H 5JLZA 2JJSA 1P53A 3Q48A 5C0EB 1U8IB 1KCUL 4KJYA 5DEFB 3RA7L 4KVNL 2VQUA 3BQUB 1FRGL 3H9SE 3BSZH 1WZ1H 1REIA 4WGVB 3RX5A 3NCBB 1AI1L 4LARL 3VFUA 1MRDH 4ZOEA 2E6JA 3QFDB 2H9GB 2VITB 2WQ8A 4EUPB 5IB1A 3OV6A 4O2EB 5T1MA 1PQZB 1CT8B 3D3VA 4RGNC 3FT4A 4DZ8A 1YEGL 4O2CA 5CLTA 3SDXE 4Q9RL 5CD3A 3WD5L 4OBRA 4MB3A 4P59H 1Z0NA 2AJZB 2NW3B 3Q6FA 4XXDA 3RL2A 4N0YH 3KYNA 4OCSL 3VDCA 4F2MA 4YDLC 3GKWH 1N5AA 3P30H 4AENB 2CKBH 3LEXA 2DQUL 1AH1A 3N06B 1Z3GL 1F5WA 4ZQKB 1JPFB 1OTUC 4TUOB 2BVYA 4FQLH 1C12B 3RNQA 2NXYB 3G04A 1LO5A 3HR5B 1OAKH 3HG1E 2DQIL 3IXAB 5FYKH 2MKWA 4OM1H 5BRZB 3CDYA 4YDVA 5FUOL 1MCPL 3JWOH 5L9DH 1OP3H 3QG7L 1IAIM 3QIBC 3OJ2C 5EORL 5F72S 3X3FH 3GEWB 4HFUL 5BJTB 4YO0A 5BO1L 4JEGB 4LRIA 3UTQB 2YHGA 1T2QL 2J6EL 3EYSH 3IVKA 2EC9U 5HVHB 4L1HA 3H42L 4M93B 1C8PA 2NYYD 4RBPH 2BERA 1OGAA 5D1QD 4ZFZA 2AV1A 2VB5A 2J6EA 4LHUA 2PO6A 5C0RL 2NTFB 4UAOC 4XZUA 4TSBL 1YY9D 4NQTA 1UB5B 3OHXB 1FORH 5DQJB 1TZIA 2CMRH 1L9NA 1Q9KA 4LHUB 1DANT 3FONB 4DN3L 4JFEB 1CIDA 4NKOA 2Y6SC 3GHBL 5E9DD 2H41A 1T5WB 1X6NA 4NC0B 1UGNA 2DQGH 2VE6A 3QDMA 4Z7WB 2LU7A 5I76B 5KSBA 3OAZK 3MODH 3THML 2VN7A 3RTQD 1JGLH 4FZ8L 4M1DL 3GMPB 1TNMA 3KXFD 1JWMB 2XY1A 2AEIT 1MCPH 1G7QA 4ZTOH 5DDHB 3W0WB 4HS8H 2BVOB 5F97E 4DZBA 2DI8A 1BBJA 2XV6B 4Z7QE 1MLBA 4WI7A 4KKBD 4U1GC 3P3YA 5J06A 4XHQA 4FQ1H 5IGXH 3GSXA 4M7JL 3CFBB 1JZ7A 4FQXB 4OD2B 4FQLL 4YPJA 5C0NC 3WJLA 3BEWA 1ZTXL 1LQSR 1SBSL 4WTZG 1INDH 2Q7YA 2EH7H 4WRLA 4U31A 1KCSH 4CVXA 3DX7A 2Q87A 5A3IC 3W9DA 3BRFA 4GQ9H 3MJ7B 2A9NH 3HZYB 4PGDA 1CXIA 2QLVB 4HWBL 4XWGL 2EZ0C 5CUSH 3SE8H 1FVCA 1D5XB 4LDOB 5IOPA 3KYNB 1QQDB 3GKZA 5D9SB 4ZAKA 7CGTA 1TIUA 3V6ZA 4NKDB 4PTTA 4DKFL 4Y16D 1VFBA 5I1KH 4RA3A 1A4JA 1MRDL 2P5WB 4GS7B 4PV8B 2VKWA 1UC6A 3M8OL 4RMWA 2BNQA 5E6IB 3NA4A 4NC1E 5E4IA 2V2TB 5TE7H 3WKMH 4AT6A 5M95B 5FGCE 4EDXA 1NAMB 2X10A 1D9KD 5F1OB 5HHOE 1CICA 4HUWA 4WFHD 2FIKB 5DD6B 5FK9B 2V5MA 4PJHA 4WI9A 1BZ9B 2OK0L 4ZO7A 5K33A 1A14H 4ODHL 1CFQA 4JG1L 4Z7NF 5GS2H 4QOKE 1PLGL 2ICCA 3QEQA 4LVEA 4QF1A 2BY3A 1DBAH 1VEOA 3NMEA 4DN3H 1A8JH 4D0CB 1FFRA 1RZ8A 3GRWH 1P84J 3F62A 4OB5L 3VXRD 4X4YB 1MREL 1QBMH 3MV8E 1W0VB 3WLWC 5INCA 4QRUB 4L9LC 1CE6B 1I4FA 3F7YA 4KQ4L 4X7TA 3DGGA 1QRNA 2NY6D 1MFAL 2EO9A 4F7TB 1AGDA 4L8BA 2VE6B 1T20A 4H88H 4OCRH 4RMUA 4YHZL 4K3GA 4PJCE 4M1DH 1EHXA 1J05A 4I2XE 4O2FA 1K2DB 4NHUB 4D3CL 4X7EC 5H94B 1GHFH 4U6YA 2NPLX 2BRQA 2FJGA 5CWSB 3U1SL 3ZE1E 5C9KA 5BS0E 5LXGL 1OD9A 4MD0A 2ATKA 3JWOL 3L5XH 4WDIB 1R3IH 4N0UA 4P23D 4PGBB 1U36A 5JOFB 5CILH 5TDOA 3D39B 4U6TA 4Q9QL 3H9HB 4JN1L 1P84K 1R5WA 1C5CH 1RZIB 3GSUB 5IVOA 1ES0B 2QHRL 3BO8A 1A7PH 1Q9WB 2IQ9H 3I3BA 5I15L 2V7NA 2J2ZA 4QT5B 2I5YH 2BVPB 1IARB 1LO2H 4PJ5B 2Y36L 5DS8A 4WGWB 3IAQA 2EYTA 4AG4H 1F58H 3RPIA 1LEIA 3DV6B 2R69L 1ZT1A 5EO9B 1SJEA 3U9PL 2V7NB 3CSPA 5D7JB 5MEOA 3CSGA 3LKRB 4HFUH 1IZJA 1D5BB 1I1RA 1I1AD 1A9BB 2EYTB 1KJ2B 5E8NB 4X6DF 1KB5L 2AKRB 4PJIE 1RZJC 4OD3H 1IAKA 1D5MB 1AI1H 1S7UA 4HF5H 4DAGH 3EOBB 2VQ1A 1N6QL 5CBAB 4MS8A 4M9OA 1ND0A 1EUTA 5C0GA 2DI9A 3PWPE 4L1DA 5JQ6L 1JPSH 1PKOA 4RSVA 3FT2A 4NZTL 4HH9B 2YZ1A 4WU7B 3ZKXB 5CZVL 1FHGA 4HT1H 2R9HC 4XB8A 1A2YB 3QZWA 2CXGA 3MXWH 3RWCA 1CFNB 2MQ0A 4YWGL 4IMLB 5IP4A 4LNRA 4LLDA 4UAOB 3ARGB 1KCKA 4WWID 4DGYL 4TVSa 1IKFL 3RWIA 3QEGL 1KCLA 1L6XA 3KLHC 4M1GH 4JM4L 2PYFB 3SGEH 4S0UC 1P4IH 1BD2E 9CGTA 1BFOA 4ODSL 4Y19E 1VA9A 4LLWA 4K9EC 5IJVB 4G80A 1NJ9A 4XI5D 3OR7A 5CMAB 4LHQB 4Z95H 2O26U 1DQJB 3Q5YA 5BQ7B 4LEOB 5DMIH 3NABL 2ITCB 1T5XB 4L3AA 3ARED 1TVDA 3GJFK 2XWTB 2DLFL 4L3EA 5DJYA 5L88L 1DFBL 3RIAF 2CLZB 1S78C 3RUGE 2GEEA 3QQ9C 1Z9SA 2JJTC 5C3LD 4WY7L 3ULUF 2Z4QB 5C9JA 2CGRH 4L4TE 2L7JA 4OGYH 1FG9C 2HT4C 2Z9TA 5JW4Q 1IC1A 4LEOA 5B4MC 4PJDF 1UXWB 1C16B 1UQSA 1CGYA 5JW5B 3PWJA 4YHML 4G6JH 3LEVL 1LE5A 2J8UF 3C5SA 1UYWH 3V5KB 3S37X 15C8H 1G6RL 3DV4A 5EOQL 1I9JH 4N5EA 3FFCD 1A3LL 4Y5VB 3ZYZA 2CKNA 2ORBH 3V5HA 1MHHB 1CLOL 1NMAH 2QJDA 4O9HL 4Z5RA 2V5YA 2ZUXA 3FRPG 1I85A 3ARYA 2AJVL 3MOBL 3MA7B 3GSNL 3MNVA 2C1OB 1LE5B 3V4VH 3BPOB 3RIAK 1F6FB 4WFED 3N85L 5IQ9A 5HGGS 1H15A 1AXIB 1BQSA 5JTWA 1DL7H 3QCTH 3S36H 3MXVH 4M1CC 3TVMB 2AXHA 5EO0A 2N56A 2NQCA 4X6BA 5LAXA 4L8SC 4AEFA 5C2UB 3ARFB 3RUGA 3MNWA 3IJYA 3KYMA 4H5SA 4I5BA 4PJEF 2VQ1B 4K71B 4A6YA 3LQAH 5D7IB 4XNUL 5B8CB 1QBAA 2AGJH 3GIZH 2X4PB 4N8CH 4WUKH 3WEXA 2AEPH 4A2LA 1DLFL 5I71B 2VIRA 1NQBA 4KK9C 3QO1B 3RP1A 1HCFX 2GIYA 3B6SA 2LU3A 1V8HA 5E4EB 1CF8L 1SEBA 2OJEB 4NQED 3LMJH 1CGVA 1A22B 5E4EC 5C0DB 3ULSA 4PJGE 2VUYA 2XACC 3QI9D 4FQPA 1T83A 3MGTB 2FX7H 1T7ZA 3PP4H 4LLDB 5CGYC 3HAEB 4LKXA 4KC3B 4W4OA 3CX2A 4L4VB 2AQ3A 4YHLL 3HG1A 5DURD 5JDSB 1MWAB 1XR8A 3KJ6L 3FQUB 3N0PB 5HDLA 3TO4A 5I8KH 1AD9B 2LFGA 4D0DA 1E6JH 5ILTH 2DBJA 3UTZA 4P3CH 4QXGL 5IBLD 4GBXA 1E28A 4EVNB 4OT1L 3UBXA 2VAJA 3LMJL 4JGMA 3TNMA 1OCWL 4L3EB 3GJFA 2MPAL 2CDEB 4M7KL 4LQ1A 4YX2H 32C2B 4MDIB 1BIHA 3T1FB 1PKQA 3VD4A 1P69B 1BVZA 3LN5A 3OKEB 4HGWB 1G7LA 2FZ3A 3RPKA 1XIWB 4XBPA 2F19L 2IBGA 5ICZB 3VXSB 3B8SA 3LH2H 1OF2B 2W9DL 4KK8C 4KI5D 4M6NL 3U79A 2DLIA 2UYLB 5EZJB 2BVTA 1IEAA 1EH9A 3TPUA 1CICD 1IKNC 2PCPA 3GSNA 1G9NC 1M7XA 3TZVA 2AJZA 3L3JA 3EYOB 4R90H 1CE1L 3VWJB 3VWKA 3L3OA 5C0BD 3RJDA 2D31B 2YUXA 3K2UL 5MP6H 2YUVA 1OSPL 5FUCC 3VRIB 1NLDH 1X5KA 1NCAL 3QZWG 3LKQA 4D9LL 3VXPA 3O3AB 3MRDB 1MFEH 4M8QB 5ESAA 5INDB 3HA0A 4JQIL 1LP9A 3P4MB 4GOSA 2VXSH 2CLVB 2YPKA 3ARZA 5HGAB 2ARJA 2GJZA 4LRNH 1MCDA 5EU6A 4ZYKA 1KIRB 1IFHH 4KHTH 1UKQA 1PYWA 1NCTA 3RL1B 4D8PA 2X4UA 4PRIE 5D96C 3NCFB 3BHBA 1TCRA 2NX5A 5K9KB 2A6DA 3RWJA 4MD5A 5TE4L 5KSAB 1ZLSL 3C5ZC 1MCBA 5F89B 3ZKQD 1B9ZA 5EDXA 5F9JA 5FUCE 4MMXC 3KG5A 1H3VA 3IFPA 1E0OB 3QQ3A 2ZOLA 1LD9A 1AO7E 3MQIA 4WO4C 2HJKB 2NY4B 3RGVC 1ZLWK 2GJ6E 1FLRH 1SYVB 15C8L 3BH8B 4J3TA 1NMBL 5DLMH 5DUBB 4QLRA 5CD5C 3QXAA 4JO1H 3J8F7 4M7LH 4HCRA 5GRVL 4PDCE 2YD9A 5ID0B 1ROWA 3HS0A 5SX4I 5DQJA 3DVIA 3KPSD 1I8IB 4YZFE 4KK6D 4KVCL 2AXFB 3L6FB 5J0BA 1I7ZB 5GS0C 5ACZB 3H9ZA 4JM2D 2CDFB 3QDGA 3KYOA 3KPLB 5JNYB 1DDHB 2FJFB 5IB3A 3BP7A 1CL7I 1I75A 2FX8H 3MLRL 4FFVD 1A47A 4M7LT 4FA8A 2A77H 3HPLA 2IPKB 32C2A 4M9PA 4MXQC 4G6MH 2J3SA 5J1SC 1WJ3A 1QFWL 2EYSB 3EJYD 3EYQC 4IIQA 3STZA 4JFOB 1FDLH 3KPLA 5JNYA 3NFPA 4NP4H 4I48A 4H26B 3MLVL 5B38B 4LSQH 4Z7VE 3PWUB 4RGNB 5A16B 4BQBA 4JM4H 3WUZA 3SDAC 5L8KB 1YPZF 4RMVA 4FQCL 1RZFH 1YNKL 2Y5TA 3HZMA 3EOTL 2X4QA 4JO3H 1G7HA 1AGDB 4L8BB 4BQ6A 3OF6D 3VGFA 1CLZL 1NGWA 2WIIA 3C6SA 4GRMA 4FG6C 4OCYL 5EC2A 3BW9A 3MLWL 1X3DA 2VERN 2YPLA 1FL6B 1F2XK 2GSIB 1FNEA 4O5LH 3LKQB 4PD4K 4H0IA 4YXKH 4PLJC 4PTUA 4OGAC 4G59A 2C1PA 3SBWC 3QEUB 3SDYH 4OCMC 3TBSB 3UTQA 5JO5A 2ARJB 1NKRA 2GJZB 4MXWH 5L8LB 4HV8A 1JN6A 2JJWA 4Z8FL 1JPFA 2IAMD 4LPUA 4JVWA 5DRWB 3HI1A 5AG9A 4GJTB 2D7PA 5E99L 5GGTA 3MRPB 2RJMA 1WSST 4P2QB 1KFAL 4GAYA 4M62L 1FIGH 4Z18A 4QGYA 5D6CA 4HD9A 4OSUH 4UTBL 1N64H 2FECI 3HRPA 3N85H 5CP3H 1KYOJ 1HINL 4WWKD 1T0NB 2A83B 2VSDA 1JV5A 3DO7B 3VWKC 3CU7A 4HULB 4QXUL 4R2GD 1D5IH 5BW7C 3VG0H 4M48L 4TNVF 2P1YA 1H3GA 3EAKA 3LS5L 3DUHA 3HUJA 1ZSDB 4WO4B 2VDLL 3PHOB 1UWEH 5IESL 2BVOA 4DZBB 2UVEA 4Y0GA 3RWFA 3ZLQC 4LCCC 3RWHB 3EFFB 4F7EA 2ZCHL 4M5ZH 3P9LB 5IMKA 3HNVH 1JRHL 4KGLA 3NZ8A 5IHLB